3LL8A

Crystal structure of calcineurin in complex with akap79 peptide
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Balanced interactions of calcineurin with AKAP79 regulate Ca(2+)-calcineurin-NFAT signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/calcium binding protein
molecule keywords AKAP79 peptide
total genus 126
structure length 357
sequence length 357
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ll8A00
2IAEC 2WDFA 3IB7A 4DHLA 4LU9A 4UT3B 3H68A 1G5BA 2A22A 3DSDA 3E7AA 4FBQA 3QG5C 3QFMA 1HO5A 1QFCA 2NYLC 2WDCA 4JA9A 3RL3A 5F3WA 1UF3A 4DSYA 2CV9A 3AUZA 3E7BA 2IE3C 4KKZA 2Z1AA 4LACC 3RL5A 1WARA 3HVQA 3N5UA 3QFKA 4TUIA 3IVDA 2DFJA 1JK7A 1W24A 1Z2XA 1FJMA 2QFPA 4O43A 4I5LC 5B8IA 2QJCA 4H1SA 3ICFA 1S3MA 2USHA 3DSCA 3AV0A 3H60A 1OI8A 1SU1A 1U32A 2R17A 3JYFA 3PSOA 1QHWA 2BCDA 3EGHA 4H2BA 4B2OA 3THNA 2ZBMA 3K7VC 3CK2A 3C9FA 4YKEA 5GTUA 4TUGA 4O24A 5JPEA 4IL1A 3FGAC 2NPPC 2KKNA 3V4YA 4ORCA 1XM7A 3QFNA 4ZVZA 1MF8A 4FBWA 1S95A 4UT2A 3TGHA 4FCXA 4H2IA 3P71C 1V73A 3H67A 4HD0A 2HY1A 4ZX2A 2NXFA 1T70A 1HPUA 3DW8C 4MOYA 4Q7FA 4MOVA 3H62B 2WDDA 2WDEA 3T1IA 3RL4A 2HYOA 1KBPA 1XZWA 4V0XA 2BDXA 3GVEA 1Z2WA 1OIEA 3QFOA 1TCOA 2NYMC 1S70A 1AUIA 2P6BA 4UT3A 5INBA 3LL8A 1T71A 4UWQA 3ZTVA 2XMOA 3H64A 4DT2A 1II7A 2GJUA 1HP1A 3EGGA 3K7WC 1WAO1 4H1YP 2HYPA 4I5NC 4ORBA 5IOHA 5JPFA 3C5WC 1S3NA 4O4KA 2BQ8X 2Z06A 4M0VA 3ZU0A 2O8GA 4ORAA 4NZVA 4H2FA 5DNYA 3IVEA 3H63A 4JA7A 1S8EA 3RQZA 4O5GA 5EQVA 3H66A 1OIDA 2Z72A 4XPNA 3H61A 2QFRA 2YVTA 1M63A 2O8AA 3H69A 2AHDA 4V0VA 2JOGA 4MP0A 2Q8UA 5C1VA 4FBKA 4J6OA 3THOB 4H2GA 2IE4C 1NNWA 3KBPA 5J28A 4LTYA 5JJTA 1USHA 4KBPA 4G9JA 3PSNA 4OR9A 4IYPC 4V0WA 4WWLA 1IT6A 3IB8A 4F0ZA 1S3LA 5HPEA 1UTEA
chains in the Genus database with same CATH superfamily
2IAEC 2WDFA 3IB7A 4DHLA 4LU9A 4UT3B 3H68A 1G5BA 2A22A 3DSDA 3E7AA 4FBQA 3QG5C 3QFMA 1HO5A 1QFCA 2NYLC 2WDCA 4JA9A 3RL3A 5F3WA 1UF3A 4DSYA 2CV9A 3AUZA 3E7BA 2IE3C 4KKZA 2Z1AA 4LACC 3RL5A 1WARA 3HVQA 3N5UA 3QFKA 4TUIA 3IVDA 2DFJA 1JK7A 1W24A 1Z2XA 1FJMA 2QFPA 4O43A 4I5LC 5B8IA 2QJCA 4H1SA 3ICFA 1S3MA 2USHA 3DSCA 