3LLCA

Crystal structure of putative hydrolase (yp_002548124.1) from agrobacterium vitis s4 at 1.80 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
261
structure length
261
Chain Sequence
RPIETHAITVGQGSDARSIAALVRAPAQDERPTCIWLGGYRSDMTGTKALEMDDLAASLGVGAIRFDYSGHGASGGAFRDGTISRWLEEALAVLDHFKPEKAILVGSSMGGWIALRLIQELKARHDNPTQVSGMVLIAPAPDFTSDLIEPLLGDRERAELAENGYFEEVSEYSPEPNIFTRALMEDGRANRVMAGMIDTGCPVHILQGMADPDVPYQHALKLVEHLPADDVVLTLVRDGDHRLSRPQDIDRMRNAIRAMIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
publication title Crystal structure of Putative hydrolase (YP_002548124.1) from Agrobacterium vitis S4 at 1.80 A resolution
rcsb
source organism Agrobacterium vitis
molecule tags Hydrolase
total genus 81
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3llcA00
1QIMA 1N5MA 2I03A 4B9AA 5ALQA 4BVLA 3L1JA 1VKHA 4QA9A 4LIPD 5CT5A 4Y7DA 1XZGA 5T4EA 1QLWA 4J03A 2XUGA 4FOLA 2QRUA 4H7FA 3D2AA 4H77A 2RHTA 1MU0A 4F21A 1VZ2A 1XZHA 1CV2A 5BOVA 4CFSA 4H7JA 3WL5A 5JATA 3GROA 3C45A 4QDZA 2WILA 2WHPA 3NUZA 1CUJA 3ZLTA 5JIBA 1AMNA 2V98A 4LYEA 5CTAA 4DMKA 3E3AA 4S0XA 5ALPA 4CCYA 3UUEA 2HA0A 5FP0A 4BP9A 1X2EA 5BV7A 2J3QA 1ORWA 1YS1X 4X7BA 3DKKA 4BAZA 5DWDA 4X90A 4M0FA 3VKFA 1MPXA 3HXKA 3DDUA 4OB6A 3LCRA 2WG1A 3AFIA 1XQXA 3BE8A 3G02A 4C4XA 2PPLA 1HPLA 2VA9A 1TKRA 3VISA 5ALHA 1CUBA 5A7HA 5AM0A 5JZSA 4ZRDA 4UHFA 3WKCA 1H23A 5IVDA 3R3WA 1LBTA 4L0CA 2ACKA 2GBFA 4BTLA 2Z3ZA 1AQLA 3ESAA 4FNMA 3I28A 3IUNA 2XMZA 1FFBA 3S2ZA 1MNQA 4C4ZA 5E4JA 5EHXA 3WK5A 4CIAA 4MYSA 5JZBA 2WUFA 4HXEB 2XQIA 2HL6A 2WUEA 4MQLA 5AKXA 5ISMA 2PSFA 4Q1VA 5D6OA 3OC0A 5CBKA 4K5QA 4JYMA 4U2EA 4B80A 1XZDA 1CUIA 2RI6A 2Z8ZA 1E5TA 1PFQA 1B6GA 1AZWA 4UUQA 3C70A 3C6BA 2ZJ6A 4FFWA 5K3FA 3EQ7A 1NU6A 4OYLA 1CQWA 3JW8A 1CIJA 1HDEA 5A6VA 2WKWA 4HXFB 5AP9A 4RE6A 1SCIA 5CT9A 5EHZA 1TCAA 4HVTA 3LIPA 1BN6A 1ZD5A 1Q0ZA 2ZSIA 1ETHA 2HA7A 1O6FA 3C5WP 2XUAA 2ECFA 2QUAA 2WG2A 3G0BA 2VJCA 3WK8A 1E8MA 1MX1A 4B0OA 3FVTA 2ONCA 5AJHA 2ZJFA 4P9NA 1VA5A 3C87A 4H7KA 3I2HA 3WMRA 2JGKA 1EDBA 3U1TA 4EB0A 5LP1A 5ALXA 3CN9A 1LLFA 3DYIA 2WIJA 1MX5A 2HU5A 4ZREA 2I78A 3W05A 1SCKA 1LGYA 3LP5A 1YA4A 1XRPA 3IA2A 2HHAA 5E4TA 1RP1A 5F4ZA 1ZICA 5KREA 1YASA 3GA7A 2BKLA 2P8SA 1CUUA 4B0PA 1XQWA 2UZ0A 4AZ0A 1LPBB 2WHRA 4BVKA 5BWBA 3MGAA 1AURA 1BROA 3DOIA 4WDRA 1QFMA 5HF8A 5AK5A 3A6ZA 4OB8A 2C58A 2XMGA 3PFCA 5H3HA 3HABA 3O9MA 1XQVA 4GI1A 1EH5A 1XKTA 1AC5A 2VAVA 3H04A 3H2IA 1XZKA 2OQVA 1ODCA 3HRHA 3K2IA 4OPMA 2LIPA 2G63A 4OCZA 4UFOA 3N2ZB 1LBSA 2EEPA 1UZAA 2YXPX 5SYMA 4BP8A 2I3DA 5CH3A 1K5PA 4MYDA 4LHEA 5LIPA 4QZVA 3DYVA 4G9EA 4U2BA 4DMFA 1FFEA 5ALKA 1EB9A 2PSJA 2H7XA 1M33A 2QOEA 2VTVA 4Y2VA 2RHWA 4UHHA 3SX4A 3DQZA 4OU5A 2CMFA 3CXUA 1EA5A 5FUMA 4P93A 4BRZA 4AMYA 1BCRA 2V97A 2GBGA 4F60A 4J3JA 3CCCA 2WFLB 2AJCA 4DNFA 1UK8A 2ACEA 5A62A 2YH2A 4KRYA 4W63A 3AILA 1JI3A 5YASA 5AICA 1DQZA 4BCBA 4FNGA 1ORVA 2OCLA 4D9JA 3WZLA 5AKJA 1WB4A 1TQHA 3WYDA 5ALZA 3G8YA 5JD5A 4UHBA 4CG2A 4BATA 4AQDA 5AOCA 4LXIA 2HA3A 4WFJA 3T4UA 3STUA 5CRIA 4BAGA 1ZIXA 2OCKA 1ZI8A 3FAKA 5LKRA 4RE5A 4DIUA 1EXWA 2PSHA 4QNNA 3WYNA 4QDTA 5FPQA 1LNSA 2CZQA 2RONA 5CXXA 4AN0A 3L1IA 2VJDA 3H2HA 2JGIA 4MEBA 4Q34A 2JBWA 3WWDA 1YSCA 3QBJA 4EHBA 3IB3A 2O2GA 5DYTA 3R41A 3I2FA 4J0DA 4W1RA 5CH5A 4J0KA 2JEZA 4MEAA 3MVEA 3UUFA 4J7AA 2XUFA 1RYYA 5K3FB 1UWCA 3IBTA 2G5PA 1ZGBA 2WTNA 4UBNA 3FNBA 5AK6A 3WKBA 3HI4A 1G5FA 4M0MA 1EX9A 3F67A 2XMQA 3M82A 2OGTA 1JJBA 4KE6A 5LZ4A 1EDEA 3DLTA 1EINA 2GZRA 1C7JA 1BN7A 1XRLA 3NWOA 3B3QA 1BU8A 2B4KA 3ESBA 4YX9A 2PUJA 1K4YA 3QYJA 1QIHA 3PUIA 3ILSA 3KXPA 3BF7A 2XUDA 4HXGA 1J1IA 4DTCA 3D2CA 2GBCA 3G9UA 3V48A 2XLCA 3I6ZA 1NU8A 1Q0RA 1JMKC 4WJLA 3V1KA 1N8SA 1TCCA 4PF1A 3FLBA 4KACA 5AM5A 3H2KA 2OGSA 2JGEA 5SYNA 1H22A 1VXRA 3G0CA 4DMCA 4B7ZA 4G8DA 2XUJA 1HBJA 1J2EA 1H2YA 2QMQA 1CUXA 2GZSA 4DNOA 1JFRA 3BDIA 3UMJA 4H7DA 2OXEA 3D5EA 4HS9A 1T2NA 2DQYA 4YASA 2Y6UA 5DYYA 2C7BA 4U2GA 5AIAA 2XB6A 2QT9A 2AXEA 2PU5A 1RWQA 5K3DA 3VVLA 4MWTA 2BUBA 5ALIA 5ALDA 1PV1A 5K3EA 1DT5A 3A2NA 5AKHA 5AIBA 1ZIYA 3WK7A 4AN1A 3QITA 5CXUA 4H18A 3IIIA 3R3YA 2WIDA 2C4HA 4GW3A 2HA6A 1DWOA 1XKLA 4GDMA 2B20A 2XE4A 5LZ9A 1Y7IA 2J4CA 5ALEA 4OD0A 4EZIA 3WL6A 3C6YA 1TIBA 2HU8A 2HA2A 4WY5A 2ES4A 3ESCA 3Q0TA 2WU3A 1F0NA 2HDWA 5JALA 4UBMA 1A8QA 1KU6A 3H19A 5A71A 4EUSA 3M81A 3STXA 2HIHA 1U8EA 4UFPA 5DTJA 3STYA 4QLAA 5ALUA 4E14A 1F8UA 1WB6A 4WDQA 3BWXA 3H17A 1WHSA 4EY8A 4EY7A 4KEAA 1CUGA 1E8NA 5HKAA 4ZXFA 1QJ4A 3V1MA 4LXGA 1EK1A 3EF3A 4B9EA 4CIBA 3E4DA 1FFCA 4KYVA 2HRQA 4PSDA 5C7YA 2BAGA 1VE7A 3QH4A 4AO6A 3HJUA 3I6YA 2O2HA 1QIEA 2VSQA 1LPOA 4FFVA 4IH4A 1J07A 4AO8A 2H7YA 3FYUA 4Y2SA 2RAUA 3V1LA 2X5XA 1ZGCA 5AI4A 4W1QA 4X6UA 2AJ8A 3W9UA 3QVMA 1MJ5A 2K2QB 4HRXA 5AOBA 3AIOA 3O4GA 2WJ4A 1SC9A 3ICWA 1CUYA 1G66A 1XZFA 2ZYSA 4H7EA 4FBLA 3H1AA 5J3JA 4F5ZA 5JAHA 3QMVA 4W1SA 2YASA 2CBGA 5AKLA 1QIIA 5HCUA 3T52A 4Y2UA 1R9NA 1CRLA 5AK3A 2B61A 3GUUA 2HADA 4BVJA 4U2CA 3KD2A 4G5XA 1MNAA 1FFAA 3GZJA 4EY4A 1NX9A 1ZJ5A 4Q82A 1QE3A 1CUHA 2CB9A 4BCCA 4YK7A 1HKHA 5JYCA 1WCYA 1VXOA 2FUKA 1FFDA 4G8CA 4G4IA 2FX5A 3D7RA 3G0GA 4IH9A 1VJ5A 1JU4A 4BYMA 5DNWA 