3LL9A

X-ray structures of isopentenyl phosphate kinase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
263
structure length
244
Chain Sequence
HMIILKLGGSVITRKDSEEPAIDRDNLERIASEIGNASPSSLMIVHGAGSFGHPFAGEYRIGSEIENEEDLRRRRFGFALTQNWVKKLNSHVCDALLAEGIPAVSMQPSAFIRAHAGRISHADISLIRSYLEEGMVPVVYGDVVLDSDRRLKFSVISGDQLINHFSLRLMPERVILGTDVDGVYTRNPKKHPDARLLDVIGMVGKIRELLLLAEKGVESEIINAAVPGNIERALLGEEVRGTRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isopentenyl phosphate kinase
publication title X-ray structures of isopentenyl phosphate kinase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transferase
total genus 75
structure length 244
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.7.4.26: Isopentenyl phosphate kinase.
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3ll9A00
3TVIA 2BTYA 2J5TA 2V5HA 1OHAA 3AB2A 3QVHA 4JZ8A 2V4YA 3QURA 3S6HA 3C1NA 3ZZGA 3LL9A 4NDRA 1GSJA 2WXBA 3C1MA 1B7BA 2A1FA 3D41A 4NDQA 4AXSA 3D2MA 2BNEA 3LL5A 4KZTA 4OLCA 3T7BA 1E19A 4NDOA 3L76A 3ZZHA 1OHBA 2X2WA 3K56A 3WWMA 4F6TA 3AB4A 2BMUA 2RD5A 2W21A 2IJ9A 3ZZIA 2BNDA 2J4LA 4NDRB 4JZ7A 2J0XA 4A7XA 4I49A 2BRIA 3EK6A 4NDQB 4USJA 2VA1A 4A7WA 2WE5A 2AKOA 3QUOA 3K52A 1OH9A 1GS5A 3D40A 4NDOB 4Q1TA 3QVFA 3S6KA 3C20A 4NDPA 2J0WA 2OGXA 2J5VA 2JJ4A 4NDPB 2OGXB 2E9YA 2JI5A 3K4OA 4F6TB 3EK5A 1YBDA 3LKKA 2R98A 2BNFA 3U6UA 3AAWA 4AB7A 2J4KA 3NWYA 3QUNA 3WWNA 2BUFA 3L86A 1Z9DA 2HMFA 2CDQA 3B8GA 2JJXA 3S6GA 2R8VA 3K4YA 2AP9A 3D2PA 3ZZFA 4JZ9A 3KZFA 2BRXA 2J4JA 2WE4A
chains in the Genus database with same CATH superfamily
3TVIA 2BTYA 2J5TA 2V5HA 1OHAA 3AB2A 3QVHA 4JZ8A 2V4YA 3QURA 3S6HA 3C1NA 3ZZGA 3LL9A 4NDRA 1GSJA 2WXBA 3C1MA 1B7BA 2A1FA 3D41A 4NDQA 4AXSA 3D2MA 2BNEA 3LL5A 4KZTA 4OLCA 3T7BA 1E19A 4NDOA 3L76A 3ZZHA 1OHBA 2X2WA 3K56A 3WWMA 4F6TA 3AB4A 2BMUA 2RD5A 2W21A 2IJ9A 3ZZIA 2BNDA 2J4LA 4NDRB 4JZ7A 2J0XA 4A7XA 4I49A 2BRIA 3EK6A 4NDQB 4USJA 2VA1A 4A7WA 2WE5A 2AKOA 3QUOA 3K52A 1OH9A 1GS5A 3D40A 4NDOB 4Q1TA 3QVFA 3S6KA 3C20A 4NDPA 2J0WA 2OGXA 2J5VA 2JJ4A 4NDPB 2OGXB 2E9YA 2JI5A 3K4OA 4F6TB 3EK5A 1YBDA 3LKKA 2R98A 2BNFA 3U6UA 3AAWA 4AB7A 2J4KA 3NWYA 3QUNA 3WWNA 2BUFA 3L86A 1Z9DA 2HMFA 2CDQA 3B8GA 2JJXA 3S6GA 2R8VA 3K4YA 2AP9A 3D2PA 3ZZFA 4JZ9A 3KZFA 2BRXA 2J4JA 2WE4A
