3LMCA

Crystal structure of zinc-dependent peptidase from methanocorpusculum labreanum (strain z), northeast structural genomics consortium target mur16
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
191
structure length
191
Chain Sequence
GIHLFWDSRVPVGLSRPVSEELSAVLEMPVSRIDDGIFPLEGFDPVRNQYDAVKVLLKLDMFRRRMPQIFKPADMDLEFYNKFNHLHEKILLVTPGDLYEPLADFVFGLAYPKLGVAIVSPHRLQNEFYGKYADDSALIDRIVKEGAHEIGHLFGLGHCDNPGCIMYCPRNLDELDRKRKYFCGKCRVQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase, zinc-dependent
publication title Northeast Structural Genomics Consortium Target MuR16
rcsb
source organism Methanocorpusculum labreanum
molecule tags Hydrolase
total genus 60
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07998 Peptidase_M54 Peptidase family M54
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lmcA00
1HOVA 1G12A 3ELMA 1CXVA 3L0VA 4HMAA 3LKAA 1BM6A 1OM6A 1PWPA 1QICA 2MZIA 4GWMA 2X3BA 4XM6A 1YCMA 1YQYA 1OMJA 1JIWP 3LQBA 4DPEA 1R1HA 1OM8A 1GO8P 1WNIA 2K2GA 2Y6CA 1AYKA 1C7KA 1ZS0A 2W12A 3TVCA 2V4BA 3TT4A 1XFWA 3LK8A 1ZXCA 1MMQA 1QIBA 4H84A 1SATA 1CGFA 3RTTA 3V96B 3KHIA 4ZR5A 2J0TA 3WV1A 2OW1A 1D8FA 1O0QA 1MMBA 1S4BP 2YB9A 2OW0A 1PWVA 5D1TA 2DW1A 1IABA 2WOAA 1QJIA 2OXZA 2MZHA 4R3VA 4PKSA 3AYUA 2W13A 3KMCA 3P1VA 1BKCI 5I0LA 1CAQA 1BIWA 3KECA 2JIHA 3U1RA 2E2DA 4L6TA 5D7WA 1ROSA 4H30A 1PWUA 4GWNA 1ZXVA 3DWBA 1B3DA 1IAAA 1GKDA 4DF9A 3MA2A 1AF0A 1QUAA 4PKVA 3LJGA 1CIZA 3Q2HA 3Q2GA 2OW9A 4HX3A 3LIRA 1RM8A 2Y6DA 5D3CA 1R55A 5B5PA 3LJTA 5JMYA 1HFSA 2AYKA 1I73A 1ATLA 4WKIA 1H71P 1HFCA 1CQRA 2EROA 3LGPA 2D1NA 2DDFA 1AKLA 3G5CA 3KRYA 1G9KA 3TSKA 4JP4A 5I12A 3K7LA 4DD8A 1EAKA 2OI0A 1KBCA 2Z2DA 2XS4A 4FXQA 1R1JA 3DNGA 4GQLA 4FXYP 1Y8JA 3DSLA 1YOUA 2W14A 2X7MA 3NX7A 4H1QA 1A85A 1BQOA 3LQ0A 1R1IA 2OY2A 4IJOA 4Q1LA 1MMRA 1XFXA 4WK7A 4PKWA 1BUVM 2X3AA 4XCTA 1RMZA 4PKQA 2ERPA 2TCLA 5LABA 3HBVP 4PKRA 3GBOA 2WO9A 3F17A 1ASTA 1A86A 4FU4A 1GE5A 2MLRA 4H49A 4GR8A 3UVCA 1PWQA 3LUNA 3E8RA 1ZVXA 1ZP5A 1SLMA 1CGLA 3AIGA 3EHXA 1XURA 1SRPA 3KEJA 3WV2A 3EDIA 4PKTA 2FV5A 1QIAA 3LMCA 2W15A 4H2EA 5CZMA 1XUDA 4GUYA 3KEKA 4I03A 4JQGA 1JANA 4WKEA 5B5OA 3F16A 2OW2A 1KUFA 3ZUKA 2POJA 1GE6A 4XM7A 5CXAA 3HB2P 4H3XA 1SU3A 1D5JA 1G49A 4A3WA 1OS2A 2MLSA 5L79A 2DDYA 3CKIA 1OO9A 2A8HA 2KRJA 1G4KA 5L7FA 1OS9A 1JAOA 3BA0A 5I4OA 1KUIA 1K7IA 2OXWA 2AIGP 3EDHA 1IAEA 2JT5A 2OY4A 1PWWA 1L6JA 4WZVA 4FVLA 1B8YA 1JIZA 2D1OA 3LEAA 1BUDA 4H76A 3I7GA 2CKIA 4IN9A 1R54A 3EHYA 1UTTA 3HDAP 3SHIA 3N2VA 4A7BA 1SLNA 1Z3JA 2O36A 1EB6A 1JK3A 1UMTA 5BOYA 1HTDA 2X3CA 3ZXHA 1FBLA 1IACA 3DL1A 3VI1A 2OZRA 2K9CA 5BOTA 4EFSA 3O64A 1USNA 1HV5A 1YP1A 1C3IA 1HY7A 3LE9A 3LILA 3B92A 4WF6A 2DW0A 1D8MA 1O0TA 3LJZA 2RJPA 1GXDA 1I76A 3EWJA 4JPAA 5D2BA 2J83A 4GR3A 2OXUA 1BZSA 3KMEA 2I47A 4ILWD 3DPEA 3B8ZA 4GF1A 5I3MA 3O2XA 