3LLOA

Crystal structure of the stas domain of motor protein prestin (anion transporter slc26a5)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
132
Chain Sequence
b'SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSANIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prestin
publication title Structure of the cytosolic portion of the motor protein prestin and functional role of the STAS domain in SLC26/SulP anion transporters.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 44
structure length 132
sequence length 143
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3lloA00
3OIRA 5EUSA 1TH8B 4XS5A 2VY9A 4QTPA 3IH8A 5EUWA 1T6RA 1TIDB 1TILB 3AGEA 3NY7A 3OIZA 3ZTBA 3ZXNA 1H4XA 5EUZA 4HYLA 3LLOA 5EUUA 1THNB 3IH9A 2KLNA 1H4ZA 4DGFA 1BUZA 1SBOA 3IHBA 5EZBA 1VC1A 2KA5A 5EUXA 3IHAA 1H4YA 1AUZA 4DGHA 3LKLA 3AGDA 3T6OA 3IF5A 3MGLA 3F43A
chains in the Genus database with same CATH superfamily
2DXNA 4XS5A 4AEJA 3GVLA 1N6FA 1TILB 1V0EA 3EH7A 3LLOA 3D03A 4DMGA 3K50A 3IH9A 1HF2A 4DGFA 5EZBA 5EUXA 3LKLA 4HIZA 3T6OA 5EUSA 1V0FA 3OIRA 2VY9A 1K32A 1N6EA 3ZXNA 3JU4A 3C0KA 3GVKA 2ZO9B 2RRLA 1THNB 3GMFA 3IHBA 2KA5A 1H4YA 3AGDA 4L1CA 1WXXA 3F43A 2AS0A 1TH8B 3DJAA 3VSEA 1WXWA 4QTPA 1FC9A 3IH8A 5EUWA 1J7XA 1T6RA 1TIDB 3OIZA 4JC0A 1H4XA 5EUZA 4HYLA 5EUUA 4L8KA 4AE2A 1FC6A 3IHAA 1FCFA 4DGHA 3GK7A 2OASA 1N6DA 3IF5A 1FC7A 4GHNA 2CWWA 3MOGA 1BPLA 3GHFA 2B78A 2DXLA 3AGEA 3NY7A 3V97A 3ZTBA 3V8VA 3GVJA 2KLNA 1H4ZA 1BUZA 3QDQA 1SBOA 3LDFA 3D3UA 1VC1A 1AUZA 3DORA 3DUPA 3MGLA 2ZOAA
chains in the Genus database with same CATH topology
3OIRA 5EUSA 1TH8B 4XS5A 2VY9A 4QTPA 3IH8A 5EUWA 1T6RA 1TIDB 1TILB 3AGEA 3NY7A 3OIZA 3ZTBA 3ZXNA 1H4XA 5EUZA 4HYLA 3LLOA 5EUUA 1THNB 3IH9A 2KLNA 1H4ZA 4DGFA 1BUZA 1SBOA 3IHBA 5EZBA 1VC1A 2KA5A 5EUXA 3IHAA 1H4YA 1AUZA 4DGHA 3LKLA 3AGDA 3T6OA 3IF5A 3MGLA 3F43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OIR A;  5EUS A;  1TH8 B;  4XS5 A;  2VY9 A;  4QTP A;  3IH8 A;  5EUW A;  1T6R A;  1TID B;  1TIL B;  3AGE A;  3NY7 A;  3OIZ A;  3ZTB A;  3ZXN A;  1H4X A;  5EUZ A;  4HYL A;  3LLO A;  5EUU A;  1THN B;  3IH9 A;  2KLN A;  1H4Z A;  4DGF A;  1BUZ A;  1SBO A;  3IHB A;  5EZB A;  1VC1 A;  2KA5 A;  5EUX A;  3IHA A;  1H4Y A;  1AUZ A;  4DGH A;  3LKL A;  3AGD A;  3T6O A;  3IF5 A;  3MGL A;  3F43 A; 
#chains in the Genus database with same CATH topology
 2DXN A;  4XS5 A;  4AEJ A;  3GVL A;  1N6F A;  1TIL B;  1V0E A;  3EH7 A;  3LLO A;  3D03 A;  4DMG A;  3K50 A;  3IH9 A;  1HF2 A;  4DGF A;  5EZB A;  5EUX A;  3LKL A;  4HIZ A;  3T6O A;  5EUS A;  1V0F A;  3OIR A;  2VY9 A;  1K32 A;  1N6E A;  3ZXN A;  3JU4 A;  3C0K A;  3GVK A;  2ZO9 B;  2RRL A;  1THN B;  3GMF A;  3IHB A;  2KA5 A;  1H4Y A;  3AGD A;  4L1C A;  1WXX A;  3F43 A;  2AS0 A;  1TH8 B;  3DJA A;  3VSE A;  1WXW A;  4QTP A;  1FC9 A;  3IH8 A;  5EUW A;  1J7X A;  1T6R A;  1TID B;  3OIZ A;  4JC0 A;  1H4X A;  5EUZ A;  4HYL A;  5EUU A;  4L8K A;  4AE2 A;  1FC6 A;  3IHA A;  1FCF A;  4DGH A;  3GK7 A;  2OAS A;  1N6D A;  3IF5 A;  1FC7 A;  4GHN A;  2CWW A;  3MOG A;  1BPL A;  3GHF A;  2B78 A;  2DXL A;  3AGE A;  3NY7 A;  3V97 A;  3ZTB A;  3V8V A;  3GVJ A;  2KLN A;  1H4Z A;  1BUZ A;  3QDQ A;  1SBO A;  3LDF A;  3D3U A;  1VC1 A;  1AUZ A;  3DOR A;  3DUP A;  3MGL A;  2ZOA A; 
#chains in the Genus database with same CATH homology
 3OIR A;  5EUS A;  1TH8 B;  4XS5 A;  2VY9 A;  4QTP A;  3IH8 A;  5EUW A;  1T6R A;  1TID B;  1TIL B;  3AGE A;  3NY7 A;  3OIZ A;  3ZTB A;  3ZXN A;  1H4X A;  5EUZ A;  4HYL A;  3LLO A;  5EUU A;  1THN B;  3IH9 A;  2KLN A;  1H4Z A;  4DGF A;  1BUZ A;  1SBO A;  3IHB A;  5EZB A;  1VC1 A;  2KA5 A;  5EUX A;  3IHA A;  1H4Y A;  1AUZ A;  4DGH A;  3LKL A;  3AGD A;  3T6O A;  3IF5 A;  3MGL A;  3F43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...