chains in the Genus database with same CATH topology
3TVIA 2BTYA 2J5TA 2V5HA 1OHAA 3AB2A 3QVHA 4JZ8A 2V4YA 3QURA 3S6HA 3C1NA 3ZZGA 3LL9A 4NDRA 1GSJA 2WXBA 3C1MA 1B7BA 2A1FA 3D41A 4NDQA 4AXSA 3D2MA 2BNEA 3LL5A 4KZTA 4OLCA 3T7BA 1E19A 4NDOA 3L76A 3ZZHA 1OHBA 2X2WA 3K56A 3WWMA 4F6TA 3AB4A 2BMUA 2RD5A 2W21A 2IJ9A 3ZZIA 2BNDA 2J4LA 4NDRB 4JZ7A 2J0XA 4A7XA 4I49A 2BRIA 3EK6A 4NDQB 4USJA 2VA1A 4A7WA 2WE5A 2AKOA 3QUOA 3K52A 1OH9A 1GS5A 3D40A 4NDOB 4Q1TA 3QVFA 3S6KA 3C20A 4NDPA 2J0WA 2OGXA 2J5VA 2JJ4A 4NDPB 2OGXB 2E9YA 2JI5A 3K4OA 4F6TB 3EK5A 1YBDA 3LKKA 2R98A 2BNFA 3U6UA 3AAWA 4AB7A 2J4KA 3NWYA 3QUNA 3WWNA 2BUFA 3L86A 1Z9DA 2HMFA 2CDQA 3B8GA 2JJXA 3S6GA 2R8VA 3K4YA 2AP9A 3D2PA 3ZZFA 4JZ9A 3KZFA 2BRXA 2J4JA 2WE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVI A;  2BTY A;  2J5T A;  2V5H A;  1OHA A;  3AB2 A;  3QVH A;  4JZ8 A;  2V4Y A;  3QUR A;  3S6H A;  3C1N A;  3ZZG A;  3LL9 A;  4NDR A;  1GSJ A;  2WXB A;  3C1M A;  1B7B A;  2A1F A;  3D41 A;  4NDQ A;  4AXS A;  3D2M A;  2BNE A;  3LL5 A;  4KZT A;  4OLC A;  3T7B A;  1E19 A;  4NDO A;  3L76 A;  3ZZH A;  1OHB A;  2X2W A;  3K56 A;  3WWM A;  4F6T A;  3AB4 A;  2BMU A;  2RD5 A;  2W21 A;  2IJ9 A;  3ZZI A;  2BND A;  2J4L A;  4NDR B;  4JZ7 A;  2J0X A;  4A7X A;  4I49 A;  2BRI A;  3EK6 A;  4NDQ B;  4USJ A;  2VA1 A;  4A7W A;  2WE5 A;  2AKO A;  3QUO A;  3K52 A;  1OH9 A;  1GS5 A;  3D40 A;  4NDO B;  4Q1T A;  3QVF A;  3S6K A;  3C20 A;  4NDP A;  2J0W A;  2OGX A;  2J5V A;  2JJ4 A;  4NDP B;  2OGX B;  2E9Y A;  2JI5 A;  3K4O A;  4F6T B;  3EK5 A;  1YBD A;  3LKK A;  2R98 A;  2BNF A;  3U6U A;  3AAW A;  4AB7 A;  2J4K A;  3NWY A;  3QUN A;  3WWN A;  2BUF A;  3L86 A;  1Z9D A;  2HMF A;  2CDQ A;  3B8G A;  2JJX A;  3S6G A;  2R8V A;  3K4Y A;  2AP9 A;  3D2P A;  3ZZF A;  4JZ9 A;  3KZF A;  2BRX A;  2J4J A;  2WE4 A; 
#chains in the Genus database with same CATH topology
