3LL9A

X-ray structures of isopentenyl phosphate kinase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
263
structure length
244
Chain Sequence
b'HMIILKLGGSVITRKDSEEPAIDRDNLERIASEIGNASPSSLMIVHGAGSFGHPFAGEYRIGSEIENEEDLRRRRFGFALTQNWVKKLNSHVCDALLAEGIPAVSMQPSAFIRAHAGRISHADISLIRSYLEEGMVPVVYGDVVLDSDRRLKFSVISGDQLINHFSLRLMPERVILGTDVDGVYTRNPKKHPDARLLDVIGMVGKIRELLLLAEKGVESEIINAAVPGNIERALLGEEVRGTRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isopentenyl phosphate kinase
publication title X-ray structures of isopentenyl phosphate kinase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transferase
total genus 75
structure length 244
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.7.4.26: Isopentenyl phosphate kinase.
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3ll9A00
3C20A 2R98A 3LL9A 3K56A 2X2WA 2HMFA 4Q1TA 2WE5A 4OLCA 3L86A 3LL5A 3D2PA 2OGXB 3QVFA 3ZZGA 2E9YA 1Z9DA 4KZTA 2A1FA 2BNFA 2IJ9A 3K4YA 1E19A 2JJXA 3KZFA 3TVIA 2WE4A 3WWMA 2BUFA 3L76A 4NDOA 3D40A 4JZ9A 4I49A 2BRXA 2J4JA 4AB7A 2JI5A 3QVHA 2J0WA 3K52A 3C1NA 2V5HA 3QURA 4A7XA 3NWYA 3S6HA 1OH9A 4NDOB 4NDPB 3EK6A 1OHAA 2BNDA 3S6KA 2W21A 4NDQB 2J5TA 3ZZHA 3EK5A 2R8VA 2BNEA 2CDQA 4NDPA 1YBDA 4NDRA 2AKOA 3D41A 4A7WA 4NDQA 2BRIA 1GS5A 2J0XA 4JZ7A 3QUNA 2WXBA 4F6TA 2JJ4A 1GSJA 2RD5A 1B7BA 3T7BA 3LKKA 1OHBA 2J4KA 4NDRB 2BMUA 4JZ8A 3WWNA 3U6UA 3AAWA 3B8GA 4AXSA 4F6TB 3ZZIA 2V4YA 3ZZFA 3K4OA 3QUOA 3C1MA 3AB2A 2BTYA 2VA1A 2AP9A 2J4LA 2OGXA 3D2MA 2J5VA 3AB4A 3S6GA 4USJA
chains in the Genus database with same CATH superfamily
3C20A 2R98A 3LL9A 3K56A 2X2WA 2HMFA 4Q1TA 2WE5A 4OLCA 3L86A 3LL5A 3D2PA 2OGXB 3QVFA 3ZZGA 2E9YA 1Z9DA 4KZTA 2A1FA 2BNFA 2IJ9A 3K4YA 1E19A 2JJXA 3KZFA 3TVIA 2WE4A 3WWMA 2BUFA 3L76A 4NDOA 3D40A 4JZ9A 4I49A 2BRXA 2J4JA 4AB7A 2JI5A 3QVHA 2J0WA 3K52A 3C1NA 2V5HA 3QURA 4A7XA 3NWYA 3S6HA 1OH9A 4NDOB 4NDPB 3EK6A 1OHAA 2BNDA 3S6KA 2W21A 4NDQB 2J5TA 3ZZHA 3EK5A 2R8VA 2BNEA 2CDQA 4NDPA 1YBDA 4NDRA 2AKOA 3D41A 4A7WA 4NDQA 2BRIA 1GS5A 2J0XA 4JZ7A 3QUNA 2WXBA 4F6TA 2JJ4A 1GSJA 2RD5A 1B7BA 3T7BA 3LKKA 1OHBA 2J4KA 4NDRB 2BMUA 4JZ8A 3WWNA 3U6UA 3AAWA 3B8GA 4AXSA 4F6TB 3ZZIA 2V4YA 3ZZFA 3K4OA 3QUOA 3C1MA 3AB2A 2BTYA 2VA1A 2AP9A 2J4LA 2OGXA 3D2MA 2J5VA 3AB4A 3S6GA 4USJA
