3LKXB

Human nac dimerization domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
54
structure length
54
Chain Sequence
EGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor BTF3
publication title The crystal structure of the human nascent polypeptide-associated complex domain reveals a nucleic acid-binding region on the NACA subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 6
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2010-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.30 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3lkxB00
3LKXB 1TR8A 3MCBB 3LKXA 3MCBA
chains in the Genus database with same CATH superfamily
3LKXB 3FS8A 2XPBA 3KCEA 4E5RA 5E65A 1JMQA 3MQGA 2YSBA 2LAJA 2JXWA 3KAHA 3KADA 3L4HA 3NTPA 2ZQVA 2MDIA 4A0UA 2DWVA 2F21A 2WADA 1FLCA 3LE4A 1K9QA 5E5WA 2ZR4A 2JMFA 3M7NA 3ODKA 2BA1A 2Q5AA 1F8AB 2DK7A 2ITKA 3M85A 2XP6A 1WR7A 4REXA 3OOBA 3FSCA 2JX8A 2EZ5W 5U47A 1EG4A 5E62A 3CNGA 2YAJB 5E66A 4U84A 2M3OW 2XP9A 2ZR6A 5CQ2A 2WAEA 2XP4A 1RP5A 3KAIA 1EG3A 2RE3A 5E64A 2JV4A 2L4JA 1NMVA 3KAFA 3TC5A 1I5HW 1O6WA 1ZCNA 4U85A 2XP7A 2YSHA 4A0TA 3KABA 2E45A 3TDBA 3FSBA 1PINA 1YW5A 2ZQTA 2DMVA 3PQHA 2XPAA 2DJYA 2YSFA 2ZR5A 4GLXA 2ZQSA 1K9RA 1TK7A 2OWOA 3MCBA 2QRVA 3MQHA 3TCZA 2XP5A 2ZQUA 2Y8NB 5AHTA 2XP3A 3MCBB 4QIBA 2DK1A 2M8IA 2M8JA 3LKXA 2XP8A 2YSIA 1TR8A 2ZAJA 3WH0A 4U86A 2YSGA 3KAGA 1WMVA 2KXQA
chains in the Genus database with same CATH topology
3LKXB 3FS8A 2XPBA 3KCEA 4E5RA 5E65A 1JMQA 3MQGA 2YSBA 2LAJA 2JXWA 3KAHA 3KADA 3L4HA 3NTPA 2ZQVA 2MDIA 4A0UA 2DWVA 2F21A 2WADA 1FLCA 3LE4A 1K9QA 5E5WA 2ZR4A 2JMFA 3M7NA 3ODKA 2BA1A 2Q5AA 1F8AB 2DK7A 2ITKA 3M85A 2XP6A 1WR7A 4REXA 3OOBA 3FSCA 2JX8A 2EZ5W 5U47A 1EG4A 5E62A 3CNGA 2YAJB 5E66A 4U84A 2M3OW 2XP9A 2ZR6A 5CQ2A 2WAEA 2XP4A 1RP5A 3KAIA 1EG3A 2RE3A 5E64A 2JV4A 2L4JA 1NMVA 3KAFA 3TC5A 1I5HW 1O6WA 1ZCNA 4U85A 2XP7A 2YSHA 4A0TA 3KABA 2E45A 3TDBA 3FSBA 1PINA 1YW5A 2ZQTA 2DMVA 3PQHA 2XPAA 2DJYA 2YSFA 2ZR5A 4GLXA 2ZQSA 1K9RA 1TK7A 2OWOA 3MCBA 2QRVA 3MQHA 3TCZA 2XP5A 2ZQUA 2Y8NB 5AHTA 2XP3A 3MCBB 4QIBA 2DK1A 2M8IA 2M8JA 3LKXA 2XP8A 2YSIA 1TR8A 2ZAJA 3WH0A 4U86A 2YSGA 3KAGA 1WMVA 2KXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKX B;  1TR8 A;  3MCB B;  3LKX A;  3MCB A; 
