3LMGA

Crystal structure of the erbb3 kinase domain in complex with amp-pnp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
280
structure length
268
Chain Sequence
b'VLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor tyrosine-protein kinase erbB-3
publication title ErbB3/HER3 intracellular domain is competent to bind ATP and catalyze autophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 268
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lmgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lmgA01
4CSVA 1OBGA 3IECA 4IIRA 2BDJA 3HAMA 4LQMA 1OKWA 3DNEA 4EZ5A 5CX9A 4NL0A 3FXWA 5C8NA 3V01A 3RKBA 5AP4A 3LFDA 2UW5A 2HWOA 4TYEA 4ZTHA 2X2LA 4I6FA 4QPMA 2AC3A 3VS1A 3TTIA 4RBLA 4ZXTA 3TJCA 4QQCA 3L1SA 5KBRA 4G9CA 1IEPA 3EQIA 3QQLA 4MXZA 4R1VA 4F7LA 1OUYA 3FLNC 4PNKA 1IA9A 5AMNA 4M69B 4DCEA 4YO4A 4TYIA 2QOQA 5D11A 2CN5A 3TNPC 4ALVA 2ZVAA 2YM5A 4QYYA 1ZOGA 3TI1A 2A1AB 3V5TA 2IN6A 4F7SA 3E87A 4X2GA 3TKUA 3VBVA 3GC8A 5TT7A 4YJVA 3VF8A 2CMWA 3DQXA 1JKTA 3G0EA 3QZFA 3A8XA 4IJPA 2PK9A 3QRKA 4TYGA 3JR1A 3TNWA 4X6RA 2XP2A 3E7VA 3DBEA 4O7WA 3N9XA 4KIPA 4TKSA 3QAME 3UO4A 1UU3A 4BKZA 2P55A 5EHYA 3ZTXA 4F99A 4YSMA 3NUNA 3ZSGA 4A07A 3GOPA 4NH1A 3DJ5A 1PXMA 4ZMEA 5ACKA 4TPTA 3IDCA 4A4LA 3EHAA 2BRBA 3R8MA 4HVGA 4JIAA 5FM2A 3E8CA 4IB5A 5CAPA 1UU9A 2BIKB 3OUKA 3PP1A 2VTLA 1A9UA 2XH5A 1Q8WA 4RT7A 4EBWA 1OMWA 4NYEA 3V8WA 4M13A 3FEGA 4PPAA 2O64A 4EQUA 3DGKA 2WQBA 4LOQA 3CTJA 4U9AA 4IM3A 4H3QA 5GNKA 5HCYA 3UGCA 1YOJA 2SRCA 1Z57A 2VO7A 4C37A 2JBOA 4DYMA 2J50A 3QCSA 3LCTA 3VN9A 3GNIB 4CLJA 3TUDA 3KQ7A 1DS5A 3DT1A 3TG1A 4BDFA 4CQEA 4UY9A 4I5PA 1SNXA 3TKHA 3HMPA 4O7TA 4U44A 1WZYA 4F0FA 1DI8A 5F9EA 4AWIA 4IZ7A 2UW8A 4AG8A 1WVYA 3PSDA 2IW6A 1GIHA 2F4JA 5E92A 5M06A 2W9ZB 4L01A 3VUGA 4JBPA 3M2WA 3POZA 3VUDA 5K0XA 2HENA 5CS6A 4ZS0A 5L6OA 4CEGA 2UVXA 1SZMA 5K4IA 4J1RA 3R9DA 4IAIA 3HUCA 4O6LA 3LMHA 4MBLA 4ANBA 4DGGA 2G15A 3W2OA 5ANOA 3WE4A 1DAYA 4OR5A 2C3JA 3G2FA 4QYFA 5HEZA 3QUDA 4AW2A 4Y83A 4C4HA 1ZOHA 2G1TA 4YTHA 5L2WA 2GS6A 3BLRA 4ANQA 3UMXA 2OH4A 3FUPA 5EOLA 2O65A 5IA4A 2VTSA 2JDRA 2RKUA 3MFUA 2QU6A 4YZNA 1TQPA 4BCNA 3R04A 3R7VA 4DHFA 1OKYA 3KGAA 5CY3A 3R01A 5G6VA 4DEBA 5AUZA 5IZFA 4PV0A 3RM6A 3ETAA 5IDPA 1KOBA 3SDJA 4DE4A 4R3CA 3QHRA 3QCXA 5JK3A 4B4LA 4M69A 1LUFA 4OTFA 5EHLA 3OY3A 4QMOA 4EOLA 4IDTA 4JX3A 2UUEA 4EOSA 4OTIA 3FSFA 2WMRA 3C5UA 4RGJA 4ASEA 4EK6A 4L67A 3ZFYA 5L8KA 5JFSA 4AXAA 5KNJA 4PDOA 3MH0A 1NW1A 