chains in the Genus database with same CATH topology
3C20A 2R98A 3LL9A 3K56A 2X2WA 2HMFA 4Q1TA 2WE5A 4OLCA 3L86A 3LL5A 3D2PA 2OGXB 3QVFA 3ZZGA 2E9YA 1Z9DA 4KZTA 2A1FA 2BNFA 2IJ9A 3K4YA 1E19A 2JJXA 3KZFA 3TVIA 2WE4A 3WWMA 2BUFA 3L76A 4NDOA 3D40A 4JZ9A 4I49A 2BRXA 2J4JA 4AB7A 2JI5A 3QVHA 2J0WA 3K52A 3C1NA 2V5HA 3QURA 4A7XA 3NWYA 3S6HA 1OH9A 4NDOB 4NDPB 3EK6A 1OHAA 2BNDA 3S6KA 2W21A 4NDQB 2J5TA 3ZZHA 3EK5A 2R8VA 2BNEA 2CDQA 4NDPA 1YBDA 4NDRA 2AKOA 3D41A 4A7WA 4NDQA 2BRIA 1GS5A 2J0XA 4JZ7A 3QUNA 2WXBA 4F6TA 2JJ4A 1GSJA 2RD5A 1B7BA 3T7BA 3LKKA 1OHBA 2J4KA 4NDRB 2BMUA 4JZ8A 3WWNA 3U6UA 3AAWA 3B8GA 4AXSA 4F6TB 3ZZIA 2V4YA 3ZZFA 3K4OA 3QUOA 3C1MA 3AB2A 2BTYA 2VA1A 2AP9A 2J4LA 2OGXA 3D2MA 2J5VA 3AB4A 3S6GA 4USJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C20 A;  2R98 A;  3LL9 A;  3K56 A;  2X2W A;  2HMF A;  4Q1T A;  2WE5 A;  4OLC A;  3L86 A;  3LL5 A;  3D2P A;  2OGX B;  3QVF A;  3ZZG A;  2E9Y A;  1Z9D A;  4KZT A;  2A1F A;  2BNF A;  2IJ9 A;  3K4Y A;  1E19 A;  2JJX A;  3KZF A;  3TVI A;  2WE4 A;  3WWM A;  2BUF A;  3L76 A;  4NDO A;  3D40 A;  4JZ9 A;  4I49 A;  2BRX A;  2J4J A;  4AB7 A;  2JI5 A;  3QVH A;  2J0W A;  3K52 A;  3C1N A;  2V5H A;  3QUR A;  4A7X A;  3NWY A;  3S6H A;  1OH9 A;  4NDO B;  4NDP B;  3EK6 A;  1OHA A;  2BND A;  3S6K A;  2W21 A;  4NDQ B;  2J5T A;  3ZZH A;  3EK5 A;  2R8V A;  2BNE A;  2CDQ A;  4NDP A;  1YBD A;  4NDR A;  2AKO A;  3D41 A;  4A7W A;  4NDQ A;  2BRI A;  1GS5 A;  2J0X A;  4JZ7 A;  3QUN A;  2WXB A;  4F6T A;  2JJ4 A;  1GSJ A;  2RD5 A;  1B7B A;  3T7B A;  3LKK A;  1OHB A;  2J4K A;  4NDR B;  2BMU A;  4JZ8 A;  3WWN A;  3U6U A;  3AAW A;  3B8G A;  4AXS A;  4F6T B;  3ZZI A;  2V4Y A;  3ZZF A;  3K4O A;  3QUO A;  3C1M A;  3AB2 A;  2BTY A;  2VA1 A;  2AP9 A;  2J4L A;  2OGX A;  3D2M A;  2J5V A;  3AB4 A;  3S6G A;  4USJ A; 
#chains in the Genus database with same CATH topology