4DSZA 4Q3OA 2OCGA 2X76A 1QIKA 3A70A 5AK4A 2CKMA 3AINA 4BC0A 5C8VA 3D0KA 3WL8A 3AJAA 4HTAA 4MWSA 3WKEA 5DNUA 2C5FA 2OGZA 5AKEA 5LYYA 5KWJA 5DTIA 2W6CX 4PO3X 2IX9A 2BUCA 2WFZA 3X3HA 1U4NA 2QM0A 1GZ7A 2AJBA 2VEOA 3W2TA 4QLOA 5AM1A 3V9AA 1WB5A 4KAJA 3A2MA 3EQ9A 3K6KA 3O0DA 4MXDA 2Y2UA 3OTQA 3HYSA 1VLQA 3W9BA 4GLBA 1R3DA 3BIXA 1DWQA 2HFKA 1J06A 2JEYA 1XZEA 2DSNA 5FRDA 3G7NA 4UBLA 5JD4A 2PSEA 5EFZA 1CUWA 4JYPA 1IZ8A 2GBIA 5AKZA 1TAHA 3YASA 3K9BA 1CUAA 3GELA 1ACJA 4B83A 1LPNA 4DSAA 3LS2A 5LKAA 2XMBA 3F8SA 4X97A 4XJVA 1N5RA 5ALMA 2QKYA 5LZ8A 3IUMA 4WCVA 5ALLA 2XQFA 2RIPA 3Q8WA 3QPAA 2VJBA 5IVHA 1Y37A 2XUQA 3PE6A 2QXUA 1YR2A 2ZJ7A 3OOSA 3QPCA 3W04A 4GWLA 5C81A 4X94A 1GPLA 1EHYA 1W1IA 3WJ1A 2VAXA 1U2EA 3H2JA 4DM7A 2IIVA 2QUBA 2XUOA 1MN6A 3WKDA 3H18A 4Q3LA 5JAUA 4AB1A 1QIJA 4INZA 2OQIA 2QJRA 1DTEA 5D7BA 4PV7A 6YASA 4BB0A 1KU0A 3AZOA 3O4IA 4ETWA 1LPAB 4TVKA 1SOMA 2YYSA 1R1DA 4IQ4A 3C5VA 3F96A 4UBJA 4J0JA 1CR6A 2BCEA 4H0CA 4DYHA 5CT6A 2PM8A 5T4FA 3STVA 1X2BA 3C6ZA 4J0CA 2ZYRA 1LPMA 1CUFA 1QTRA 3SK0A 4X91A 2QJWA 1IMJA 4B84A 4JNCA 2ORYA 3E0XA 2WHPB 1JT2A 3R40A 4UBIA 1TRHA 2PL5A 1YAJA 4C4YA 4CCYB 5LLSA 3IULA 4GHWA 1CUSA 1W4LA 3BIWA 1QGED 2OAGA 3AUKA 3S8YA 3O9VA 2B9VA 1R9MA 4P92A 5CT8A 1R4ZA 5FDFA 1QO7A 1XRRA 4GECA 2PSDA 1F0PA 3BDVA 3DEAA 4L9AA 5DLPA 4Y2TA 3VVMA 1DU4A 2XLBA 5HK8A 4UHEA 2OG1A 3FBWA 3WA6A 3L1HA 2AJDA 3EQ8A 3TEJA 4BC1A 2FJPA 2WIFA 5AM4A 4H7HA 4IO0A 4QDOA 4MJ3A 1CFJA 4TPKA 2WLSA 1S8OA 1P0IA 3DCNA 3I2IA 1DQYA 1MTZA 4ZWNA 1FSSA 3H0CA 1THTA 4FDMA 1OILA 1AX9A 4EY5A 4KE9A 3ZI7A 5EHQA 2D0DA 4J0IA 1L7RA 5IH7A 2W22A 1E66A 1EI9A 2WIGA 4I3FA 1QIGA 1P0PA 1VZ3A 4J0GA 1YB6A 1C4XA 4X71A 1XRNA 3I2JA 2QS9A 3QM1A 1MAHA 4BRSA 2VQ6A 5AKIA 2OCIA 3OPMA 1THGA 1E8DA 4OU4A 3A2LA 3RM3A 2VATA 1EK2A 3KOOA 4UFNA 5ALOA 4IHAA 4G1FA 3QMWA 2G5TA 3O4HA 2GYVA 2GYUA 5BWCA 3R3XA 4B6GA 4UBKA 2EDCA 2XI4A 4QEKA 2NW6A 4OB7A 1XROA 3HLKA 4QWWA 1JJIA 2HU7A 3DKRA 3V1NA 1ZI9A 2WU4A 1A88A 5JAPA 1ZJ4A 3HC7A 3VXKA 3CN7A 3G9TA 5JAOA 3I2KA 3JWEA 5EIHA 4FLMA 4Q05A 1ODTC 5LZ5A 4EA6A 4XIIA 4DNQA 1XLUA 2O7VA 3C8DA 3BJMA 2GYWA 2WM2A 1JU3A 5ALFA 4MQMA 3ICVA 4Y2JA 5AI5A 3RLIA 2WJ6A 3IDAA 1GKKA 2C5GA 1ISPA 5EIAA 3STTA 1BCSA 1CUEA 1TK3A 4BBZA 1K8QA 3C8HA 3IUQA 1MO2A 4E46A 2R11A 4UHDA 5AI8A 3WK6A 4N8EA 5CT4A 1WHTA 4X3CA 1DINA 2XUHA 4E15A 1GQRA 3TJMA 2Y6VA 1QO9A 3VJLA 2XUIA 5AKYA 5HZGA 1CLEA 1WM1A 3WLAA 2VT6A 1DX6A 4BDSA 3DL4A 1YS2X 3KDAA 1IUPA 4LKOA 1UXOA 3D2BA 4X95A 2ZSHA 2HA5A 3OG9A 1OXMA 3BF8A 2CJPA 5ALJA 2DHDA 3FCYA 4IH1A 2VT7A 1YAHA 2XQGA 1ODSA 1UKAA 2DFPA 2QTBA 1UOOA 3RK4A 4G4GA 3FVRA 4AMZA 1AKNA 2PX6A 3WWCA 1XZBA 3N0TA 3IURA 4X00A 3G0IA 5ALNA 2VJAA 1GKLA 2WG0A 4K6GA 2H1IA 2PU7A 3DS8A 5C8XA 2C0PA 4OYYA 5I8PA 5AM3A 3PI6A 2O7RA 1CUDA 5HFNA 4AO7A 3EIOA 5FOQA 1GPNA 1P0MA 4ZV7A 1K63A 4KRXA 1G42A 1QZ3A 1EB8A 3FSGD 3WK9A 1L7QA 3WIBA 5K3AA 4W9RA 2XMSA 4X6YA 2DQZA 1I6WA 1BS9A 1GXSA 3TGLA 4X6XA 5E4YA 4FTWA 3BJRA 1W52X 1R50A 4GEGA 3AZQA 4UPDA 3D59A 2DHEA 4X93A 4C01A 4CI9A 4BCDA 3PDCA 2XMDA 4QDUA 1ZOIA 3F97A 4BZZA 3RKSA 2WFLA 2WUDA 4B81A 3OURA 2CUTA 4KJXA 5JD6A 2R8BA 1YA8A 5CH8A 4M0EA 4U2DA 1CUVA 3DNMA 4BZWA 1XLWA 1AGYA 3IUJA 3AIKA 1GGVA 2D5LA 4BAUA 2Z8XA 2BUAA 4DNPA 1B41A 4OUKX 4Y9SA 2EDAA 3RARA 5DNVA 1D07A 1HQDA 4I4CA 4ARAA 1GT6A 5ALWA 4N5IX 1MAAA 1A8SA 1UOQA 4FMPA 1IZ7A 4QWMA 5ALSA 5HF5A 4U2FA 1KEZA 3CCBA 3WZMA 2PKYX 3QPDA 5ALGA 2WFMA 5AKGA 1USWA 4FKBA 1UOPA 3ESDA 2HRRA 4JUIA 1MX9A 5ALVA 2IITA 1CUCA 3ZV7A 3AZPA 5ALTA 1O6GA 1UFOA 5IVKA 2JGMA 3P2MA 2QXTA 1GPKA 5HKBA 5EHNA 3U0VA 2Y2VA 1XZMA 1FJ2A 5D3KA 4E11A 1DWPA 3I1IA 3VDXA 4C89A 1CVLA 1G4HA 5I7UA 1LPPA 2OPHA 4A16A 5ALRA 4G8BA 4A23A 3KWJA 2HM7A 7YASA 4KE7A 4UBOA 4L72A 4HRYA 4C6HA 5ALYA 5LZ2A 3WK4A 2H9YA 4Y2PA 1UKCA 3G0DA 3B12A 4ROTA 4NS4A 4WFKA 1LZKA 2WUGA 1LPSA 3STWA 1CPYA 3LIIA 3PFBA 1E3QA 2WTMA 2C0QA 3WIOA 3QMMA 3C6XA 2RGUA 3E1GA 1XZCA 1ZD2P 4C88A 3WKAA 4LXHA 1X70A 3WQHA 3W06A 4G4JA 2CEKA 1C7IA 4KE8A 2E3JA 3QZUA 3ZPXA 4ZGBA 1YCDA 5AHXA 4OSEA 4FLEA 3R3UA 4Y2XA 4RPCA 5FKJA 2DR0A 2XMRA 1HLGA 4FLFA 3OM8A 5IKXA 3WJ2A 1A7UA 5K3CA 4UHCA 3D3NA 5JASA 1Q84A 5AH0A 1UKBA 3DD5A 2PVSA 4QE3A 2QVBA 4K2AA 2BGNA 4PSCA 4EBBA 3R0VA 4Y2QA 5CW2A 4B85A 4FBMA 3LLCA 5AM2A 4WFIA 5JADA 5FPPA 1OCEA 3G9ZA 4L3WA 3WA7A 4BTVA 3DJYA 4KAAA 4NVRA 5DYWA 3NOXA 5T4HA 3WWEA 5HQ3A 1JKMA 4Y2RA 5A7FA 1LZLA 4Q3KA 3TRDA 1XQYA 3FLAA 4BE9A 1CEXA 1XZAA 1H2WA 3I6MA 4NZZA 5IVIA 4O08A 5HFAA 1BEZA 1BE0A 5T4BA 4HZGA 5DJ5A 2WIKA 2Z3WA 5JANA 1YB7A 3ZLVA 1VA4A 5FXMA 1U65A 1MT3A 1ZD3A 3BXPA 5AOAA 4K6KA 5LZ7A 3FYUB 1ZI6A 3KWFA 2QR5A 4P08A 3PF9A 5K5EA 5D3ZA 1TCBA 4AXBA 2FJ0A 2V96A 1XFDA 3FWHA 4DGQA 1VE6A 1DX4A 5FV4A 4EY6A 2JGJA 4H35A 2OAEA 3FCXA 3FYTA 4CG3A 4XWGA 3GFFA 2DHCA 3NGMA 1AUOA 4F0JA 4PSUA 4CG1A 4GXNA 2X8BA 1EVEA 2J4FA 3ANTA 1UK9A 1XLVA 1Z68A 3KSRA 1BRTA 3M3DA 1HL7A 4WY8A 3B5EA 2H7CA 2JIDA 1XRQA 1CUZA 2OLEA 1E89A 1GQSA 2BFNA 1QTIA 3BL8A 2ZVDA 1F6WA 5K3BA 5JARA 4QDXA 2PBLA 4GBGA 3HEAA 4FWBA 3D4LA 3H2GA 3GBSA 1JJFA 3O95A 2HA4A 4YPVA 3VJMA 4AZ3A 3WWOA 1Q83A 3R3ZA 5I9IA 2WSLA 1XZJA 4XX1A 2HFJA 2VF2A 3ZWQA 5C8ZA 1R88A 4H7IA 