3AV0A 3H60A 1OI8A 1SU1A 1U32A 2R17A 3JYFA 3PSOA 1QHWA 2BCDA 3EGHA 4H2BA 4B2OA 3THNA 2ZBMA 3K7VC 3CK2A 3C9FA 4YKEA 5GTUA 4TUGA 4O24A 5JPEA 4IL1A 3FGAC 2NPPC 2KKNA 3V4YA 4ORCA 1XM7A 3QFNA 4ZVZA 3FLOA 1MF8A 4FBWA 1S95A 4UT2A 3TGHA 4FCXA 4H2IA 3P71C 1V73A 3H67A 4HD0A 2HY1A 4ZX2A 2ZO9B 2NXFA 1T70A 1HPUA 3DW8C 4MOYA 4Q7FA 4MOVA 3H62B 2WDDA 2WDEA 3T1IA 3RL4A 2HYOA 1KBPA 1XZWA 4V0XA 2BDXA 3GVEA 1Z2WA 1OIEA 3QFOA 1TCOA 2DXNA 1S70A 2NYMC 3D03A 1AUIA 2P6BA 4UT3A 5INBA 3LL8A 1T71A 4UWQA 3ZTVA 2XMOA 3H64A 4DT2A 2DXLA 1II7A 2GJUA 1HP1A 3EGGA 3K7WC 1WAO1 4H1YP 2HYPA 4I5NC 4ORBA 5IOHA 5JPFA 3C5WC 1S3NA 2ZOAA 4O4KA 2BQ8X 2Z06A 4M0VA 3ZU0A 2O8GA 4ORAA 4NZVA 4H2FA 5DNYA 3IVEA 2YEQA 3H63A 4JA7A 1S8EA 3RQZA 4O5GA 5EQVA 3H66A 1OIDA 2Z72A 4XPNA 3H61A 2QFRA 2YVTA 1M63A 2O8AA 3E0JA 3H69A 2AHDA 4V0VA 2JOGA 4MP0A 2Q8UA 5C1VA 4FBKA 4J6OA 3THOB 4H2GA 2IE4C 1NNWA 3KBPA 5J28A 4LTYA 5JJTA 1USHA 4KBPA 4G9JA 3PSNA 4OR9A 4IYPC 4V0WA 4WWLA 1IT6A 3IB8A 4F0ZA 1S3LA 5HPEA 1UTEA
chains in the Genus database with same CATH topology
2IAEC 2WDFA 3IB7A 4DHLA 4LU9A 4UT3B 3H68A 1G5BA 2A22A 3DSDA 3E7AA 4FBQA 3QG5C 3QFMA 1HO5A 1QFCA 2NYLC 2WDCA 4JA9A 3RL3A 5F3WA 1UF3A 4DSYA 2CV9A 3AUZA 3E7BA 2IE3C 4KKZA 2Z1AA 4LACC 3RL5A 1WARA 3HVQA 3N5UA 3QFKA 4TUIA 3IVDA 2DFJA 1JK7A 1W24A 1Z2XA 1FJMA 2QFPA 4O43A 4I5LC 5B8IA 2QJCA 4H1SA 3ICFA 1S3MA 2USHA 3DSCA 3AV0A 3H60A 1OI8A 1SU1A 1U32A 2R17A 3JYFA 3PSOA 1QHWA 2BCDA 3EGHA 4H2BA 4B2OA 3THNA 2ZBMA 3K7VC 3CK2A 3C9FA 4YKEA 5GTUA 4TUGA 4O24A 5JPEA 4IL1A 3FGAC 2NPPC 2KKNA 3V4YA 4ORCA 1XM7A 3QFNA 4ZVZA 3FLOA 1MF8A 4FBWA 1S95A 4UT2A 3TGHA 4FCXA 4H2IA 3P71C 1V73A 3H67A 4HD0A 2HY1A 4ZX2A 2ZO9B 2NXFA 1T70A 1HPUA 3DW8C 4MOYA 4Q7FA 4MOVA 3H62B 2WDDA 2WDEA 3T1IA 3RL4A 2HYOA 1KBPA 1XZWA 4V0XA 2BDXA 3GVEA 1Z2WA 1OIEA 3QFOA 1TCOA 2DXNA 1S70A 2NYMC 3D03A 1AUIA 2P6BA 4UT3A 5INBA 3LL8A 1T71A 4UWQA 3ZTVA 2XMOA 3H64A 4DT2A 2DXLA 1II7A 2GJUA 1HP1A 3EGGA 3K7WC 1WAO1 4H1YP 2HYPA 4I5NC 4ORBA 5IOHA 5JPFA 3C5WC 1S3NA 2ZOAA 4O4KA 2BQ8X 2Z06A 4M0VA 3ZU0A 2O8GA 4ORAA 4NZVA 4H2FA 5DNYA 3IVEA 2YEQA 3H63A 4JA7A 1S8EA 3RQZA 4O5GA 5EQVA 