1Q62A 5DT3A 3RAKA 1YXSA 5HLWA 3C0IA 3Q9WA 3DOGA 4GU6A 4RA5A 3LOKA 2CN8A 3Q6WA 5FQDC 4CV8A 5CVFA 2XRWA 5C8MA 3OUNB 5B0XA 4G34A 4GVJA 1V0OA 3E7OA 2FYSA 1YI4A 2OI4X 5KBQA 2JAMA 1PHKA 1WBNA 1HCKA 1VZOA 4B8LA 4CFXA 3PXQA 1Q8ZA 3D5VA 3HV6A 5FEDA 3KK9A 3C4ZA 3Q32A 4ZP5A 4LRKA 5C4KA 4BIEA 5DI1A 4MQ1A 1VR2A 3B8RA 3QQUA 5DFPA 3RJCA 3ZONA 2VTMA 4E5WA 4D5KA 4F1MA 3M11A 5M57A 3MJ2A 3CIKA 4UMQA 1UNGA 5M4IA 5BUIA 3NDMA 2XNGA 3NEWA 3VUIA 2YM3A 4D1SA 3DLZA 4O6EA 4FIJA 4CG8A 3KULA 5AEPA 1STCE 5CALA 4YZMA 2J7TA 5LVNA 3V5QA 3H3CA 3DKFA 3C1XA 3P23A 2BROA 1YXXA 2C1AA 5GIOE 1MQBA 2YZLA 2JFLA 3H9FA 1P4OA 4GH2A 4J8NA 3OT8A 2I40A 5J7BA 4X2FA 3OXZA 2PVKA 1FGIA 4IB0A 5TF9A 2C5XA 4EUUA 1UU7A 5HTBA 3SRVB 3E8EA 1XJDA 4I92A 4G9RA 5FGKA 5A14A 5LQFA 2E9VA 2VTJA 4Y72A 3FZOA 3EQCA 3TJDA 3RVGA 2RGPA 3WZJA 4YP8A 4NCTA 5H9BA 2V0DA 4FTOA 4XNEA 3VUTA 4AE6A 3DBDA 4BTMA 4C4EA 4ZLZA 3FBVA 3WBLA 5GZ9A 4FYNA 1PYEA 4C3RA 3C4XA 1Q3WA 3TDWA 3EOCA 5IA0A 3MBLA 3F3VA 2DYLA 1NVQA 4GFGA 1O9UA 5I9UA 1T45A 3E88A 2WPAA 4CFNA 3NYNA 3QKKA 4YHJA 5AA9A 3FKOA 3FMLA 1RDQE 2WXVA 4M97A 5DWRA 4Z3VA 3LQ3A 3CE3A 5HG5A 4IX3A 5HGIA 1PY5A 4AP7A 4GIHA 4QQJA 2CKEA 5D10A 4HVHA 4MD7E 1YXUA 3GQLA 3ERKA 3OWKA 3HP2A 4NCTC 2WMBA 4WHZA 4DFBA 1W8CA 3ZLXA 1U5QA 4ZY6A 2C5NA 1AD5A 5BYZA 4GUEA 3FMDA 5DG5A 2OZAB 2XK4A 5ETCA 2VTPA 3CS9A 2BR1A 4L44A 4YPDA 4FG7A 2XKFA 1FINA 2R3IA 3BELA 1S9JA 4BDAA 1OGUA 1I09A 2XYUA 2JIVA 3E64A 5CSWA 3RINA 3EN5A 5JKGA 4DFZE 2FUMA 3FI4A 3NZ0A 4IZAA 3AD5A 2WMQA 3PXRA 3T8OA 3I5ZA 3O17A 3ZHPC 3BYVA 3GB2A 5D9HA 1FMKA 3DJ6A 3LFSA 1YWRA 2VWUA 3PLAE 1U54A 1JQHA 3H0ZA 3NW5A 4L42A 3LIJA 4UB7A 3VF9A 4YURA 5F1ZA 1EH4A 2VO6A 2Z7RA 2C6IA 4JT3A 4HGEA 3EYGA 3NCZA 1JKKA 1XH7A 2BALA 4FL2A 5HCXA 1OVEA 4BC6A 3U54A 3QQFA 4JG6A 5L6PA 2XKEA 3ZEPA 5KMNA 3BIZA 3NW7A 5CEQA 2IWIA 3GP0A 2QOCA 4V04A 5DGZA 1GNGA 5FBOA 4QT1A 4O84A 5AV1A 4RLLA 3NLBA 4CMTA 2X0GA 5J95A 3OD6X 1WBWA 2OGVA 1KWPA 5IH5A 2B9IA 3Q52A 5D12A 1H08A 2VTTA 4DH7A 5C4LA 5CASA 3LW0A 5M51A 4CRLA 4JLCA 2V7AA 3VBQA 2C30A 4C4IA 1UA2A 3EMGA 3BYMA 4RJ4A 3Q9YA 4I6HA 2OWBA 4IAZA 2DQ7X 5FWKK 5JRSA 4P90A 5K5NA 1W83A 3OROA 4JI9A 2PYWA 3IGGA 3FY0A 5I3RA 3M1SA 3Q5ZA 3D0EA 4U7ZA 1H07A 3H10A 3FSKA 4KS7A 4FKSA 3HMOA 4RJ3A 4TYHB 1F0QA 2Y7JA 3IW4A 4PDSA 3V8SA 4F08A 3C4EA 5KMOA 5AP2A 2WHBA 2X4FA 3DAKA 2YM7A 3ZXZA 1OL6A 5FTGA 1VYZA 3OOMA 2RFSA 4E73A 1YHVA 2RSVA 2WMAA 2OF4A 1B6CB 2R3OA 4K33A 4L68A 4ZTLA 2DUVA 5LVPA 2ZMDA 4X6QC 3ZMMA 4OTPA 