3P24A 3F15A 1UMSA 1FLSA 1CK7A 2USNA 4CTHA 4L63A 1JKYA 2W0DA 4L19A 1I1IP 1Y93A 5D1SA 2DW2A 5I43A 456CA 4I35A 3L0TA 3KWVC 3VTGA 3F18A 1FM1A 3ZVSA 4ON1A 1UEAA 3WV3A 1IAGA 1Q3AA 4JIJA 2ERQA 2E3XA 2YIGA 3K7NA 5BPAA 1GE7A 1JAQA 4JA1A 2OVXA 1DTHA 3F1AA 1XFYA 2MZEA 1KUGA 1GKCA 2CLTA 1QJJA 4AUOA 4XBHA 4AXQA 3HY7A 1K7QA 4AYKA 5I2ZA 1OM7A 4G9LA 1G05A 3B2ZA 4IUWA 4PKUA 3HYGA 1UTZA 4DV8A 1KAPP 1DMTA 3I7IA 3AYKA 2JT6A 3USNA 2JSDA 2O3EA 2PJTA 5H8XA 5CUHA 1XFVA 2QPJA 3G42A 4J4MA 1BQQM 4XM8A 1IADA 4AIGA 2N8RA 1C8TA 2SRTA 3HBUP 1XUCA 5D1UA 1D7XA 1JJ9A 1GO7P 2RJQA 1Y0VA 1ND1A 1KUHA 1BKCA 1EUBA 1J7NA 4QKZA 3HDBA 1BSWA 966CA 2FV9A 2OVZA 3EDGA 3RTSA 3TS4A 1MNCA 3N2UA 3DPFA 3OHLA 1SMPA 1JAPA 1XFZA 830CA 1XFUA 1CGEA 2L0RA 2WO8A 3HY9A 3F19A 4GR0A 3OHOA 3EDZA 4G0DA 3LIKA 1JH1A 2JNPA 1ZTQA 1KUKA 1K7GA 2XS3A 4H82A 3LUMA 1BKCE 1MMPA 2HU6A
chains in the Genus database with same CATH superfamily
1HOVA 1G12A 3ELMA 1CXVA 3L0VA 4HMAA 3LKAA 1BM6A 1OM6A 1PWPA 1QICA 2MZIA 4GWMA 2X3BA 4XM6A 1YCMA 1YQYA 1OMJA 1JIWP 3LQBA 4DPEA 1R1HA 1OM8A 1GO8P 1WNIA 2K2GA 2Y6CA 1AYKA 1C7KA 1ZS0A 2W12A 3TVCA 2V4BA 3TT4A 1XFWA 3LK8A 1ZXCA 1MMQA 1QIBA 4H84A 1SATA 1CGFA 3RTTA 3V96B 3KHIA 4ZR5A 2J0TA 3WV1A 2OW1A 1D8FA 1O0QA 1MMBA 1S4BP 2YB9A 2OW0A 1PWVA 5D1TA 2DW1A 1IABA 2WOAA 1QJIA 2OXZA 2MZHA 4R3VA 4PKSA 3AYUA 2W13A 3KMCA 3P1VA 1BKCI 5I0LA 1CAQA 1BIWA 3KECA 2JIHA 1XM5A 3U1RA 2E2DA 4L6TA 5D7WA 1ROSA 4H30A 1PWUA 4GWNA 1ZXVA 3DWBA 1B3DA 1IAAA 1GKDA 4DF9A 3MA2A 1AF0A 1QUAA 4PKVA 3LJGA 1CIZA 3Q2HA 3Q2GA 2OW9A 4HX3A 3LIRA 1RM8A 2Y6DA 5D3CA 1R55A 5B5PA 3LJTA 5JMYA 1HFSA 2AYKA 1XAXA 1I73A 1ATLA 4WKIA 1H71P 1HFCA 1CQRA 2EROA 3LGPA 2D1NA 2DDFA 1AKLA 3G5CA 3KRYA 1G9KA 3TSKA 4JP4A 5I12A 3K7LA 4DD8A 1EAKA 2OI0A 1KBCA 2Z2DA 2XS4A 4FXQA 1R1JA 3DNGA 4GQLA 4FXYP 1Y8JA 3DSLA 1YOUA 2W14A 2X7MA 3NX7A 4H1QA 1A85A 1BQOA 3LQ0A 1R1IA 2OY2A 4IJOA 4Q1LA 1MMRA 1XFXA 4WK7A 4PKWA 1BUVM 2YUFA 2X3AA 4XCTA 1RMZA 4PKQA 2ERPA 2TCLA 5LABA 3HBVP 4PKRA 3GBOA 2WO9A 3F17A 1ASTA 3DTKA 1A86A 4FU4A 1GE5A 2MLRA 4H49A 4GR8A 3UVCA 1PWQA 3LUNA 3E8RA 1ZVXA 1ZP5A 1SLMA 1CGLA 3AIGA 3EHXA 1XURA 1SRPA 3KEJA 3WV2A 3EDIA 4PKTA 2FV5A 1QIAA 3LMCA 2W15A 4H2EA 5CZMA 1XUDA 4GUYA 3KEKA 4I03A 4JQGA 1JANA 4WKEA 5B5OA 3F16A 2OW2A 1KUFA 3ZUKA 2POJA 1GE6A 4XM7A 5CXAA 3HB2P 4H3XA 1SU3A 1D5JA 1G49A 4A3WA 1OS2A 2MLSA 5L79A 2DDYA 3CKIA 1OO9A 2A8HA 2KRJA 1G4KA 5L7FA 1OS9A 3DTIA 1JAOA 3BA0A 5I4OA 1KUIA 1K7IA 2OXWA 2AIGP 3EDHA 1IAEA 2JT5A 2OY4A 1PWWA 1L6JA 4WZVA 4FVLA 1B8YA 1JIZA 2D1OA 3LEAA 1BUDA 4H76A 3I7GA 2CKIA 4IN9A 1R54A 3EHYA 1UTTA 3HDAP 3SHIA 3N2VA 4A7BA 1SLNA 1Z3JA 2O36A 1EB6A 1JK3A 1UMTA 5BOYA 1HTDA 4L7AA 2X3CA 3ZXHA 1FBLA 1IACA 3DL1A 3VI1A 2OZRA 2K9CA 5BOTA 4EFSA 3O64A 1USNA 1HV5A 1YP1A 1C3IA 1HY7A 3LE9A 3LILA 3B92A 4WF6A 2DW0A 1D8MA 1O0TA 3LJZA 2RJPA 1GXDA 1I76A 