3LLCA

Crystal structure of putative hydrolase (yp_002548124.1) from agrobacterium vitis s4 at 1.80 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
261
structure length
261
Chain Sequence
RPIETHAITVGQGSDARSIAALVRAPAQDERPTCIWLGGYRSDMTGTKALEMDDLAASLGVGAIRFDYSGHGASGGAFRDGTISRWLEEALAVLDHFKPEKAILVGSSMGGWIALRLIQELKARHDNPTQVSGMVLIAPAPDFTSDLIEPLLGDRERAELAENGYFEEVSEYSPEPNIFTRALMEDGRANRVMAGMIDTGCPVHILQGMADPDVPYQHALKLVEHLPADDVVLTLVRDGDHRLSRPQDIDRMRNAIRAMIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative hydrolase
publication title Crystal structure of Putative hydrolase (YP_002548124.1) from Agrobacterium vitis S4 at 1.80 A resolution
rcsb
source organism Agrobacterium vitis
total genus 81
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3llcA00
2QXTA 3OC0A 3WLAA 4BB0A 4WFIA 2BGNA 4HRYA 4Y2XA 3FVRA 4TGLA 5DJ5A 3WYNA 4J0JA 4C4YA 3BL8A 3K9BA 3IVMA 5CRIA 2WKWA 2XMSA 2XMRA 5JAHA 1GZ7A 5AM2A 4UHBA 3HJUA 2ZSIA 4J0HA 1N1MA 2OAGA 3GBSA 3PI6A 1DX4A 1EVEA 4G8BA 5D7BA 2PPLA 1GKLA 5CXXA 5ALTA 1HL7A 4QDZA 2D0DA 5JIBA 2ZJFA 3F9CA 4K6KA 4RGYA 5EHZA 3G0BA 5ALJA 4UBLA 3IURA 4GECA 1Q83A 4EA6A 3C5VA 3WK5A 1XROA 4QDUA 1MU0A 4DYHA 4DLNA 5LP1A 2FX5A 2XUIA 5FUMA 5SYNA 5A6VA 5ALWA 1VE7A 4CG1A 3OPMA 5ALIA 4WJLA 2HA0A 1CUFA 4UHFA 4OB6A 2OGZA 2HADA 3V1LA 1H22A 4Q3OA 3W2TA 3IIIA 4F21A 3DOHA 3DLTA 2XUKA 4LYDA 4BRSA 3U1TA 1S8OA 1YSCA 1U4NA 1MX5A 5AO9A 1YA8A 4H7HA 1ZIYA 2IITA 3QPCA 2CKMA 5JATA 1CEXA 2VT7A 4OCZA 1TCAA 1W76A 1CUIA 2UZ0A 3B3QA 3R41A 4H7EA 1F0PA 4FTWA 4OUKX 4I3FA 1ZGCA 3STWA 3OTQA 3C70A 1AKNA 5HK9A 2X5XA 3HRHA 1BU8A 4ZRDA 4N5HX 3TRDA 5JZSA 2XUFA 2ACKA 3IDAA 5IH7A 5CT5A 4AZ0A 5FV4A 3BXPA 1EDEA 4KE8A 4BVKA 2CB9A 1IUNA 3FLBA 2VAXA 3CCCA 4ROTA 3G9ZA 1XZFA 3WZLA 1XRPA 2WHQA 4HRXA 1CRLA 5AKIA 4G4GA 5FP0A 2VA9A 3WWOA 1PJAA 5FKJA 3DS8A 5CTAA 4Y2RA 2HU8A 2J4FA 2OGTA 1YB6A 1ODTC 2C0QA 1SCKA 1XQVA 5JADA 4ZV7A 1IVYA 4C4ZA 4OB8A 3G7NA 4DTCA 5IKXA 4BBZA 4XWGA 4ARBA 1RWQA 3KXPA 4P93A 5CW2A 1MTZA 2ORYA 4X92A 3W05A 2AJLI 1QZ3A 2PX6A 4BAZA 3IUJA 1XQYA 3SX4A 1H2ZA 3VVMA 3E0XA 5LZ5A 3AJAA 4MWTA 5CMLA 1UK7A 5DYWA 2R11A 1AMNA 2ONCA 5LLSA 4X90A 5JAPA 1EA5A 4PO3X 1LPAB 2RI6A 4W1RA 1RP1A 1VJ5A 3A2MA 1C7JA 2WIKA 1ZGBA 1QOZA 1E8DA 1LPSA 3QVMA 5HZGA 1IUOA 4B84A 2XE4A 1GPKA 2WQZA 3O4IA 1CUAA 1DU4A 2VT6A 3EQ9A 1T2NA 4WY5A 4Q3KA 1PV1A 1VA5A 3OOSA 3DYVA 4M0EA 2H7YA 4NVRA 3KSRA 2I3DA 2HRQA 1UOOA 3QPAA 5FPPA 4J03A 4X3CA 1QIIA 1CUZA 2XQGA 3QMWA 1IMJA 3CXUA 2Y1KA 3D0KA 2ZVDA 1QTRA 1CUCA 5AI9A 1WCYA 2DQZA 1CUBA 3WK6A 3STUA 5IVHA 1FFEA 5IVKA 1ZICA 1W4LA 1ODCA 5ALLA 3BE8A 5EFZA 4BAUA 2ZJ7A 2C5FA 1MPXA 3HZOA 4WDRA 3N0TA 3RLIA 5T4FA 5DLPA 3VJLA 1L7RA 2OGSA 2H7CA 3VXKA 3C6BA 2HIHA 3FNBA 5LKRA 5CBKA 1DX6A 4FMPA 1SFRA 5KWIA 4X6XA 5HF9A 5LYYA 1WB4A 1EINA 3AZQA 3WKCA 1HKHA 4LYEA 1A8SA 2Z3WA 4X95A 4Z49A 4BDSA 2PL5A 4J0DA 2HM7A 1EB9A 3T52A 1ZI9A 1CQWA 1R3DA 1IUPA 2WIFA 3WK7A 2O7RA 1CPYA 1QO7A 1XZJA 5HF6A 4X71A 5FLKA 4UHHA 4B83A 5AKJA 5AKXA 2XUGA 4IH9A 1USWA 3IUNA 2QR5A 1LBTA 1BEEA 1VZ3A 1XZLA 2AJ8A 2GBGA 3FYUB 2CUTA 1UKAA 3PDCA 2QJWA 1LPBB 2B61A 3W04A 3WK8A 2OCGA 1HLGA 1ORVA 1ACLA 5EGNA 4AN1A 3H1BA 4OD0A 3ICVA 5DNUA 2Z8ZA 3WZMA 4HS9A 2BGRA 1LZLA 1E8MA 4M0FA 5D3ZA 4LIPD 5AJHA 2ZSHA 1J2EA 2G5PA 3D3NA 2HDWA 2WU3A 2JGEA 4C4XA 5EIEA 3AIMA 2QXUA 2W6CX 1THGA 5K3FB 1WHSA 1P0QA 3N2ZB 5AKGA 1VZ2A 1VA4A 5AOBA 4CIBA 2JGIA 3QYJA 4M0MA 4Y2PA 4ZXFA 2XMQA 1WM1A 4ZGBA 2HA5A 4X91A 2XUQA 1F0NA 4W63A 3PICA 4BP8A 4PSCA 5AI4A 1DINA 4KAFA 4CCYA 4B7ZA 4JNCA 5E4JA 3DKRA 2XQIA 3F8SA 3NUZA 4Y2SA 1DQZA 1ACJA 2P8SA 1R88A 2WHPB 4LXHA 3R3ZA 5ALRA 4KACA 1H23A 4RPCA 2AJCA 2WIGA 4X94A 4Y2UA 4GXNA 3I2JA 5BOVA 5CH5A 1CUWA 4EY4A 3O9VA 5ALNA 2BJHA 4Y7DA 4QA9A 1ZD2P 1N5RA 3PFCA 3KWJA 4UFPA 2G4LA 4FNMA 4HXFB 4UUQA 1FJ2A 3WMRA 2QT9A 3F67A 3MUNA 1HQDA 3AINA 5T4EA 2VSQA 3LLCA 3JWEA 4L72A 1XRNA 4EY6A 1LPNA 2EDCA 4EY5A 4G4IA 3A70A 2VJAA 2PSJA 1IZ8A 4FFWA 1K63A 4JEIA 3QH4A 3VKFA 1MAAA 3WL5A 3C6XA 4J0KA 2PM8A 4P08A 5C8XA 4L0CA 4ZREA 4H0CA 1UKBA 2ES4A 1XZHA 3OURA 2GYVA 4X97A 5ALVA 3C45A 5JASA 3PF9A 4GWLA 4CG2A 2GBIA 1XZEA 1CLEA 1Q0ZA 2DFPA 3IA2A 1O6GA 1QIKA 1X70A 4FKBA 2R8BA 2I03A 5EIHA 1RYYA 3V1KA 4GEGA 5KWJA 5CH8A 1MNQA 3V1NA 3GUUA 3E4DA 4W9RA 1CUSA 1MO2A 4MEBA 2V98A 1DT3A 4C6HA 5AKZA 3ESAA 3G9TA 2OLEA 3G0GA 1EXWA 1M33A 3D2AA 2RONA 4C89A 1KU0A 2WJ3A 2I3ZA 1GKKA 1CFJA 1DWQA 2V97A 5EHNA 4MYDA 1P0PA 3FBWA 1MX1A 1NU6A 3R3UA 5CURA 5JAOA 5AI6A 4X6YA 5E4TA 3X3HA 4HTAA 5E4YA 4AMZA 3G0DA 2ZJ6A 4PQEA 4NS4A 4CCYB 1F8UA 2Z5GA 2RHWA 1XKTA 1UOQA 4N8DA 3UUFA 1ZD5A 4QWWA 3ZV7A 4K2AA 5HFAA 1YAJA 4UFOA 1OILA 4UPDA 4Q1VA 4Y2YA 3HSSA 3ILSA 4N8EA 3I6MA 4BRZA 3LIPA 1XQXA 1TQHA 1QIDA 3CN7A 3FYTA 1LGYA 4JYPA 2QTBA 2WU4A 1YAHA 4UBJA 3RARA 2YYSA 5A7GA 5D6OA 1JKMA 1XQWA 1XKLA 2XT0A 5DYYA 1HBJA 2OPHA 1YASA 5C7YA 2XMZA 2QJRA 2XMGA 1AUOA 3B12A 3C5WP 1NU8A 1JMKC 2XI4A 5AIAA 2JEZA 5T4BA 2O2GA 3M81A 3D2CA 2QKYA 1XLVA 1ORWA 2WSLA 5JZ9A 3H1AA 2DHEA 2JF0A 4J0GA 5DTIA 4K6GA 4C01A 2QMQA 3TJMA 4OYYA 4AO8A 3TEJA 4E14A 1FSSA 3H2IA 3C8HA 3QPDA 3FCXA 4NMWA 3EBLA 1CUUA 4L9AA 3AZOA 3C43A 4OU4A 4UBIA 1X2EA 