3W2PA 3SA0A 1YOLA 2Z7LA 3OY1A 4ZSEA 4E26A 4R5SA 4F1OA 3D2KA 4L45A 4XRLA 4HCVA 2VZ6A 4CYJA 2OXYA 3AG9A 5ANDA 3U6HA 3DXPA 4M8TA 4U42A 2EVAA 3HYHA 1G3NA 3MTLA 2CNVA 2Q83A 4KRCA 5E91A 3KF4A 1J3HA 3LPBA 5HE2A 4I6QA 4IQ6A 4O2PA 4WUAA 2QOHA 3QRIA 5EKOA 4GJ3A 4N70A 3LQ8A 5L2IA 2X1NA 4YU2A 5ACBC 3EZRA 4AE9A 3RM7A 4CZUA 3CKWA 3NS9A 2UW6A 2CHLA 4XCUA 5HG8A 3RP9A 2JAVA 3II5A 4EQCA 4Q2AA 2X81A 4LRJA 1CKPA 2A4LA 3OHTA 1M2RA 4I5MA 3TCPA 2ONLA 4U41A 4BCFA 3BU6A 3CP9A 4FSZA 3UIMA 3WF6A 4GEOA 3UPXA 4O22A 4NT4A 4QMWA 4UXLA 3SC1A 5CWZA 3UODA 3PXFA 5AV0A 3NUUA 3DCVA 4N6ZA 2RFEA 3GFWA 4ZZNA 5EM6A 2YLEA 4RC4A 2X9FA 4FL3A 4CMOA 4HNIA 4TNDA 3BGQA 3UP2A 2XNEA 3UOHA 4BCGA 2Y9QA 4QMTA 3E8DA 4FVQA 1QCFA 3MFTA 4XV2A 4C4GA 3GCVA 2ZM4A 1FVTA 3NUYA 3ZLYA 4ERKA 4FKJA 2PZYA 4J96A 5IH4A 3GEQA 2ITTA 3PY0A 3ZEWA 3C50A 1W0XC 4F0GA 5EHOA 4NJDA 4QP3A 1KSWA 4BCJA 3UZRA 3HMNA 5EQEA 5CT7A 2YDJA 4DH3A 4GVAA 5AUTA 2XJ0A 2ONLC 2J0JA 2XCHA 3GC9A 4IBMA 5DMZA 3AT2A 4KKGA 4UX9A 3ZU7A 2VWIA 3FWQA 5HO7A 3ORIA 3LXLA 4YJNA 5FTQA 2W1FA 4NIFB 2UZDA 5CEMA 3UJGA 2WGJA 4ANMA 3ZDUA 3CD3A 2OLCA 3PPZA 5IPJA 4BCQA 3DQWA 1OBDA 3I6UA 4F9YA 4BBEA 3QKLA 2HZIA 4KB8A 3CY3A 3K5UA 3KXGA 4MBIA 3VS6A 2Z7SA 2G9XA 3F66A 4ZEGA 5LXMA 4KWPA 1PXIA 4M66A 3THBA 4S30A 2NP8A 2HXLA 2Z7QA 4IAYA 4EHZA 4YZDA 3R1SA 3QC9A 3ZLSA 4CG9A 1Z9XA 5I4NA 4EHGA 3RTPA 4RIOA 4OTQA 4TYHA 3LCOA 2OJFE 2YDIA 4NM7A 4WSYA 2OW3A 3EZVA 5M4FA 3GQIA 3UZTA 4O86A 1F3MC 5I3OA 4FTIA 4O0XA 5TOZA 3U8WA 4G5JA 4C4JA 5JFVA 4TN6A 3LLTA 4RIYA 5EW8A 5AV2A 3V5WA 3LKMA 3FAAA 3QTQA 4FSMA 4RX8A 1Y6BA 2XK3A 3JVRA 5A4LA 3IK3A 4MF0A 1KE6A 4GV1A 4H05A 4BY9E 5HD7A 5LWMA 3DAEA 4AX8A 5ANEA 4IB3A 4WNPA 5LOHA 3BHYA 2YAAA 3W2QA 4G3GA 3PRIA 4DGMA 5ITAA 4LYNA 2QCSA 4F63A 2B4SB 2PL0A 5AR8A 2W1ZA 5F94A 4DC2A 4KIKA 4PMTA 3PE2A 3DU8A 3LFBA 4D1XA 5FXRA 1U46A 2UZLA 1L3RE 5LCJA 2RF9A 1BYGA 3BRBA 3MFRA 3P79A 4BDCA 4DT9A 2VTNA 4CT1A 2OIQA 1FBNA 2J9MA 1O6LA 2PZRA 3UNZA 3D94A 2DS1A 4O27B 4C4FA 2ITPA 3ORKA 4FOBA 4FSYA 5LVMA 2VX0A 3CCNA 5HTIA 2F7ZE 4E6QA 4Q9ZA 2RL5A 4FX3A 5CQUA 3REPA 4G3FA 2B53A 2ITVA 3ULIA 4DEIA 5JT2A 3V5LA 2W5HA 4R7HA 3W18A 4FKQA 4QMZA 5E8XA 3AOXA 3O96A 1WBPA 3Q60A 5CU3A 5IH6A 4Y5HA 4MD8E 1GZNA 4CKJA 5ICPA 5GIPE 2CGUA 2HWPA 2BRNA 3ZS5A 1Q61A 3R9HA 2GQRA 4CKRA 5KUPA 4WBOA 4PY1A 3PWDA 3WI6A 3U4UA 4JX7A 3BBTB 3D2IA 1H24A 3JS2A 3KVWA 4ZK5A 4TXCA 5FRIA 2QR8A 3VO3A 3BWJA 2I1MA 1GIIA 2QHMA 4CT2A 3PDTA 4BCOA 4FEXA 2YIWA 4PX6A 3WZDA 4B8MA 