3EWJA 4JPAA 5D2BA 1TVIA 2J83A 4GR3A 2OXUA 1BZSA 3KMEA 2I47A 4ILWD 3DPEA 3B8ZA 4GF1A 5I3MA 3O2XA 3P24A 3F15A 1UMSA 1FLSA 1CK7A 2USNA 4CTHA 4L63A 1JKYA 2W0DA 4L19A 1I1IP 1Y93A 5D1SA 2DW2A 5I43A 456CA 4I35A 3L0TA 3KWVC 3VTGA 3F18A 1FM1A 3ZVSA 4ON1A 1UEAA 3WV3A 1IAGA 1Q3AA 4JIJA 2ERQA 2E3XA 2YIGA 3K7NA 5BPAA 1GE7A 1JAQA 4JA1A 2OVXA 3DTEA 1DTHA 3F1AA 1XFYA 2MZEA 1KUGA 1GKCA 2CLTA 1QJJA 4AUOA 4XBHA 4AXQA 3HY7A 1K7QA 4AYKA 5I2ZA 1OM7A 4G9LA 1G05A 3B2ZA 4IUWA 4PKUA 3HYGA 1UTZA 4DV8A 1KAPP 1DMTA 3I7IA 3AYKA 2JT6A 3USNA 2JSDA 2O3EA 2PJTA 5H8XA 5CUHA 1XFVA 2QPJA 3G42A 4J4MA 1BQQM 4XM8A 1IADA 4AIGA 2N8RA 1C8TA 2SRTA 3HBUP 1XUCA 5D1UA 1D7XA 1JJ9A 1GO7P 2RJQA 1Y0VA 1ND1A 1KUHA 1BKCA 1EUBA 1J7NA 4QKZA 3HDBA 1BSWA 966CA 2FV9A 2OVZA 3EDGA 3RTSA 3TS4A 1MNCA 3N2UA 3DPFA 3OHLA 1SMPA 1JAPA 1XFZA 830CA 1XFUA 1CGEA 2L0RA 2WO8A 3HY9A 3F19A 4GR0A 1OZ9A 3OHOA 3EDZA 4G0DA 3LIKA 1JH1A 2JNPA 1ZTQA 1KUKA 1K7GA 2XS3A 4H82A 3LUMA 1BKCE 1MMPA 2HU6A
chains in the Genus database with same CATH topology
1HOVA 1G12A 3ELMA 1CXVA 3L0VA 4HMAA 3LKAA 1BM6A 1OM6A 1PWPA 1QICA 2MZIA 4GWMA 2X3BA 4XM6A 1YCMA 1YQYA 1OMJA 1JIWP 3LQBA 4DPEA 1R1HA 1OM8A 1GO8P 1WNIA 2K2GA 2Y6CA 1AYKA 1C7KA 1ZS0A 2W12A 3TVCA 2V4BA 3TT4A 1XFWA 3LK8A 1ZXCA 1MMQA 1QIBA 4H84A 1SATA 1CGFA 3RTTA 3V96B 3KHIA 4ZR5A 2J0TA 3WV1A 2OW1A 1D8FA 1O0QA 1MMBA 1S4BP 2YB9A 2OW0A 1PWVA 5D1TA 2DW1A 1IABA 2WOAA 1QJIA 2OXZA 2MZHA 4R3VA 4PKSA 3AYUA 2W13A 3KMCA 3P1VA 1BKCI 5I0LA 1CAQA 1BIWA 3KECA 2JIHA 3U1RA 2E2DA 4L6TA 5D7WA 1ROSA 4H30A 1PWUA 4GWNA 1ZXVA 3DWBA 1B3DA 1IAAA 1GKDA 4DF9A 3MA2A 1AF0A 1QUAA 4PKVA 3LJGA 1CIZA 3Q2HA 3Q2GA 2OW9A 4HX3A 3LIRA 1RM8A 2Y6DA 5D3CA 1R55A 5B5PA 3LJTA 5JMYA 1HFSA 2AYKA 1I73A 1ATLA 4WKIA 1H71P 1HFCA 1CQRA 2EROA 3LGPA 2D1NA 2DDFA 1AKLA 3G5CA 3KRYA 1G9KA 3TSKA 4JP4A 5I12A 3K7LA 4DD8A 1EAKA 2OI0A 1KBCA 2Z2DA 2XS4A 4FXQA 1R1JA 3DNGA 4GQLA 4FXYP 1Y8JA 3DSLA 1YOUA 2W14A 2X7MA 3NX7A 4H1QA 1A85A 1BQOA 3LQ0A 1R1IA 2OY2A 4IJOA 4Q1LA 1MMRA 1XFXA 4WK7A 4PKWA 1BUVM 2YUFA 2X3AA 4XCTA 1RMZA 4PKQA 2ERPA 2TCLA 5LABA 3HBVP 4PKRA 3GBOA 2WO9A 3F17A 1ASTA 3DTKA 1A86A 4FU4A 1GE5A 2MLRA 4H49A 4GR8A 3UVCA 1PWQA 3LUNA 3E8RA 1ZVXA 1ZP5A 1SLMA 1CGLA 3AIGA 3EHXA 1XURA 1SRPA 3KEJA 3WV2A 3EDIA 4PKTA 2FV5A 1QIAA 3LMCA 2W15A 4H2EA 5CZMA 1XUDA 4GUYA 3KEKA 4I03A 4JQGA 1JANA 4WKEA 5B5OA 3F16A 2OW2A 1KUFA 3ZUKA 2POJA 1GE6A 4XM7A 5CXAA 3HB2P 4H3XA 1SU3A 1D5JA 1G49A 4A3WA 1OS2A 2MLSA 5L79A 2DDYA 3CKIA 1OO9A 2A8HA 2KRJA 1G4KA 5L7FA 1OS9A 3DTIA 1JAOA 3BA0A 5I4OA 1KUIA 1K7IA 2OXWA 2AIGP 3EDHA 1IAEA 2JT5A 2OY4A 1PWWA 1L6JA 4WZVA 4FVLA 1B8YA 1JIZA 2D1OA 3LEAA 1BUDA 4H76A 3I7GA 2CKIA 4IN9A 1R54A 3EHYA 1UTTA 3HDAP 3SHIA 3N2VA 4A7BA 1SLNA 1Z3JA 2O36A 1EB6A 1JK3A 1UMTA 5BOYA 1HTDA 4L7AA 2X3CA 3ZXHA 1FBLA 1IACA 3DL1A 3VI1A 2OZRA 2K9CA 5BOTA 4EFSA 3O64A 