3WQHA 1QIMA 4X85A 3FYUA 2HU7A 1AZWA 1JJIA 5K3CA 4ETWA 1CUXA 2GBFA 1UXOA 2RGUA 3WWPA 4PF1A 1YR2A 2GYUA 5AI5A 5HK8A 5T4HA 2PVSA 1G4HA 4GDMA 1K8QA 2NW6A 3MGAA 2B20A 2X76A 4J3JA 4BE9A 4FLEA 1XRQA 2OXEA 2XB6A 5EHQA 3ZWQA 5HKBA 3I2IA 1MNAA 4X93A 2FUKA 2C0PA 3AZPA 3O95A 5K3DA 1K4YA 4U2DA 1ODSA 1R9MA 5BV7A 2J3DA 5K3FA 4BP9A 5ALYA 1OCEA 2XUOA 4DMFA 1FFDA 2WTNA 2CJPA 3FYUC 2WUFA 2VEOA 2XQFA 1WPRA 4QNNA 5JALA 2CMFA 1CUDA 1B6GA 2C58A 5ALZA 3G9UA 4B81A 4A23A 1XZKA 5LZ4A 4UBMA 3B5EA 2GZRA 2WIJA 5AI8A 1L7QA 2WJ6A 5C8VA 4LXIA 1XRMA 1LPOA 3AILA 4EZIA 1K6EA 5EHXA 2WHPA 2O2HA 2O2IA 4Y2QA 3JYHA 4U2CA 3HEAA 4ZWNA 2J3QA 3M82A 3BJMA 4QE3A 3QMMA 4LHEA 1YA4A 5ALXA 2OAEA 3VDXA 4Y2JA 3WL8A 4FFVA 5KREA 5ALUA 2C7BA 4Q34A 5AICA 4EBBA 5A62A 4I19A 2VF2A 2O7VA 5AKKA 4RE5A 4N5IX 3CCBA 5LZ8A 4DMCA 1F6WA 2HA3A 1VXRA 2WFLA 2C5GA 3G0IA 4FDMA 1Y7HA 3G8YA 1ZJ4A 4MQMA 3TGLA 2QUAA 1XZDA 5H3HA 3S8YA 1E8NA 2WJ4A 2QOEA 5FPQA 2ECFA 4J0CA 5I7UA 3O4JA 5DYTA 3D59A 5AK4A 2V96A 1MT3A 2X8BA 2XUPA 4H7DA 3BJRA 1N5MA 1K5PA 1R50A 2XDWA 2XLCA 5JZBA 5AM4A 5JARA 5K5EA 2QS9A 3LP5A 4WFKA 1ZIXA 1FFCA 4AQDA 4H77A 1QJ4A 3F96A 3O0DA 4IH1A 4Q3LA 4B9EA 3H19A 1H2WA 3IULA 2CZQA 1DWPA 3C6ZA 3R3VA 4JYMA 2ACEA 5A7FA 2E3JA 4XVCA 4Y2TA 1QFMA 1XZGA 1BCRA 3P2MA 3QITA 1X2BA 3H2HA 3H2GA 4W1QA 4KJXA 4WCVA 2JGMA 5AM3A 1GXSA 1XRLA 4KAJA 5I9IA 4OU5A 4BTVA 4UHCA 3R3WA 3C6YA 4H7FA 1TAHA 4B6GA 5ALKA 1G5FA 3LCRA 5K3AA 3VJKA 3AIOA 4DSZA 3ESBA 4C88A 3W9BA 1LPMA 4FWBA 2YASA 5AOCA 1LLFA 3AIKA 4IHAA 4G5XA 5AK6A 2HU5A 3A2NA 2WUDA 2PSHA 4C87A 3U0VA 2PUJA 2XUJA 1DWOA 1KEZA 3DCNA 2EDAA 4WY8A 4QWMA 1SCIA 1LZKA 2XMBA 5AP9A 3R3XA 1QTIA 2VJCA 3NGMA 1G66A 1E3QA 4KYVA 2YH2A 4AN0A 6YASA 4QDTA 5BWCA 1E5TA 3YASA 2B9VA 4BE4A 5AI0A 5K3EA 2AJDA 5AM0A 3WKBA 4A16A 4BTLA 2Z8XA 3I2GA 3IBTA 4BVLA 1XRRA 1Z68A 4U2EA 3IUQA 4OSEA 3Q0TA 4K6HA 3EQ7A 4H18A 1UOPA 1Y7IA 1EDDA 1TKRA 3I2HA 1I6WA 2HA2A 1EDBA 3ANSA 1JU4A 4HXEB 3WJ1A 3ESDA 5ALHA 3OM8A 2VJDA 4G9EA 4EUSA 3DL4A 3PF8A 2WFLB 4BYMA 4BDTA 1VXOA 1GQRA 4YPVA 4HXGA 3UUEA 4B0PA 4PNZA 1WB5A 4DNOA 4QLOA 5J3JA 3DEAA 3IUMA 1Q84A 4U2BA 1W52X 3GA7A 4DNPA 1NX9A 2GZSA 4B82A 1UFOA 1XZAA 2HRRA 4DNQA 3HABA 2Y2VA 4H7JA 4JUIA 1QE3A 2PKYX 2DCMA 4XIIA 5AKYA 2AXEA 5BWBA 2RHTA 4G8DA 1UKCA 1JMYA 5AKLA 4BZZA 4CFSA 2CBGA 1QLWA 1AGYA 3O4HA 1ZI6A 5LZ9A 4IQ4A 1C4XA 4AXBA 4QDOA 5JD5A 3STVA 1ISPA 1G42A 1CUYA 2WM2A 3I2FA 3FLEA 2C4HA 3DKKA 4BATA 1U2EA 1EX9A 2WILA 4KR0A 5ESRA 5AM1A 3R3YA 4BZWA 4AB1A 3EF3A 3AFIA 3ESCA 3DD5A 1CVLA 4E11A 2EEPA 1TCBA 2PBLA 1XZIA 3E3AA 3WYDA 2JIDA 1CQZA 3STYA 1JFRA 1P0IA 1TRHA 4GW3A 3VJMA 3ZLTA 3ZLUA 4V2IA 4Q05A 3KOOA 3L1IA 2XQJA 4RNCA 2BCEA 1PFQA 1CUJA 3O9MA 3GROA 1LNSA 3EIOA 2RAUA 2WLSA 1H2YA 3KDAA 4PSDA 1VLQA 1BEZA 2JGLA 3SWWA 3IB3A 5HQ3B 2QZPA 2WG2A 5CT6A 5LIPA 5AOAA 3BF7A 1GQSA 2HFKA 4DGQA 4X7BA 4TPKA 3Q8WA 2Y6VA 2PSFA 4BC1A 3BDVA 2JGKA 5AKEA 2OG1A 4XJVA 3ZLVA 2JGFA 3DDUA 5ALSA 5A7HA 4AO7A 1GPLA 3ED1A 2FJPA 5FRDA 3R0VA 4KRXA 1AC5A 4LKOA 2H1IA 3WIOA 2BUCA 1ZJ5A 4FNGA 2Q0XA 4ITVA 4KE6A 4MJ3A 5AHXA 5C81A 4K5QA 7YASA 4FBMA 4YK7A 3WWCA 2WG0A 4JH0A 1C7IA 5DTJA 3F97A 5CT4A 1R9NA 5IVIA 5KBYA 5LKAA 1YS1X 3G02A 5A71A 4E15A 4HVTA 4Y2VA 4L3WA 4UFNA 3MVEA 1IZ7A 3PFBA 1AURA 1CUHA 1JI3A 3BF8A 3WJ2A 3RK4A 3K6KA 3QZUA 4FHZA 3A6ZA 2VAVA 4QEKA 4Q82A 2BFNA 4BAGA 3STTA 3WKAA 2WUGA 2OCKA 3FOBA 1MJ5A 2OQVA 2J4CA 5ALOA 4H7IA 3I6ZA 3STXA 2XUHA 3E1GA 1JT2A 1CUEA 1SOMA 3DOIA 3V1MA 2WHRA 2XQKA 2DQYA 1GPNA 3WI7A 1J07A 3W06A 3ANTA 2RIPA 4P92A 3F98A 4DNFA 3D2BA 3CN9A 4MYSA 4DMHA 5ALEA 4B80A 1EVQA 2HA4A 2VATA 4X6UA 5ALMA 3PUIA 5FDFA 4UHDA 1AQLA 3QBJA 2DSNA 4BCDA 5EI5A 3FVTA 4AMYA 3HXKA 4QLAA 4F0JA 2PSDA 3VVLA 2HFJA 1AX9A 2QUBA 1CUGA 5HF8A 1DT5A 3NWOA 3H04A 4GBGA 1EI9A 3PE6A 3FSGD 1MX9A 4BCCA 5JANA 1JU3A 2Y2UA 4MEAA 4ZV9A 1UK8A 3R40A 1MAHA 1VKHA 3DYIA 3L1HA 3G9XA 2YXPX 2DHCA 3H2KA 1VOTA 5CH3A 1CR6A 1EK1A 5AH0A 1WOMA 5FOQA 2HHAA 1A88A 2BUBA 3WK9A 4G4JA 2XLBA 1B41A 3KWFA 4UBNA 4CI9A 4TVKA 1TCCA 2JEYA 3K2IA 3RKSA 1L7AA 1KU6A 1A7UA 2XMDA 2QRUA 4BCBA 1JJBA 2VJBA 5HCUA 2HL6A 3D4LA 3M3DA 1Q0RA 3C87A 1U8EA 4PV7A 1XZCA 2DR0A 5YASA 5A2GA 1OXMA 3OG9A 2H9YA 3BWXA 4D9JA 3V9AA 2B4KA 2LIPA 4A5SA 3ZPXA 1A8UA 1U65A 3DJYA 4AX4A 3W9UA 1QONA 1T4MA 2FJ0A 4B0OA 5AK5A 5IVDA 1WB6A 2BKLA 1XZMA 1UZAA 4BC0A 3WL7A 1DQYA 5ALPA 1UWCA 2Z3ZA 3KD2A 1HDEA 1D07A 2PSEA 3H17A 4U2FA 4XX1A 1XFDA 2H7XA 1VE6A 3T4UA 1HPLA 5F4ZA 2XUAA 4GHWA 1R1DA 5SYMA 1BROA 2WTMA 1JJFA 4OPMA 1CIJA 1CV2A 4YASA 4G1FA 3FAKA 1XLUA 3RM3A 1LBSA 3D7RA 2DHDA 4KAAA 2VTVA 4PW0A 4ZI5A 4IH4A 1J1IA 4QZVA 3GFFA 4CCWA 3DL7A 4E46A 2IX9A 2WIDA 4F60A 3G0CA 3QMVA 4ARAA 1WPXA 3I28A 4CG3A 2PUHA 5DWDA 1ZOIA 1EB8A 3WKEA 3D5EA 2K2QB 1TK3A 1YCDA 2CEKA 1BN6A 2WFZA 4J0IA 1E89A 1LPPA 5HF5A 3I2KA 3I1YA 5JAUA 2AJBA 4P9NA 3BDIA 3SK0A 4OYLA 3GZJA 2G5TA 3VISA 4EHBA 4Y9SA 4F5ZA 3WIBA 1Y37A 2JGJA 4S0XA 3L1JA 3M83A 4H35A 4KE9A 2W22A 2I78A 4DMKA 4YX9A 4FLMA 2ROQA 3SC2A 1ZD4A 4DIUA 4W1SA 4IO0A 4U2GA 4WDQA 4OB7A 3BIXA 3O4GA 4UHEA 1UK9A 4B9AA 3WK4A 4G9GA 1BCSA 5LZ7A 3NOXA 2OCIA 4J7AA 3HACA 2WG1A 5JD4A 1EHYA 4FLFA 5CT8A 1ETHA 1P0MA 4AZ3A 1H2XA 4I4CA 