4U81A 4U97A 5HICA 2YEXA 4IWQA 4W4XA 4ANNA 5DVRA 4OBOA 4YHFA 4C57A 2IG7A 4AT3A 3Q9ZA 1UVRA 4OBQA 3LAUA 3OEZA 4AT5A 1P4FA 3R7EA 1ZMWA 2R7BA 4TWOA 4J95A 3LZBA 1AQ1A 4NTSA 4W9WA 1XH8A 4S2ZA 3ZXTA 3LE6A 4Y95A 4FTNA 3MJ1A 3NAYA 4B9DA 3AT3A 4IJ9A 3GCSA 5BVKA 4AACA 4GK3A 4NJ3A 3A60A 5IMEA 4FODA 4U3YA 1PMVA 4JR3A 4C61A 3OBJA 4RWIA 5JH6A 3LMGA 2YITA 4IVCA 5E1SA 5KCVA 4E4MA 1Q3DA 3QZIA 5CVGA 4ANLA 2IVUA 3ROCA 3LJ1A 1PJKA 3FMMA 4O7RA 4PMPA 4JS8A 5K5XA 4C58A 1Q5KA 3QRUA 3R63A 4BWXA 4O7LA 3UO5A 4FSQA 1ZYJA 4EH4A 3R2YA 3D14A 3CY2A 4LL0A 4UV0A 2YAKA 3ODZX 1GOLA 3EQFA 1BLXA 4ZZMA 2JLDA 4KD1A 3RHXA 2P33A 2JBPA 4RFMA 4MXCA 3Q4CA 5ANIA 5G1XA 5HCZA 2H96A 3ORTA 3CGOA 2REIA 2GTMA 5DEWA 4MYGA 5JFWA 4UMUA 3DK6A 2WIHA 3FXZA 3FYJX 4CZTA 3HRFA 4EZ7A 4BI1A 3ZO2A 5TO8A 4OTRA 4QYHA 2ZYBA 2F2UA 3BYSA 2C6DA 2YCFA 3ZCLA 4RZVA 1M17A 3QX2A 4IZYA 1PXNA 2C6LA 2XS0A 2AUHA 3MSSA 4ALUA 4UWCA 3UQFA 3FQSA 4FT3A 3UE4A 3WIGA 4R7BA 4WD5A 3VIDA 1HOWA 3UIXA 3DZOA 5EI6A 2QLQA 4RRVA 5KE0A 1R0EA 4KIQA 4KRDA 5BVWA 2QNJA 2WTWA 3PVGA 4EK8A 5AUWA 3QC4A 4QYGA 4BDKA 4UWBA 1XBAA 4NTTA 3EL7A 4U6RA 5IA5A 4YR8A 4W9XA 4FZFB 2HAKA 3OCSA 4M7IA 1GJOA 4I0RA 5D41A 2CGXA 4CV9A 4DH5A 3EH9A 3AXWA 4U45A 1ND4A 4M3QA 1JLUE 1WVXA 1ZXEA 1R3CA 2E9OA 3COHA 3NRMA 5IQAA 3EN7A 4IVBA 4QD6A 5BUEA 4XMOA 2F7EE 4FTQA 4LGDA 4TYJA 1Q8TA 2GU8A 2ETKA 3UVRA 3KRWA 5CXZA 4M15A 3PPKA 4NM3A 4ASZA 3I4BA 5FTOA 2GCDA 4XP3A 4RSSA 2FSMX 4C34A 4CFWA 1ZYDA 1V0PA 1PXKA 4AW0A 4ZTSA 1WBSA 5CAOA 4ZSLA 3WIKA 4TRLA 4YJOA 2J2IB 4EH6A 5CVHA 4DAWA 1V0BA 4R77A 4FEQA 5ETIA 3HV5A 3LVPA 3CLYA 2XKDA 3UTOA 3Q2JA 3SG8A 3VC4A 3L8SA 2V7OA 3EQGA 3ATSA 4V01A 5D1JA 4Y73A 4IAKA 3Q4ZA 4O0UA 4RA4A 3UVPA 5ETAA 5HI2A 5HZNA 2XZSA 3BCEA 4D28A 2FSTX 2BFYA 5A4EA 3G90X 3G33A 3MB6A 4RIWB 5HU9A 3BPRA 3R9NA 2WAJA 3UC4A 4BDEA 5A4QA 4S32A 4W8EA 5L8JA 3A7JA 2G01A 2OFVA 3P5KA 3TWJA 3M42A 2OJJA 4DBXA 4NFMA 4ASDA 3AD4A 2C5VA 5CF4A 2Y6OA 3CR0A 3KXZA 3PVBA 1M2QA 2JC6A 5BPYA 4RX9A 3ELJA 4QMMA 1KUTA 3PXZA 1CTPE 3VS4A 5IA1A 2W4OA 4DFLA 4LM5A 3U4WA 4B99A 3ANQA 3MTFA 3NIZA 4DGOA 2YJRA 1ZYLA 2GDOA 2H8HA 2FGIA 3BE2A 5J5TA 1BL6A 1FVVA 4ANOA 2B55A 4RLKA 5M44A 3VQUA 4A9RA 4A9UA 4R3PA 1OIYA 5KKRB 1OL7A 2IW9A 4IDVA 1OM1A 1CKIA 2QQ7A 2QOFA 3E63A 1YW2A 3R83A 4MXAA 5IA2A 2ETMA 2YN8A 3HL7A 4DEHA 5DA3A 4RJ8A 2WB8A 4WNKA 3AD6A 2R64A 4JDKA 2VTHA 3I7BA 4H36A 4O1OA 5CSVA 4OUCA 3PG1A 1M7NA 3PJ8A 1KE8A 4L46A 4YJSA 3HDNA 1WMKA 4D2PA 5A9UA 4HCUA 3BI6A 3N4VA 4TZRA 