3H66A 1OIDA 2Z72A 4XPNA 3H61A 2QFRA 2YVTA 1M63A 2O8AA 3E0JA 3H69A 2AHDA 4V0VA 2JOGA 4MP0A 2Q8UA 5C1VA 4FBKA 4J6OA 3THOB 4H2GA 2IE4C 1NNWA 3KBPA 5J28A 4LTYA 5JJTA 1USHA 4KBPA 4G9JA 3PSNA 4OR9A 4IYPC 4V0WA 4WWLA 1IT6A 3IB8A 4F0ZA 1S3LA 5HPEA 1UTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAE C;  2WDF A;  3IB7 A;  4DHL A;  4LU9 A;  4UT3 B;  3H68 A;  1G5B A;  2A22 A;  3DSD A;  3E7A A;  4FBQ A;  3QG5 C;  3QFM A;  1HO5 A;  1QFC A;  2NYL C;  2WDC A;  4JA9 A;  3RL3 A;  5F3W A;  1UF3 A;  4DSY A;  2CV9 A;  3AUZ A;  3E7B A;  2IE3 C;  4KKZ A;  2Z1A A;  4LAC C;  3RL5 A;  1WAR A;  3HVQ A;  3N5U A;  3QFK A;  4TUI A;  3IVD A;  2DFJ A;  1JK7 A;  1W24 A;  1Z2X A;  1FJM A;  2QFP A;  4O43 A;  4I5L C;  5B8I A;  2QJC A;  4H1S A;  3ICF A;  1S3M A;  2USH A;  3DSC A;  3AV0 A;  3H60 A;  1OI8 A;  1SU1 A;  1U32 A;  2R17 A;  3JYF A;  3PSO A;  1QHW A;  2BCD A;  3EGH A;  4H2B A;  4B2O A;  3THN A;  2ZBM A;  3K7V C;  3CK2 A;  3C9F A;  4YKE A;  5GTU A;  4TUG A;  4O24 A;  5JPE A;  4IL1 A;  3FGA C;  2NPP C;  2KKN A;  3V4Y A;  4ORC A;  1XM7 A;  3QFN A;  4ZVZ A;  1MF8 A;  4FBW A;  1S95 A;  4UT2 A;  3TGH A;  4FCX A;  4H2I A;  3P71 C;  1V73 A;  3H67 A;  4HD0 A;  2HY1 A;  4ZX2 A;  2NXF A;  1T70 A;  1HPU A;  3DW8 C;  4MOY A;  4Q7F A;  4MOV A;  3H62 B;  2WDD A;  2WDE A;  3T1I A;  3RL4 A;  2HYO A;  1KBP A;  1XZW A;  4V0X A;  2BDX A;  3GVE A;  1Z2W A;  1OIE A;  3QFO A;  1TCO A;  2NYM C;  1S70 A;  1AUI A;  2P6B A;  4UT3 A;  5INB A;  3LL8 A;  1T71 A;  4UWQ A;  3ZTV A;  2XMO A;  3H64 A;  4DT2 A;  1II7 A;  2GJU A;  1HP1 A;  3EGG A;  3K7W C;  1WAO 1;  4H1Y P;  2HYP A;  4I5N C;  4ORB A;  5IOH A;  5JPF A;  3C5W C;  1S3N A;  4O4K A;  2BQ8 X;  2Z06 A;  4M0V A;  3ZU0 A;  2O8G A;  4ORA A;  4NZV A;  4H2F A;  5DNY A;  3IVE A;  3H63 A;  4JA7 A;  1S8E A;  3RQZ A;  4O5G A;  5EQV A;  3H66 A;  1OID A;  2Z72 A;  4XPN A;  3H61 A;  2QFR A;  2YVT A;  1M63 A;  2O8A A;  3H69 A;  2AHD A;  4V0V A;  2JOG A;  4MP0 A;  2Q8U A;  5C1V A;  4FBK A;  4J6O A;  3THO B;  4H2G A;  2IE4 C;  1NNW A;  3KBP A;  5J28 A;  4LTY A;  5JJT A;  1USH A;  4KBP A;  4G9J A;  3PSN A;  4OR9 A;  4IYP C;  4V0W A;  4WWL A;  1IT6 A;  3IB8 A;  4F0Z A;  1S3L A;  5HPE A;  1UTE A; 