2XMCA 5HFNA 4MXDA 3MUOA 4FBLA 3GELA 5JD6A 2ZYIA 4EY8A 2G63A 5E2IA 3FLAA 3H2JA 2QVBA 1SCQA 3FWHA 3WA7A 2V9ZA 4LXGA 3HI4A 1UK6A 3FSGA 1YS2X 5C8ZA 1W6RA 5DNWA 1FFAA 5DNVA 2D5LA 2VQ6A 5HKAA 3DQZA 3FCYA 2ZYHA 5HQ3A 2XUDA 3LS2A 1R4ZA 4HAIA 2ZYSA 1QO9A 5ALDA 4KEAA 5AKHA 1W75A 1GT6A 1QIEA 1QIGA 1QIFA 5AIBA 4AO6A 5FXMA 5I8PA 4DSAA 2WFMA 4GI1A 1QGED 4N8SA 5EIAA 1MN6A 3H18A 5LZ2A 5K3BA 5AK3A 1DTEA 4QDXA 5CT9A 1FFBA 4X00A 1CUVA 5D3KA 1THTA 4RE6A 3I1IA 1XZBA 2WUEA 1QIJA 1ZD3A 3C8DA 4INZA 2BAGA 4NZZA 1BE0A 3JW8A 1YB7A 2PU5A 2GYWA 4EY7A 3ICWA 4UBOA 4CIAA 3EQ8A 3WKDA 2OCLA 2GBCA 1J06A 2OQIA 3HYSA 4H7KA 4HZGA 3S2ZA 4G8CA 3A2LA 2QM0A 1BS9A 3H0CA 2JBWA 3WWEA 3HC7A 1O6FA 1WHTA 1EH5A 3WWDA 4GLBA 5ALFA 2ZYRA 3QM1A 4WFJA 1EK2A 1GGVA 3V48A 3I6YA 3DNMA 2Y6UA 2HA6A 2BUAA 4BVJA 3UMJA 1W1IA 1QFSA 1ZI8A 5JYCA 3ZI7A 2HA7A 4KE7A 3PUHA 4KRYA 4UBKA 5AM5A 5ISMA 1N8SA 4W1PA 3WL6A 1QIHA 3BIWA 3HLKA 4PSUA 2PU7A 1SC9A 2IIVA 1BN7A 3WA6A 1A8QA 4B85A 4FOLA 4DM7A 1E66A 1UT6A 4EB0A 1XLWA 5ALGA 4MQLA 5CXUA 1TIBA 4MWSA 3LIIA 1BRTA 3AUKA 4O08A 5ALQA
chains in the Genus database with same CATH superfamily
1R0ZA 1PGNA 1RWNA 3AESB 3FYDA 4EWLA 2J85A 1YXMA 3QVKA 2P4EA 3WLAA 2XDQB 4EX7A 4BB0A 2IHKA 2O48X 4WFIA 1SPBS 5C46F 5ICSA 1A9XB 2L0XA 4CM9D 4I08A 3CNOA 3KV3O 4XFDA 3TRHA 4GO1A 5F2NA 1U2GC 2HLDD 4ZYLA 1C7RA 3LC0A 2M6LA 4XUCA 3LF1A 4HGOA 2D1RA 4ETNA 1ONOA 1GV1A 2DEUA 4BX9A 2IYWA 3U4QB 2H48A 1VIDA 4Q3EA 4OQNA 5I4CA 1PD0A 3EGXB 4XGRA 3UY4A 2RK4A 1X77A 2XMSA 2XMRA 4GOXA 2JFWA 4V0SA 3RU3A 1GZ7A 1M0SA 4M60A 1T25A 4J1TA 2PZAA 4CE6A 1E3JA 3RJMA 4N5LA 2A1TR 2AFRA 2C7VA 3CLRC 3M6XA 5F9HA 2A5FA 3QXXA 4HQOA 1FSZA 4EB8A 1T9BA 3SJCA 1PYGA 2OAGA 4LTMA 2PE5A 3PI6A 1DCFA 1EVEA 2WB4A 4L4ZA 4M86A 4FOOA 4AY2A 5CG1A 1GKLA 3JVDA 4G0QA 1FXSA 1PGQA 1UJMA 3FUUA 4PLWA 1D6SA 1WHSB 2QWXA 1PZHA 2IU6A 3MXOA 5E6RA 1W29A 1PZEA 2UYGA 4AMBA 5JTUA 2FFJA 1OAOA 2XAAA 3JD4A 4IJKA 3VHXA 5JV5A 1E0AA 1HG0A 2Y76A 1ZUHA 4BLUA 1L5GB 3C6KA 5ALJA 4CLRB 2Q5JA 4EVSA 3DZKA 5FYQA 1RLOA 2C2BA 2QTGA 1PJ4A 5IAAA 1R4NA 1V47A 4ZAXA 1GAJA 4ZQCB 5A1JA 2ACWA 1P5ZB 4HADA 1JKIA 2DY1A 3HCPA 3PWSA 4QDUA 5HPYB 3K72B 3QF7A 3VYWA 4DYHA 1A9ZA 1FXUA 4HT3B 2XUIA 1E7YA 2XQVA 1PK9A 5SYNA 4RY8A 2H2FA 1GGKA 3H5VA 4DLKA 2Y9MB 3FCCA 4G85A 2NTYC 1N0VC 2VQ3A 3BSSA 3IBFA 1GLGA 1T5TA 3FI9A 2IL1A 3GQBA 4GKVA 4I55B 1NWCA 3MWLA 5F2OA 3RUHA 3V4PB 2Q6KA 2C94A 2PGDA 3V1LA 1SCBA 2HJWA 3CUTA 2G9ZA 4MCJA 4RHYA 5DNAA 5EWMA 4IDFA 3MF4A 3QPWA 1VPWA 4F21A 3G5MA 1R0KA 1K7YA 2ZRJA 3DOHA 4IFIA 4RPKA 1Y1PA 3NBAA 3OE7A 3PQCA 4V03A 4P4TA 1C4OA 3GFTA 4EUKA 2CLFB 3DLTA 2P9BA 3TXXA 3PNBA 4LWQA 3T5TA 3OQPA 3PWKA 4KI0A 4ZVRA 3FVVA 1K8XB 4RPJA 3U1TA 4J0EA 3DVAB 3GCZA 1OV6A 3NOVA 2D1YA 5I9SA 2J0UB 1L6IA 2RC6A 4LHYA 3SX0A 1E2FA 4LQDA 5JVDF 4RTMA 1MX5A 1IBRA 3A4YA 3DOUA 3M6UA 4HZIA 1UXHA 1T8RA 1CEEA 5A5EA 2GFIA 1FP6A 4OMCA 5CD9A 2NO6A 3DE2X 3OHPA 2IITA 3WQQA 4BYGA 3FHTA 1IWPB 4CM5A 4QPCA 2X9LA 4XASA 3PNVA 2OXIA 4WX2B 3T9CA 4MVJH 4E3WA 3THWA 4GLFA 1L9KA 1MQSA 3B7GA 1NXPA 2VT7A 5JATA 5KYNA 1RWVA 3KKKA 5KS2A 2I29A 1KWGA 2QLNA 3MJEA 2ENWA 4FR5A 4FHDA 1EP9A 3OX3A 3SBEA 3PZBA 3HFJA 5I01A 4QT0A 2F17A 3GLGE 3HN6A 2RHCA 1FYVA 4DV1B 1EWKA 4HNVA 1W76A 1E63A 4UMFA 5CDYA 1YVPA 1SXJE 3LCUA 4WT7A 4BXOB 1C29B 2JIPA 3EY9A 2B0JA 3BGOS 2QAIA 3FPGA 3Q5GA 1O77A 1Y0BA 2OHHA 4I2VA 3RU2A 2LTAA 1JWBB 1E5LA 2V7WA 4EFKA 5CEFA 1Y1QA 3D2LA 4JLWA 5K0SA 3L93A 1NBAA 1SZPA 4OUKX 3T1VA 3U19A 1YZVA 3CRW1 1LSSA 2KJQA 3DA8A 2FEMA 4ID3A 4EHDA 1O0CA 4MW5A 5EJ7A 4BMDA 2OVFA 2Q07A 3W6OA 4BLQA 5EWJB 3C70A 4LJ8A 5KJCA 2REBA 5FL7D 5KVQA 4HEA1 5DRTA 2NU7B 3L9WA 2HDNB 4PXYA 2AYXA 4AG5A 4LBZA 5E2AA 4BP1A 5C3MA 5HK9A 3F49S 2QJOA 3TN7A 3NZEA 2Y77A 1USKA 1FUIA 3A9VA 3K2QA 2I7CA 3TTUA 3ONNA 1T4CB 1KC3A 3W8NA 1RKVA 1RBZA 2XTAA 1SC1A 3U1VA 3KZNA 2DGDA 1U3WA 2XODA 3NVAA 4IGIA 3TQRA 4DSUA 4V0NA 1K7XB 4MICA 1VTKA 1HETA 4JWTA 5IARA 2VHUA 1WLYA 3E58A 1YKFA 5IH7A 2OV3A 4KSBA 1OGIA 3CJRA 2FG7C 1TAGA 4P34A 4GF5A 5DI3B 4AZ0A 3GPLA 4D0SA 2DPGA 3A3KA 5FV4A 4E5SA 1O96B 2ADMA 4LY9A 1IYZA 3BSWA 1Y5IA 3A10A 3MILA 3OZGA 2ZRIA 4MVJP 4Q24A 3UTCA 4CU5A 4BVKA 3VR4A 1IUNA 4F2WA 1HQCA 1FU7A 4HDNA 1T10A 3IBGA 5TF0A 3N9IA 4FGUA 4EKEA 2IW1A 4TRMA 5KQGA 2A9RA 2QMUA 3RSCA 3OZDA 3QUCA 4JT9A 3VR5H 3JWJA 1YHNA 3A14A 1AKTA 4P2BA 3JTMA 5G41A 4ZEOA 3GJXC 1PT8A 5FP0A 2AFIB 1PJAA 4GOND 1NULA 2O0MA 3IXMA 5AT1A 1T0PA 3R09A 4QHSA 1WZCA 2RH5A 4GZLA 3PFNA 3QFTA 4PVDA 2KPOA 1ZH0A 2QN2A 5EY5B 3WMFA 3ZE7A 5DM1A 5DGCA 3AF2A 1XELA 4KRGA 1EXMA 4YAGA 1ZVMA 3LA8A 4UCWA 4XQEA 3GA0A 1BC5A 2GXQA 4OB8A 1YL7A 5EJGA 3I6IA 4AUEA 2IJGX 2JLXA 4YRIA 2R6AA 4DTCA 2XGMA 1HOTA 3WG9A 3LLUA 4KIGA 3RS8A 1NASA 3QLEA 1MQ8B 1CR1A 1OW3B 4XWGA 2XNKA 3LPNA 2GPWA 2OYSA 2HHHB 3VNBA 3KXPA 5CW2A 3X1WA 1I2MA 4OGGA 4KMSA 1ICEA 4ZRNA 2J9GA 4YCMA 2YY6A 1E6WA 3ONFA 1RJ9A 1QZ3A 2E4XA 2ORWA 1EVIA 3O8OB 3WLHA 3CBQA 4ZMBA 2P3SA 1CBUA 1XXLA 4XSGA 3UHFA 1AO0A 4RXTA 1IBCA 1XQYA 1EWTA 3MJHA 4BVEA 4BB5A 3HZZA 4CV1A 5CCXA 4YWJA 3PE4A 3VVMA 2YV5A 3DM5A 5KNBD 4O25A 4LXUA 4XA8A 4ND2A 2Z08A 1I32A 4XVRA 4BZPA 2XIQA 2ETXA 3RFCA 1LTKA 2HT6A 1Z39A 3QLUC 1QR6A 