1USNA 1HV5A 1YP1A 1C3IA 1HY7A 3LE9A 3LILA 3B92A 4WF6A 2DW0A 1D8MA 1O0TA 3LJZA 2RJPA 1GXDA 1I76A 3EWJA 4JPAA 5D2BA 2J83A 4GR3A 2OXUA 1BZSA 3KMEA 2I47A 4ILWD 3DPEA 3B8ZA 4GF1A 5I3MA 3O2XA 3P24A 3F15A 1UMSA 1FLSA 1CK7A 2USNA 4CTHA 4L63A 1JKYA 2W0DA 4L19A 1I1IP 1Y93A 5D1SA 2DW2A 5I43A 456CA 4I35A 3L0TA 3KWVC 3VTGA 3F18A 1FM1A 3ZVSA 4ON1A 1UEAA 3WV3A 1IAGA 1Q3AA 4JIJA 2ERQA 2E3XA 2YIGA 3K7NA 5BPAA 1GE7A 1JAQA 4JA1A 2OVXA 3DTEA 1DTHA 3F1AA 1XFYA 2MZEA 1KUGA 1GKCA 2CLTA 1QJJA 4AUOA 4XBHA 4AXQA 3HY7A 1K7QA 4AYKA 5I2ZA 1OM7A 4G9LA 1G05A 3B2ZA 4IUWA 4PKUA 3HYGA 1UTZA 4DV8A 1KAPP 1DMTA 3I7IA 3AYKA 2JT6A 3USNA 2JSDA 2O3EA 2PJTA 5H8XA 5CUHA 1XFVA 2QPJA 3G42A 4J4MA 1BQQM 4XM8A 1IADA 4AIGA 2N8RA 1C8TA 2SRTA 3HBUP 1XUCA 5D1UA 1D7XA 1JJ9A 1GO7P 2RJQA 1Y0VA 1ND1A 1KUHA 1BKCA 1EUBA 1J7NA 4QKZA 3HDBA 1BSWA 966CA 2FV9A 2OVZA 3EDGA 3RTSA 3TS4A 1MNCA 3N2UA 3DPFA 3OHLA 1SMPA 1JAPA 1XFZA 830CA 1XFUA 1CGEA 2L0RA 2WO8A 3HY9A 3F19A 4GR0A 3OHOA 3EDZA 4G0DA 3LIKA 1JH1A 2JNPA 1ZTQA 1KUKA 1K7GA 2XS3A 4H82A 3LUMA 1BKCE 1MMPA 2HU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HOV A;  1G12 A;  3ELM A;  1CXV A;  3L0V A;  4HMA A;  3LKA A;  1BM6 A;  1OM6 A;  1PWP A;  1QIC A;  2MZI A;  4GWM A;  2X3B A;  4XM6 A;  1YCM A;  1YQY A;  1OMJ A;  1JIW P;  3LQB A;  4DPE A;  1R1H A;  1OM8 A;  1GO8 P;  1WNI A;  2K2G A;  2Y6C A;  1AYK A;  1C7K A;  1ZS0 A;  2W12 A;  3TVC A;  2V4B A;  3TT4 A;  1XFW A;  3LK8 A;  1ZXC A;  1MMQ A;  1QIB A;  4H84 A;  1SAT A;  1CGF A;  3RTT A;  3V96 B;  3KHI A;  4ZR5 A;  2J0T A;  3WV1 A;  2OW1 A;  1D8F A;  1O0Q A;  1MMB A;  1S4B P;  2YB9 A;  2OW0 A;  1PWV A;  5D1T A;  2DW1 A;  1IAB A;  2WOA A;  1QJI A;  2OXZ A;  2MZH A;  4R3V A;  4PKS A;  3AYU A;  2W13 A;  3KMC A;  3P1V A;  1BKC I;  5I0L A;  1CAQ A;  1BIW A;  3KEC A;  2JIH A;  3U1R A;  2E2D A;  4L6T A;  5D7W A;  1ROS A;  4H30 A;  1PWU A;  4GWN A;  1ZXV A;  3DWB A;  1B3D A;  1IAA A;  1GKD A;  4DF9 A;  3MA2 A;  1AF0 A;  1QUA A;  4PKV A;  3LJG A;  1CIZ A;  3Q2H A;  3Q2G A;  2OW9 A;  4HX3 A;  3LIR A;  1RM8 A;  2Y6D A;  5D3C A;  1R55 A;  5B5P A;  3LJT A;  5JMY A;  1HFS A;  2AYK A;  1I73 A;  1ATL A;  4WKI A;  1H71 P;  1HFC A;  1CQR A;  2ERO A;  3LGP A;  2D1N A;  2DDF A;  1AKL A;  3G5C A;  3KRY A;  1G9K A;  3TSK A;  4JP4 A;  5I12 A;  3K7L A;  4DD8 A;  1EAK A;  2OI0 A;  1KBC A;  2Z2D A;  2XS4 A;  4FXQ A;  1R1J A;  3DNG A;  4GQL A;  4FXY P;  1Y8J A;  3DSL A;  1YOU A;  2W14 A;  2X7M A;  3NX7 A;  4H1Q A;  1A85 A;  1BQO A;  3LQ0 A;  1R1I A;  2OY2 A;  4IJO A;  4Q1L A;  1MMR A;  1XFX A;  4WK7 A;  4PKW A;  1BUV M;  2X3A A;  4XCT A;  1RMZ A;  4PKQ A;  2ERP A;  2TCL A;  5LAB A;  3HBV P;  4PKR A;  3GBO A;  2WO9 A;  3F17 A;  1AST A;  1A86 A;  4FU4 A;  1GE5 A;  2MLR A;  4H49 A;  4GR8 A;  3UVC A;  1PWQ A;  3LUN A;  3E8R A;  1ZVX A;  