4PW0A 2J3DA 2ZYIA 1ACLA 5AKKA 3IVMA 4PQEA 3PF8A 3SC2A 3C43A 1SCQA 5AI6A 2QZPA 4RGYA 4B82A 3FLEA 3HACA 1IUOA 1QIFA 5HF9A 3WWPA 3WL7A 4DMHA 1L7AA 2JGLA 4ZI5A 2JF0A 1IVYA 3PICA 1WPXA 4X92A 4N8SA 5E2IA 1WPRA 4RNCA 5FLKA 5AI0A 4ITVA 1CQZA 4N8DA 2XDWA 5HF6A 1UK6A 2XT0A 1ZD4A 3I2GA 1A8UA 2JGFA 1JMYA 4BE4A 3ED1A 2Z5GA 3MUOA 1XRMA 1SFRA 2WJ3A 5JZ9A 1H2XA 2XUPA 4J0HA 4X85A 4K6HA 3ZLUA 4C87A 4TGLA 3FYUC 5EIEA 3JYHA 2I3ZA 2AJLI 1DT3A 3EBLA 5KWIA 4A5SA 1UT6A 5AO9A 2XMCA 2PUHA 1BEEA 4Y2YA 3DL7A 3PUHA 4KR0A 4CCWA 3HZOA 3VJKA 5CMLA 5A2GA 2V9ZA 3R3VA 2WQZA 2O2IA 3H1BA 1QIDA 5A7GA 2DCMA 4ZV9A 4DLNA 1P0QA 1EDDA 2Q0XA 1T4MA 1W75A 3HSSA 4AX4A 5HK9A 5EGNA 5CURA 2XQJA 2G4LA 3WI7A 3MUNA 3SWWA 2ROQA 4ARBA 2BGRA 4HAIA 1QOZA 1N1MA 1Y7HA 5KBYA 4V2IA 4FHZA 1VOTA 4W1PA 5HQ3B 5AI9A 4JH0A 1H2ZA 3FOBA 5ESRA 4JEIA 3F9CA 4KAFA 3F98A 3I1YA 3O4JA 1WOMA 3DOHA 2XQKA 4Z49A 1QFSA 3FSGA 2BJHA 1PJAA 2ZYHA 1EVQA 1W6RA 4NMWA 4PNZA 1IUNA 3ANSA 1UK7A 1W76A 4N5HX 4LYDA 3M83A 4I19A 3AIMA 4XVCA 2Y1KA 4BDTA 2WHQA 4G9GA 1QONA 2XUKA 1K6EA 1XZIA 1XZLA 5EI5A 3G9XA
chains in the Genus database with same CATH superfamily
4ND4A 2ZSFA 1G3QA 2CUZA 3ZCVA 1PS0A 1QIMA 1NATA 3NHRA 3ENVA 1JAHA 2I03A 2YIJA 3NH9A 3QLTA 1B6SA 4IJUA 4KIFA 1BMTA 2XE7A 5ALQA 4A8PA 3L1JA 4DJ5X 4E32A 3KSDO 5JZOA 4WQMA 5IM4F 1KOGA 1Q19A 2FWRA 2GT1A 4KBGA 4LZAA 4QELA 3RFVA 1EM8B 4U2KA 4BTEA 2E9SA 1XZGA 5T4EA 1QLWA 4J03A 4A8TA 2YWRA 3EF0A 4TLEA 4YRJA 4ZICA 4FOLA 2GH1A 2RMKA 3T7JA 2FSGA 2NUTA 3M6XA 4MWEA 5LP6B 1P77A 4BKQA 3PC8A 4H77A 1B8NA 1SBCA 4RPHA 5HTKA 1DDIA 3PD0A 4I8XA 4LX0A 2RGNA 5B2ZA 3U80A 4AX8A 1KDYA 1ZRHA 1SH7A 5K45A 1HA3A 5AMXA 1NXXA 1U8CB 2ORIA 4QULA 2BZ0A 1XMXA 3IALA 4M6WB 5KVCA 3COPA 1NQWA 3AVQA 1U1DA 3RYFA 5HKKD 2UYQA 3N2LA 2GJ8A 1CV2A 2A3NA 2H4JA 2C4UA 5LM3A 4NV3A 3TQTA 3GROA 3KZNA 1N0VC 1XCGB 4U5QA 2X1LA 5AOVA 1AHPA 4YB8A 4AKSA 1X7ZB 4D02A 4RHYA 1W1UA 2PHZA 4M55A 1OIWA 1QZXA 2NO0A 1Q16A 2C5HA 2R6CA 5B36A 2N46A 1Z7YA 2G6TA 4S0XA 4NJEB 2DEUA 3AVWA 1KVRA 4RM2A 1DJLA 2ZJ5A 3ZGVA 1Q95A 2GM4A 2OK7A 1TZBA 3M4XA 4YPOA 5D3MB 1E5LA 3FCAA 5AVWA 3QG5A 1Z2NX 4DYVA 5LXTF 5JWHA 2GRJA 1V8ZA 4CF6A 3CPSA 3ROMA 2BHSA 3DZ8A 4E31A 3L49A 2G1JA 4UEKA 4AFNA 1Z16A 1CC1S 1GTMA 1GDHA 4J07A 3R5JA 3R9IA 3IMFA 2PH1A 3OZBA 1OBOA 4ZGWA 3EC7A 2BKVA 2G7ZA 2XTNA 3DOJA 3RRJA 2GD0A 1Z37A 1ENZA 1YZQA 3GNLA 4LGVA 3L7BA 4NE9A 3ABQB 1TZCA 2JIZD 3M4JA 1TZ2A 2CHFA 3CRRA 2R4QA 3BRQA 3LKDA 3MAGA 5KX5B 4G63A 2J1LA 3AFIA 1DP4A 3ADCA 1EESA 3GNTA 4ARZA 1XQXA 1GTJ1 2IE0A 2VA9A 3EFOB 4L3VA 5GY7A 4GOKA 2P9EA 5A7HA 1CUBA 4C0JA 4G5FA 2FPLA 1N3IA 1NXVA 2B2CA 2KX7A 3WGMA 3GJQA 3MWLA 1BMDA 5K0SA 5KMGA 4UAJA 4DQ0A 1JEDA 1SVLA 2QSYA 4A5OA 1N9GB 4BTLA 2EWVA 2C95A 5IX8A 2QN6A 1J8DA 5BNWA 4ZRNA 1T8RA 4IIUA 3EEFA 3A6JA 4EEZA 1LNZA 1GARA 1RBYA 1FFBA 3QXSA 3U19A 2X13A 5G2OA 1KEKA 5CNKA 1JLKA 2X86A 2HPAA 4IJWA 3S55A 1U3DA 2Z4RA 5E4JA 4CV2A 2PT5A 4CEIA 3WK5A 4CIAA 5HJ5A 4US2R 2AH5A 4QUKA 5CVDA 1PS8A 1HYGA 1QGOA 1XLTC 2QUZA 2WUFA 3GJ5A 3IBFA 4HXEB 4LE1A 3WLPA 5F98A 3FPCA 3VZPA 4QOJA 3G8AA 3IQXA 2WD7B 2C2ZA 1IVNA 4FPXA 4O2AA 3V00A 3GGGA 4XEUA 2XXAB 4B6FA 3V8VA 1DJMA 1BX3A 2OM6A 3KC2A 3AGQA 1MQSA 4B80A 5K8CA 2JFBA 3MJTA 1GGMA 5A9TA 4DV0B 1CUIA 3QKIA 2DLNA 4YR9A 2CHQA 4MCHA 4QVGA 3S28A 4IHKA 3HNOA 3R7DA 4L50A 1ZNQO 1JQ5A 3GF4A 1QQ5A 5EUCA 4B4WA 1AZWA 1F06A 4RPJA 4UUQA 3O8OA 1ML4A 2OPBA 1IN7A 1TKBA 1P4SA 2WU1A 3H83A 4BP1A 4FFWA 4Y1RB 2G67A 3QKSA 2FDXA 3PKJA 1B76A 2BKUA 2H3EA 3ET4A 1DAOA 1NU6A 2VP4A 4OYLA 1CQWA 4YMIA 3Q7PA 1QP0A 1EG2A 1FTQA 3H9GA 3ZHVA 4DQKA 5A6VA 2ORWA 4QTYA 4JDPA 5KYTA 4IIEA 4DV2B 5FO0A 3N07A 3IA7A 4MV7A 1UM8A 2KJQA 2ZFUA 1U1CA 1ZD5A 1PGJA 8AT1A 1QFJA 1COZA 1G3RA 1P9NA 3FDJA 5IULC 3ILYA 4MLDA 2FQQA 5LBIA 4TYMA 1VCOA 3QKWA 1YGPA 1FRQA 2XUAA 3C5WP 3NHKA 1NWCA 3V3KA 1X7WB 2JJMA 3MWKA 2A5LA 2PL9A 1EJ0A 2QTWB 4GX2A 2QZ4A 1G7CA 3SQDA 1PT5A 3ZDZB 4UTVA 3F73A 3DZDA 1E3EA 3G0BA 3IUEA 3OJWA 4Q1FA 1AQNA 5LQCA 4YT2A 3HM9A 3ADDA 1ZRNA 1QH0A 1MX1A 3AHGA 3FVTA 3PLNA 2ONCA 4HB0A 3A7DA 1GU7A 2BFDA 4Z1OA 1K8ZB 1ZHFA 1BXRA 3GLKA 3H9UA 3RUFA 4D8XA 3E23A 4PHCA 1NOIA 1L9KA 4D3XA 1NAHA 3C87A 3QIAA 1TVMA 2YHUA 4MWCA 2J85A 3EXAA 4Q9NA 3LHFA 4TMVA 5EQJB 4BWVA 3WMRA 3O1LA 1RIIA 3TSCA 1JXMA 5BXYA 5LP1A 1KQGA 3M5PA 1SCJA 5F5XA 4MB2A 1X1RA 1JP7A 1YZNA 4CHGA 2FR8C 4LEIA 3VV3A 5F2OA 3DYIA 4QBKA 1S7CA 3QOYA 3RDPA 3WAGA 2WWGA 5IEBA 1SN7A 2R5NA 4MVJH 5DNDA 3AOEC 1LGYA 3LX8A 2PK3A 1AKTA 4F2DA 2Q41A 2WWWA 1NF2A 1DE0A 3AHFA 1XRPA 2NO7A 5DOVA 2CWWA 3IA2A 3TRIA 1VKJA 3V8QA 3VAZA 3LRTA 2FWPA 3WP0A 2QUJA 1TZKA 4YLEA 2H52A 3C15C 3LVBA 3CLTC 2PS3A 2BP7A 5I6DA 4G5OA 1RXVA 2PUTA 2B34A 5EJ2A 1GSAA 5BWMA 3THYB 2JCYA 1XL0A 2R79A 3GA7A 3NCHA 4N6OA 4QYMA 4CKBA 4F1KA 3THRA 4TKMA 3NIBA 1GPMA 3JV7A 4PE5B 5TARA 4O4IF 1NJ2A 3VR4H 3WMGA 4TTTS 3LQFA 4D57A 3PVCA 1JQ3A 3NBKA 2FSUA 4R40A 2M6KA 3DC2A 1Z0IA 1G5QA 2WHRA 4HQ6A 3ZWXA 3PSAA 3DNFA 3Q7QA 4S24A 3L1VA 2M2IA 4MVJD 2O8FA 4ALMA 2CJYA 4RY9A 4DOMA 3KUDA 3BTVA 4HL6A 2AN4A 3QNMA 1E6MA 1WR8A 2OHIA 3MGAA 1T8PA 2A30A 2P65A 2W71A 2XKKA 3DOIA 2FN4A 4KVZA 3E81A 5JNRA 1DKPA 3N2KB 2FWNA 1B43A 3DCJA 3MCWA 