#chains in the Genus database with same CATH topology
 2IAE C;  2WDF A;  3IB7 A;  4DHL A;  4LU9 A;  4UT3 B;  3H68 A;  1G5B A;  2A22 A;  3DSD A;  3E7A A;  4FBQ A;  3QG5 C;  3QFM A;  1HO5 A;  1QFC A;  2NYL C;  2WDC A;  4JA9 A;  3RL3 A;  5F3W A;  1UF3 A;  4DSY A;  2CV9 A;  3AUZ A;  3E7B A;  2IE3 C;  4KKZ A;  2Z1A A;  4LAC C;  3RL5 A;  1WAR A;  3HVQ A;  3N5U A;  3QFK A;  4TUI A;  3IVD A;  2DFJ A;  1JK7 A;  1W24 A;  1Z2X A;  1FJM A;  2QFP A;  4O43 A;  4I5L C;  5B8I A;  2QJC A;  4H1S A;  3ICF A;  1S3M A;  2USH A;  3DSC A;  3AV0 A;  3H60 A;  1OI8 A;  1SU1 A;  1U32 A;  2R17 A;  3JYF A;  3PSO A;  1QHW A;  2BCD A;  3EGH A;  4H2B A;  4B2O A;  3THN A;  2ZBM A;  3K7V C;  3CK2 A;  3C9F A;  4YKE A;  5GTU A;  4TUG A;  4O24 A;  5JPE A;  4IL1 A;  3FGA C;  2NPP C;  2KKN A;  3V4Y A;  4ORC A;  1XM7 A;  3QFN A;  4ZVZ A;  3FLO A;  1MF8 A;  4FBW A;  1S95 A;  4UT2 A;  3TGH A;  4FCX A;  4H2I A;  3P71 C;  1V73 A;  3H67 A;  4HD0 A;  2HY1 A;  4ZX2 A;  2ZO9 B;  2NXF A;  1T70 A;  1HPU A;  3DW8 C;  4MOY A;  4Q7F A;  4MOV A;  3H62 B;  2WDD A;  2WDE A;  3T1I A;  3RL4 A;  2HYO A;  1KBP A;  1XZW A;  4V0X A;  2BDX A;  3GVE A;  1Z2W A;  1OIE A;  3QFO A;  1TCO A;  2DXN A;  1S70 A;  2NYM C;  3D03 A;  1AUI A;  2P6B A;  4UT3 A;  5INB A;  3LL8 A;  1T71 A;  4UWQ A;  3ZTV A;  2XMO A;  3H64 A;  4DT2 A;  2DXL A;  1II7 A;  2GJU A;  1HP1 A;  3EGG A;  3K7W C;  1WAO 1;  4H1Y P;  2HYP A;  4I5N C;  4ORB A;  5IOH A;  5JPF A;  3C5W C;  1S3N A;  2ZOA A;  4O4K A;  2BQ8 X;  2Z06 A;  4M0V A;  3ZU0 A;  2O8G A;  4ORA A;  4NZV A;  4H2F A;  5DNY A;  3IVE A;  2YEQ A;  3H63 A;  4JA7 A;  1S8E A;  3RQZ A;  4O5G A;  5EQV A;  3H66 A;  1OID A;  2Z72 A;  4XPN A;  3H61 A;  2QFR A;  2YVT A;  1M63 A;  2O8A A;  3E0J A;  3H69 A;  2AHD A;  4V0V A;  2JOG A;  4MP0 A;  2Q8U A;  5C1V A;  4FBK A;  4J6O A;  3THO B;  4H2G A;  2IE4 C;  1NNW A;  3KBP A;  5J28 A;  4LTY A;  5JJT A;  1USH A;  4KBP A;  4G9J A;  3PSN A;  4OR9 A;  4IYP C;  4V0W A;  4WWL A;  1IT6 A;  3IB8 A;  4F0Z A;  1S3L A;  5HPE A;  1UTE A; 