2PO7A 1M34B 4Q7LA 4YFVA 1BVRA 2QTVA 3HCWA 4JQYA 4K9QA 1UK7A 4MVJA 5DYWA 3RS0A 4F3YA 3DBRB 1NKTA 1QRTA 1Q12A 4RVNA 3T4EA 3E2PA 1Z0KA 3NGXA 4K28A 2GWRA 2LKDA 5LLSA 3TBHA 2N47A 1DG1G 4PO3X 4WEOA 1W85B 4H59A 2UYCA 2VNAA 3GDGA 3VFDA 4XDZA 1PK7A 4YJ2B 1ZUD1 2WIKA 4G0NA 3UKDA 3BXOA 2O8FA 3NV7A 1RQRA 2GLUA 1K66A 4P3XA 3CF6R 4DDTA 1K0UA 3TWOA 1PX0A 4B84A 2Q5OA 4MRMB 2R2GA 3PQEA 4NEGA 1SWVA 3QVOA 2OQ2A 2Q4DA 1KKMA 2VT6A 4LGVA 4YAJA 3TD9A 3OEWA 4BNLA 2SICE 2N42A 3B3JA 1EXDA 1AXGA 2XE8A 2C92A 3UAZA 3SN6A 1VA5A 5CA1B 4M0EA 1BHQ1 3HM2A 2H7YA 2XNDD 1X1AA 2XCQA 1R0WA 2HRQA 1YDHA 1ZJYA 3DUFB 1TIPA 1UOOA 1NMQA 4GSYA 4YFYA 1SHTX 2W4QA 3TLGA 2RGNC 1X8JA 3E9CA 1Y3IA 4OJQA 1Z7YA 3H5TA 4PRKA 4X3CA 1XZ8A 3S81A 1JH9A 5LIRA 3B36A 4TKUB 4BVFA 4D8XA 3G2KA 4EYQA 4AFNA 1A5AB 2YHBA 3F7TA 5B4TA 2ZB3A 1NLZA 1OGYA 1W30A 3ITNA 3CM0A 3GGDA 1QTRA 1CUCA 4Q7MB 1RHQA 1WCYA 3ZCVA 4A03A 4LRTB 1U6IA 4Z6KA 1OBOA 3PXXA 4M49A 2BISA 3FUVA 3RUAA 4GYYA 3WTBA 5HM6A 5LP6A 3WK6A 5IVHA 4KNYA 3BRCA 3QVSA 2IYPA 5LPNA 5DT9A 5KKAA 3OIUA 5IVKA 5A9SB 4B7UA 5DM2A 1L5HA 2HSGA 4ZT7A 1L0BA 4R98A 2ZIZA 4RLQA 5ALLA 1WCWA 2P9QA 3BE8A 3ZV6A 4DW8A 1JX6A 1PSZA 3CZ4A 3MMZA 5H59A 1NUPA 2BVNA 6CHYA 2C7OA 1GUDA 1P8JA 3V2IA 4DT1B 3LUDA 1KY2A 3QWAA 5REQB 1G41A 2PYZA 3F3YA 3KEGA 2Z1NA 4IXTA 3UT5B 5JRDS 4AWXA 1A9TA 4ZVPA 2QI9C 3D8BA 1RAIA 3FPBA 3QW4B 1CRQA 2P65A 2XBUA 3MSCA 3QVWA 3BULA 3LPAA 1Z82A 4CM8A 3TIXB 4FD3A 4H17A 1TF7A 2HLHA 3WYBA 1SCUB 5KHOC 1L7RA 2F62A 2DLNA 2OGSA 4TTTS 3VXKA 4RD6A 1AH2A 3FNBA 4EJ0A 1NW3A 3KQWA 1G2IA 3O74A 4LNUA 4O02B 4QSHA 3WLTA 4DIOA 1BGWA 5CBKA 3EMDA 2SKDA 4Q47A 3OVMA 5DHSA 4OMDA 1JA1A 3Q5EA 2HO5A 2P67A 1MH9A 1YTUA 2PX5A 4DQVA 4EG1A 4TQUS 3VBCA 1D0SA 2EW8A 5LYYA 4NYIQ 5DYGA 1EINA 4F3CA 4FW9A 4P3NA 4NCXA 4E5MA 4MTCA 5I9TA 5IJ0A 4MVYA 1HKHA 3FMIA 4LOHA 4B79A 3KRTA 3E9YA 4QBTA 3QLTA 1E7WA 1WCXA 2DWUA 1A8SA 5K0FA 5JSZB 2PL5A 4U3JB 3T52A 1EB9A 3UMGA 3SFVA 4ZIRA 1M2NA 1CQWA 1N5LA 1IUPA 1UQRA 3LCVB 3OBBA 4I9NA 4JX9A 4KKXB 5J63A 3VYRB 4OLBA 4GBED 1VL2A 2GARA 1KPGA 1Y5MA 3QBDA 3WK7A 2CVOA 1WQ1R 2O7RA 3NRBA 3ABQB 3WL3A 5C0OE 2P2GA 5IABA 1GQOA 1DIHA 1YE8A 1Z74A 1GUAA 3CF2A 9LDTA 3BVPA 2VPWA 2LP4Y 4FR0A 1T8UA 4IFEA 4KIWA 3ABRB 4PLCA 4XWAA 3SHTA 3ADCA 1EE2A 1FU4A 3TX2A 8MHTA 4HYTA 3KQVA 1GVHA 2IHYA 3AL3A 2BPOA 4GXQA 5KOHB 1U99A 2Q46A 1RXUA 4IH9A 3KELA 5L4NA 4L16A 1J2RA 3D7NA 2FUCA 3FGNA 3T5BA 2J67A 1ZN7A 4I99A 4PSKA 3UV6A 5JQGF 3GZNB 4HY3A 1FRVA 1KMHA 1IH8A 1NF3A 3IUBA 5DNDA 1KK3A 2PQ6A 2BFEB 3WL4A 2AJ8A 1E92A 1FS6A 3GLQA 2J6HA 5JAQA 3FYUB 3ZHCA 2RSLA 4WNIA 1U81A 4ZCQA 3HL0A 4ZZ2A 1VI2A 2VO1A 2LNDA 2VHZA 2F67A 3T3NA 1XGKA 1DBVO 4N39A 2FWPA 2YWHA 4NATA 4LWOA 3E9NA 3B51X 3KJHA 3RS3A 4L4YA 1XVVA 2XDQA 1HLGA 3ZQKA 2LWIA 1RAFA 3QOXA 4MUKA 5K45A 2V7VA 1ORVA 4EGSA 4YMIA 1A9XA 4JKYA 5JJKA 3GRYA 1WA5A 5DNUA 1O94A 1B6SA 3MYYA 1Y8QA 5U9CA 5A03A 1WY5A 4M76B 2E5LB 4N41A 1PZXA 4NZOA 3RRZA 2X2OA 1E0JA 4HGYA 4U9IS 5HMLA 2Z2IA 3DFKA 4MWOA 4LJAA 4WOCA 3LOQA 2VEDA 3U4QA 1MJGA 2CB0A 3C4VA 5C51B 2LDBA 5D3ZA 3EGXA 3UH1A 5AWFC 1JW9B 2YOGA 1UADA 4OXRA 2BFDB 3GRFA 1OASA 4MHTA 1TW2A 2JGEA 5DSTA 3FHJA 3P9PA 4NYIR 1L4UA 1NQWA 2R7MA 3KC2A 3ANMA 5DX1A 4LF8B 2Q2VA 3EF1A 4L6CA 1JPNA 3W8DA 3RB8A 4ZD6A 1EX7A 4Q1DA 2JFHA 3EXIB 3N59A 1K1EA 5BURA 4KFUA 2FP4A 3C5CA 1VFPA 2NG1A 3GUHA 4BGIA 1OUMA 3NH9A 5KSYA 1D2RA 1WHSA 1O2DA 1YHYA 2H1LA 3F5QA 2J3LA 4RMIA 1NW7A 3UB2A 1YVDA 3DPIA 3T5PA 1GUYA 3PNKA 4I5EA 2FK8A 1VZ2A 3N7AA 1VA4A 4DE5A 1J8DA 4CLRA 1NIPA 1V96A 5KYUB 5AOBA 2OOKA 2Q62A 1RADA 2WPNA 4J43A 5CCEA 3G2OA 3JY6A 5C31A 2O8BB 4QTZA 3DKIA 3O90A 4A7PA 1EAMA 1OWNA 1VPTA 3BFKA 4Y9UA 4BNZA 1P3Y1 2CEAA 4MWZA 2XYVA 2XCLA 5AW1A 3H42B 1H6BA 3ETCA 1NKSA 5HYVA 1VG9B 2JJ2A 5FWNA 5JZOA 1KAGA 1OT5A 3IT3A 4GC5A 3U81A 4EFLA 3WGOA 3LZDA 4G81A 1F17A 2BM0A 1UIMA 3H1PA 1OXVA 1S02A 3PICA 2C9ZA 4DDWA 1E60A 2ZI4A 4PSCA 1ANKA 4K2HA 4P4NA 3W6NA 4B74A 2BE7A 1OROA 3I9FA 2ORVA 3VVBA 5JI3E 2Z8YA 2FMUA 2WF7A 5IMBA 3BTUA 1P6XA 2OORA 2PZMA 2W6JA 5I9NA 5BUSA 1AGNA 1T6NA 3C8ZA 4K86A 2JCYA 4I9UA 1Z37A 1M7HA 3MOSA 3QKRB 1Z3IX 2JGNA 4IIDA 5E4JA 4ZYUA 4EYKA 1E6EA 5BR4A 3CFYA 2DPLA 2R1TB 4UXHA 5FA6A 5F1KA 3NUZA 3KEMA 5L3RA 3EXHC 3TXAA 3M3HA 1P1JA 1DQZA 3P26A 3TZQA 3X2FA 2P8SA 3D5TA 1DZ3A 3BCHA 3WC4A 1Q0SA 4JJ6A 1UJ6A 4QJIA 4C0LA 2J0UA 4BVHA 2IF0A 1N3IA 5KOYA 2FW9A 1I5RA 1WW2A 5JXJA 1GV0A 2B34A 1E6MA 4IDEA 2IYOA 2AJCA 3PA6A 1GJRA 2OHGA 2BTQB 4COOA 4D9MA 1BOFA 3I05A 3V46A 1H2RS 1NR1A 3T8YA 4RL4A 4IV0A 3JD2A 1JU9A 4ZDWA 2ZKIA 1X1SA 2C5LA 3RREA 2VF4X 4RQAA 2B1QA 2WYVA 2VVTA 4BRUA 4EY4A 3RT7A 3ZJ5A 2WM9B 3RHFA 3VSDA 3EZYA 1UBUS 4BP3A 4DQ0A 2B8NA 4NZPA 2VNIA 4FYPA 5C4MA 3IKJA 5AYVA 3L7DA 2B7LA 4K05A 5ALNA 5GGXA 3ZTTA 5CBPA 3KYDA 1V1RB 1COWD 1KVUA 2Y1EA 1Y4ZA 2Z2JA 3LW8A 5KPDA 4BXOA 2W48A 1D9ZA 5ECGC 2ZDQA 4RDIA 2GUWA 1WP4A 4RZ3A 2WJYA 1PG5A 5LLTA 1T8TA 1VE3A 4Q1CA 5GONF 4A91A 1ECLA 2G4LA 3CBGA 3CUSA 1T2VA 1SU8A 4NBSA 1XA4A 3O4RA 3E05A 5EWJA 2WAMA 2E9SA 5CM8B 3ROTA 1H65A 3PC8C 2JBAB 2ZBEA 2QIOA 1QHYA 2NU7A 2Q0HA 3K35A 3OX4A 3PXDA 1BYUA 4NR0A 4S2EA 1NQXA 4UUQA 4AJIA 4MP6A 4OO3A 4FFPA 4C2TA 3NCTA 4HGZA 