5HIBA 3ALOA 2UZNA 3PZEA 5BMMA 4YBKA 1GZOA 3D5XA 1URCA 2J0KA 3AC4A 4XUFA 4C3FA 2W1HA 3ROYA 3OCTA 4E4XA 2ZDTA 2OFUA 2X39A 3EFWA 1ZZLA 1KE7A 3KN5A 4NSTA 3OOGA 5AM7A 3U9CA 2HK5A 4YSJA 1H27A 2ITYA 4JAIA 3SXSA 4M67A 3COKA 4ZZOA 5HNBA 3PSBA 5JRQA 4ID7A 5CENA 4BFMA 5K3YA 1X8BA 4EH8A 2W1IA 4HGSA 5FDXA 2WTKB 4XX9A 2R7IA 4PP9A 4IFCA 1OECA 3QA0A 3NNUA 2V55A 2YIYA 4O7VA 2B52A 2I7QA 4APCA 2CNUA 3V04A 4DTKA 2W1GA 1IR3A 2B1PA 1PYXA 3DS6A 4A4OA 2WMSA 3P86A 3EN9A 3F82A 5M55A 2ZM3A 2HOGA 2OU7A 4RG0A 4EKLA 4F7JA 4PP7A 5CI6A 3R0TA 5ANGA 4BRXA 4IC8A 4PDPA 2Y8OA 5E8WA 2F2CB 1ZWSA 2CLQA 3FZRA 4EONA 4I23A 5EDQA 4LRMA 3LXNA 4X3FB 5I0BA 3UG2A 3N4TA 3S4QA 3HV4A 4RIWA 2V22A 1WBTA 4FV0A 4U43A 5HG9A 3Q96A 5KMKA 4OAVB 5DPVA 3FMJA 3NNWA 5HLPA 3C9WA 4EYJA 2PE0A 4YTIA 3BV2A 3KRXA 4A9TA 3L9LA 4D4VA 3VWAA 3JYAA 2JKOA 4QP9A 2R3MA 2X4ZA 3LXPA 4KABA 4R6VA 3DZQA 1P14A 5CXHA 3AQVA 3FL4A 2YDKA 4I94A 4BZOA 2WD1A 5K9IA 5KHWA 3MIAA 2VWWA 4FZAB 5IG1A 4IWPA 4FOCA 3DFAA 4UZDA 5J8IA 2E9UA 4BB4A 3NSZA 3DV3A 3CQUA 4PPCA 4ORKA 3W2RA 3UQCA 3HA8A 3G9LX 2LAVA 2H6DA 2X8DA 5CNNA 3R22A 3GU8A 3RK7A 2ACXA 3DKGA 3GT8A 4LMNA 5ANKA 2C6MA 4FK3A 2ZOQA 2UW0A 3ZC6A 4E20A 4XV1A 5M53A 5H8BA 4EJNA 3VVHA 3EFKA 1WFCA 5CF5A 5HIEA 4FEVA 4RJ5A 4I21A 2UZUE 2OICA 2GTNA 3QYZA 4EBVA 3ORXA 4KKHA 4ACGA 3HNGA 3E3BX 3U9NA 2F7XE 3IKAA 4OBPA 4EL9A 3EB0A 4A7CA 1H0VA 2VWBA 4DTAA 5DE2A 1H01A 2ZAZA 4M0ZA 5FUTA 3CEKA 4ZIMA 2CNQA 4FV3A 3GENA 5CNOA 5CAQA 4PDYA 3HVCA 4Q9SA 4NK9A 3MB7A 5CF6A 3FDNA 2CSNA 2O0UA 3FPQA 5EG3A 4WIHA 3FZPA 3N4UA 5KMJA 4MK0A 4RFZA 2HW6A 4CVAA 5L8LA 1REKA 2XK7A 3LMIA 3BYUA 5EYMA 4BVUA 3SQQA 2X2KA 3S0OA 4YJUA 3AC5A 2QODA 4D2SA 4ZY5A 2PMLX 2BAKA 1XH9A 4O0RA 5CYIA 3DTWA 3HX4A 3NCGA 5B2KA 3KXNA 3VNTA 2VWZA 5CSHA 4IADA 3VW6A 4XG6A 3NGAA 4E93A 5A54A 3SV0A 2P0CA 5EI8A 1G8AA 4OT5A 4R78A 2Z02A 5BVNA 3BU3A 3FYKX 4QQTA 2HELA 3D7ZA 4MWHA 2XNPA 4AZEA 4C7TA 5JFXA 3AC1A 4G3DA 4V0GB 4AU8A 4MTAA 5FBNC 5DR6A 4BI2A 2PMIA 2V62A 4FSRA 4I4EA 3NAXA 4E6DA 4XP2A 3C4WA 3UZPA 2PUUA 3QQJA 4RJ6A 4FG9A 4FNYA 4D0WA 4R3RA 4MH7A 3C13A 3QHWA 3MVJA 4BI0A 2WTKC 2YJSA 3R9RA 4UALA 2YCRA 3R1YA 4TL0A 1J91A 4JQEA 4DH1A 2C3KA 3ACJA 3CXWA 3F7ZA 5HNGA 3I81A 1VJYA 5AR5A 4ZS4A 4FZ7A 4P7EA 2HYYA 1PF8A 3QQKA 3V3VA 4AAAA 2BILB 2P4IA 3V8TA 1URWA 3KCKA 4R5YA 2ZV7A 3WZEA 5AP1A 1OL5A 4ZLOA 3EN6A 4IX4A 2GS7A 5CU2A 2A27A 5CU4A 3DPKA 3ANRA 4LOPA 4YZCA 1O6YA 1YI6A 2JFMA 2WEIA 3NYVA 4MBJA 3UOKA 2OG8A 4AZSA 2NO3A 5J9LA 4AFEA 4O82A 