#chains in the Genus database with same CATH homology
 2IAE C;  2WDF A;  3IB7 A;  4DHL A;  4LU9 A;  4UT3 B;  3H68 A;  1G5B A;  2A22 A;  3DSD A;  3E7A A;  4FBQ A;  3QG5 C;  3QFM A;  1HO5 A;  1QFC A;  2NYL C;  2WDC A;  4JA9 A;  3RL3 A;  5F3W A;  1UF3 A;  4DSY A;  2CV9 A;  3AUZ A;  3E7B A;  2IE3 C;  4KKZ A;  2Z1A A;  4LAC C;  3RL5 A;  1WAR A;  3HVQ A;  3N5U A;  3QFK A;  4TUI A;  3IVD A;  2DFJ A;  1JK7 A;  1W24 A;  1Z2X A;  1FJM A;  2QFP A;  4O43 A;  4I5L C;  5B8I A;  2QJC A;  4H1S A;  3ICF A;  1S3M A;  2USH A;  3DSC A;  3AV0 A;  3H60 A;  1OI8 A;  1SU1 A;  1U32 A;  2R17 A;  3JYF A;  3PSO A;  1QHW A;  2BCD A;  3EGH A;  4H2B A;  4B2O A;  3THN A;  2ZBM A;  3K7V C;  3CK2 A;  3C9F A;  4YKE A;  5GTU A;  4TUG A;  4O24 A;  5JPE A;  4IL1 A;  3FGA C;  2NPP C;  2KKN A;  3V4Y A;  4ORC A;  1XM7 A;  3QFN A;  4ZVZ A;  3FLO A;  1MF8 A;  4FBW A;  1S95 A;  4UT2 A;  3TGH A;  4FCX A;  4H2I A;  3P71 C;  1V73 A;  3H67 A;  4HD0 A;  2HY1 A;  4ZX2 A;  2ZO9 B;  2NXF A;  1T70 A;  1HPU A;  3DW8 C;  4MOY A;  4Q7F A;  4MOV A;  3H62 B;  2WDD A;  2WDE A;  3T1I A;  3RL4 A;  2HYO A;  1KBP A;  1XZW A;  4V0X A;  2BDX A;  3GVE A;  1Z2W A;  1OIE A;  3QFO A;  1TCO A;  2DXN A;  1S70 A;  2NYM C;  3D03 A;  1AUI A;  2P6B A;  4UT3 A;  5INB A;  3LL8 A;  1T71 A;  4UWQ A;  3ZTV A;  2XMO A;  3H64 A;  4DT2 A;  2DXL A;  1II7 A;  2GJU A;  1HP1 A;  3EGG A;  3K7W C;  1WAO 1;  4H1Y P;  2HYP A;  4I5N C;  4ORB A;  5IOH A;  5JPF A;  3C5W C;  1S3N A;  2ZOA A;  4O4K A;  2BQ8 X;  2Z06 A;  4M0V A;  3ZU0 A;  2O8G A;  4ORA A;  4NZV A;  4H2F A;  5DNY A;  3IVE A;  2YEQ A;  3H63 A;  4JA7 A;  1S8E A;  3RQZ A;  4O5G A;  5EQV A;  3H66 A;  1OID A;  2Z72 A;  4XPN A;  3H61 A;  2QFR A;  2YVT A;  1M63 A;  2O8A A;  3E0J A;  3H69 A;  2AHD A;  4V0V A;  2JOG A;  4MP0 A;  2Q8U A;  5C1V A;  4FBK A;  4J6O A;  3THO B;  4H2G A;  2IE4 C;  1NNW A;  3KBP A;  5J28 A;  4LTY A;  5JJT A;  1USH A;  4KBP A;  4G9J A;  3PSN A;  4OR9 A;  4IYP C;  4V0W A;  4WWL A;  1IT6 A;  3IB8 A;  4F0Z A;  1S3L A;  5HPE A;  1UTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...