3LL8A

Crystal structure of calcineurin in complex with akap79 peptide
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Balanced interactions of calcineurin with AKAP79 regulate Ca(2+)-calcineurin-NFAT signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/calcium binding protein
molecule keywords AKAP79 peptide
total genus 126
structure length 357
sequence length 357
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ll8A00
3LL8A 2WDEA 3H66A 4MP0A 1S95A 1U32A 3EGGA 5IOHA 4JA7A 3H63A 4H2BA 4YKEA 2YVTA 2P6BA 4OR9A 1JK7A 3CK2A 1NNWA 1AUIA 3H69A 3H64A 3HVQA 4FBQA 3ZU0A 1V73A 4Q7FA 4V0VA 1S70A 4ORBA 3E7AA 3PSNA 2O8GA 2QJCA 4O4KA 4FBKA 4UT2A 3V4YA 4O43A 3RL3A 3THOB 2NYLC 4KKZA 1II7A 4I5NC 4V0WA 2Z1AA 4ORCA 2NPPC 1IT6A 5F3WA 3PSOA 1Z2WA 3EGHA 4HD0A 5JJTA 1QHWA 3QFKA 2WDFA 3H68A 3C5WC 4F0ZA 1OIDA 4O5GA 4FBWA 5INBA 2GJUA 2O8AA 1XM7A 3DSDA 1T70A 1W24A 2USHA 3QFMA 1S8EA 4H2IA 4H2GA 2Q8UA 4H1YP 1HPUA 3RL4A 2IE4C 2WDDA 3H61A 2WDCA 1WAO1 2ZBMA 2Z72A 4MOYA 4JA9A 4H1SA 4LTYA 5B8IA 3ICFA 1S3MA 2BQ8X 4G9JA 1FJMA 1USHA 4LU9A 3RL5A 2AHDA 3QFOA 4MOVA 3H60A 3AV0A 5C1VA 3QFNA 2HY1A 4IL1A 2BCDA 4WWLA 1HP1A 3C9FA 1S3NA 1OI8A 1UTEA 4XPNA 2Z06A 4FCXA 1KBPA 2QFPA 2R17A 5J28A 3IB7A 1UF3A 5DNYA 1SU1A 4ZX2A 2QFRA 3JYFA 5GTUA 4TUIA 4NZVA 4TUGA 4LACC 4UT3B 3P71C 3IVDA 1QFCA 1XZWA 1WARA 1M63A 4IYPC 2IAEC 1HO5A 5JPEA 2CV9A 4H2FA 3DW8C 2XMOA 2BDXA 3THNA 3H67A 3KBPA 4DT2A 4DSYA 4O24A 3E7BA 1S3LA 4M0VA 4ORAA 3GVEA 3ZTVA 4DHLA 1T71A 3IB8A 2HYPA 3DSCA 3K7VC 5JPFA 4UWQA 4V0XA 3K7WC 1MF8A 3H62B 2IE3C 3IVEA 4KBPA 3RQZA 4ZVZA 3FGAC 2KKNA 3AUZA 3TGHA 3QG5C 2DFJA 2JOGA 1OIEA 5HPEA 4UT3A 1TCOA 1G5BA 2HYOA 1Z2XA 3T1IA 4B2OA 3N5UA 2NXFA 4I5LC 5EQVA 2NYMC 2A22A 4J6OA
chains in the Genus database with same CATH superfamily
3LL8A 2WDEA 3H66A 4MP0A 1S95A 1U32A 3EGGA 5IOHA 4JA7A 3H63A 4H2BA 4YKEA 2YVTA 2ZO9B 2P6BA 4OR9A 1JK7A 3CK2A 1NNWA 1AUIA 3H69A 3H64A 3HVQA 4FBQA 3ZU0A 1V73A 4Q7FA 4V0VA 1S70A 4ORBA 3E7AA 3PSNA 2O8GA 2QJCA 4O4KA 4FBKA 4UT2A 3V4YA 4O43A 3RL3A 3THOB 2NYLC 4KKZA 3D03A 1II7A 4I5NC 4V0WA 2Z1AA 4ORCA 2NPPC 3E0JA 1IT6A 