4BV3A 3A6ZA 2CLLB 4OB8A 3PC3A 1C9YA 4KMRA 4XRGA 2HCJB 3PFCA 2GPBA 4E5SA 1IJFA 1PGNA 2ZOSA 4GC9A 4UU0A 3NWPA 1SHJA 4CLRA 4FZ5A 3ZZNA 2RFLA 1XKTA 1LFAA 3MOGA 4KU4A 2VXOA 1J0EA 4MIKA 1M7GA 1TLFA 1B1AA 2VPWA 3E3LA 5JCOC 1WX1A 1RWVA 1Y7TA 4JBLA 2G7MC 1ARZA 1ORHA 1CF4A 2OQVA 1ZH2A 3V55A 3RYTC 1V8FA 2WAOA 4GF5A 4FE3A 3MS4A 4Z54A 2IYQA 3Q8LA 3NHPA 4TXNA 4UFOA 5CFOA 1NY5A 2ODTX 5HSGA 3N2ZB 1MRSA 2EEPA 2HBQA 3EAFA 3HXPA 4R83A 2REOA 2CNWD 3AWDA 4XCVA 1NVEA 5SYMA 2IUTA 4BP8A 1RADA 1XDZA 2ACVA 2BKAA 2I3DA 2PQ2A 1KYQA 3EG5A 3ENWA 2E4AA 4LPSA 4FHEA 1CS4C 4HD8A 3BE5A 3UBMA 2IZ5A 1W5SA 2EATA 4HEQA 5AVJA 2CLHB 1YULA 4YJGB 4YLGA 3AR7A 4J7UA 4Z7OB 5ARDA 4FYPA 1WTCA 4F97A 2O0KA 4H15A 1WSBA 3OPNA 3HJTA 4MYDA 1ZK2A 5U4QA 5ITZB 2P2NA 1SEPA 2K87A 2QNBA 1WUTA 5FNVB 5IJXA 2PX8A 3PGMA 4H4DA 2GLTA 1WNFA 2PX0A 5CNIA 2V0GA 3Q7TA 1NUSA 2HSGA 3N8GA 4FGZA 3W9YA 4LNUA 4NXMB 5C8YA 8ATCA 2CDRA 4RORA 1N5IA 4G9EA 3KDSE 4N5DA 4M1QA 4GR4A 3QWHA 3RFFA 4G0NA 4KXLA 4HADA 5DO9A 1GUYA 3AFGA 2AA3A 3NB0A 2YCBA 2ZTVA 5DGHA 2PXAA 1NPDA 2IHNA 4R54A 3RD5A 1M33A 4MVCA 2FX3A 1O1YA 4GI5A 1X1AA 2EVWX 1JG7A 2CZGA 1WLYA 4Y2VA 1TTQB 4UHHA 4RADA 4D8YA 1Q7CA 1P9WA 2PJUA 1LY1A 2MYNA 2HJRA 4ADSG 1PKEA 3ZWVA 5K8VA 1I4LD 5ILOA 1PR4A 1P44A 1SPBS 2X22A 3F7NA 2P1DA 4FMBB 4MUFA 5L3QA 3THXA 1XZPA 4TRJA 4AMYA 2GBGA 5KWVA 4LQLA 1ZAYA 1MIHA 3G0HA 1Z88A 3FSJX 3R6TA 4W9NA 3Q3HA 2JVKA 3MMZA 1WVMA 1Y1TA 1H1DA 1C9KA 1O5OA 3ODPA 4Q7MB 4RH0A 4XIJA 3TQFA 3ZHCA 3OOWA 1UBSB 1KWKA 4RDCA 2ACEA 1G4UR 5E0KB 3MMXA 4MS4B 2KLHA 3GI1A 4XGKA 2UUCB 1EFUA 3WBBA 2FSVC 1YI1A 1WDWB 5AICA 1P8JA 2ZGVA 1DQZA 1JTVA 2QG4A 2QK4A 3DXXA 1NMXA 4FNGA 4HYTA 5CVCA 5J63A 5CVJA 4C30A 1HM5A 2GX6A 2RBKA 4JJZA 3WZLA 2CNBA 3GJ8A 4XJSA 4ZVTA 3R76A 3TLZA 3WYDA 4IDBA 5JAHA 3O03A 5JD5A 5GJCA 3PNQA 5FOWA 3RSSA 3TAXA 5KYUB 2BLLA 4GKJB 3Q1KA 1VJTA 4D8UA 2H29A 1SU7A 1E98A 1R6XA 2PGAA 3C3MA 2DBZA 4ZT2A 4AG5A 1SIUA 3HHEA 2QLBA 2ATVA 3QYAA 3HCAA 3ME5A 1K2WA 2R6FA 4RLHA 5TQJA 2PTGA 3W4JA 2XYVA 3L84A 3BD9A 1Z82A 3BDAA 2G5CA 2Q4BA 1L1FA 3HY4A 2ZB2A 4GT1A 4LXIA 1V5EA 2AFHB 2CNKA 4KOAA 4WJZA 4MI1A 1KKLA 2VHTA 3SZRA 3V7YA 3Q9SA 1M1XB 4WFJA 3C1UA 3T9EA 3NHUA 2IYEA 3H9QA 5DYIA 3VMMA 1G3MA 3A6DA 3FVQA 4RXTA 5CRIA 4BAGA 2REXB 4B2LA 4QO8A 1E1CB 2IHUA 4YVFA 4C6TB 1RLOA 1LEHA 4CLDA 2NYRA 1RKUA 3AXTA 5C7LO 4TQGA 1QTQA 1SJ9A 2J3IA 4KSCA 2GM5A 3IO5A 4M98A 3ZWKA 4RTLA 1U1GA 4RKEA 3JATB 2MYTA 2AOVA 3OQJA 4HNRA 4L8GA 5J5AA 1Z5VA 3IO3A 1AU9A 2VUUA 4OLHA 3W7VA 1P1BA 2IELA 3QRWA 2PSHA 3QVGB 2VDWA 3WYNA 1Z4NA 4Q02A 3GG9A 1EHCA 4H6VA 3UVEA 1LNSA 4B34A 3ZV5A 4KR3A 4EAAA 5E1OA 2HGZA 1L4LA 1SXJB 5BNTA 3HBNA 1JHMA 1I1OA 3V4FA 4IQ8A 2I62A 4O02B 3A6EA 4P53A 3H2HA 2QN7A 1PEDA 2DZDA 3K8ZA 4PO1A 1DPFA 4EF4A 1NBHA 4MR8B 1AQJA 4A2WA 3HGMA 4EHBA 3L4KA 5E9AA 4BBPA 3N74A 3M2PA 4E4RA 4RY2A 2E37A 3D6VA 3T35A 5MN5A 3A9SA 4AJHA 5I4IA 1BG6A 1JHPA 1RPNA 3MJEA 1AM4D 3O21A 1B2LA 3R41A 3I2FA 1W36C 2WUVA 2AN5A 3EC2A 1XK6A 1RKQA 2GCOB 1RE1A 4E1VA 2IYVA 1KIAA 4H9GA 5JMPA 1UFRA 1VLVA 2R62A 4ER7A 1P74A 2GEVA 2UXBB 4QBIA 2IV2X 3HDHA 5DN9A 3ICEA 5HXAA 5JPDA 1ZOPA 2P4HX 2PMKA 2XNJA 1BWSA 3P0FA 4JHXA 4BKPA 1JB1A 5I7HA 1MO3A 2BMAA 3LQ2A 3NBZC 4J4TA 1XI2A 3TNDA 5IMSA 2NUAB 2WM3A 4EHAA 1NXOA 4F72A 1KE2A 1P2BA 4CR6A 2D59A 5LR6A 1BA3A 2WTNA 5E7IA 4EMBA 2GQ0A 3SHQA 2C92A 4FEGA 3F74A 4NQRA 1JLLA 1KAOA 3WKBA 5LNK1 4Y8VA 1MZVA 1WF3A 3DMFA 3UWDA 4EW2A 2EFDB 4M0MA 1EX9A 2ILVA 5IYZB 2FCRA 2BJWA 2XMQA 3M82A 4IHJF 4MUAA 4BEJA 5EKXA 2Q3HA 4KE6A 3CLUD 5LZ4A 4WINA 5EZYA 2NU8A 4URVR 2JFUA 1EINA 1TM7E 2OV6A 4ILEA 1KY4A 1NQTA 1QU2A 4Z0PA 1P4AA 4P4SA 4XB1A 2EX1A 3KEFA 2FN9A 5GP1A 2ZR8A 5LMCA 1W4AA 1YJXA 2B4KA 3I83A 1W2GA 2ANCA 2B25A 1DQSA 4CV3A 2D0PB 2PUJA 3EXFA 5JY1A 3I09A 3Q3IA 1MMFB 3BGSA 1SULA 2BFOA 3GCWA 3ILSA 2QZ9A 3AM3A 1SXHA 3F8TA 3N7TA 3OU7A 4RHTA 5AR1A 2CK3D 5JQGB 2RCYA 5KC8A 3BF7A 3V2GA 4R8VA 3THWA 1E61A 1OVMA 2JLWA 3U31A 3UAOA 1ZHHA 2GZ1A 5CLIA 2DC1A 4RSGA 1IJBA 4TVBA 1HFWA 2J5BA 4IDFA 3E1KA 4ILKA 4TKLA 3I6ZA 1QH1A 4H6PA 3W4KA 1Z12A 4DG9A 4DREA 1H2HA 1Z47A 4YCLA 2QRQA 1N8SA 4D9BA 4CM4A 1XN4A 1TCCA 3D6HA 4PF1A 3JARA 4G1CA 5HA5A 3RFCA 5EJMA 4G1BA 5C37A 4MB0A 2B4TO 1OR8A 1CRWG 1TLTA 2YVQA 1V16B 3SVZA 3TL2A 1EE2A 3CC8A 2CF5A 1WMDA 3FFXA 3T3DA 1D9ZA 2AZTA 2JNWA 2W6JD 2B8JA 3N8HA 1QP8A 5KC9A 2CV2A 4DN6A 5A03A 4YROA 4DMCA 3GRFA 3IR7A 3O31A 4O63O 1H8HA 4PZLA 1SK9A 3S2IA 4E6EA 2WSMA 5F78A 1OI7A 1L4HA 1Y6JA 5FBLB 1GRQA 3VVBA 3RFTA 4KMOA 5KTSA 1M34E 4AZ0B 3JAMA 5I7SA 3JQRA 4K26A 5AJVB 2WV9A 1LVGA 4LJSA 1HL3A 1H2BA 1FMCA 3BMXA 1X19A 3EN0A 1YE5A 1UZMA 4HH0A 4KIWA 1XTBA 1RQLA 4HRAA 1DHTA 1RC1A 2YOGA 3VNRA 3CVUA 2FFBA 1QXSA 1J5PA 1U8XX 3I5UA 3NCTA 2HWUA 3BDIA 3UMJA 2C2KA 4H7DA 4HS9A 121PA 4HMPA 3E2IA 4M83A 4NKRA 5K8TA 5AHWA 4FCWA 3MTJA 3EEYA 3O73A 5TGDA 1YZUA 2JH9A 2CWDA 3SDSA 3JQBA 3EPKA 2YRFA 1DZ3A 4A6XA 3OCZA 5DI3A 4RF4A 1E2EA 1HNWB 5GGYA 3TXAA 2OCYC 3HE3A 4DC0A 4IVRA 4EGAA 4BNNA 2F1IA 5DM1A 4AY4A 5CITA 3U1VA 2N9UA 5ABPA 1PV1A 2XE6A 4EEXA 3KQSA 4FCCA 1QU3A 1ORRA 1PT7A 2O5RA 4JK3A 1UC8A 1O6BA 1NLUA 1XMIA 5IWAB 1Z6YA 3B70A 3Q88A 5SV2A 3Q4GA 1L5YA 4C3OB 4E22A 