 3TVI A;  2BTY A;  2J5T A;  2V5H A;  1OHA A;  3AB2 A;  3QVH A;  4JZ8 A;  2V4Y A;  3QUR A;  3S6H A;  3C1N A;  3ZZG A;  3LL9 A;  4NDR A;  1GSJ A;  2WXB A;  3C1M A;  1B7B A;  2A1F A;  3D41 A;  4NDQ A;  4AXS A;  3D2M A;  2BNE A;  3LL5 A;  4KZT A;  4OLC A;  3T7B A;  1E19 A;  4NDO A;  3L76 A;  3ZZH A;  1OHB A;  2X2W A;  3K56 A;  3WWM A;  4F6T A;  3AB4 A;  2BMU A;  2RD5 A;  2W21 A;  2IJ9 A;  3ZZI A;  2BND A;  2J4L A;  4NDR B;  4JZ7 A;  2J0X A;  4A7X A;  4I49 A;  2BRI A;  3EK6 A;  4NDQ B;  4USJ A;  2VA1 A;  4A7W A;  2WE5 A;  2AKO A;  3QUO A;  3K52 A;  1OH9 A;  1GS5 A;  3D40 A;  4NDO B;  4Q1T A;  3QVF A;  3S6K A;  3C20 A;  4NDP A;  2J0W A;  2OGX A;  2J5V A;  2JJ4 A;  4NDP B;  2OGX B;  2E9Y A;  2JI5 A;  3K4O A;  4F6T B;  3EK5 A;  1YBD A;  3LKK A;  2R98 A;  2BNF A;  3U6U A;  3AAW A;  4AB7 A;  2J4K A;  3NWY A;  3QUN A;  3WWN A;  2BUF A;  3L86 A;  1Z9D A;  2HMF A;  2CDQ A;  3B8G A;  2JJX A;  3S6G A;  2R8V A;  3K4Y A;  2AP9 A;  3D2P A;  3ZZF A;  4JZ9 A;  3KZF A;  2BRX A;  2J4J A;  2WE4 A; 
#chains in the Genus database with same CATH homology
 3TVI A;  2BTY A;  2J5T A;  2V5H A;  1OHA A;  3AB2 A;  3QVH A;  4JZ8 A;  2V4Y A;  3QUR A;  3S6H A;  3C1N A;  3ZZG A;  3LL9 A;  4NDR A;  1GSJ A;  2WXB A;  3C1M A;  1B7B A;  2A1F A;  3D41 A;  4NDQ A;  4AXS A;  3D2M A;  2BNE A;  3LL5 A;  4KZT A;  4OLC A;  3T7B A;  1E19 A;  4NDO A;  3L76 A;  3ZZH A;  1OHB A;  2X2W A;  3K56 A;  3WWM A;  4F6T A;  3AB4 A;  2BMU A;  2RD5 A;  2W21 A;  2IJ9 A;  3ZZI A;  2BND A;  2J4L A;  4NDR B;  4JZ7 A;  2J0X A;  4A7X A;  4I49 A;  2BRI A;  3EK6 A;  4NDQ B;  4USJ A;  2VA1 A;  4A7W A;  2WE5 A;  2AKO A;  3QUO A;  3K52 A;  1OH9 A;  1GS5 A;  3D40 A;  4NDO B;  4Q1T A;  3QVF A;  3S6K A;  3C20 A;  4NDP A;  2J0W A;  2OGX A;  2J5V A;  2JJ4 A;  4NDP B;  2OGX B;  2E9Y A;  2JI5 A;  3K4O A;  4F6T B;  3EK5 A;  1YBD A;  3LKK A;  2R98 A;  2BNF A;  3U6U A;  3AAW A;  4AB7 A;  2J4K A;  3NWY A;  3QUN A;  3WWN A;  2BUF A;  3L86 A;  1Z9D A;  2HMF A;  2CDQ A;  3B8G A;  2JJX A;  3S6G A;  2R8V A;  3K4Y A;  2AP9 A;  3D2P A;  3ZZF A;  4JZ9 A;  3KZF A;  2BRX A;  2J4J A;  2WE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...