1M2PA 1PMEA 4ZTQA 3U87A 3LFEA 3MESA 1FOTA 1PXLA 3HGKA 1R39A 3VHKA 1FPUA 2WMVA 3PYYA 4MAOA 5I9ZA 4USEA 4IWDA 4HYUA 1XBBA 1APME 5KZIA 4RZWA 2WMWA 3OS3A 4X21A 3TNIA 5M4CA 2CKPA 4H58A 4TWCA 4II5A 3FLWA 3A99A 3A62A 4GRBA 1UWHA 4CCBA 4FE2A 4I6BA 4U79A 2F57A 4KSPA 3R8VA 3TUBA 5EM5A 4ARKA 4XRJA 2QD9A 4EK4A 4BL1A 3VS2A 4RQKA 1SNUA 5AP6A 2NRYA 1U59A 4FTKA 1YKRA 4BCKA 1O6KA 5AUYA 5F4NA 3BX5A 2NPQA 2UZOA 3HV7A 3V6SA 2GHLA 3W8LA 3FKLA 3UP7A 1HCLA 3LJ0A 4ITHA 5LVLA 3SXFA 4ONAA 3RPOA 3P7CA 4XEYA 1RJBA 3VULA 2NRUA 1ZAOA 3QLFA 4L9IA 3UO6A 4IM2A 3AT4A 4QPSA 4RFYA 2F49A 3G15A 4FEUA 1YDTE 4N6YA 1JBPE 3F5UA 3O8UA 4BIBA 2QLUA 3RMFA 4EC8A 3QFVA 1H00A 2VTRA 5H3QA 3OG7A 4KNBA 4WNMA 3TV6A 3VW8A 4C02A 5IQHA 4P5ZA 2ZB1A 3RPYA 5M09A 3TEIA 2JIUA 4MHAA 4FSTA 2JDOA 4D4RA 1XH5A 3FC2A 2R3NA 4MEDA 4X2KA 3O8TA 3GFEA 4BN1A 5BMSA 5HNIX 3MVLA 4LV5A 3E92A 4BDJA 3KCFA 4OTHA 4RPVA 2QOIA 3OCGA 1IAHA 4H1MA 2R3FA 3IOKA 3F3WA 1F5QA 2HW7A 3JUHA 3SRVA 4OAUC 1IG1A 4MNEB 4FZDB 3FL5A 5BUJA 4IHPA 2BKKA 4I24A 3GC0A 4ZLYA 5D7AA 4HPUE 1K2PA 4N0SA 5E9EA 4K11A 3LCSA 5M56A 3F2RA 3VUMA 4DA5A 5EDPA 3WF9A 4MWIA 3EQPA 2R5TA 2R3PA 4QMNA 2WQMA 3EYHA 4P5QA 3AMBA 4PWNA 4MNFA 3VUHA 3F69A 4X2NA 3UNKA 4RQVA 4DTBA 1J1BA 2XM8A 3CJGA 3ORZA 4GYIA 4QMYA 4WG4A 5GHVA 2YCSA 5L2TA 5LMKA 1Q41A 2VN9A 3DDQA 4NWMA 4AOJA 3ZOSA 5AR3A 1KV2A 3I60A 3OWLA 2C6EA 4F6SA 2J0MB 4V05A 1YWVA 2WEVA 3IW6A 3NPCA 4GL9A 4OTWA 5EOBA 4AN3A 4D9UA 4DGLC 3QYWA 3CQEA 5HVKA 3EJ1A 4BF2A 4BKJA 1XO2B 5CU6A 3T9IA 3WF7A 2CPKE 1R0PA 2UW7A 2RFDA 1YHWA 4GJ2A 4J52A 4O1PA 3RPRA 4CYIA 4F7NA 1J7LA 2C47A 3KK8A 4OT6A 2WU6A 5EQPA 1Z5MA 3D5WA 2UZBA 1K9AA 2OZAA 3JXWA 5IUHA 3F3UA 3MPMA 3OFMA 4YC6A 5J5SA 2CKQA 2PMNX 3FLZA 4RWKA 5LMKC 2I0YA 2KTYA 3GU6A 3FZTA 3ZRKA 5GZAA 4FG8A 4AA5A 2GHMA 1MRUA 4MD9E 3BV3A 4FKWA 3CPBA 5GJDA 3GU5A 2QONA 4HCTA 2XJ1A 4L3PA 3G5DA 1ATPE 3FHRA 5HE1A 2YM6A 1J7UA 4YLKA 3W1FA 2OF2A 2BCJA 3ORLA 5AM6A 3R7OA 4LMUA 2C6OA 3G51A 4C2WA 4JR7A 4EHEA 1SVHA 1OITA 4AGWA 2X8EA 1REJA 4JBOA 4MCVA 2V5QA 2XK6A 4ALWA 3KB7A 2VUWA 3QL8A 2XNNA 4ZJVA 2IZRA 1LP4A 3I6WA 4ITJA 4JRNA 2YABA 5A4TA 3ZFXA 2QG7A 5DEYA 5D7VA 1UU8A 5B2MA 1ZYSA 3TACA 4IW0A 1OKVA 2A0CX 3COIA 1TQIA 2W1EA 3GCPA 3MYGA 2OIDA 4FGBA 4NM5A 4PL3A 5AUVA 3NYOA 2BRGA 4GT3A 5HO6A 1ZMVA 3IDBA 5CT0A 1K3AA 2XRUA 3BLQA 3V5JA 3P1AA 4K2RA 3G9NA 2WO6A 3ZM4A 2CGWA 2QKWB 4FICA 4P2KA 4C8BA 4JXFA 1XBCA 5HVJA 5JGDA 2XKCA 4PTCA 3FQEA 3S95A 5HORA 3JY9A 3R21A 2BMCA 4TWPA 4L00A 