1ZP5 A;  1SLM A;  1CGL A;  3AIG A;  3EHX A;  1XUR A;  1SRP A;  3KEJ A;  3WV2 A;  3EDI A;  4PKT A;  2FV5 A;  1QIA A;  3LMC A;  2W15 A;  4H2E A;  5CZM A;  1XUD A;  4GUY A;  3KEK A;  4I03 A;  4JQG A;  1JAN A;  4WKE A;  5B5O A;  3F16 A;  2OW2 A;  1KUF A;  3ZUK A;  2POJ A;  1GE6 A;  4XM7 A;  5CXA A;  3HB2 P;  4H3X A;  1SU3 A;  1D5J A;  1G49 A;  4A3W A;  1OS2 A;  2MLS A;  5L79 A;  2DDY A;  3CKI A;  1OO9 A;  2A8H A;  2KRJ A;  1G4K A;  5L7F A;  1OS9 A;  1JAO A;  3BA0 A;  5I4O A;  1KUI A;  1K7I A;  2OXW A;  2AIG P;  3EDH A;  1IAE A;  2JT5 A;  2OY4 A;  1PWW A;  1L6J A;  4WZV A;  4FVL A;  1B8Y A;  1JIZ A;  2D1O A;  3LEA A;  1BUD A;  4H76 A;  3I7G A;  2CKI A;  4IN9 A;  1R54 A;  3EHY A;  1UTT A;  3HDA P;  3SHI A;  3N2V A;  4A7B A;  1SLN A;  1Z3J A;  2O36 A;  1EB6 A;  1JK3 A;  1UMT A;  5BOY A;  1HTD A;  2X3C A;  3ZXH A;  1FBL A;  1IAC A;  3DL1 A;  3VI1 A;  2OZR A;  2K9C A;  5BOT A;  4EFS A;  3O64 A;  1USN A;  1HV5 A;  1YP1 A;  1C3I A;  1HY7 A;  3LE9 A;  3LIL A;  3B92 A;  4WF6 A;  2DW0 A;  1D8M A;  1O0T A;  3LJZ A;  2RJP A;  1GXD A;  1I76 A;  3EWJ A;  4JPA A;  5D2B A;  2J83 A;  4GR3 A;  2OXU A;  1BZS A;  3KME A;  2I47 A;  4ILW D;  3DPE A;  3B8Z A;  4GF1 A;  5I3M A;  3O2X A;  3P24 A;  3F15 A;  1UMS A;  1FLS A;  1CK7 A;  2USN A;  4CTH A;  4L63 A;  1JKY A;  2W0D A;  4L19 A;  1I1I P;  1Y93 A;  5D1S A;  2DW2 A;  5I43 A;  456C A;  4I35 A;  3L0T A;  3KWV C;  3VTG A;  3F18 A;  1FM1 A;  3ZVS A;  4ON1 A;  1UEA A;  3WV3 A;  1IAG A;  1Q3A A;  4JIJ A;  2ERQ A;  2E3X A;  2YIG A;  3K7N A;  5BPA A;  1GE7 A;  1JAQ A;  4JA1 A;  2OVX A;  1DTH A;  3F1A A;  1XFY A;  2MZE A;  1KUG A;  1GKC A;  2CLT A;  1QJJ A;  4AUO A;  4XBH A;  4AXQ A;  3HY7 A;  1K7Q A;  4AYK A;  5I2Z A;  1OM7 A;  4G9L A;  1G05 A;  3B2Z A;  4IUW A;  4PKU A;  3HYG A;  1UTZ A;  4DV8 A;  1KAP P;  1DMT A;  3I7I A;  3AYK A;  2JT6 A;  3USN A;  2JSD A;  2O3E A;  2PJT A;  5H8X A;  5CUH A;  1XFV A;  2QPJ A;  3G42 A;  4J4M A;  1BQQ M;  4XM8 A;  1IAD A;  4AIG A;  2N8R A;  1C8T A;  2SRT A;  3HBU P;  1XUC A;  5D1U A;  1D7X A;  1JJ9 A;  1GO7 P;  2RJQ A;  1Y0V A;  1ND1 A;  1KUH A;  1BKC A;  1EUB A;  1J7N A;  4QKZ A;  3HDB A;  1BSW A;  966C A;  2FV9 A;  2OVZ A;  3EDG A;  3RTS A;  3TS4 A;  1MNC A;  3N2U A;  3DPF A;  3OHL A;  1SMP A;  1JAP A;  1XFZ A;  830C A;  1XFU A;  1CGE A;  2L0R A;  2WO8 A;  3HY9 A;  3F19 A;  4GR0 A;  3OHO A;  3EDZ A;  4G0D A;  3LIK A;  1JH1 A;  2JNP A;  1ZTQ A;  1KUK A;  1K7G A;  2XS3 A;  4H82 A;  3LUM A;  1BKC E;  1MMP A;  2HU6 A; 
#chains in the Genus database with same CATH topology