1RKBA 4D98A 2WIDA 4GW3A 1X8XA 4ZKEA 4AG3A 4CNQA 1YJQA 4EMSA 1P5RA 2HA6A 1RYZA 1EFVA 2Q6KA 3QVXA 3RIGA 1LJLA 2VLIA 1DKUA 1DWOA 1S3FA 2R8YA 2YCLA 3G9QA 2B20A 4GMDA 1WEHA 4MGKR 4QTUB 5BNIA 3CB2A 1XZQA 3GBPA 4P4TA 5DIFA 3ZWDA 4CMBA 3HMQA 2R85A 5FO1A 4MGIR 5IW8A 1ODLA 2Y9PB 1Y7IA 1GTRA 5F3WB 2H06A 1YB1A 4FFOA 2VRCD 5F2NA 5TMEA 1DIRA 1RAEA 4Z6KA 3KZKA 3M6LA 1GTL1 2YJTD 2B7CA 4IPTA 5SZHB 1MLDA 2DUUA 3VZCA 4DCSA 4KSBA 2ZCJA 3BQ9A 1QK4A 3K8QA 4QO7A 1RXSA 2P3OA 1A8PA 2HBYA 1KS2A 2I4OA 3B38A 5JS7A 3FZYA 3DR3A 4OIMA 1NTOA 1WXDA 2FLKA 3IMCA 5M2QA 2WU3A 3HUFA 2JGAA 3VUFA 4OGLA 3EOZA 2Q7DA 3ZDXB 4B33A 5IJ0B 1EX6A 4ZT4A 5HKKA 2I1WA 2IKSA 1XTVA 4IJ5A 4PHFA 1HY3A 1G60A 3ND8A 2F62A 3SBXA 4Q9HA 4CGZA 1QF6A 4KH1A 4QT0A 5BR8B 1P3DA 3MJ4A 2XB4A 4XUCA 4EGJA 4EUSA 2FW9A 5ITWA 3ENQA 1RWMA 3BN3A 3HA2A 4NE7A 3S5JA 3E7DA 3ILXA 4B4DA 1T6NA 5K9ZA 4PZ0A 4N47A 3H2ZA 3DMHA 5BN5B 3K53A 4XM1A 3DHVA 4L8FA 3ZE2B 4TS1A 4UFPA 3EVFA 3R6LA 1NMZA 1ZN7A 3OEED 2K7FA 5EJFA 3HEMA 5CAEB 1WB6A 4HWRA 2EW2A 2ZIGA 1DAFA 2LW7A 2ZRNA 4NZNA 2IU3A 3E8SA 2WZQA 2FX2A 4OXIA 5CD1A 5JVDA 1U1IA 3H17A 5AXCA 2FEWB 4N6NA 4XCXA 3F7MA 1KI6B 5IASA 5TDHA 4EY7A 4HX5A 3BC1A 4JELA 5AYVA 1MA0A 2OORC 2FOIA 1V1MB 2QJFA 2YDYA 3CRW1 4MYTA 2JIZA 3R7AA 4LKRA 3DT9A 3RS0A 1QGUB 3RYHA 4AKGA 2JW5A 5CHEA 5HKAA 4XI9A 4JYZA 2C4KA 2J9GA 3GUCA 3VC1A 1F2UA 2NACA 3NFYA 1EE1A 3O83A 3LLSA 3L7LA 4CIBA 2OZVA 3SXUB 5GIPE 2NYVA 4KYVA 5C5DA 1CU1A 5IUNC 4QFMA 1OJ7A 1Z4KA 3AYZB 3C3YA 4PSDA 3W5SA 4ZIRB 2QNIA 5C7YA 4EUEA 1B6RA 2QAGB 5CDGA 2BAGA 1GDDA 2IEDA 2XVAA 2ZXEA 3KEMA 1XX6A 3KYJB 8ADHA 3B6ZA 3VR5D 4CIWA 2Q3JA 5EE9A 2PKQO 2PQ6A 3BMNA 2C2HA 3C3BA 1HH4A 1IC6A 4MRRA 3PXGA 2RC5A 1HDYA 4AP6A 2FE1A 4XASA 3NVDA 3IXQA 1LPOA 1PQYA 5DHPA 4FFVA 5EXPA 9ABPA 4I5DA 1J07A 5GGXA 2H7YA 4AO8A 1SCNE 4Y2SA 1HC7A 1P2SA 3V1LA 3JZAA 3VU1A 4PXSA 3B3FA 1R0XA 5KDLA 5E6UA 5AI4A 2C97A 3W9UA 4O4JA 4RAOA 3WXMA 1PNQA 3GDHA 1ZC3A 3ONVA 3ANLA 4MP6A 1VRVA 2PX4A 3KL4A 1I2DA 3N86A 4NCKA 2ATIA 1C3OA 1KYTA 2ZYGA 5DMXA 4CEHA 4KLRA 1W4CA 1KZHA 2ZYSA 4JSYA 3ZCPA 4BP3A 3FCOA 1SOWA 3AR4A 5HW0A 1QZTA 1XVAA 4IG4A 2APJA 3MCVA 4FBLA 3QE9Y 1JHQA 2X58A 1ZU5A 2ZTLA 3DDHA 4TWAA 3EXIA 4F5ZA 1E2IA 1QR2A 1NE2A 5DTQA 3FMOB 1ISHA 2GPNA 3JZMA 1KOLA 4GU5A 4LGYA 3DZHA 3T52A 1Z34A 4LJ8A 3WGHA 4CTNA 1R9NA 5J4YA 3HVRA 1CRLA 2HAEA 5JXHA 3F3YA 1U28A 2HMWA 3KZXA 2RSLA 1JFFB 3IBCA 1BW9B 1DRWA 2RARA 4ZU6X 1WMEA 2JH3A 1LSOA 4KC0A 4RNDB 3T7CA 3UC5A 2CNLA 5KYXB 4QHYA 5A0VA 1FRZA 4O29A 1FFAA 3GZJA 2GO7A 1DKQA 4EY4A 3PWZA 2UVPB 4R9VA 2AQHA 2Q3FA 3MINB 4LY6A 4WBSA 2UV8A 2IXGA 1AV7A 3RWOA 3D6UA 3E35A 4Q7KA 4B7CA 1CUHA 2P6PA 3N59A 1SU6A 2J48A 2PUWA 3M49A 3UAWA 2YV1A 1U98A 2C94A 1Z07A 2YQZA 4O8ZA 1Z36A 1JPUA 3JCZA 4TLLB 1HKHA 5FLEX 1O54A 3KKOA 4DLSA 2CXUA 2AI3A 5GJWC 3KV3O 5HPYB 2HCTA 3FNGA 4ML3A 4G8CA 4YRIA 4RTRA 3CJRA 4IZOA 4Y98A 3SF8B 3P2OA 1QCDA 4PC2A 3EJWA 1JR4A 4LXQA 1HLFA 1SHTX 4L85A 4NF2A 3SE7A 4PLPA 1JU4A 4RS4A 1Y6GA 1FTNA 2XTZA 4JJ7A 1N7HA 3IRUA 2GF9A 1IOZA 1M74A 4YV1A 1FTGA 3GAMA 5AW3A 2AFIB 2ZS9A 4XOUA 3O1HB 3QWBA 4J1TC 3T95A 1UJ2A 4I9FA 4Q3DA 4NQZA 3AINA 1H4VB 2BWJA 4O1IA 2AVNA 2X2OA 5F7OA 2H1RA 3U9TA 4YXWD 3AUFA 2FCAA 1JR2A 1KI4A 3D0KA 4KBYA 3AJAA 3H2YA 4JUDX 5H83A 4FBGA 4LY9A 4MWSA 5J4KA 2J45A 1JYFA 3F3KA 3WKEA 2QTTA 3USZA 5HMLA 5B2EA 4PCLA 3KCQA 4WXRA 4N7MA 1K5DA 2NG1A 3DBVO 3W34A 1EEXB 4MV8A 1BKDR 4EQ6A 1R8YA 2QB5A 2BUCA 2REBA 3LC0A 2QM0A 3QYPA 2AJBA 3DZCA 1YCFA 2OT3B 2VEOA 3DCIA 2WY2D 3W2TA 4AY5A 4D9CA 5BQXA 3KYIB 4IEIA 1R6AA 3H1GA 5AM1A 1YVUA 2NSJA 5HRCA 4X20B 4EI8A 1WB5A 3L0PA 4JV5B 4NYJR 2NQ8A 3EGEA 3B60A 4LZZA 4OQPA 1JHRA 3DAGA 3GR6A 3G8BA 3VH3A 3OPQA 4MTCA 5A2QA 4V0QA 4RK4A 1G2OA 2Y2UA 4EFDA 4I55F 4TMZA 3G8CA 3OESA 3L79A 1GKIA 1R3DA 4HGRA 3G2IA 3BIXA 4I14A 4K6CA 4ONEA 4XX0B 3SLRA 3VC7A 4D9FA 1B15A 4I1VA 5CTJA 2I9KA 1GV1A 1V3QE 3B9BA 3FWPA 1W87A 4BMSA 1ZMOA 3QV2A 3GMDA 1BDBA 4QOSA 5HOEA 5CXSA 1ZRMA 4MVJA 1E6LA 3WQQA 1G6Q1 2H1VA 3LDAA 4MQEA 4OFZA 4DA8A 3M33A 5MFPA 2XVYA 4BO0A 2O1WA 4HF7A 4PZCA 4W5RA 2P9FA 1GADO 4UZSA 3PQ8A 1L3BA 1XELA 4AZTA 1NC1A 3BSWA 1WZIA 1QHEA 1X77A 1EFKA 3OQBA 2JEYA 4HFJA 2EGGA 3PPYA 1TM4E 1XZEA 5H3LA 1Q1ZA 4JT4A 1U81A 4I1IA 2XA9A 5IN4A 1XSEA 2JLCA 5HGXA 2BSXA 5FYQA 3WGQA 2WVAA 2ICAA 1RP7A 2IXEA 3G7NA 1QKIA 4GMXA 3FDFA 2XOKD 3WGJA 1RJ9B 1T26A 1ZSVA 2HC9A 4UBLA 3RNLA 5JD4A 3V8NA 4ZOLB 2YW9A 3A32A 1M1YA 4HI0E 2XEXA 1Z2CA 4C14A 3TX2A 3NH6A 5AKZA 2FXIA 1XNRB 1MQ9A 4HYQA 5TQ0A 5F64A 3RIYA 1CY8A 1E62A 2QLLA 3L92A 5FBWB 2G04A 2YUIA 5G0SA 4A0FA 2WWYA 1ACJA 1RM3A 2BHRA 1LPNA 3IKLA 4YJFA 3SYKA 3VX3A 4B83A 2Q4OA 5DXJA 4Q00A 3W2FA 3WLLA 2IBSA 1WVGA 2BBOA 2VUIB 2ZWPA 4D25A 1GLNA 1UDBA 1WDTA 4DG8A 4IY1A 2VZ9A 4WNCA 4TROA 3N9IA 4B3MB 3BD7A 1EFCA 4BQQA 3OVMA 1CJSA 3OWXA 5AUPB 3INNA 1T2AA 3MPUA 4LVNA 4MZXA 2ZULA 4FR5A 4B6QA 5LKAA 4JLJA 4X97A 4RMNA 2AN9A 4QJ5A 3RASA 1J49A 1N5RA 1QDLB 3UV3A 1EVLA 4CQMD 1MTOA 2VUHB 3KQOA 1K5HA 5LZ8A 4JDUA 3UPTA 1V1RA 2ZUFA 1XWWA 1A9RA 4C3VA 3S1AA 1LVUA 4DIBA 2ZTHA 1QDEA 2FPXA 5CFMA 1HZZC 2O54A 1WQ1R 3ZGNA 3P2KA 1K98A 5ALLA 4LOAA 6LDHA 2RIPA 3AVPA 3Q8WA 2C7RA 3QXJA 1Y4AE 3DT8A 