#chains in the Genus database with same CATH topology
 3LKX B;  3FS8 A;  2XPB A;  3KCE A;  4E5R A;  5E65 A;  1JMQ A;  3MQG A;  2YSB A;  2LAJ A;  2JXW A;  3KAH A;  3KAD A;  3L4H A;  3NTP A;  2ZQV A;  2MDI A;  4A0U A;  2DWV A;  2F21 A;  2WAD A;  1FLC A;  3LE4 A;  1K9Q A;  5E5W A;  2ZR4 A;  2JMF A;  3M7N A;  3ODK A;  2BA1 A;  2Q5A A;  1F8A B;  2DK7 A;  2ITK A;  3M85 A;  2XP6 A;  1WR7 A;  4REX A;  3OOB A;  3FSC A;  2JX8 A;  2EZ5 W;  5U47 A;  1EG4 A;  5E62 A;  3CNG A;  2YAJ B;  5E66 A;  4U84 A;  2M3O W;  2XP9 A;  2ZR6 A;  5CQ2 A;  2WAE A;  2XP4 A;  1RP5 A;  3KAI A;  1EG3 A;  2RE3 A;  5E64 A;  2JV4 A;  2L4J A;  1NMV A;  3KAF A;  3TC5 A;  1I5H W;  1O6W A;  1ZCN A;  4U85 A;  2XP7 A;  2YSH A;  4A0T A;  3KAB A;  2E45 A;  3TDB A;  3FSB A;  1PIN A;  1YW5 A;  2ZQT A;  2DMV A;  3PQH A;  2XPA A;  2DJY A;  2YSF A;  2ZR5 A;  4GLX A;  2ZQS A;  1K9R A;  1TK7 A;  2OWO A;  3MCB A;  2QRV A;  3MQH A;  3TCZ A;  2XP5 A;  2ZQU A;  2Y8N B;  5AHT A;  2XP3 A;  3MCB B;  4QIB A;  2DK1 A;  2M8I A;  2M8J A;  3LKX A;  2XP8 A;  2YSI A;  1TR8 A;  2ZAJ A;  3WH0 A;  4U86 A;  2YSG A;  3KAG A;  1WMV A;  2KXQ A; 
#chains in the Genus database with same CATH homology
 3LKX B;  3FS8 A;  2XPB A;  3KCE A;  4E5R A;  5E65 A;  1JMQ A;  3MQG A;  2YSB A;  2LAJ A;  2JXW A;  3KAH A;  3KAD A;  3L4H A;  3NTP A;  2ZQV A;  2MDI A;  4A0U A;  2DWV A;  2F21 A;  2WAD A;  1FLC A;  3LE4 A;  1K9Q A;  5E5W A;  2ZR4 A;  2JMF A;  3M7N A;  3ODK A;  2BA1 A;  2Q5A A;  1F8A B;  2DK7 A;  2ITK A;  3M85 A;  2XP6 A;  1WR7 A;  4REX A;  3OOB A;  3FSC A;  2JX8 A;  2EZ5 W;  5U47 A;  1EG4 A;  5E62 A;  3CNG A;  2YAJ B;  5E66 A;  4U84 A;  2M3O W;  2XP9 A;  2ZR6 A;  5CQ2 A;  2WAE A;  2XP4 A;  1RP5 A;  3KAI A;  1EG3 A;  2RE3 A;  5E64 A;  2JV4 A;  2L4J A;  1NMV A;  3KAF A;  3TC5 A;  1I5H W;  1O6W A;  1ZCN A;  4U85 A;  2XP7 A;  2YSH A;  4A0T A;  3KAB A;  2E45 A;  3TDB A;  3FSB A;  1PIN A;  1YW5 A;  2ZQT A;  2DMV A;  3PQH A;  2XPA A;  2DJY A;  2YSF A;  2ZR5 A;  4GLX A;  2ZQS A;  1K9R A;  1TK7 A;  2OWO A;  3MCB A;  2QRV A;  3MQH A;  3TCZ A;  2XP5 A;  2ZQU A;  2Y8N B;  5AHT A;  2XP3 A;  3MCB B;  4QIB A;  2DK1 A;  2M8I A;  2M8J A;  3LKX A;  2XP8 A;  2YSI A;  1TR8 A;  2ZAJ A;  3WH0 A;  4U86 A;  2YSG A;  3KAG A;  1WMV A;  2KXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...