3N0VA 3OA2A 1N5IA 1NQOA 4JT4A 2IDJA 1J42A 2VSQA 1NI3A 3LLCA 1NI4B 3DE6X 4MVWA 3V1UA 3UHAA 4F1JA 1N0WA 5JDIC 4L72A 2CDAA 1QAQA 3RASA 3OPNA 3ZZNA 1XHEA 3PEVA 1LPNA 5BQ5A 4EY5A 2CUNA 4G4IA 3LT5A 5K01A 2V6MA 3JASB 2GFHA 1F9AA 2V1XA 3EVDA 4TLBA 5DI3A 1JQEA 2VDJA 3VJRA 4RC9A 2GJAA 4LFCB 5LWQA 1O96A 1RPTA 1VQ1A 1PVOA 2PY6A 2AK2A 2VJAA 1XQ6A 2J0EA 1JAIA 1YACA 4LJRA 1IZ8A 5KC9A 1K63A 3L1KA 1C9MA 1L7PA 4K1LA 2R47A 4PQYA 2VBFA 4XX0B 1FQOA 2PT7A 3UJ9A 3VKFA 4NECA 1K7EB 2H2DA 2QG6A 2Y27A 3P27A 1CW2B 3RJTA 3TBKA 1XX6A 4JENA 2EJCA 3OLWA 5EERA 2R0QC 2O5VA 3SY8A 2XGGA 5C8XA 1SQ5A 3N53A 3ZH2A 3CF0A 2A3NA 2COEA 2H92A 2IC5A 4FC6A 4FEYA 4GRIA 4NBLA 3QVVA 3ZHTA 4Z7NB 2ZXEA 1TEXA 3S27A 4QXMA 4Y0AA 1F2VA 1FTNA 4KDCA 4L0MA 4KLAA 4RV9A 1ZGHA 3N0WA 2GPJA 3DB2A 3OKAA 1XZHA 4FUTA 2GYVA 4NULA 4S0ZA 4ZT3A 4M1KA 4AKTA 4Z1MD 4OI0A 2JVJA 3AF3A 4PO1A 5D5QA 3C45A 5JFTA 1TQDA 3PF9A 1ZESA 4ARZB 5IT9A 4JLDA 3S1AB 1KTVA 2PH3A 1XZEA 1CY0A 3E9MA 2OEPA 3CKKA 1Q0ZA 2J5XA 3HGMA 5H3LA 3ET4A 4CM7A 4WW0A 4Y67A 2A0YA 1TEHA 6REQA 2DERA 3TZBA 2DFPA 3ZNPA 3ZXSA 2NNLD 2YINC 4H1UA 1RXIA 2IWHA 5CFRA 4BUZA 1EM8B 4KGDA 4DV7B 3A9RA 3FAZA 4UMEA 1Z0UA 5K4AA 3ZDEA 3PHBE 4BN0A 1YIOA 4O1MA 3CRMA 3EX7C 1KGDA 1IJFA 4NEQA 1KJ9A 1T0IA 4EF6A 3CPSA 2GWHA 4LECA 3ZJVA 1JR2A 2IYQA 1O9GA 4NYMQ 4AF6A 1F3LA 2BV3A 2C98A 3M7IA 3LHFA 4DRXB 1PEKE 3AUAA 3E4DA 4YRFA 3RWMB 4PIMA 4B5LA 1B3BA 2FN3A 5JVDA 4RHTA 2ZDGA 1BX1A 1B93A 4LOIA 4B6OA 1DT3A 2CL6X 4FGJA 5AKZA 4OI4A 3A6FA 4ND8B 1A2KC 3G9TA 3MFQA 4BJ1A 2OLEA 3GVXA 1M34A 2YVLA 1G6HA 2I1QA 1P4RA 4OYHA 2C04A 3DBRA 2CV0A 5CJ2A 1M33A 1ODKA 3GY0A 3DW1X 4C89A 3WO0A 2DXIA 4ZO9A 1IL0A 4XTCS 1TX4B 1J8MF 1CFJA 4B7CA 1C4WA 4B2YA 1W85A 2ZRLA 5E3JA 5ICGA 3NT5A 1GEGA 3ST7A 1JNXX 2BBTA 1XTPA 3SYLA 2O6HA 3HV0A 4I1UA 3OQNA 4GDFA 1JMVA 4DLAA 1EK6A 1LQTA 1RWKA 1V3UA 3QKTA 4QXQA 4YRKA 1VLZA 2Z98A 4PZYA 4XPIB 1ZSYA 1V45E 5FEMA 1RAEA 1Z4JA 4FSXA 1HDOA 3RRBA 3B85A 4O2BB 5J4YA 3PQ6A 3RIMA 4YRZA 1J99A 2ZWPA 3CLVA 4MRMA 1NU6A 1IQ0A 4RV5A 4GL2A 5JAOA 3DAHA 5AI6A 4X6YA 2WJGA 3AG6A 4QJ5A 1ABEA 2C5EA 3SDBA 2ORED 1NSYA 3M9WA 1M5RA 2XV1A 4LOKA 4PQEA 3DHEA 1Y1SA 2RAVA 5FQNA 4DKXA 4FDUA 4PIPA 1E9DA 1E69A 4JBHA 4CCYB 1RQ7A 2DH5A 1U02A 1R8XA 1F8UA 2JCGA 1KP2A 2I4RA 2KLBA 3FUXA 3PC7A 1EU1A 5CA1A 3PUVA 4C14A 1QBGA 2RHWA 3Q7SA 4EABA 4BPBA 4J1TC 4LMBA 3CRQA 2CLEB 5B3AA 3FHOA 3BXXA 2CCGA 3DUFA 3NGLA 4ZAWA 3SNHA 2QZSA 4BQRA 3PJGA 4R71A 1EAYA 2BKVA 3IUPA 3AYXB 2C5SA 2G8NA 3VYVA 1YJAA 1ZD5A 3PGKA 2W6ZA 4LPSA 1I10A 1DX9A 1SG0A 1ZONA 1O97D 1XTRA 1P91A 1R64A 2WBLC 1TDJA 3LUGA 3KJNA 4A27A 1UBGA 3Q7RA 4PCAA 4TKUA 4GD3Q 2A30A 1PZNA 221PA 2PGOA 5EJ9A 3FG9A 1TKAA 4TTSA 1OAOC 2NSLA 3PX2A 3Q9SA 1K68A 1L7MA 1I33A 3DEHA 3LKDA 4UPDA 3RGWS 4EHHA 5JU6A 5FUQA 1NE2A 5ITZB 3HXPA 3NHUA 3W5UA 2QQ5A 2Q5IA 3TZKA 1MA3A 3W3ZB 1KAHA 3ILSA 2JI9A 3AB3A 3EWNA 2P4SA 2PLFA 3WMWA 5JPIA 5KYXA 1W0KD 3X1JA 2VJMB 2Z2YA 3W0LB 2ZT6A 2VPYA 1NBMA 4W4TA 4DN6A 3I4FA 3ZDYB 3CN7A 2C42A 2IY8A 3TM5A 1CDDA 2E55A 2PZJA 2UUAB 4KQEA 1SGWA 1XTVA 4D79A 1JR3A 1L5ZA 1OMOA 1V4VA 4AURA 3LT0A 5BRAA 1N2GA 2K7FA 1A96A 4ZQGA 1KO1A 1YAHA 2DVMA 2ZI7A 1YU6A 1LV8A 4D9NA 3N2KB 4A0SA 4DHWA 2W98A 1ZAYA 3G5AA 5DWQA 4DT1A 5D6OA 4LJSA 1GU1A 3A9WA 1P9WA 5B2FA 4KL8S 1XQWA 1PJ2A 3IAEA 1XKLA 1IATA 1MT0A 1NVXQ 2DMRA 2FG6C 1P9LA 1HBJA 3GT7A 2D1SA 3M49A 4IBOA 2OPHA 4BHTA 2YJ6A 4CIDA 2XMZA 2QJRA 3B9QA 4RD1A 4YACA 4R8LA 4B6RA 1SCUA 1Z7BA 1CJKC 2H00A 2QRPA 2Z9CA 3LHIA 4N0DA 5AK0A 3PPIA 5EIOA 3GT4A 4DLRA 2DFLA 1NU8A 2MTBA 2O2SA 4ZEXA 5DV9A 2BGJA 2XI4A 5AIAA 4RTKA 2FW7A 5F5XA 1GZHB 5AVUA 4PLVA 4XIGS 3AGPA 3CLUD 4O2AA 1QH9A 2VH2A 2GXSA 3AEXA 3M81A 5DH9A 3TG8A 2HXYA 2K6GA 4PLTA 3SX2A 3TW8B 4O33A 4C7OB 3HL4A 4EDFA 1J8FA 3MMSA 1FB5A 2HIMA 5K8VA 4KPYA 1EE1A 1ORWA 1EQAA 2WSLA 2IUYA 3RWOA 4CMEC 4DLWA 5K20A 3UQYS 4J3NA 1G19A 1H3FA 2Q28A 2EJUA 3FD8A 4I1IA 4LDNA 3CT6A 1F8YA 5JSZA 2O5EA 4RXUA 4JBNA 3G2IA 2CBZA 3AR5A 1IQRA 5FPYA 3B78A 1Y80A 5T3UA 2RGRA 4J29A 1P1BA 4RX1A 4MHOA 4C01A 1F1BA 4KFRA 3HEBA 5KDDA 4TTQA 4Z0HO 3TZCA 1E77A 1R27A 1IHXA 4ZO7A 2I2AA 4F9EA 4WADA 4F1KA 4QUJA 2Z6AA 3BCRA 1FLNA 5D3QA 1WZ2A 1FSSA 3MB5A 4G24A 4W6QA 1U8CB 3N0RA 1GNPA 5AUPB 5K3OA 3FNFA 3H3XA 3LLMA 3IPCA 2Z9BA 1Q14A 4E2WA 4HAUA 3QPDA 5EMJA 5LU8A 2XCRB 3OLCX 3NHMA 3PCXA 3TW4A 4EW3A 1JHUA 3AETA 5KOHA 1CZLA 3FPAA 4L9AA 3WBKA 3ZWKA 4D7AA 1TTPB 4L7VA 4JZYA 3ZY3A 3CU5A 4P0TA 1XPRA 4OU4A 3P96A 3D1LA 1G0NA 4L50A 3QBEA 1FFSA 2O0LA 4C5AA 4ZZ1A 4B4OA 2F3TA 4HDCA 1ZQ1A 2PMKA 4GRAA 5JMPA 4ES6A 3FYUA 1B3RA 3NWBA 3WLOA 4OSPA 3E3NA 1C50A 3KXIA 1ENOA 3NTOA 2HU7A 1AZWA 1IHPA 3NXSA 1YFZA 3WQRA 3B1KA 4ETWA 1QM5A 2IP4A 2P1RA 2GBFA 3I0MA 3WWPA 4CKWB 1YR2A 4EJSC 3ENKA 2GYUA 1H2FA 1NJ5A 4DJJA 4PSAA 1IC6A 1A2OA 1EKXA 1LWOA 1ODIA 2ZWAA 4GDMA 2ZG6A 4QUAA 4UTRA 2NW6A 3NFYA 3MGAA 4I7EA 1QHHB 4AMUA 1HYBA 2X76A 2UV8A 1E6KA 3CW2A 3P9RA 2C3PA 1HE2A 2P75A 3IVRA 2EFHB 1Q1ZA 4Q37A 5TT0A 4AY4A 1LWNA 5LBIA 2D13A 2HBZA 4MR7B 4A26A 4EHLA 4D9EA 4FP9A 3NYWA 3HXOA 2X14A 4L9WA 3B3AA 3EGOA 2HX1A 1JG2A 4LI3X 4L8YA 4DXHA 2XADA 5F3RA 2QGNA 3PFKA 4PAQA 4UTVA 5DHQA 4M3NA 5DU2A 2E87A 4Z0TA 4BV9A 