5F3WA 3PSOA 1Z2WA 3EGHA 4HD0A 5JJTA 1QHWA 3QFKA 2WDFA 3H68A 3C5WC 2DXLA 4F0ZA 1OIDA 4O5GA 4FBWA 5INBA 2GJUA 2O8AA 1XM7A 3DSDA 1T70A 1W24A 2USHA 3FLOA 3QFMA 1S8EA 4H2IA 4H2GA 2Q8UA 4H1YP 1HPUA 3RL4A 2ZOAA 2IE4C 2WDDA 3H61A 2WDCA 1WAO1 2ZBMA 2Z72A 4MOYA 4JA9A 4H1SA 4LTYA 5B8IA 3ICFA 1S3MA 2BQ8X 4G9JA 1FJMA 1USHA 4LU9A 3RL5A 2AHDA 3QFOA 4MOVA 3H60A 3AV0A 5C1VA 3QFNA 2HY1A 4IL1A 2BCDA 2YEQA 4WWLA 1HP1A 2DXNA 3C9FA 1S3NA 1OI8A 1UTEA 4XPNA 2Z06A 4FCXA 1KBPA 2QFPA 2R17A 5J28A 3IB7A 1UF3A 5DNYA 1SU1A 4ZX2A 2QFRA 3JYFA 5GTUA 4TUIA 4NZVA 4TUGA 4LACC 4UT3B 3P71C 3IVDA 1QFCA 1XZWA 1WARA 1M63A 4IYPC 2IAEC 1HO5A 5JPEA 2CV9A 4H2FA 3DW8C 2XMOA 2BDXA 3THNA 3H67A 3KBPA 4DT2A 4DSYA 4O24A 3E7BA 1S3LA 4M0VA 4ORAA 3GVEA 3ZTVA 4DHLA 1T71A 3IB8A 2HYPA 3DSCA 3K7VC 5JPFA 4UWQA 4V0XA 3K7WC 1MF8A 3H62B 2IE3C 3IVEA 4KBPA 3RQZA 4ZVZA 3FGAC 2KKNA 3AUZA 3TGHA 3QG5C 2DFJA 2JOGA 1OIEA 5HPEA 4UT3A 1TCOA 1G5BA 2HYOA 1Z2XA 3T1IA 4B2OA 3N5UA 2NXFA 4I5LC 5EQVA 2NYMC 2A22A 4J6OA
chains in the Genus database with same CATH topology
3LL8A 2WDEA 3H66A 4MP0A 1S95A 1U32A 3EGGA 5IOHA 4JA7A 3H63A 4H2BA 4YKEA 2YVTA 2ZO9B 2P6BA 4OR9A 1JK7A 3CK2A 1NNWA 1AUIA 3H69A 3H64A 3HVQA 4FBQA 3ZU0A 1V73A 4Q7FA 4V0VA 1S70A 4ORBA 3E7AA 3PSNA 2O8GA 2QJCA 4O4KA 4FBKA 4UT2A 3V4YA 4O43A 3RL3A 3THOB 2NYLC 4KKZA 3D03A 1II7A 4I5NC 4V0WA 2Z1AA 4ORCA 2NPPC 3E0JA 1IT6A 5F3WA 3PSOA 1Z2WA 3EGHA 4HD0A 5JJTA 1QHWA 3QFKA 2WDFA 3H68A 3C5WC 2DXLA 4F0ZA 1OIDA 4O5GA 4FBWA 5INBA 2GJUA 2O8AA 1XM7A 3DSDA 1T70A 1W24A 2USHA 3FLOA 3QFMA 1S8EA 4H2IA 4H2GA 2Q8UA 4H1YP 1HPUA 3RL4A 2ZOAA 2IE4C 2WDDA 3H61A 2WDCA 1WAO1 2ZBMA 2Z72A 4MOYA 4JA9A 4H1SA 4LTYA 5B8IA 3ICFA 1S3MA 2BQ8X 4G9JA 1FJMA 1USHA 4LU9A 3RL5A 2AHDA 3QFOA 4MOVA 3H60A 3AV0A 5C1VA 3QFNA 2HY1A 4IL1A 2BCDA 2YEQA 4WWLA 1HP1A 2DXNA 3C9FA 1S3NA 1OI8A 1UTEA 4XPNA 2Z06A 4FCXA 1KBPA 2QFPA 2R17A 5J28A 3IB7A 1UF3A 5DNYA 1SU1A 4ZX2A 2QFRA 3JYFA 5GTUA 4TUIA 4NZVA 4TUGA 4LACC 4UT3B 3P71C 3IVDA 1QFCA 1XZWA 1WARA 1M63A 4IYPC 2IAEC 1HO5A 5JPEA 2CV9A 4H2FA 3DW8C 2XMOA 2BDXA 3THNA 3H67A 3KBPA 4DT2A 4DSYA 4O24A 3E7BA 1S3LA 4M0VA 4ORAA 3GVEA 