 3C20 A;  2R98 A;  3LL9 A;  3K56 A;  2X2W A;  2HMF A;  4Q1T A;  2WE5 A;  4OLC A;  3L86 A;  3LL5 A;  3D2P A;  2OGX B;  3QVF A;  3ZZG A;  2E9Y A;  1Z9D A;  4KZT A;  2A1F A;  2BNF A;  2IJ9 A;  3K4Y A;  1E19 A;  2JJX A;  3KZF A;  3TVI A;  2WE4 A;  3WWM A;  2BUF A;  3L76 A;  4NDO A;  3D40 A;  4JZ9 A;  4I49 A;  2BRX A;  2J4J A;  4AB7 A;  2JI5 A;  3QVH A;  2J0W A;  3K52 A;  3C1N A;  2V5H A;  3QUR A;  4A7X A;  3NWY A;  3S6H A;  1OH9 A;  4NDO B;  4NDP B;  3EK6 A;  1OHA A;  2BND A;  3S6K A;  2W21 A;  4NDQ B;  2J5T A;  3ZZH A;  3EK5 A;  2R8V A;  2BNE A;  2CDQ A;  4NDP A;  1YBD A;  4NDR A;  2AKO A;  3D41 A;  4A7W A;  4NDQ A;  2BRI A;  1GS5 A;  2J0X A;  4JZ7 A;  3QUN A;  2WXB A;  4F6T A;  2JJ4 A;  1GSJ A;  2RD5 A;  1B7B A;  3T7B A;  3LKK A;  1OHB A;  2J4K A;  4NDR B;  2BMU A;  4JZ8 A;  3WWN A;  3U6U A;  3AAW A;  3B8G A;  4AXS A;  4F6T B;  3ZZI A;  2V4Y A;  3ZZF A;  3K4O A;  3QUO A;  3C1M A;  3AB2 A;  2BTY A;  2VA1 A;  2AP9 A;  2J4L A;  2OGX A;  3D2M A;  2J5V A;  3AB4 A;  3S6G A;  4USJ A; 
#chains in the Genus database with same CATH homology
 3C20 A;  2R98 A;  3LL9 A;  3K56 A;  2X2W A;  2HMF A;  4Q1T A;  2WE5 A;  4OLC A;  3L86 A;  3LL5 A;  3D2P A;  2OGX B;  3QVF A;  3ZZG A;  2E9Y A;  1Z9D A;  4KZT A;  2A1F A;  2BNF A;  2IJ9 A;  3K4Y A;  1E19 A;  2JJX A;  3KZF A;  3TVI A;  2WE4 A;  3WWM A;  2BUF A;  3L76 A;  4NDO A;  3D40 A;  4JZ9 A;  4I49 A;  2BRX A;  2J4J A;  4AB7 A;  2JI5 A;  3QVH A;  2J0W A;  3K52 A;  3C1N A;  2V5H A;  3QUR A;  4A7X A;  3NWY A;  3S6H A;  1OH9 A;  4NDO B;  4NDP B;  3EK6 A;  1OHA A;  2BND A;  3S6K A;  2W21 A;  4NDQ B;  2J5T A;  3ZZH A;  3EK5 A;  2R8V A;  2BNE A;  2CDQ A;  4NDP A;  1YBD A;  4NDR A;  2AKO A;  3D41 A;  4A7W A;  4NDQ A;  2BRI A;  1GS5 A;  2J0X A;  4JZ7 A;  3QUN A;  2WXB A;  4F6T A;  2JJ4 A;  1GSJ A;  2RD5 A;  1B7B A;  3T7B A;  3LKK A;  1OHB A;  2J4K A;  4NDR B;  2BMU A;  4JZ8 A;  3WWN A;  3U6U A;  3AAW A;  3B8G A;  4AXS A;  4F6T B;  3ZZI A;  2V4Y A;  3ZZF A;  3K4O A;  3QUO A;  3C1M A;  3AB2 A;  2BTY A;  2VA1 A;  2AP9 A;  2J4L A;  2OGX A;  3D2M A;  2J5V A;  3AB4 A;  3S6G A;  4USJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...