4KBCA 4DT8A 2XNMA 3NR9A 3NYXA 1GZ8A 3QTIA 1FMOE 4QYEA 3C7QA 3ACKA 4O0SA 5AIKA 3KKVA 2GQSA 3EQRA 3IG7A 3KXMA 5L6WL 1NVSA 4JVGA 4QTEA 5AADA 2JGZA 3FZ1A 4QRCA 5IQIA 3TM0A 5DLSA 1KE5A 3SAYA 4OW8A 5FP5A 2FSLX 2ZJWA 2WQOA 3DLSA 3PJCA 3ZO3A 3PLSA 4Q5HA 3F2AA 2VD5A 3F61A 4TW9A 1ZYCA 4ZAUA 2XIKA 1H26A 2IJMA 2C0TA 3PY1A 4HGLA 5ETFA 3C51A 4XYFA 3IPHA 5DN3A 4QP7A 4G6LA 4F70A 3OXTA 3AC3A 1B39A 2C0OA 4M12A 4I4FA 4D5HA 4FV9A 3QTUA 3TIYA 5AA8A 4XG4A 5EYKA 3OW3A 1WAKA 2ITQA 4ZTNA 3RK9A 2QOBA 2R0IA 3JVSA 2WQEA 4YJRA 4AFJA 3KMMA 4CFFA 3HZTA 3V51A 4GG7A 3TZ7A 2XMYA 2Q0NA 3GU7A 2PSQA 1E1XA 1YWNA 3R1NA 4NZWB 4AOTA 4KBKA 2ZV8A 3DAJA 3P78A 5F20A 3V5PA 5HX6A 3ZZWA 3QBNA 3SOAA 3OTVA 3BWFA 3MH1A 2W4JA 5H2UA 5AAGA 3KF7A 4A4XA 4ASXA 2XBAA 3U51A 4U5JA 2JDTA 3R8PA 3QGYA 3R02A 2XNOA 5AAEA 4FTMA 4PMSA 4L43A 4GCJA 4RIXB 3FY2A 1IASA 2OXXA 1SVEA 3NVMB 3FE3A 1KE9A 1CKJA 2W17A 2BHHA 4FMQA 4BTJA 4AGUA 3R8LA 5E8SA 4AS0A 4BICA 2P3GX 4C59A 5HG7A 3EQDA 2X2MA 4I41A 3F7WA 4DINA 1BUHA 2PVRA 4WA9A 2UV2A 2CGVA 3A7GA 5CSPA 3K3IA 5HD4A 4N57A 4G31A 1KV1A 4F0IA 4IZ5A 5B2LA 1OZ1A 2PVFA 4S34A 5CTPA 2PULA 2W1CA 4AZTA 1Q99A 3FZSA 4DFUA 2JKQA 3P4KA 4D2VA 2Y4IB 4WRSA 4O7ZA 3RNIA 3S00A 5EQYA 4CMUA 3BQRA 3RCDA 4NIFA 2Z8CA 4JG7A 3RCJA 4G3EA 3OC1A 4YHTA 4EI4A 2UW9A 3Q2MA 4WKQA 4FVRA 5IEXA 2BZJA 4DEAA 2UZWE 4FTUA 3DFCB 3QXOA 2BRMA 3LQ5A 2R3RA 4BTKA 4QP4A 3MH2A 1JSVA 4ZTMA 3R7GA 3Q9XA 2GNHA 4B7TA 4QP2A 1GZKA 1OUKA 3H30A 3Q04A 5K0KA 1W84A 4J53A 2C1BA 2DWBA 2EB2A 4BDGA 2JEDA 1JNKA 3IS5A 4FSNA 4ENYA 2VTOA 3EN4A 5E8VA 3UYSA 3UNJA 4MXYA 1BKXA 4OTGA 5EM8A 4D58A 4LI5A 2X6DA 4FUYA 5AWMA 4CD0A 4DEGA 2FA2A 1YDSE 3NUSA 4U0IA 3COMA 3R1QA 3MI9A 5HE3A 3SG9A 2ETRA 4UMTA 2QO7A 3C0GA 2WNTA 5HBHA 4XP0A 2I6LA 2QHNA 2C68A 5GJGA 4O0TA 5IF1A 1NT2A 3K5VA 4W4YA 3EKNA 4NW6A 4O0YA 4JL9A 2XM9A 3E62A 1CMKE 3DB8A 4FNXA 1WBOA 4ACCA 1IAJA 4GT4A 3D7TB 4AZWA 4E7WA 3ORNA 5DR9A 2PUPA 4BDIA 3F5XA 3TV7A 1H1QA 3VJOA 4BCMA 4QP1A 4D4SA 3QWJA 2VGOA 4KAOA 3BGPA 1YVJA 4L8MA 4JNWA 2EUFB 4X7QA 3RAIA 5M4UA 3ZZEA 2W99B 2PZPA 4FNZA 3PIYA 3W32A 1SVGA 4BYIA 4PMMA 2HY81 2C0IA 3KXXA 3QRTA 5A46A 3BU5A 3RBWA 2IZTA 1YQJA 2YM4A 3FQHA 4FKPA 3RNYA 4KUJA 1PMUA 4XG8A 3VBYA 4QMLA 3ORMA 4L6QA 4QO9A 4F1TA 2WMTA 4YPSA 5L2SA 3HUBA 3KC3A 4FKTA 4D0XA 1OIQA 2QC6A 2QURA 2BFXA 2BZKB 2ZV9A 3P7BA 4DF3A 3OXIA 4S33A 4ENXA 1G5SA 5LJJA 4W4VA 2BIYA 4L53A 2PVMA 4Y46A 4BZNA 3EQBA 4DH8A 3TT0A 4D2WA 5CF8A 3NUXA 5FG8A 4D9TA 4F9WA 3P9JA 4JOAA 