3ZTVA 4DHLA 1T71A 3IB8A 2HYPA 3DSCA 3K7VC 5JPFA 4UWQA 4V0XA 3K7WC 1MF8A 3H62B 2IE3C 3IVEA 4KBPA 3RQZA 4ZVZA 3FGAC 2KKNA 3AUZA 3TGHA 3QG5C 2DFJA 2JOGA 1OIEA 5HPEA 4UT3A 1TCOA 1G5BA 2HYOA 1Z2XA 3T1IA 4B2OA 3N5UA 2NXFA 4I5LC 5EQVA 2NYMC 2A22A 4J6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LL8 A;  2WDE A;  3H66 A;  4MP0 A;  1S95 A;  1U32 A;  3EGG A;  5IOH A;  4JA7 A;  3H63 A;  4H2B A;  4YKE A;  2YVT A;  2P6B A;  4OR9 A;  1JK7 A;  3CK2 A;  1NNW A;  1AUI A;  3H69 A;  3H64 A;  3HVQ A;  4FBQ A;  3ZU0 A;  1V73 A;  4Q7F A;  4V0V A;  1S70 A;  4ORB A;  3E7A A;  3PSN A;  2O8G A;  2QJC A;  4O4K A;  4FBK A;  4UT2 A;  3V4Y A;  4O43 A;  3RL3 A;  3THO B;  2NYL C;  4KKZ A;  1II7 A;  4I5N C;  4V0W A;  2Z1A A;  4ORC A;  2NPP C;  1IT6 A;  5F3W A;  3PSO A;  1Z2W A;  3EGH A;  4HD0 A;  5JJT A;  1QHW A;  3QFK A;  2WDF A;  3H68 A;  3C5W C;  4F0Z A;  1OID A;  4O5G A;  4FBW A;  5INB A;  2GJU A;  2O8A A;  1XM7 A;  3DSD A;  1T70 A;  1W24 A;  2USH A;  3QFM A;  1S8E A;  4H2I A;  4H2G A;  2Q8U A;  4H1Y P;  1HPU A;  3RL4 A;  2IE4 C;  2WDD A;  3H61 A;  2WDC A;  1WAO 1;  2ZBM A;  2Z72 A;  4MOY A;  4JA9 A;  4H1S A;  4LTY A;  5B8I A;  3ICF A;  1S3M A;  2BQ8 X;  4G9J A;  1FJM A;  1USH A;  4LU9 A;  3RL5 A;  2AHD A;  3QFO A;  4MOV A;  3H60 A;  3AV0 A;  5C1V A;  3QFN A;  2HY1 A;  4IL1 A;  2BCD A;  4WWL A;  1HP1 A;  3C9F A;  1S3N A;  1OI8 A;  1UTE A;  4XPN A;  2Z06 A;  4FCX A;  1KBP A;  2QFP A;  2R17 A;  5J28 A;  3IB7 A;  1UF3 A;  5DNY A;  1SU1 A;  4ZX2 A;  2QFR A;  3JYF A;  5GTU A;  4TUI A;  4NZV A;  4TUG A;  4LAC C;  4UT3 B;  3P71 C;  3IVD A;  1QFC A;  1XZW A;  1WAR A;  1M63 A;  4IYP C;  2IAE C;  1HO5 A;  5JPE A;  2CV9 A;  4H2F A;  3DW8 C;  2XMO A;  2BDX A;  3THN A;  3H67 A;  3KBP A;  4DT2 A;  4DSY A;  4O24 A;  3E7B A;  1S3L A;  4M0V A;  4ORA A;  3GVE A;  3ZTV A;  4DHL A;  1T71 A;  3IB8 A;  2HYP A;  3DSC A;  3K7V C;  5JPF A;  4UWQ A;  4V0X A;  3K7W C;  1MF8 A;  3H62 B;  2IE3 C;  3IVE A;  4KBP A;  3RQZ A;  4ZVZ A;  3FGA C;  2KKN A;  3AUZ A;  3TGH A;  3QG5 C;  2DFJ A;  2JOG A;  1OIE A;  5HPE A;  4UT3 A;  1TCO A;  1G5B A;  2HYO A;  1Z2X A;  3T1I A;  4B2O A;  3N5U A;  2NXF A;  4I5L C;  5EQV A;  2NYM C;  2A22 A;  4J6O A; 