3RAFC 4CL2A 3KT3A 1GA4A 4JQCA 1GG8A 1YR2A 2QXUA 1KOJA 2ZJ7A 2JD2A 1NFRA 2F7SA 3QPCA 4IFIA 1YGYA 2WOJA 1U0TA 2VP2A 2PMBA 4OI1A 1ZK0A 1JBEA 4IKPA 3RR2A 1W1IA 1UANA 3LHKA 2VAXA 4NBRA 2GJSA 4RH1A 2P7IA 1A9OA 4RL4A 3VNAA 4NICA 2LTAA 2VTBB 1JUDA 2AG1A 3HL0A 2IZZA 1ZMBA 4CKWB 2PUGA 1M1NA 1DG1G 4EO7A 4MP8A 3H2JA 4RJKA 2IH4A 3CF2A 5KYYA 5IT9A 1X38A 4OHYA 4FQ7A 3DQQA 4GX1A 2PVPA 3CZ9A 3RJ5A 4DCTA 1AN9A 3SSOA 4NYIR 5ED4A 3H18A 4WLEA 5IM5A 5ULLA 3UW1A 4AB1A 2ID7A 3SG0A 4INZA 4NARA 4JZKA 1X7YB 2XBUA 5H0IA 5D7BA 1NV9A 3ZDDA 2NZ8A 1NXQA 2P9TA 2QLJA 4PV7A 1EFTA 1EVJA 3C4JA 3K6SB 1KU0A 4NDZA 4B44A 3AZOA 1Z22A 1GZSA 1Z33A 1Z5ZA 3EARA 4Q1AA 3DM9B 4L0DA 1Q2UA 1YDFA 4O4LB 3HUDA 4RANA 3GUZA 2TMYA 3JWJA 4IQ4A 4YPFA 3DOFA 1UQTA 3NT2A 2EHJA 1U1EA 4K88A 1JDTA 3TGWA 3S81A 2FPGB 3EPHA 1UZNA 4NZPA 3I5MA 1ICEA 4BJ3A 3GD5A 1DDOA 5K8IA 5IP5A 4BKOA 4BO1A 7MDHA 1QRAA 1SOUA 4O59O 4UPVA 3WLIA 4I50B 5BN3B 2CVHA 3DUFB 3IILA 5IN5A 3M4ZA 1A96A 1T6ZA 1DDGA 2NM0A 3STVA 5JS2A 1C1XA 2YQ4A 1MW9X 1Q7TA 1QG2A 1JKXA 2CXTA 2P0YA 2PMDA 4HLUA 4KQ2A 3T3GA 4X66B 4HYYA 3HZRA 4ZP1A 3W0LB 2QJWA 2BT4A 2CLDX 4A8JA 1J42A 2C3UA 3DBHB 3INTA 1D4ZA 2AD5A 3SSNA 5KINB 2X15A 1D1PA 4KVAA 3R40A 5GM2A 4OV6B 2ZIXB 1XGKA 1TRHA 3HU1A 3U60B 1AUVA 5D5QA 3C3WA 3DAPA 4IJMA 2TS1A 4C4YA 4HNTA 2Z2IA 4MMYB 4NATA 1Z15A 5LDDC 3O1IC 5B55A 3MT8A 3KR2A 3S8EA 2Z6VA 1W4LA 1DG3A 1Y80A 2O8NA 3A25A 3BIWA 3WYEA 3OZEA 1FVFA 3L0CA 4TMYA 2OZPA 4L0QA 4OMFG 3RHSA 2OAGA 4DUGD 4FYMA 3QTTA 1Z5WA 2H9IA 2BJVA 3O9VA 1AXGA 5HQJA 1DG9A 2CHUA 4G1EB 3NAQA 4BNTA 2FN7A 3IVRA 1FFXB 4E0BA 5FDFA 3OIWA 4JL8A 4P0TA 3KKZA 1J2RA 2O52A 4J9UE 4AWAA 3MLBA 3A11A 5KOHB 4GR9A 3R7BA 1EM8A 2OQRA 3DKVA 5C5CA 4S2UA 3GJRA 4TKUA 1PN3A 1ZKDA 4RENA 3ZDFA 2HWYA 3H9BA 1A8IA 1UIRA 4BNYA 5LP6A 2H2DA 4LF4B 3MB5A 4EPXA 2XLBA 3M6IA 1IIRA 3KT8A 4GOMD 3MILA 1S8AA 1XAGA 2GSDA 4IVNA 2X4GA 3TK1A 5DIZA 3OTIA 2JIMA 1WUHS 1TZJA 1ZEJA 3HG7A 1I13A 4F6CA 3BCHA 3IP3A 3QOWA 1SCBA 4FOPA 4M6WA 3FBWA 4MHOA 3C3XA 4A73A 4B6RA 4EDHA 4AL4A 3L1HA 5T6MA 1NUQA 1EVYA 5A5DA 1ESMA 1Z6ZA 2PX5A 2VJOA 2DFNA 1CJBA 2ASEA 5LD2C 3EQ8A 4QTZA 3FVWA 2XRFA 1H5NA 4FHDA 1N0WA 4P5PA 2FJPA 3OEWA 1PJ3A 1TYAE 1OYYA 4URHA 1F8YA 1P31A 4WA8A 4WRRA 3RVMA 3TLXA 3WGLA 1F7VA 4A36A 4QDOA 1C0KA 1NKVA 4MJ3A 3HN7A 4UM7A 4BLVA 2C61A 1SKYE 4NJEA 1P0IA 4LY3A 1OXSC 3GPDG 4PZYA 4BX8A 2Y1WA 4NY1A 2BCJQ 1XAJA 4PO9A 1LK7A 2JFXA 5EJAA 4YMGA 2VO1A 4V3BA 1FFWA 4XJTA 4CI0B 5IJWA 1V3UA 3LHIA 2BF7A 1FIUA 4TKVB 3F5MA 1FSSA 2DFVA 1A27A 3H0CA 3OT1B 3PDIA 3ZEAA 3DVLA 1SM4A 3E05A 1TD9A 3KTDA 1M2HA 1XV5A 4FDMA 4HBZA 3WGOA 3RAJA 1AX9A 4EY5A 1MFZA 1T8SA 4KE9A 2TMGA 5FAKA 5KSYA 2E87A 1L7RA 3LVQE 4NV0A 4GOND 3K1AB 3IS3A 1U0NA 3MT7A 2FFJA 3LHSA 4ZV4A 1EI9A 5HQTA 4BGUA 1TTPB 1ID8A 3KO8A 2ZS7A 1K2VN 1XA4A 4KNYA 1WXIA 1P0PA 3NVMB 4LMPA 2DGDA 2IYRA 3L07A 4N3AA 5FADA 1HEIA 4JL5A 3ST7A 3ZV6A 5L4SA 1C4XA 1E9BA 1UP6A 4UMVA 2OD9A 4GMHA 3EFOA 2XGGA 2G4CA 4EJSB 2DERA 3QM1A 5LQAA 2QYSA 4JJ8A 1X1EA 2PZAA 1GNLA 4ZHQF 4TT3D 3I6QA 3W8FA 13PKA 4JL6A 2O8BB 1QRSA 4RKWA 2ZDHA 3G89A 2OBNA 4O4HB 1N9GA 4PGFA 3ZVRA 1KAQA 4B17A 4BMDA 4YP1A 3OH8A 4FI3C 2G8LA 3R5HA 3B1JA 3GDGA 4NHOA 4KXYA 1EK2A 3ZS9A 4UFNA 3GEBA 4OJNA 2FPIB 2W6JA 3CMCO 5ALOA 4UXJA 1H3EA 4L4RA 5BSEA 1UPUA 3WQBA 1I7QB 1P5FA 1IB0A 1I6MA 3JQEA 3LYLA 3O4HA 1NXTA 1D09A 5FBVB 2GZ2A 2NADA 3R9WA 3R9XB 1R0BA 2VHUA 5F21A 4YRMA 5IBQA 1H65A 2D06A 3BTSA 3TI7A 3R3XA 3NQ41 4HK4A 1H85A 4B6GA 2ATEA 3EYWA 4LFCB 3NBMA 3D0OA 4MEJA 5DOZA 3PV0A 5G3ZA 3BRCA 4QEKA 2XXAA 2DBYA 4MWOA 2MYPA 4QFDA 2NW6A 4DCPA 4DCNA 5E2AA 1OFTA 5SY9A 2QWXA 4OB7A 3ZBTA 3HLKA 4ZVVA 1U8AA 4QWWA 4EVSA 5B3LA 1GNTA 4XAQA 1LNQA 2VXBA 4R2HA 3ZC3A 1X80A 4XXHA 2O5CA 1VHWA 2FSIA 3U4MA 1QBKC 1J00A 2ZRHA 1LTKA 3N58A 4LZJA 1E9VA 4KLAA 2HJGA 5C1IA 2P40A 4IOLA 3WIVA 4E2WA 3BBLA 1DJPA 2F9LA 1A88A 4BFUA 1SO8A 1ZJ4A 5JFTA 1NFQA 3P27A 1Y4DE 2AQKA 2CL0X 4RTNA 2IOFA 4FK8A 4YJ2F 4PC6A 3B51X 1P9RA 3JWEA 4YCBA 3HO6A 1D2HA 2WJGA 2YZKA 4TN1A 4ERNA 3SJCA 4IDPA 3AESA 4Z4HA 1UWLA 4TV8B 3S70A 1HG0A 1AS3A 4NU8X 1UDRA 2K4MA 3QUTA 4GEKA 3FB4A 4P86A 4YFYA 3UCXA 3B1KA 4AF8A 4BNXA 3TRKA 1I3LA 1P1RA 5GOTA 4D9NA 2C77A 4QXQA 4DNQA 3BXHA 5B1SA 1XLUA 2FWJA 3UHAA 2IEAA 1VPDA 4EA9A 3NHJA 1JTFA 3HGTA 4MUHA 2RAFA 2O7VA 4KCGA 5FA6A 1JIKA 1O6ZA 1L1QA 1PFVA 1FU7A 1Z17A 2FZCA 1PBNA 1HZJA 2PGJA 3TLGB 2P9JA 2QYHA 3SNHA 7REQB 2IY9A 2VRCA 2WWHA 3HLYA 3ZDQA 4YT8A 1OX6A 5AI5A 1Y34E 1JIXA 3VHLB 2J30A 1RT9A 2WJ6A 1PG0A 3GLIA 1YFJA 1TJ5A 2PWYA 2X0NA 3ZY3A 1N6KA 3NTXA 4KLCA 2FFQA 5LMNB 2WE7A 1F20A 4IDOA 4PCAA 1FYEA 3K5HA 3K9GA 1X1CA 1TK3A 2NVOA 2YJ5A 5EKSA 2OFWA 4BBZA 4BMNA 1K8QA 1TAQA 1ZNWA 3BIOA 3WTCA 1TECE 3TTWA 3KHTA 1EHIA 1L4MA 3BCSA 2B4YA 3QVKA 5AI8A 1UJCA 4E46A 5HYVA 2R2AA 1KEVA 1UXJA 1WWKA 3EMKA 3OHMA 4M8IA 4LDAA 4V0KA 3CM0A 4UNRA 4CF7A 3EZXA 3ITKA 4J94A 3V4PB 4QICA 5J2UA 1OF1A 1V6CA 3QHPA 3WGYA 1EGQA 4MUBA 4I4TB 2Y6VA 3PKZA 1NRXA 3PNKA 1UMCA 1UDXA 2ZYDA 3EE6A 4TX1A 4FIDA 2IP1A 2PL1A 3TZBA 3U56A 3QOXA 3DPIA 3LHDA 5AKYA 1SXJC 2R5WA 5FBHA 4D3YA 1UBFA 821PA 1E7SA 3THYA 3UOAB 4DLRA 3LT5A 3VAAA 1VG1A 1PUXA 4IX9A 3C5HA 3C1OA 3OY7A 