 1HOV A;  1G12 A;  3ELM A;  1CXV A;  3L0V A;  4HMA A;  3LKA A;  1BM6 A;  1OM6 A;  1PWP A;  1QIC A;  2MZI A;  4GWM A;  2X3B A;  4XM6 A;  1YCM A;  1YQY A;  1OMJ A;  1JIW P;  3LQB A;  4DPE A;  1R1H A;  1OM8 A;  1GO8 P;  1WNI A;  2K2G A;  2Y6C A;  1AYK A;  1C7K A;  1ZS0 A;  2W12 A;  3TVC A;  2V4B A;  3TT4 A;  1XFW A;  3LK8 A;  1ZXC A;  1MMQ A;  1QIB A;  4H84 A;  1SAT A;  1CGF A;  3RTT A;  3V96 B;  3KHI A;  4ZR5 A;  2J0T A;  3WV1 A;  2OW1 A;  1D8F A;  1O0Q A;  1MMB A;  1S4B P;  2YB9 A;  2OW0 A;  1PWV A;  5D1T A;  2DW1 A;  1IAB A;  2WOA A;  1QJI A;  2OXZ A;  2MZH A;  4R3V A;  4PKS A;  3AYU A;  2W13 A;  3KMC A;  3P1V A;  1BKC I;  5I0L A;  1CAQ A;  1BIW A;  3KEC A;  2JIH A;  1XM5 A;  3U1R A;  2E2D A;  4L6T A;  5D7W A;  1ROS A;  4H30 A;  1PWU A;  4GWN A;  1ZXV A;  3DWB A;  1B3D A;  1IAA A;  1GKD A;  4DF9 A;  3MA2 A;  1AF0 A;  1QUA A;  4PKV A;  3LJG A;  1CIZ A;  3Q2H A;  3Q2G A;  2OW9 A;  4HX3 A;  3LIR A;  1RM8 A;  2Y6D A;  5D3C A;  1R55 A;  5B5P A;  3LJT A;  5JMY A;  1HFS A;  2AYK A;  1XAX A;  1I73 A;  1ATL A;  4WKI A;  1H71 P;  1HFC A;  1CQR A;  2ERO A;  3LGP A;  2D1N A;  2DDF A;  1AKL A;  3G5C A;  3KRY A;  1G9K A;  3TSK A;  4JP4 A;  5I12 A;  3K7L A;  4DD8 A;  1EAK A;  2OI0 A;  1KBC A;  2Z2D A;  2XS4 A;  4FXQ A;  1R1J A;  3DNG A;  4GQL A;  4FXY P;  1Y8J A;  3DSL A;  1YOU A;  2W14 A;  2X7M A;  3NX7 A;  4H1Q A;  1A85 A;  1BQO A;  3LQ0 A;  1R1I A;  2OY2 A;  4IJO A;  4Q1L A;  1MMR A;  1XFX A;  4WK7 A;  4PKW A;  1BUV M;  2YUF A;  2X3A A;  4XCT A;  1RMZ A;  4PKQ A;  2ERP A;  2TCL A;  5LAB A;  3HBV P;  4PKR A;  3GBO A;  2WO9 A;  3F17 A;  1AST A;  3DTK A;  1A86 A;  4FU4 A;  1GE5 A;  2MLR A;  4H49 A;  4GR8 A;  3UVC A;  1PWQ A;  3LUN A;  3E8R A;  1ZVX A;  1ZP5 A;  1SLM A;  1CGL A;  3AIG A;  3EHX A;  1XUR A;  1SRP A;  3KEJ A;  3WV2 A;  3EDI A;  4PKT A;  2FV5 A;  1QIA A;  3LMC A;  2W15 A;  4H2E A;  5CZM A;  1XUD A;  4GUY A;  3KEK A;  4I03 A;  4JQG A;  1JAN A;  4WKE A;  5B5O A;  3F16 A;  2OW2 A;  1KUF A;  3ZUK A;  2POJ A;  1GE6 A;  4XM7 A;  5CXA A;  3HB2 P;  4H3X A;  1SU3 A;  1D5J A;  1G49 A;  4A3W A;  1OS2 A;  2MLS A;  5L79 A;  2DDY A;  3CKI A;  1OO9 A;  2A8H A;  2KRJ A;  1G4K A;  5L7F A;  1OS9 A;  3DTI A;  1JAO A;  3BA0 A;  5I4O A;  1KUI A;  1K7I A;  2OXW A;  2AIG P;  3EDH A;  1IAE A;  2JT5 A;  2OY4 A;  1PWW A;  1L6J A;  4WZV A;  4FVL A;  1B8Y A;  1JIZ A;  2D1O A;  3LEA A;  1BUD A;  4H76 A;  3I7G A;  2CKI A;  4IN9 A;  1R54 A;  3EHY A;  1UTT A;  3HDA P;  3SHI A;  3N2V A;  4A7B A;  1SLN A;  1Z3J A;  2O36 A;  1EB6 A;  1JK3 A;  1UMT A;  5BOY A;  1HTD A;  4L7A A;  2X3C A;  3ZXH A;  1FBL A;  1IAC A;  3DL1 A;  3VI1 A;  2OZR A;  2K9C A;  5BOT A;  4EFS A;  3O64 A;  1USN A;  1HV5 A;  1YP1 A;  1C3I A;  1HY7 A;  3LE9 A;  3LIL A;  3B92 A;  4WF6 A;  2DW0 A;  1D8M A;  1O0T A;  3LJZ A;  2RJP A;  1GXD A;  1I76 A;  3EWJ A;  4JPA A;  5D2B A;  1TVI A;  2J83 A;  4GR3 A;  2OXU A;  1BZS A;  3KME A;  2I47 A;  4ILW D;  3DPE A;  3B8Z A;  4GF1 A;  5I3M A;  3O2X A;  3P24 A;  3F15 A;  1UMS A;  1FLS A;  1CK7 A;  2USN A;  