#chains in the Genus database with same CATH topology
 3LL8 A;  2WDE A;  3H66 A;  4MP0 A;  1S95 A;  1U32 A;  3EGG A;  5IOH A;  4JA7 A;  3H63 A;  4H2B A;  4YKE A;  2YVT A;  2ZO9 B;  2P6B A;  4OR9 A;  1JK7 A;  3CK2 A;  1NNW A;  1AUI A;  3H69 A;  3H64 A;  3HVQ A;  4FBQ A;  3ZU0 A;  1V73 A;  4Q7F A;  4V0V A;  1S70 A;  4ORB A;  3E7A A;  3PSN A;  2O8G A;  2QJC A;  4O4K A;  4FBK A;  4UT2 A;  3V4Y A;  4O43 A;  3RL3 A;  3THO B;  2NYL C;  4KKZ A;  3D03 A;  1II7 A;  4I5N C;  4V0W A;  2Z1A A;  4ORC A;  2NPP C;  3E0J A;  1IT6 A;  5F3W A;  3PSO A;  1Z2W A;  3EGH A;  4HD0 A;  5JJT A;  1QHW A;  3QFK A;  2WDF A;  3H68 A;  3C5W C;  2DXL A;  4F0Z A;  1OID A;  4O5G A;  4FBW A;  5INB A;  2GJU A;  2O8A A;  1XM7 A;  3DSD A;  1T70 A;  1W24 A;  2USH A;  3FLO A;  3QFM A;  1S8E A;  4H2I A;  4H2G A;  2Q8U A;  4H1Y P;  1HPU A;  3RL4 A;  2ZOA A;  2IE4 C;  2WDD A;  3H61 A;  2WDC A;  1WAO 1;  2ZBM A;  2Z72 A;  4MOY A;  4JA9 A;  4H1S A;  4LTY A;  5B8I A;  3ICF A;  1S3M A;  2BQ8 X;  4G9J A;  1FJM A;  1USH A;  4LU9 A;  3RL5 A;  2AHD A;  3QFO A;  4MOV A;  3H60 A;  3AV0 A;  5C1V A;  3QFN A;  2HY1 A;  4IL1 A;  2BCD A;  2YEQ A;  4WWL A;  1HP1 A;  2DXN A;  3C9F A;  1S3N A;  1OI8 A;  1UTE A;  4XPN A;  2Z06 A;  4FCX A;  1KBP A;  2QFP A;  2R17 A;  5J28 A;  3IB7 A;  1UF3 A;  5DNY A;  1SU1 A;  4ZX2 A;  2QFR A;  3JYF A;  5GTU A;  4TUI A;  4NZV A;  4TUG A;  4LAC C;  4UT3 B;  3P71 C;  3IVD A;  1QFC A;  1XZW A;  1WAR A;  1M63 A;  4IYP C;  2IAE C;  1HO5 A;  5JPE A;  2CV9 A;  4H2F A;  3DW8 C;  2XMO A;  2BDX A;  3THN A;  3H67 A;  3KBP A;  4DT2 A;  4DSY A;  4O24 A;  3E7B A;  1S3L A;  4M0V A;  4ORA A;  3GVE A;  3ZTV A;  4DHL A;  1T71 A;  3IB8 A;  2HYP A;  3DSC A;  3K7V C;  5JPF A;  4UWQ A;  4V0X A;  3K7W C;  1MF8 A;  3H62 B;  2IE3 C;  3IVE A;  4KBP A;  3RQZ A;  4ZVZ A;  3FGA C;  2KKN A;  3AUZ A;  3TGH A;  3QG5 C;  2DFJ A;  2JOG A;  1OIE A;  5HPE A;  4UT3 A;  1TCO A;  1G5B A;  2HYO A;  1Z2X A;  3T1I A;  4B2O A;  3N5U A;  2NXF A;  4I5L C;  5EQV A;  2NYM C;  2A22 A;  4J6O A; 