4LNHA 4A8HA 1UFRA 4K26A 4YUAA 2HCFA 5E0KB 3AZPA 3LBNA 3I53A 5K0NA 3O95A 4XRGA 4ME6A 1VKRA 1YQTA 2JHCA 2VZEA 4Z4FA 4WKBA 1LRLA 3EXIA 3K20A 4Q00A 3PKZA 2VUTA 2R6ZA 3BFPA 1D4OA 1EP2B 3P7MA 3VHQA 3EVZA 5JO9A 4MI9A 2ZWOA 2WKQA 4R2KA 2AZXA 1HZJA 4JQCA 1NNUA 5DMXA 3I0NA 3TFQA 5CIYA 3SZOA 2ZJOA 4KTTE 1NC1A 5L53A 3BUSA 2WWGA 3K0CC 1FFDA 2JARA 3SR0A 4AJPA 2P2LA 2ZIXB 3MA0A 5KYUA 2IKSA 4K9LA 5IUNC 2YZMA 1R6UA 1T2FA 3BYZA 1ORIA 1BXGA 1TJYA 4YWHA 1QP8A 3H3FA 1D2MA 4XE5A 4I3HA 1WPRA 4QNNA 3SJZA 4EA9A 2JGDB 3U7FB 1B6GA 1TM5E 1Y9AA 2KQUA 3CG4A 3PB3A 3GU3A 4HB3A 3NPMA 5F73A 5U4QA 3TVYA 1M1XB 3FPSA 3HCEA 2F8LA 4JS0A 3T06B 1E2MA 2VDWB 1UKEA 3QJYA 1B74A 1VLJA 2ZWIA 4Z9BA 1V39A 1ML4A 5AUQA 1IXYA 3UWMA 3B1JA 1JLKA 4B81A 5C37A 2E4VA 4Q9KA 3CTMA 1VP9A 3F6CA 3OJOA 1Q19A 4ZQIA 5C5CA 5KOIA 3IJRA 3L4SO 3K70D 3C3DA 1GCUA 1WXIA 2AB0A 2FG5A 2H6EA 3B5EA 3PVCA 3QKRA 2QN8A 2WVHA 2H1HA 4R9VA 1G9SA 3H13A 3G89A 3COVA 2WJ6A 4I4TF 5H5JA 1ZUNB 1QC5A 1XVUA 4I8DA 4I14A 4AL4A 3CS3A 2VI5A 4IQFA 2C88A 1LPOA 3OLQA 4ZOEA 4DEYA 3WB9A 3A1EA 3EG9B 5DK6A 1JEOA 2O2HA 3KQYA 4CMIA 4L4RA 5C18A 3H9CA 2R7LA 1FFHA 3HEAA 4FW8A 3PKJA 1K88A 2BTQA 4QASA 1VE5A 1XN4A 3M82A 3BJMA 4IHQA 4QE3A 2ATIA 4M1SA 1K7FB 1Z0ZA 3QMMA 4L15A 3NEJA 3GA5A 4LHEA 1RRVA 2EG9A 3VA7A 5ALXA 1UM9A 2F2TA 3CZCA 1DADA 1NDQA 2OAEA 5IC6A 3U39A 3VHRA 2BTEA 3FCSB 4OHKA 4FFVA 3BQNB 4REMA 2IDZA 3DWGA 3F7NA 2G76A 5M7EA 2CLDX 4RFLA 3BMNB 5CYOA 1WSBA 5DX0A 2C7BA 5A62A 4AT1A 1X15A 2O7VA 4MV0A 4HK4A 2EZ8A 3A1SA 1K97A 2ONYA 1T8PA 3C3JA 5FJIA 2AFVA 2VPTA 4ZCPA 3FOFC 5A04A 4BLPA 4A0GA 4XEUA 4XVUA 3BRWD 3KJXA 3ZOKA 1LQUA 2H0AA 3A9UA 4C4SA 2IZOA 1CE8B 1Z8FA 3SDZA 1B0UA 2FPGA 2C9BA 2HA3A 4WVLA 2WFLA 4CEHB 1O4VA 3NTUA 3AKEA 1BRMA 3I9MA 2I2FA 3OQBA 1ZJ4A 2ODPA 4DA8A 2D7DA 4GBJA 2JBAA 3NHJA 1CF2O 2C2HA 1ZK2A 3NHSA 2XEDA 4IJWA 1RCTE 3WBFA 3KQMA 4YV1A 3S8YA 1XMQB 5KCZA 1JBKA 2RHMA 3HR4A 1HMYA 4PYKA 3AV0B 4ZO4A 4NBNA 2Q7XA 4XM1A 3HB1A 5CVJA 5TPZA 1VPDA 2V96A 1SVUA 3NB0A 4OTZA 5BSUA 5CLFA 2WSYB 1BIFA 3M2TA 2PFSA 4I36A 1SUIA 4M4SA 3SIWA 5LP6C 3W1EA 3WQSB 1PJSA 4YY3B 1DLIA 3IQFA 1H4SA 2AF4C 4XI9A 5EQDA 3RVMA 4CEJB 4KVZA 5BN3A 1N0UA 1VCOA 1WD5A 1OZFA 2OK7A 3NTRA 4P80A 3JASA 4O4IB 4R8SA 3W4KA 3UC9A 1VL0A 1J2YA 3GFVA 3TVDA 4FYXA 4EQ6A 3A6EA 3GAZA 4M89A 5AM4A 2QS9A 1K6MA 3LP5A 1U6JA 3OX2A 3UXYA 2HJSA 1ADBA 1N2CB 4QTXA 2QRHA 5AVVA 5EE1A 2VZ8A 3C3PA 4BO0A 1LEHA 4F38A 4KHZA 1GTRA 4XX0A 3VI4B 3VNAA 4XD7D 1IG3A 4H77A 4D0GA 4EPRA 1U2TA 1K9VF 4U7DA 3M6WA 3N7UA 2WHYA 1TYAE 4IDQA 2V0CA 4OHUA 3ZCSA 4FN4A 1MRNA 1MENA 3HHPA 1XQ1A 2J5KA 2WAXA 4AN4A 1NBEA 3QLVA 3LY5A 4J9UE 2C2KA 3D8RA 3GN1A 5JD3A 4MRAA 4QT4A 3H19A 1H2WA 4NCKA 4MGZR 2QD2A 4ZHSA 2UXCB 2CUZA 2HYDA 4AJ1A 2JCSA 2XY4A 2X8JB 1WLSA 1U0TA 1WU7A 4M87A 1EGVB 2NSJA 4INAA 1ULHA 3LNTA 4ARZA 4B6JA 4JYMA 2ACEA 3S1AA 4R9SA 4H4DA 4I1VA 4KBFA 2E4WA 5JNWA 2E3JA 3T0FA 3UV7A 1YC5A 1QFMA 1A1SA 2EP7A 1BCRA 1P73A 1YZQA 3OZBA 3UF0A 2F64A 1MABA 1RFGE 4QUIA 3B7PA 1CQJB 1E62A 1B8OA 1KYQA 2IKQA 5L95A 1ZY2A 3H2GA 3JALB 1WKVA 4ZYVA 5CFNA 3ZTWA 1Q6YA 1IAQA 4HUJA 3UCEA 2J5BA 1Y48E 2NAFA 3ROMA 1XKXA 3W2GA 5AM3A 2HCBA 1BDBA 4EGAA 1J0EA 4I50F 1ZGGA 1GXSA 1XRLA 3ZY5A 2NP6A 3ZE1B 3DLIA 3PEFA 3GLGA 2NZ8A 1SB9A 2ZQZA 5EWLA 3S44A 1Z0DA 1I0LA 3JVEA 2C9MA 3II6X 1VRVA 3MW8A 3PNPA 2D5BA 1SXJA 3A4VA 5T41A 4I5GA 2I3AA 3AOGA 1SMKA 3R6TA 3ND6A 4MKXA 1S3SA 3ZHOA 4HBGA 1Y6FA 3ACCA 1DTWA 4CF5A 3FMFA 4YRGA 2DUWA 1C3XA 1XSEA 1JQBA 2PN1A 1J5XA 1W9MA 2CHUA 2RH9B 3C6YA 2ZJ0A 4FGLA 4QPDA 5KAPA 5BN1A 3BWBA 5IJWA 4H7FA 1W35A 2HWKA 3L6CA 1CQIB 1KC1A 3I39X 1G5IA 4QEZA 3TKYA 1G7RA 4RGBA 3AHIA 1H4VB 1QUEA 2YXBA 1NN1A 4DSZA 1SUBA 3GMDA 5TJHA 4GRDA 4C88A 3J81A 2DFDA 1D3AA 1G8FA 4ZU6X 5HKKD 3JQEA 1C1DB 3K16A 5FUVA 4FYJA 4W8OA 2HDHA 3SKYA 1M66A 5AOCA 1YDWA 2E4YA 2POQX 2QTCA 3AIKA 5A6SB 1CS4C 3LFHA 1I5OA 1GNTA 5F7XA 4XUDA 3O8RA 1JF8A 2JAHA 3GFPA 1J49A 3A2NA 1O7JA 4NAVA 3UAWA 4DDUA 4EENA 3IGFA 3DBIA 3GT3A 2VUUA 3FJYA 3GDOA 1GZUA 1L4LA 1O94C 2W90A 4WZAE 2PUJA 5LMZA 2XCTB 2O0KA 3CNBA 2ARKA 3ZTYA 4EI7A 1ABBA 2Y1OA 2GTHA 1CX9B 2J48A 2EJVA 3BE4A 3IQIX 1ZITA 1RHMA 2M98A 2NXWA 3KHKA 1H42A 2C83A 5FWXA 4DB4A 1XJQA 4QVIA 2QK4A 2NO9A 2YV3A 4HDRB 3LWBA 1MIOB 3EXFB 3ORQA 2AN3A 4GI7A 5F33A 1Z6YA 5LM3A 4MGIR 2ZSBA 1DJOA 3HKDB 3Q4GA 4XB1A 3CSSA 1FNBA 2WHEA 2FF5A 1LJ8A 3VNRA 5JCJD 5LDDC 1QTIA 1UPAA 1C30A 2VJCA 3E15A 3PIIA 4EECA 2OL4A 3UVEA 1PK8A 3RROA 3HFRA 2GCNA 1UBTS 5FBWB 4AN0A 1U8TA 4J8PA 2DRIA 4DR7B 4RZUA 1R18A 4L5CA 1V16B 4D4GA 4L3OA 2YV2A 4ABTA 4CQLA 2NSYA 2JHAA 2OESA 4NOKA 1PV4A 1HRDA 2B9VA 2ECOA 3CR8A 4BE4A 3WWYA 5K3EA 3NR2A 3IO5A 3F7MA 2CWWA 3FIUA 3QW2A 4HNAA 4MB2A 1KMCA 4JLNA 4OIMA 1P3DA 3ZU6A 4BGDA 4OHVA 2Z8XA 4KPGA 1JDVA 1FP4B 1XRRA 1Z68A 1EUCB 4M0DA 4EZEA 1WO8A 4MMYB 4TYNA 2JIMA 3OP4A 1KI2A 3NBKA 2EBWA 3Q0TA 4IPTA 4MWCA 3VZRA 2NX2A 2A92A 2O1EA 2QM3A 2VJMA 4H18A 2IUTA 2HF2A 1KEWA 3OZAA 4R40A 3P2IA 1TKRA 5DCYA 3IUSA 1JU4A 4W8HA 3RS4A 3BB3A 1FTGA 4I5IA 5TY0A 2ICAA 3IEMA 5ALHA 3B8EA 3FYHA 4R8RA 2QT1A 4G9EA 1ETUA 4EUSA 5IYZB 3L2OB 1IN6A 1IRIA 3N2KA 3GCWA 2YTZA 5CDGA 1RI3A 1TQ6A 2JIQA 2PDAA 3ETNA 2JBHA 