4CTH A;  4L63 A;  1JKY A;  2W0D A;  4L19 A;  1I1I P;  1Y93 A;  5D1S A;  2DW2 A;  5I43 A;  456C A;  4I35 A;  3L0T A;  3KWV C;  3VTG A;  3F18 A;  1FM1 A;  3ZVS A;  4ON1 A;  1UEA A;  3WV3 A;  1IAG A;  1Q3A A;  4JIJ A;  2ERQ A;  2E3X A;  2YIG A;  3K7N A;  5BPA A;  1GE7 A;  1JAQ A;  4JA1 A;  2OVX A;  3DTE A;  1DTH A;  3F1A A;  1XFY A;  2MZE A;  1KUG A;  1GKC A;  2CLT A;  1QJJ A;  4AUO A;  4XBH A;  4AXQ A;  3HY7 A;  1K7Q A;  4AYK A;  5I2Z A;  1OM7 A;  4G9L A;  1G05 A;  3B2Z A;  4IUW A;  4PKU A;  3HYG A;  1UTZ A;  4DV8 A;  1KAP P;  1DMT A;  3I7I A;  3AYK A;  2JT6 A;  3USN A;  2JSD A;  2O3E A;  2PJT A;  5H8X A;  5CUH A;  1XFV A;  2QPJ A;  3G42 A;  4J4M A;  1BQQ M;  4XM8 A;  1IAD A;  4AIG A;  2N8R A;  1C8T A;  2SRT A;  3HBU P;  1XUC A;  5D1U A;  1D7X A;  1JJ9 A;  1GO7 P;  2RJQ A;  1Y0V A;  1ND1 A;  1KUH A;  1BKC A;  1EUB A;  1J7N A;  4QKZ A;  3HDB A;  1BSW A;  966C A;  2FV9 A;  2OVZ A;  3EDG A;  3RTS A;  3TS4 A;  1MNC A;  3N2U A;  3DPF A;  3OHL A;  1SMP A;  1JAP A;  1XFZ A;  830C A;  1XFU A;  1CGE A;  2L0R A;  2WO8 A;  3HY9 A;  3F19 A;  4GR0 A;  1OZ9 A;  3OHO A;  3EDZ A;  4G0D A;  3LIK A;  1JH1 A;  2JNP A;  1ZTQ A;  1KUK A;  1K7G A;  2XS3 A;  4H82 A;  3LUM A;  1BKC E;  1MMP A;  2HU6 A; 
#chains in the Genus database with same CATH homology
 1HOV A;  1G12 A;  3ELM A;  1CXV A;  3L0V A;  4HMA A;  3LKA A;  1BM6 A;  1OM6 A;  1PWP A;  1QIC A;  2MZI A;  4GWM A;  2X3B A;  4XM6 A;  1YCM A;  1YQY A;  1OMJ A;  1JIW P;  3LQB A;  4DPE A;  1R1H A;  1OM8 A;  1GO8 P;  1WNI A;  2K2G A;  2Y6C A;  1AYK A;  1C7K A;  1ZS0 A;  2W12 A;  3TVC A;  2V4B A;  3TT4 A;  1XFW A;  3LK8 A;  1ZXC A;  1MMQ A;  1QIB A;  4H84 A;  1SAT A;  1CGF A;  3RTT A;  3V96 B;  3KHI A;  4ZR5 A;  2J0T A;  3WV1 A;  2OW1 A;  1D8F A;  1O0Q A;  1MMB A;  1S4B P;  2YB9 A;  2OW0 A;  1PWV A;  5D1T A;  2DW1 A;  1IAB A;  2WOA A;  1QJI A;  2OXZ A;  2MZH A;  4R3V A;  4PKS A;  3AYU A;  2W13 A;  3KMC A;  3P1V A;  1BKC I;  5I0L A;  1CAQ A;  1BIW A;  3KEC A;  2JIH A;  3U1R A;  2E2D A;  4L6T A;  5D7W A;  1ROS A;  4H30 A;  1PWU A;  4GWN A;  1ZXV A;  3DWB A;  1B3D A;  1IAA A;  1GKD A;  4DF9 A;  3MA2 A;  1AF0 A;  1QUA A;  4PKV A;  3LJG A;  1CIZ A;  3Q2H A;  3Q2G A;  2OW9 A;  4HX3 A;  3LIR A;  1RM8 A;  2Y6D A;  5D3C A;  1R55 A;  5B5P A;  3LJT A;  5JMY A;  1HFS A;  2AYK A;  1I73 A;  1ATL A;  4WKI A;  1H71 P;  1HFC A;  1CQR A;  2ERO A;  3LGP A;  2D1N A;  2DDF A;  1AKL A;  3G5C A;  3KRY A;  1G9K A;  3TSK A;  4JP4 A;  5I12 A;  3K7L A;  4DD8 A;  1EAK A;  2OI0 A;  1KBC A;  2Z2D A;  2XS4 A;  4FXQ A;  1R1J A;  3DNG A;  4GQL A;  4FXY P;  1Y8J A;  3DSL A;  1YOU A;  2W14 A;  2X7M A;  3NX7 A;  4H1Q A;  1A85 A;  1BQO A;  3LQ0 A;  1R1I A;  2OY2 A;  4IJO A;  4Q1L A;  1MMR A;  1XFX A;  4WK7 A;  4PKW A;  1BUV M;  2YUF A;  2X3A A;  4XCT A;  