#chains in the Genus database with same CATH homology
 3LL8 A;  2WDE A;  3H66 A;  4MP0 A;  1S95 A;  1U32 A;  3EGG A;  5IOH A;  4JA7 A;  3H63 A;  4H2B A;  4YKE A;  2YVT A;  2ZO9 B;  2P6B A;  4OR9 A;  1JK7 A;  3CK2 A;  1NNW A;  1AUI A;  3H69 A;  3H64 A;  3HVQ A;  4FBQ A;  3ZU0 A;  1V73 A;  4Q7F A;  4V0V A;  1S70 A;  4ORB A;  3E7A A;  3PSN A;  2O8G A;  2QJC A;  4O4K A;  4FBK A;  4UT2 A;  3V4Y A;  4O43 A;  3RL3 A;  3THO B;  2NYL C;  4KKZ A;  3D03 A;  1II7 A;  4I5N C;  4V0W A;  2Z1A A;  4ORC A;  2NPP C;  3E0J A;  1IT6 A;  5F3W A;  3PSO A;  1Z2W A;  3EGH A;  4HD0 A;  5JJT A;  1QHW A;  3QFK A;  2WDF A;  3H68 A;  3C5W C;  2DXL A;  4F0Z A;  1OID A;  4O5G A;  4FBW A;  5INB A;  2GJU A;  2O8A A;  1XM7 A;  3DSD A;  1T70 A;  1W24 A;  2USH A;  3FLO A;  3QFM A;  1S8E A;  4H2I A;  4H2G A;  2Q8U A;  4H1Y P;  1HPU A;  3RL4 A;  2ZOA A;  2IE4 C;  2WDD A;  3H61 A;  2WDC A;  1WAO 1;  2ZBM A;  2Z72 A;  4MOY A;  4JA9 A;  4H1S A;  4LTY A;  5B8I A;  3ICF A;  1S3M A;  2BQ8 X;  4G9J A;  1FJM A;  1USH A;  4LU9 A;  3RL5 A;  2AHD A;  3QFO A;  4MOV A;  3H60 A;  3AV0 A;  5C1V A;  3QFN A;  2HY1 A;  4IL1 A;  2BCD A;  2YEQ A;  4WWL A;  1HP1 A;  2DXN A;  3C9F A;  1S3N A;  1OI8 A;  1UTE A;  4XPN A;  2Z06 A;  4FCX A;  1KBP A;  2QFP A;  2R17 A;  5J28 A;  3IB7 A;  1UF3 A;  5DNY A;  1SU1 A;  4ZX2 A;  2QFR A;  3JYF A;  5GTU A;  4TUI A;  4NZV A;  4TUG A;  4LAC C;  4UT3 B;  3P71 C;  3IVD A;  1QFC A;  1XZW A;  1WAR A;  1M63 A;  4IYP C;  2IAE C;  1HO5 A;  5JPE A;  2CV9 A;  4H2F A;  3DW8 C;  2XMO A;  2BDX A;  3THN A;  3H67 A;  3KBP A;  4DT2 A;  4DSY A;  4O24 A;  3E7B A;  1S3L A;  4M0V A;  4ORA A;  3GVE A;  3ZTV A;  4DHL A;  1T71 A;  3IB8 A;  2HYP A;  3DSC A;  3K7V C;  5JPF A;  4UWQ A;  4V0X A;  3K7W C;  1MF8 A;  3H62 B;  2IE3 C;  3IVE A;  4KBP A;  3RQZ A;  4ZVZ A;  3FGA C;  2KKN A;  3AUZ A;  3TGH A;  3QG5 C;  2DFJ A;  2JOG A;  1OIE A;  5HPE A;  4UT3 A;  1TCO A;  1G5B A;  2HYO A;  1Z2X A;  3T1I A;  4B2O A;  3N5U A;  2NXF A;  4I5L C;  5EQV A;  2NYM C;  2A22 A;  4J6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...