2VT6A 2QD4A 1DX6A 3DB2A 3NKLA 3OUUA 4TL6A 5GONF 1PR9A 3FRHA 1NVWQ 3RIHA 1ECFA 1Z8HA 1R8JA 3JSAA 3PNSA 3O5AA 5TPWB 3ZHBA 4BJ5A 2K2WA 2O0JA 2BW0A 1WMAA 2QRZA 1ID1A 1CJUC 3DLCA 3DYBA 4D41A 2DOKA 2H1LA 3BF8A 2OILA 1OV4A 1U0EA 3GJZA 2GF2A 5G0UA 4D44A 5K0EA 4ZO4A 2AKEA 3TLYA 1SGWA 2DHDA 2AG5A 4G86A 1CE8B 3D7LA 2V5UA 3HMKA 4ZVPA 4IH1A 3GA5A 2VT7A 4Y6RA 3U7QB 1O8BA 1FA9A 1YR7A 2XQGA 3I8OA 3SKYA 4F5YA 2P3LA 2QTBA 1ULTA 3VR5A 1UOOA 4NJOA 3T5MA 3GVPA 4AMZA 2Z6QA 3TTXA 3HJAA 3Q8MA 5G53C 1M2NA 2GN6A 3K4HA 1A0OA 4L8WB 4BNKA 4RD4A 1KYVA 1BCRB 1VG8A 3AF2A 4LN1A 3PGJA 5ELLA 4YRRA 3WWCA 4CUKA 4FHCA 1S6YA 2O6LA 1KAHA 2RJNA 1N2CE 1VMAA 2W2KB 3N0TA 4OI2A 4B6SA 4ZJZA 2MSEB 4YMTA 2W2VA 2E55A 2VJAA 2KHZA 4X1IB 4D6XA 4K6GA 2ACWA 1ZCBA 3AJRA 5A3JA 4Z9AA 2MWMA 3QA3E 4FIZA 2H1IA 2WMDA 5F1YA 4WKBA 5C8XA 3KJXA 2BRUC 3PXEA 4CMGA 2GLUA 1VMDA 4OYYA 1Q22A 4ME6A 2ALJA 2F3UA 4C4OA 4RKYA 4J91A 4QPJC 4YJGA 3EIOA 2Q28A 2NUPB 1OASA 1ETUA 4DUYB 1TU4A 4MRSA 1M2OA 1GPNA 1P0MA 3GK3A 4ZV7A 5ITZA 1K63A 2PUAA 2HWKA 3B5IA 4M87A 5LU9A 1VPVA 1G42A 2A78A 2ZKIA 1DQPA 3T6KA 1E1KA 4QASA 4C04A 2NMVA 1T0BA 1JAIA 4BQIA 3ZLJA 1JLRA 1L7QA 2B83A 4NZMA 1D5WA 2YWBA 3COWA 3KJZA 4NL4H 4Y9RA 4X1YB 5K3AA 3DBIA 4IICA 1YD7A 4LVUA 4W9RA 1FX0A 2P1RA 3ERCA 3RTAA 4X6YA 5AK0A 2DQZA 4FMCB 2Q3CA 4OH1A 3LP8A 1QKJA 1T8YA 4OXYA 4PRKA 3UTDA 3X2FA 4CLXA 1PNRA 2RGRA 3MJHA 3ZVLA 1Q3TA 4L9RA 5EWJB 1J90A 2JJQA 3BJRA 4F93B 3RRBA 5FHRA 1EE9A 2W4MA 1I8TA 3QTLA 4WBNA 1Z6QA 4JYCA 4RZQA 1R50A 4V1CI 3TUZC 3DMTC 2V3CC 1VHTA 1FF9A 3OSZA 2J0QA 3G0OA 3FDZB 2XDAA 1II0A 2EOAA 4OY3A 1NUUA 2VP6A 1KRHA 5B64A 1OZ0A 4BB9A 2FDCA 3R4CA 4GQIA 4OQFA 1OC4A 2FRXA 4NCIA 3UANA 3VZBA 3G2MA 2JASA 4C01A 2Y0CA 3KP1A 1RBQA 1MVNA 4CI9A 4MHTA 2D6FA 3RO7A 2X4LA 2OHXA 3PDCA 4QDUA 3WLMA 1ZOIA 1OAOC 1K9VF 3GOHA 2CUTA 4TXHA 3LUDA 3NBQA 4FYKA 5J2TB 4R31A 1S8NA 2QSZA 3GRRA 4HVLA 2XIQA 1N2EA 5HZMA 3ADBA 3IP6A 4LI0A 3HXMA 3GRPA 2IS4A 1P7PA 4CM9D 4JI7B 4XZ3A 1YCHA 1UAYA 3DNMA 4IFBA 4LZNA 1BHJA 1AGYA 1OWNA 1YTLA 3AI7A 3RS7A 5KTMA 1RCFA 4KFTA 1GGVA 3VYSB 3SXJA 5EP4A 3LT0A 4PAGA 4X1OA 4YXWA 3CINA 3K9CA 4YV7A 5K51A 4KPEC 4HZUB 4ZALA 1ZGJA 1J99A 3S29A 6REQB 5DB4A 4RD6A 2FMUA 3D5QA 2IPOA 1B41A 3OZFA 5KYUA 1TI7A 4C0SA 5BORA 4QXPA 5KTNA 2EDAA 3E2PA 4MVJE 5GM1A 1XMVA 4WFQA 2XB2A 2WU8A 4MR7B 1VI5A 5DNVA 3LFHA 2IP4A 2R1VA 3QKRB 4AROA 3ZCTA 2J5RA 4MJLA 4TZ6A 4IKEA 2E1PA 1CZRA 2IPLA 4L3OA 1P2VA 4XYBA 2NPFA 4WSOA 3FMGA 1MAAA 1A8SA 1E2DA 4Q19A 1UKYA 1HDXA 2F67A 3G88A 1GFZA 3WBFA 3QKUA 3O47A 3ACCA 5CPBA 2Q9BA 3ECSA 3ZY4A 1NG9A 1JIJA 5EEGA 1W5TA 3GN1A 2HJSA 2EZTA 4G25A 4EVQA 3Q8KA 4KIUA 5TIIA 3ZOKA 4C6TA 4EK9A 4YJHB 3VKWA 1HQYE 4FHFA 1TGYA 4AULA 4BFYA 4EW3A 3UJ6A 4PBSA 1JMVA 1A5BB 4QOIA 1H2AS 3N0VA 5DT2A 3JATA 2I2XB 5AKGA 5B7QA 3P0RA 4Q6BA 2ZEJA 4FKBA 1RTKA 1UOPA 4TLBA 3BA1A 3ESDA 5JW6A 3AUYA 1JH8A 3FFWA 4XQ9A 3RS9A 4E5NA 4CXMA 3QVGA 3FNFA 2R44A 4WESB 1KDVA 4W5WA 3LX4A 4DWWA 1CRZA 4JUFA 4IS3A 5KHAA 3PUZA 1KYIA 1MIOB 2X5KO 2VYFA 4YBZA 1ISGA 3V4SA 1TQ4A 3T3IA 2D0OB 4MPPA 2P9HA 2CXSA 5EJEA 4HWGA 1XTIA 3I45A 2HHJA 5L51A 3F6EX 1JEYB 3R7NA 4WZBB 2AK3A 4D74A 3D8TA 2VR1A 1VG0B 3SF0A 3UMGA 4WK6A 2QXTA 4XWAA 2YN4A 3KZVA 1SHKA 2ZYTX 4HUQB 4ETNA 4QGSA 3U0VA 2Y2VA 4R81A 3U7EB 1CT9A 4XD7D 1FJ2A 2V7TA 2OUIA 1IXSB 4BVGA 1Q0LA 4OA5A 2E48A 1LVHA 2PLAA 2VZLA 3F7OA 5ITSA 2GFHA 1G4HA 1JU9A 3CFYA 4DL9A 3ZVNA 2CSXA 1X9HA 5HDQA 3SOZA 1UP4A 2QEQA 2AZDA 4PPQA 5M29A 3NGLA 5FPHA 2QTFA 3NOVA 5ALRA 3VHXB 1NMQA 1TK2A 3WGUA 2J6CA 4A23A 3UKDA 3P96A 1PJLA 2V74B 3KWJA 4B35A 3AM4A 1ZSYA 4WCFB 1UBMS 2JCVA 4UBOA 4RCVA 4KI7A 1SVKA 4Y6PA 4CF4A 4HAZA 2YWHA 1JFTA 3WRYA 3AERB 5CLFA 3G6WA 1C3EA 4WGFA 5EKDA 3SZMA 2UZ3A 4UOQA 4C6HA 2LCFA 3NHBA 3WLQA 4HQKA 1NVKA 4YI3A 4JQZA 4HEJA 4DF3A 3ETJA 3DP9A 3WSTA 3EZGA 1I0LA 4AC9A 2EIXA 3ZCXA 4CQMA 3TIGA 2MSKA 1URPA 2Q45A 2DWCA 1KYXA 4HPJB 4Y2PA 5LQSA 5DFAA 4ZZ2A 2AC2A 4IXDA 4BLOA 3B12A 2XDYA 4O5AA 3RRMA 2VAMA 4MVJP 3SS8A 1CPYA 2BFFA 2ECOA 1Q6YA 4LHVA 1QHGA 3HY6A 2C0QA 5REQB 1K75A 3Q5GA 4ARSA 4W4TA 2UKDA 3IC5A 5LN1A 2RGUA 2DSTA 4JEMA 4QPDA 1XZCA 3D43A 1ZD2P 4D3DA 3BFXA 4LY0A 2JLAA 3A1EA 4C88A 4ZDIA 5JQGA 4BNIA 2O2EA 1PK9A 4IIJA 1DRJA 1DRUA 4KI0A 4NZYA 3OIDA 4WHMA 2A1TR 3UHOA 1X94A 4G4JA 1E0KA 3TMYA 2F59A 4KUGA 1R5JA 3UTCA 3MPOA 5JE8A 2I29A 2NU9A 3LCCA 1OIVA 3H4TA 4QJIA 2GD1O 4FYJA 1Z5UA 4EECA 4U6QA 4I66A 2W7TA 4HZIA 3NJ8A 4KLZA 5DF1A 3UKJA 3NEJA 4HH3C 1SQFA 4RFSB 2IYAA 1MA3A 4Y2XA 1X6VA 1T9AA 2GARA 2EIHA 5JH7A 4WCDA 1P73A 2V0NA 5TC4A 3Q11A 1ODFA 3EAGA 2J5KA 1W4RA 2WP8J 1IM8A 1V16A 3NDRA 1A7UA 1WQ4A 5SY4A 3B6MA 1EUCB 2QTHA 5K3CA 1ZGGA 2H0RA 2C9OA 4UHCA 3CZ4A 1DRKA 3E0QA 4B32A 3D3NA 1NRJB 2VWPA 3SHOA 3VJRA 4NCBA 2HHHB 5FL3A 4QRHA 3V4VB 4CETA 1CJTC 1PJ2A 4IWNA 3MHPA 3R5SA 4D96A 1Q84A 2YFKA 3PQ3A 4TM7A 3W6OA 2CCGA 1RQNA 4FGKA 1N6IA 2A6PA 2PVSA 4QE3A 1Q12A 3ABOB 3GEEA 5BSGA 3U44B 1JSZA 5FF9A 4L7VA 4WXHA 4FVTA 2XXJA 2ZSKA 1NYRA 4PSCA 2IYOA 4EBBA 3R0VA 4JFRA 1E0AA 2GNPA 1LDGA 1YK1A 1UPFA 5TS3A 4GPAA 4QUBA 3O75A 4B85A 4X84A 4BFTA 1B74A 4TLDA 2RAVA 2R96A 3FD8A 2Q4RA 3CCFA 1F4PA 3DDSA 3TMAA 4CEJB 3TW6A 1NL3A 1DEXA 