1RMZ A;  4PKQ A;  2ERP A;  2TCL A;  5LAB A;  3HBV P;  4PKR A;  3GBO A;  2WO9 A;  3F17 A;  1AST A;  3DTK A;  1A86 A;  4FU4 A;  1GE5 A;  2MLR A;  4H49 A;  4GR8 A;  3UVC A;  1PWQ A;  3LUN A;  3E8R A;  1ZVX A;  1ZP5 A;  1SLM A;  1CGL A;  3AIG A;  3EHX A;  1XUR A;  1SRP A;  3KEJ A;  3WV2 A;  3EDI A;  4PKT A;  2FV5 A;  1QIA A;  3LMC A;  2W15 A;  4H2E A;  5CZM A;  1XUD A;  4GUY A;  3KEK A;  4I03 A;  4JQG A;  1JAN A;  4WKE A;  5B5O A;  3F16 A;  2OW2 A;  1KUF A;  3ZUK A;  2POJ A;  1GE6 A;  4XM7 A;  5CXA A;  3HB2 P;  4H3X A;  1SU3 A;  1D5J A;  1G49 A;  4A3W A;  1OS2 A;  2MLS A;  5L79 A;  2DDY A;  3CKI A;  1OO9 A;  2A8H A;  2KRJ A;  1G4K A;  5L7F A;  1OS9 A;  3DTI A;  1JAO A;  3BA0 A;  5I4O A;  1KUI A;  1K7I A;  2OXW A;  2AIG P;  3EDH A;  1IAE A;  2JT5 A;  2OY4 A;  1PWW A;  1L6J A;  4WZV A;  4FVL A;  1B8Y A;  1JIZ A;  2D1O A;  3LEA A;  1BUD A;  4H76 A;  3I7G A;  2CKI A;  4IN9 A;  1R54 A;  3EHY A;  1UTT A;  3HDA P;  3SHI A;  3N2V A;  4A7B A;  1SLN A;  1Z3J A;  2O36 A;  1EB6 A;  1JK3 A;  1UMT A;  5BOY A;  1HTD A;  4L7A A;  2X3C A;  3ZXH A;  1FBL A;  1IAC A;  3DL1 A;  3VI1 A;  2OZR A;  2K9C A;  5BOT A;  4EFS A;  3O64 A;  1USN A;  1HV5 A;  1YP1 A;  1C3I A;  1HY7 A;  3LE9 A;  3LIL A;  3B92 A;  4WF6 A;  2DW0 A;  1D8M A;  1O0T A;  3LJZ A;  2RJP A;  1GXD A;  1I76 A;  3EWJ A;  4JPA A;  5D2B A;  2J83 A;  4GR3 A;  2OXU A;  1BZS A;  3KME A;  2I47 A;  4ILW D;  3DPE A;  3B8Z A;  4GF1 A;  5I3M A;  3O2X A;  3P24 A;  3F15 A;  1UMS A;  1FLS A;  1CK7 A;  2USN A;  4CTH A;  4L63 A;  1JKY A;  2W0D A;  4L19 A;  1I1I P;  1Y93 A;  5D1S A;  2DW2 A;  5I43 A;  456C A;  4I35 A;  3L0T A;  3KWV C;  3VTG A;  3F18 A;  1FM1 A;  3ZVS A;  4ON1 A;  1UEA A;  3WV3 A;  1IAG A;  1Q3A A;  4JIJ A;  2ERQ A;  2E3X A;  2YIG A;  3K7N A;  5BPA A;  1GE7 A;  1JAQ A;  4JA1 A;  2OVX A;  3DTE A;  1DTH A;  3F1A A;  1XFY A;  2MZE A;  1KUG A;  1GKC A;  2CLT A;  1QJJ A;  4AUO A;  4XBH A;  4AXQ A;  3HY7 A;  1K7Q A;  4AYK A;  5I2Z A;  1OM7 A;  4G9L A;  1G05 A;  3B2Z A;  4IUW A;  4PKU A;  3HYG A;  1UTZ A;  4DV8 A;  1KAP P;  1DMT A;  3I7I A;  3AYK A;  2JT6 A;  3USN A;  2JSD A;  2O3E A;  2PJT A;  5H8X A;  5CUH A;  1XFV A;  2QPJ A;  3G42 A;  4J4M A;  1BQQ M;  4XM8 A;  1IAD A;  4AIG A;  2N8R A;  1C8T A;  2SRT A;  3HBU P;  1XUC A;  5D1U A;  1D7X A;  1JJ9 A;  1GO7 P;  2RJQ A;  1Y0V A;  1ND1 A;  1KUH A;  1BKC A;  1EUB A;  1J7N A;  4QKZ A;  3HDB A;  1BSW A;  966C A;  2FV9 A;  2OVZ A;  3EDG A;  3RTS A;  3TS4 A;  1MNC A;  3N2U A;  3DPF A;  3OHL A;  1SMP A;  1JAP A;  1XFZ A;  830C A;  1XFU A;  1CGE A;  2L0R A;  2WO8 A;  3HY9 A;  3F19 A;  4GR0 A;  3OHO A;  3EDZ A;  4G0D A;  3LIK A;  1JH1 A;  2JNP A;  1ZTQ A;  1KUK A;  1K7G A;  2XS3 A;  4H82 A;  3LUM A;  1BKC E;  1MMP A;  2HU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...