3TQFA 1GNLA 2C8LA 1KQPA 4PPGA 1GVNB 2XB9A 1CETA 1GQRA 5HWSA 2ZVQX 2XGJA 13PKA 3WBBA 2GSWA 5K1ZA 2IEGA 4NU5A 4R3UC 1C3VA 4IIJB 2FEKA 3ZKWB 1GPUA 1U3UA 3TNJA 1JP7A 4DNOA 5DHUA 4Z0PA 2ZM6B 1Z6PA 1BMQA 2UYHA 3A11A 5KIAA 1VSTA 2L82A 4US0R 1SN7A 1BX0A 3M4YA 2QRVB 3R8FA 4A5OA 2QX7A 4D92A 4LX0A 4EKGA 4DUYB 5CB6A 4R0MA 1K3FA 1PVDA 2Q9BA 5AW7A 3PL1A 2YFHA 3BWVA 4QFBA 2GEKA 1O5OA 1P1CA 3EA4A 3TW8A 3PRJA 2O3UA 3U4MA 4QGBA 2EKPA 3GEGA 4Y9DA 1UANA 1S01A 2IPAB 1PW7A 1QGUB 3WB0A 3IJEB 5KNCH 3QHPA 3HBJA 3MTJA 1FE8A 2FRXA 2FEPA 4JUIA 4UATA 1QE3A 2DT5A 3BTSA 2WQ6A 1SBYA 1ECFA 3AY7A 1B2LA 3H2BA 1Y9DA 2H4ZA 1SHLA 2I99A 4L6AA 3N2LA 2VYVD 3ES9A 4TKZA 4YUYA 1E79D 3NDIA 3PHIA 3ELYA 3NRCA 3QG5A 2JFVA 2FA9A 2FLVA 2J7KA 4S1TA 1GT91 2B1GA 3RV4A 3TCKA 4EG0A 4PX9A 3K5WA 1SUFA 2W71A 2O0HA 5TB5A 2CV2A 5A9TA 1KIFA 3OT5A 3H86A 1L5NA 1XHLA 2CHFA 2ZBPA 2CNBA 4QGAA 3IH5A 3VR6D 2LW7A 4ARCA 1NXTA 4BY9E 3OZSA 1D1SA 3OQ6A 3EA0A 3COSA 3WNCA 3LXUX 3ZIUA 4BZZA 4PYJA 2CBGA 4UAUA 4HUQB 5E1MA 1L4KA 2ZJBA 1KYYA 5GIOE 5G0WA 1VYUA 4HWKA 5IAJA 4RULA 4LTDA 3VC3A 3RIXA 4ALJA 4YQEA 4Z1OA 4TM7A 1DRJA 1KYVA 4LMPA 1T8WA 3N8HA 4OQXA 1C4XA 3VR6A 4EIWA 4AP5A 1N4DA 3AVVA 2NYVA 1RPJA 3VR3D 2D4AA 1KDYA 4G4SP 3EASA 1NMEA 3IT2A 1QP0A 1AMUA 2FDXA 1NYTA 5CB8A 4YRBA 4DBLE 1G42A 3Q3EA 4FGZA 2NXEA 1XNRB 1NW5A 4KMRA 5K0CA 3QWIA 3I2FA 5KYYB 3IDFA 3BRQA 2UZ4A 2YYYA 3PXBA 1XDWA 3DKKA 2CHGA 4A2PA 3DVQX 4HMPA 1QHHA 4G6ZA 4WA8A 5DIZA 3SR4A 5JBNA 2Z83A 5IP5A 1C0PA 3NLLA 1IFXA 5A5DA 2OT3B 4TKVA 4Q12A 4GBMA 4MR7A 4Y8VA 4BZWA 1GPAA 2RHGB 1L8LA 4U7WA 4BLSA 1W87A 5D3MA 1LSOA 4DAEA 1WDKA 2ZROA 3H5NA 3TSOA 4ZAFA 4RCYA 4DIDA 2IS4A 5AXCA 3ESCA 1K5DA 1SY7A 3SC3A 4EPVA 1H2AS 4TVSA 5JYBA 1DIBA 1IBSA 1C3EA 2PBLA 2QRLA 3E3AA 3MJDA 2X0KA 3RUIA 1INLA 5COAA 3IP9A 2XXJA 3DMPA 2F1HA 3EC1A 3T3HA 1JFRA 3VPSA 8AT1A 1JSRA 2F1OA 4XOUA 3TDMA 3W90A 2BDTA 5BY2A 3AP2A 3QYFA 4Q05A 4U8GA 4MV5A 3G9QA 3RYIA 1SA0B 3KOOA 1A9YA 2AIRA 3L1IA 4RAOA 4UREA 3U3JA 2J6IA 3VQTA 1ORRA 3DH0A 2XQJA 5ALIA 3TLZA 1TZ2A 2FQQA 4LK3A 4B3HA 3V42A 2Q6LA 1PFQA 4R6XA 5EE9A 2EZ4A 3EDYA 4C04A 4QD3A 1KJ8A 2RAUA 4DILA 2ZIXA 4ZVSA 1MO3A 3L7YA 2EARA 3PYXA 3K31A 5CGQB 2WJJA 4FD2A 1H2YA 3ZE6A 1DOAA 1QYWA 2V8BA 1R37A 1VPLA 3TPFA 1YK0A 4DC0A 4RUKA 2FH5B 1THZA 1VL1A 1QCYA 1BEZA 2PGXA 2HDOA 3DBLB 4QIHA 1ZUWA 1T9HA 1W5AA 3IB3A 2B3TA 4QNRA 2IHUA 5IKMA 4C4TA 1ULBA 5HQ3B 4JXXA 4MWDA 1WXHA 1ZK4A 2VDWA 2HIGA 5K0BA 2XB4A 3A2KA 1ZH8A 1U2QA 1WUIS 1H05A 1PNTA 2PNFA 2WG2A 1DUVG 2YWRA 4DJDC 4A6EA 1U7ZA 2QN6A 3KPVA 5LYJF 4N7BA 3A6JA 1NOJA 3DXZA 5BT9A 3HDQA 5JJBA 4X7BA 4TPKA 1CF9A 1Y4SA 4Z8YA 1DTSA 1Q1BA 2ODTX 3NEYA 3R7NA 4MRSA 3QVLA 3VR0A 3KLNA 3VR5D 2D2IA 3PK0A 2QSJA 2GNPA 1OU0A 1WG8A 3BDVA 1GL3A 2BFPA 3A4NA 3I3OA 3OWHA 5AKEA 2PS9A 3RRMA 4LZJA 4YIHA 1IOZA 4J75A 3AO0B 3GJ6A 2NTEA 5ALSA 4JHLA 4YRRA 4AYTA 4RM3A 1RYHA 4YV7A 1KOFA 4BIIA 4GPBA 2FJPA 3DT6A 5EXXA 4NG5A 4E7OA 1T6XA 5LA6F 2BUCA 2IYTA 1GNRA 2AYZA 3I37X 4MUIA 4RHXA 1C9YA 3JQFA 2Q0XA 3O9ZA 1UJ5A 3RK0A 3TW0A 2OFWA 4YI5A 2EGGA 4ITVA 6PFKA 3SQXA 4YMVA 2BEWB 4R0VA 1CTQA 2GAIA 4I0WB 5TS2A 2JLYA 3MBKA 1XTZA 2AOTA 5FTWA 3DWFA 4R05A 1RNLA 3CVWA 1OH6A 1E3EA 4Q4DA 4BS9A 2WG0A 4MS3B 1WRBA 3UEOA 2AVNA 4MYCA 5TC4A 1BYIA 1Z5NA 4WY2A 4BEJA 4HQ0A 2KBEA 1WXGA 3L0IB 2ZTMA 3BPSA 1UODA 2QN7A 1U3VA 2PKQO 3BMNA 5IVIA 3VZBA 2QQFA 1IONA 3FDFA 4X3PA 1IRXA 4LDQA 3L8GA 4MIKA 5L8VA 4E1VA 2QLTA 2A9FA 1UPCA 4Q9AA 2RC5A 1YS1X 4OFBA 5LKAA 2ZXFA 1VJTA 5F5LA 4X1KA 4E15A 5AFSA 4K9NA 3GWGA 3O8QB 4AJKA 4V1CB 1RKQA 1RBMA 2OWDA 3E8SA 2C8KA 1CE8A 3IHTA 3MVEA 3R3JA 1O3YA 1CUHA 5HUQA 2HK9A 1GTMA 1IEWA 1P31A 1Q7BA 1V6AA 3OJ0A 2DJ5A 1TJNA 1KEUA 4R3NA 3C2QA 2VKQA 1R5OA 5DCLA 4K81B 4A82A 4IUDS 3N1UA 3A6ZA 4FHZA 3PDIB 5DYNA 3V2UA 5BV2P 3M70A 1P4JA 3UXMA 4QTYA 3BL5A 1MJHA 2VAVA 5JJIA 1UBOS 5ADUS 3PLAE 4Q82A 5T8KA 2BFNA 3ILVA 4BAGA 3OQIB 1XF1A 3STTA 1G2OA 2EFGA 1N6KA 1NQVA 2IRWA 3JSAA 3H8SA 4FN5A 2B3DA 2VHQA 4DV2B 2P5UA 3KUCA 1FDRA 1WWKA 2WUGA 2OCKA 3U3XA 3FOBA 3K5HA 1TK2A 1KEEA 2Q9AA 1C8BA 2F3UA 3SVZA 4HXYA 1SCJA 1FDTA 3Q5DA 2BGWA 4H7IA 3STXA 1P2DA 3E1GA 3IUEA 1WZIA 3LXXA 3W4JA 3QU9A 3ZIAD 1CUEA 1NDHA 4ESEA 3T5GA 1Z17A 2V65A 3DOIA 4LF7B 4EA8A 4P22A 4L22A 3COYA 4FKMA 2VNHA 4PPNA 1GPNA 2FN7A 1A69A 2JJ1D 1WXDA 3D7MA 3OMLA 1E2IA 1D8TA 1SBZA 3D6FA 3AOEA 3OLZA 4IV8A 4K1XA 4OHCA 5HGXA 3E9ZA 4IZIA 2DULA 4DSOA 1ITZA 1F3OA 1UQTA 1DIGA 1Z2DA 2RIPA 3JYPA 1O58A 1NG1A 4D26A 3X1YA 2QRMA 4MYSA 1CY8A 2FWJA 2FQ1A 2JK0A 1FDWA 2VHYA 1R0YA 3GBPA 2GCIA 3E18A 3Q11A 1WZEA 5GMOA 3N87A 4MA0A 4MP8A 4ZKDA 2H8KA 2P5YA 2LV8A 2R86A 3BGWA 4M99A 3KFXA 2P2ZA 3QU2A 1N8TA 2EP8A 4TS4A 4DR5B 1FPMA 3FVTA 3PJFA 5JWRA 2B83A 2XVXA 1L4NA 3M6AA 2WB2A 1NXSA 2GZAA 1NG9A 3HXKA 4QLAA 5NULA 3U5ZB 4TL7A 3DEJA 3HVRA 3OUTA 4TZTA 2WZCA 3B89A 3QE2A 4Z4CA 1W0CA 4HX2A 1HFEL 4CKYA 4P4SB 3RSZA 1Z75A 4LFAB 4QPNA 5FCDA 5BSFA 3DXXA 2IHVA 3H04A 4LQ4A 3WGZA 3JR7A 3JALA 2QQ0A 3GAMA 1MJFA 4GBGA 3GPCA 2XE7A 2XR1A 3E7DA 3THYA 2WJPA 1YS4A 3I76A 4G89A 3N75A 3ZCPA 5FTJA 4QQRA 4WBSA 2O7NA 1IJEA 4TXNA 1G7SA 1RWBA 1SVWA 3O2NA 4EH1A 4DCNA 3WX0A 4TL9A 1GU7A 2FSGA 3GGSA 1JSLA 4BLTA 3GFOA 