1TM2A 1XEXB 2RIRA 3BWVA 3REQA 4DTIA 3I05A 1AHHA 3G9ZA 4YUWA 3DV0A 2GK3A 2G1AA 2PKQP 3H6GA 2VK4A 3V8EA 2QXYA 4JBXA 5A3RA 1F4LA 1RMQA 3K1ZA 3UA3A 4BTVA 1W9MA 3DJYA 2ZJ8A 3GIWA 5KQGA 1NQVA 2OV3A 4NVRA 3UZUA 5DYWA 4Z2YA 2GAFA 1I3KA 5E1MA 2KM1A 1CRQA 1WDKA 1YBAA 1L7PA 5T4HA 1A04A 4TMWA 5IMBA 3N7UA 3SM9A 4PRYA 4M88A 3F47A 4QAQA 1NJ5A 4W82A 4F2WA 3LAWA 4DUGA 5A7FA 3ASUA 1UPAA 4FR2A 4HDQB 4I55B 2J0UB 4QOFA 3W3AD 1VCNA 1E3LA 1XQYA 3FLAA 3KYDA 2YOHA 1OWLA 1XZAA 1YHYA 1Z8DA 4RIFA 5EGSA 1WHSB 2LCQA 3RABA 1WAMA 4DSTA 3CEPB 4NZZA 1BOFA 3OJCA 4F1WA 3RSFA 5A4AA 3B82A 5K6AC 2WT9A 1D1SA 2QG6A 3DSRA 3B3AA 4LBVA 1KKUA 4LX8A 4Q4HB 1FTYA 1EUQA 4ID9A 2A8YA 2CBZA 3CVJA 3GFGA 4ENTA 4Y9UA 4B73A 4O2AF 3FUXA 1BYIA 1YONA 3CQ9A 1YOBA 2WIKA 4FT2A 1RHKA 3ND6A 5DJ5A 4OLBA 4JLDA 2ON6A 3H8VA 1M7BA 5B5SA 2QI9C 3SNKA 2CSUA 3NS7A 3BL6A 3PR1A 1X7DA 2O59A 3IEPA 4KHZA 4UE6A 1BS2A 1LB1B 4U9HS 1L4EA 4F3TA 4DCGA 3GLQA 4ZOCA 3ZNOA 3W2EA 2QGFA 4ZCQA 3TE7A 3RGGA 1PSWA 3UK2A 3MTBA 5IDVA 3DT6A 1B4DA 1WMBA 2AKAB 4ZAVA 1N6OA 4QXRA 1AOXA 4B2IA 3MWEA 4ODIA 1CJKC 5LZ7A 3FYUB 4CL3A 4CMEA 1OZHA 4DR6B 1PTJA 4GOOD 2VDQB 2O5EA 3PEVA 2QR5A 3X0DA 3LQ1A 1UBKS 4M76B 1E2NA 4OQDA 1ML3A 1P7YA 3BWBA 4UM8B 5K5EA 2GXSA 2WOOA 4QHTA 3DGEC 5FORA 4PG8A 2JLBA 3EEOA 4Z4IA 3NUQA 1G8FA 2OWEA 1GHTA 1GA6A 1Z4IA 2C2MA 2VH2A 3WWYA 2FJ0A 5LPNA 5FPSA 3LOPA 1QE0A 3MTEA 4FS3A 4IKOA 2KBEA 1Z18A 4OA8A 3D02A 5JD3A 2XZDA 2NVWA 4F06A 4X54A 2LUOA 4J7XA 2IYZA 3DE5X 5KSOA 2QX6A 2IEIA 2XCSB 1EGAA 5JRZA 1I3CA 3DP7A 5LUBA 1NMYA 3ODGA 2IBMA 3FYTA 4PWYA 4DDKA 1F6DA 2C1EA 4JAVC 1D7OA 4JT2A 4Y3UA 2CL5A 3NGMA 3WS7A 1L8AA 3T5DA 1SNYA 3DZKA 2HQRA 1JALA 5J1TB 5DBGA 1OXXK 5IKOA 1G8GA 2X8BA 1EVEA 2J4FA 3KTAB 1HEUA 3SXUA 5CIQA 1XTQA 3ANTA 1Z68A 1XLVA 2JDID 4R41A 3M3DA 1HL7A 2J7KA 3P2YA 2QAGA 4QU9A 3PJDA 3TM4A 1U04A 3F2VA 2JIDA 2X40A 1P4GA 4TT3A 1CUZA 2OLEA 5TF0A 3ZBUA 3ZCUA 5GZ1A 2NTYC 3BL8A 1DC7A 1OMOA 2ZVDA 2E18A 2V7VA 4YAJA 1MHTA 1AA9A 1U9CA 1M1UA 3ASZA 3ONWA 5K3BA 3MW8A 3TINA 1HI9A 1FDOA 2GKSA 2VJPA 2ZU0C 4ZCRA 4R1SA 1I4WA 2ADFA 4RSRA 4L5YA 3MMSA 3IAUA 3LUGA 2P41A 4JVOA 1SD5A 3ORFA 4FWBA 3HYTA 5M7EA 2WUWE 2EFEB 5DHTA 3P52A 1KVQA 4EMTA 1JJFA 1OIXA 1MRZA 1IE3A 2VHXA 4W6ZA 5AJXA 2GS9A 3O95A 2ZBGA 4HDSB 4XB6B 2HNKA 2DG2A 3G6KA 4BO4A 1Z5OA 4YPVA 1JG3A 1JDJA 3CWZA 2YXNA 4AZ3A 1BHO1 1FLVA 1B14A 4BMXA 3U16A 1CP2A 1C1HA 1W0JD 4RBNA 1M3SA 1FRFS 5DASA 3L8CA 5I9IA 1TU0A 5IHPA 3R8FA 1AGPA 2QU7A 5D6NA 4DXAA 1A4IA 1GQYA 2SHKA 4XX1A 2M6LA 1TF5A 1YZKA 2VF2A 4FZ3A 4OMUA 3OZCA 3ZQKA 6NULA 1I5OA 4H7IA 4I1RA 1X1TA 4PW0A 3R44A 2K5UA 2XSZD 4ZOBA 1G7RA 5JJKA 3ER9A 2W90A 1U7XA 3WYAA 1TQ2A 1NVBA 5LBTA 1XA3A 1JFFA 3TIIA 4QJ4A 4RX1A 3PZBA 2OECA 5FPYA 4MLCA 4L0MA 5JS6A 4EAQA 3T0GA 2F4VB 3GLIE 5FBKA 1R8SA 3FFAA 3OX2A 5DCWA 3MNFA 5KYXA 3KKMA 1SCQA 1NP7A 4EBFA 4WOJA 3TVDA 2RGBA 3OF2A 5AI6A 1KQNA 2FR0A 3GOQA 1CDZA 4ZQIA 1CY0A 3HACA 2UVPA 4UNQA 5BSFA 3QUAA 2BGIA 3D1LA 3MINA 5COAA 5HUJA 5IKPA 2RHCA 1VPWA 4NV1A 1OC2A 4HN2A 4DLBA 1UM9B 2D13A 1I7NA 2MR5A 3FMIA 3ONEA 4UVEA 1ISSA 4RK0A 1C30B 5FTMA 1WZUA 3IAM6 3WWPA 4DPLA 5IJ9A 2NO4A 3OCXA 1IVSA 1VP9A 3PPVA 2X0FA 1KDOA 4DIKA 1IVYA 2EKZA 4OHCA 3KT0A 1OFIA 4UMEA 2OXIA 3KKPA 3CRMA 4J90A 1PZMA 4DWOA 1GAEO 3IYLW 3GJSA 3VPGA 1FQOA 2HMAA 2WBLC 2PZEA 1V48A 2XCUA 4Q1CA 2A33A 1O97D 1U8YA 4N8SA 3H3FA 3JYPA 4P34A 5E2IA 4F9GA 1M6WA 1WCXA 3ITEA 1GGJA 1KJYA 4FHGA 4LHYA 3RT1A 2ZWOA 4RU1A 4A26A 1JG1A 2AFIA 1GCOA 3P9RA 4GI3A 2X77A 1CQZA 3OMLA 1E92A 4UAUA 1C8KA 1UK6A 2V6IA 2AD1A 4GVXA 2EFGA 3I9MA 3ICCA 3OUZA 1A8UA 1C7FA 2J5QA 4C0WA 2GAJA 3DXZA 4BE4A 1MCZA 3EUFA 3PJGA 3WYGA 1RWPA 3RFUA 2IS6A 2Z5GA 3MUOA 4TL9A 3PTAA 4HTFB 4B7AA 1P1HA 3DTVB 2OZEA 3T4EA 4R2IA 2Z1NA 3HKCB 3FDXA 3GFRA 1DIHA 4C07A 4LOJA 2WYVA 2WJ3A 1SB9A 1NJFA 1H2XA 2I5PO 5AUNB 2WYIA 4J0HA 2I2BA 5F7JA 1VE9A 4NBUA 4QUGA 1V45E 4ISCA 5K8JB 5KYNA 1VKZA 4LJ6A 1Y8CA 4G1VA 5KQRA 5KNBH 1BQEA 1UCFA 4KV9A 2FOXA 3NDBB 5F35A 4RMHA 3WQRA 3PB3A 4TGLA 4GGMX 3V2HA 5EIEA 2VSXA 2QJOA 3TQIA 3WSVA 1E5XA 1QHHB 3EBLA 3DGFC 2J3EA 3PXCX 4ZDJA 2AB0A 4ZOAA 1V37A 4PG7A 3FNEA 3BRWD 3ROZA 1AIPA 1UT6A 1LUAA 4Y2GA 5I7RA 4CKEB 2W8BA 5I3CA 4TRNA 3WDMA 1O6CA 1KO1A 16PKA 2ODQA 3OO1A 1N4AA 4KREA 3A0UA 3L9XA 3NWBA 3DXYA 3DL7A 5K3OA 3ZJ4A 4ARIA 3HZOA 2R00A 2ZBVA 4XX0A 4YUZA 3ZXYA 3RVDA 5THXA 4A9AA 4KXQA 2R7MA 1VLLA 2OXRA 3Q9NA 1OD6A 2JLXA 1KEWA 1SIOA 1PLJA 2IUEA 2NAPA 4J29A 4KIGA 1VMEA 4M0DA 4RABA 3UWSA 4XD2A 1T9CA 3IBYA 5AW5A 1XMQB 1IM5A 2BN4A 2Z9DA 3GPBA 4Z3OA 3KJFA 1QIDA 5TGZA 3WQSB 4S1PA 4BN5A 1N6LA 3GT7A 1U9JA 3TE6A 2IYNA 3JQ6A 2HPVA 1P0QA 3FETA 1M7HA 3UJ9A 1Q5PA 3QQ5A 3RS5A 4PZEA 4RVGA 1G98A 2CFOA 4TS4A 4MAFA 3GNQA 3SCZA 1I33A 2XYGA 4G1UC 1RJ9A 4RD3A 2XQJA 3MRTA 1JN0A 2FRDC 1GCUA 1NX6A 1H9AA 1LLUA 1Y5RA 2B2NA 2PFGA 3ACBA 3GHYA 3HKDB 4W5JA 4ZOLA 2VRBA 2ROQA 3P9SA 5FBRB 4M4SA 1L6IA 5C35A 1I3NA 2GN0A 1P1CA 5FYDA 2I6XA 3CSDA 3MGKA 3T94A 4FHZA 4Y0NA 4JASB 5L8VA 2RGXA 3TD6A 3FE2A 5AI9A 1P1IA 1U0OC 1MC5A 2J9FA 3FGOA 1Y63A 3O7MA 2QN1A 2SKEA 1H2ZA 1C4OA 1ZH0A 3QVLA 3VGJA 5ESRA 4JEIA 5FUQA 4ZC1A 1IBSA 1GGNA 1NM5A 4ZODA 1T3HA 1D03A 3UC9A 3KZ1E 2LGJA 4CTKA