2ODQA 1ECJA 2FR0A 4MEAA 1DBPA 3R40A 3RS9A 1BHSA 4MAMA 3DYIA 1VKOA 1GDDA 3L1HA 3V4VB 4P32A 3M3PA 3OAAA 2EVWX 4JLOA 4DQXA 1OWOA 2DHCA 2HRBA 2H4XA 3LXMA 3DMTA 4C22A 2JPDA 1O0SA 5ES3A 4TLLB 5ER6A 1EG2A 2Q4BA 4RYDA 4ZPJA 1EK1A 1P1KA 1V95A 1N2HA 4FYYA 2CJXA 5AH0A 5EE5B 4EZBA 2IEBA 5AESA 1QO0A 5B30A 5FOQA 1C1DA 3FB1A 4X5OA 2CMHA 1IN4A 2QXYA 4G4JA 1KSFX 1P75A 1B41A 3EFOB 1HT1E 4ZOBA 4JI1B 3TI7A 1JXQA 1WY7A 3AGQA 4Z9XA 3WYAA 4CI9A 2W6MA 4RH1A 3TKAA 4TVKA 3INRA 3JQAB 3O21A 2X22A 1ESNA 1K4KA 2JEYA 3NNDA 4EVRA 5B4VA 3M5WA 4PZDA 5K2OA 3K2IA 4OF4A 1QZUA 6ABPA 2H5IA 2YV1A 3CZ9A 5HOQA 5EJ2A 1A7UA 2XMDA 5HIJA 3ZUPA 1UJBA 2QRUA 3EXFA 1Y33E 1JJBA 1MLDA 1N9GB 2VJBA 1YF3A 1JQKA 4ZPXA 2HL6A 1E9AA 1IXZA 1R5NA 3D4LA 3M3DA 1BFKA 3C87A 3IR6A 3PGA1 1F60A 3T4PA 1U8EA 1KI7A 2I2BA 3GG9A 3IMGA 2DR0A 3MTEA 4RCZA 4RWEA 2ZOSA 5YASA 2JG3A 5A2GA 5MN5A 1RAAA 2VKTA 4GVXA 1IDN1 2PMFA 1T9AA 3CGGA 2B99A 4FDVA 5KVSA 1KP9A 4V0MA 1U7TA 2BKAA 2JFXA 3NW9A 1VJRA 3DZDA 2LIPA 3KVVA 1EGAA 3DLPX 3CKLA 2QYSA 2R9VA 1V16A 1UKYA 4NJMA 3AHJA 2F1KA 5ANRB 3UFBA 1RRFA 4DRZA 2YYZA 3IYLW 3QENA 3WV5A 3N0XA 4UOQA 3PBKA 5TQ2B 3O1IC 4AX4A 1BS1A 1PG2A 1JYEA 3MGBA 1QONA 4G1EB 1N7HA 1RWMA 4TS1A 2EU8A 3JAKB 5I9MA 5AK5A 4BFVA 3NKFA 4PFQA 1GGHA 1TB4A 2QL6A 2BKLA 1EK5A 2VPPA 1EUCA 4MMZB 5E1DA 4UTNA 3ZIDA 1USUA 2IU0A 2R6JA 2AG0A 1Q1GA 2WD7B 1ONBA 2IXGA 3F6RA 1DFIA 3HUUA 1YKSA 2DUJA 3NNSA 4KXLA 5J2TA 3PP8A 5TVKA 1R5BA 1JBQA 4BV2A 1TVCA 1KZ1A 1LRJA 4ENRA 1WX1A 1VYTA 2QMHA 2Z3ZA 4IF4A 3ZI0A 3A6HA 4CIVA 3JRWA 2VRNA 3U3MA 1COZA 1NJ1A 2Q3JA 3MEQA 1ZDMA 5SZHB 3H17A 3GRZA 4YRTA 3EGWA 1NUQA 2H7XA 5BWNA 4HNSA 1JNYA 1S2LA 3LH5A 3PDJA 4NCHA 1HPLA 1BFDA 3C24A 3B1ZA 4NICA 3GRKA 5F4ZA 3JYLA 4L95C 1R1DA 2GK6A 1BROA 3AEKA 4Z99A 4Q39A 3ZH9B 5LOVF 3UMYA 3EPRA 4P7BA 4YTEA 2P40A 5KYTA 3ZKWA 1EFVB 3GIWA 3L6UA 4QL3A 1H9AA 4G1FA 2D0IA 2UZIR 2IPNA 5DSXA 1E96A 1LBSA 4URZR 3CLRD 2QRVA 2X0EA 4ZAYA 5GGYA 2REOA 4OQYA 4XWKA 2XRMA 4TS3A 5H3CA 2VTVA 2Z4RA 3LOUA 1HL3A 1WD7A 3MMXA 4M7WA 1ACMA 4NNJA 4ZI5A 4RSHA 1YL5A 4HV4A 1ZS9A 1SCNE 2CXRA 1ISSA 3BB4A 4FWTA 1H1TA 3DL7A 2PLRA 2WIDA 4BQOA 4ER7A 2XCSB 3G0CA 1U5CA 2B8TA 3HKBA 3OM9A 3QMVA 4RA6B 3TTTA 4ZZ0A 3VM6A 3AF4A 4TYQA 1T9CA 2CXHA 1YQDA 2NVUB 4XD2A 2IHBA 3ACBA 2MDTA 1JWLA 1ESZA 1CNFA 1QSGA 4QO8A 4QOEA 4KMOA 5GPBA 3D5EA 5HZMA 4WZAB 3UQZA 1TZKA 1KDVA 1U2PA 5IT4A 1MUUA 2LPMA 5HF5A 3I2KA 1TMKA 1R66A 2RCYA 4FMDF 1XAJA 1KORA 1RJWA 3FFBA 3GJQA 3X2SA 3D6AA 1U2RA 2A5GA 4F3RA 1ID8A 3BDIA 2O19A 1QV9A 4OYLA 5DBFA 2RAFA 3JAWB 1N3BA 4AQ7A 2H5EA 4Z7JA 3OICA 2OKGA 3LXRA 1BD4A 1JA0A 3CEJA 4EHBA 2XITA 5DOZA 3E9RA 4MZXA 2PRJA 3WIBA 4TLCA 3COJA 1ATZA 5JXIA 4R2JA 1A5BB 1JQJC 4QFDA 3HK2A 2NZ2A 3GQVA 4H35A 1E9EA 4KE9A 5E7JA 4FMBB 4PGMA 3VMMA 1EWVA 1J1UA 1Z4MA 2IXBA 2CK3D 5C2JB 2Y1LA 5G3ZA 2G08A 1G8JA 1U04A 3F0TA 1I2BA 3IP3A 4IIVA 4DMKA 4UM9B 2OHFA 4YX9A 5CK4A 5MF6A 4W1SA 4EGCB 1DHTA 2IYNA 1Z0IA 5CB4F 2IVZA 3AHFA 3O4GA 4UHEA 2D54A 3KPYA 3KZXA 2UXBB 2WWXA 4LK2A 1RACA 3LTEA 4KQ6A 4DG9A 2ODWA 3NOXA 2PWAA 1OC2A 2JVIA 3KOYA 2PGNA 3NOOA 4D1YA 3WLEA 2B4YA 3A4LA 2HHLA 4F5YA 1WMSA 4LZOA 3ZY2A 4BO5A 1YIDA 4OK3A 5JD4A 4JEHA 4YGYA 1YDGA 1RJGA 1OH8A 2QAGA 4FLFA 3GLHB 1RYBA 4ZC8A 1KMIY 1HE3A 5CT8A 3V8QA 4ENPA 2NXCA 2J9YB 2YW9A 2VR1A 3MRXA 2PA3A 4OFWA 4R68A 4TKLA 4O3MA 1SC4A 2DPXA 3HV2A 1E59A 3LI2A 3FZEA 4JLAA 5JPCA 3HKEB 1XLTA 1SXGA 3NHWA 3JZDA 1XXHE 3RJZA 2HO4A 4IOLA 5JD6A 4X7PA 4HN2A 5E2IA 4U00A 4O5AA 3ZCXA 2R4TA 2XSZA 4CQMB 1AOXA 1E0SA 2Z5FA 4MUHA 2FZLA 2ZR8A 4J2HA 4V24A 1RHUA 3DO6A 4YRQA 3EC2A 1JHOA 4L76A 1SPXA 1MC8A 1XP5A 3FWHA 3WA7A 3TNYA 1YIAA 3T94A 3M6VA 1SD1A 5FBLB 2QAJA 5CNIA 4DLBA 2PWZA 3E7WA 5BSVA 3HI4A 1UK6A 2WWYA 1RLIA 1VG0B 5JQGB 1JKJB 2J7PD 2OG2A 1BWPA 2IW3A 3FE2A 1YS2X 3TS1A 4MW4A 1RLMA 1A0OA 1VBKA 4L0QA 1Z0SA 4QXAA 2WJIA 1FFAA 4HC4A 4ZI7F 3MGKA 3DBLA 1A7AA 5JHGB 5F1OA 4IKOA 1X0VA 3GLSA 1AGPA 1PU2A 2F8MA 2ZYDA 1N2JA 5TX7A 4ZMSA 1JEYA 3ZGZA 5JNTA 5BV8A 3U37A 5HQ3A 3RR2A 4F12A 1V7ZA 4HR7A 4PS0A 4XEHA 3SHQA 1EX1A 1XTTA 2WRZA 2YN2A 4M1QA 5J59A 1JZSA 2Y1FA 4UOEA 1V9SA 1FUUA 4AU1A 3NHKA 1D7AA 5TGTA 1NBWB 2QVCA 5JW6A 1SXJC 3VPFA 2WOOA 1NVEA 2JI7A 4X20B 3SZ3A 1XMJA 4D43A 4PPFA 4I1PA 2UKDA 4HFNA 4PGHA 1UBMS 2A9JA 2H4HA 2WWRA 5I51A 3R9XB 2OCAA 3ZJ4A 1YH3A 2AMYA 2F6RA 4M1EA 4PPQA 4OUDB 5DN6A 2YQ4A 4AO6A 5FXMA 4OMUA 2PS1A 4YN3A 4G1BA 3NJRA 3TW6A 2OHVA 2EYUA 2WFMA 1IJKA 4UE6A 1TT5A 3JQCA 2G9QA 5HZKA 2M6RA 3WGGA 4WJLA 1E2DA 1L4GA 3AFGA 3AP3A 3MJVA 4LRQA 1UDRA 5KNDD 1NVMB 2HK7A 3OU6A 3FRJA 3QEOA 1BKDR 4MW9A 4HAYA 4NV1A 3JQQA 1MN6A 2V4MA 3OPYA 1SM4A 2C4VA 4BBPA 3QPUA 3UBTA 4QDXA 4G1CA 1PSDA 3H11A 4GPTA 1GPJA 1Q5PA 4RIEA 5JRZA 1GDTA 1FFBA 4H3SA 4O63O 3G17A 2DECA 4LGMA 1KZ7B 5J5VA 1Y5NA 3I1IA 3USES 5C1BA 2WUEA 1BVHA 2Q4OA 1XYGA 4MS3A 4RESA 2OECA 3UIEA 3IE0A 1E1CB 1ZD3A 2BHNA 2CXTA 3I01M 3T9DA 2XA9A 2Y0CA 4WESA 2BAGA 3G8AA 4ZJYA 4NZZA 1BE0A 5CLJA 2AMFA 2V03A 2ZZMA 3IKTA 1L8AA 2PU5A 2GYWA 3F47A 3A4IA 4RXMA 3ICWA 1IVNA 4KYIB 5FBZA 4AG3A 1C8KA 1QQ7A 3NTVA 4CIAA 1MO6A 3R0ZA 4PM4A 4V1CA 1MRZA 2GCEA 1MC4A 1J06A 2ZIVB 3WISA 4JLVA 2L18A 2BEVA 2J9ZB 4IFTA 5BVHB