4WBBB 5CAVA 1TKIA 1NA7A 1T46A 2XCKA 3BEAA 4MF1A 3QA8A 3FMNA 4K0YA 4EOOA 3KREA 4DLIA 2VTQA 4PL4A 4FT0A 2YFXA 3PA5A 4CZYB 3OEFX 1XQZA 3PA4A 4HVIA 4E6CA 5EK7A 2B54A 3FXXA 2LGCA 5CU0A 3MIYA 3PRFA 4FSUA 2W5BA 3KEXA 4PPBA 4AA4A 2RIOA 3DKOA 3HMMA 4XOZA 2XEZA 5J9YA 2ERKA 2GHGA 4O21A 5K4JA 1ZOEA 4ANSA 2XBJA 3MN3A 2VNWA 1FGKA 3RAWA 2PWLA 4RWLA 3T3VA 2VAGA 3KU2A 5EW3A 4DG0E 4ZOGA 4FGRA 4UMPA 4I0SA 5GJFA 3VHEA 4UEUA 3PUPA 3NUPA 2R3KA 3VS3A 3BEGA 3FLSA 4EKKA 4GSBA 5AIRA 2WU7A 3GGFA 3TNQB 3A8WA 4O81A 3ZM9A 2O3PA 4BR3A 3SOCA 1B38A 2PVYA 5LMAA 4WT6A 5IUIA 3UOLA 3QTRA 3OBGA 4LL5A 1UKHA 3P7AA 2C3LA 5TE0A 3GBZA 3W16A 3VRZA 2ZM1A 1YDRE 3R8UA 2W06A 4G2FA 3TNHA 4CTBA 4M84A 4K9YA 5KMMA 3NX8A 3MVMA 4E5AX 3RHKA 4WG5A 1YXVA 5F95A 3GI3A 3CSVA 2R4BA 3CC6A 3O8PA 1J1CA 4I5HA 2OXDA 4USFA 3S3IA 3W55A 4C0TA 2WQNA 4RVTA 2P2HA 4FV8A 3K54A 5BVFA 5CSXA 4HW7A 4OTDA 3NNXA 2QG5A 3QUPA 3DDPA 4GMYA 5IUGA 3QD2B 1NXKA 4OGRA 4DCAA 4F9AA 1WCCA 5KX8A 4E3CA 4E8AA 4S31A 3OWJA 5DT4A 2O8YA 3QZGA 3VBXA 3KL8A 2JD5A 2W9FB 2QOLA 3F5PA 3IW8A 4A9SA 1Q4LA 4F6UA 4U40A 4FKOA 4FVPA 2CDZA 5CANA 4LUDA 2GSFA 1LEZA 1Q8YA 2XB7A 1IA8A 4E6AA 4RVLA 3MY5A 5DOSA 5CEOA 3ZFMA 4WO5A 4NUSA 3Q5IA 5E7RA 5E8UA 2J51A 4K8AA 4FKIA 3W33A 1H1SA 3QKMA 3POOA 5DYJA 4DGNA 3ZUUA 1NVRA 1ZLTA 3Q53A 2J5FA 4CCUA 4YTCA 1A48A 4KS8A 5FM3A 4GG5A 5I9WA 2R3HA 4ZSJA 3RALA 4QTAA 4C38A 4JDHA 5JZJA 2G2HA 4RC2A 3RPVA 4F9CA 5HTCA 4UYAA 4JDJA 4EUTA 4H3BA 2EWAA 2X7OA 4EH9A 2J4ZA 4XV9A 3RZFA 4BYJA 4MQ2A 4C36A 4XJ0A 4YGAA 4DEDA 4DG3E 4ITIA 1QMZA 5FLFA 3R2BA 5IA3A 3WE8A 4YLJA 3UG1A 4IE9A 4IC7A 1OL1A 4BTFA 4JQ7A 5IMXA 2WMXA 4I1ZA 4Y8DA 5J7HA 5L3AA 4WRGA 3QU0A 3T9TA 4IACA 5HBEA 4XOYA 4TTHB 4PL5A 3A7HA 1DM2A 1JPAA 3D5UA 3IQ7A 4EQMA 5BYLA 2XVDA 2CCIA 3H9RA 2XIRA 3AGMA 2OBJA 4MXOA 4ZSGA 3UBDA 4EOMA 4Z7HA 2GFCA 2WELA 2B7AA 3P08A 4XV3A 5BVEA 5C1QB 5EYDA 4O7NA 2C6TA 3SLSA 2IZSA 4U3ZA 5BNJA 5TKDA 2OKRA 2RG5A 4AGCA 5AR4A 3SHEA 1Y6AA 3DBFA 1BI8A 2QO2A 3TXOA 2CJMA 4KKEA 2J90A 5E1EA 5C27A 3KULB 3PP0A 4EC9A 2W5AA 4YUQA 5DRBA 3K2LA 2W1DA 4J99A 4QNAA 1R1WA 4AZVA 3ZC5A 4Z16A 5HQ0A 2GQGA 2ITNA 2YA9A 1R78A 2GPHA 3RI1A 3RPSA 4HOKA 1OKZA 2JDVA 5IEVA 4BCPA 1H1RA 1YRPA 5E8ZA 3KXHA 4UWYA 3FHIA 1E1VA 5JMSA 1PKDA 4UMRA 2UZTA 3W2CA 3ID6C 3AMAA 2G2FA 3GCUA 2EXCX 2YIQA 2ZMCA 4C2VA 5J1VA 4A9YA 2VNYA 3KFAA 5HHWA 1P2AA 2F9GA 5DBXA 4Z9LA 5IDNA 4YNEA 5HESA 2YZAA 4GYGA 5L2QA 2XF0A 4JJRA 1JAMA 2JKMA 4XG2A 2GS2A 4QMPA 4XH6A 2C6KA 3AC8A 3UIBA 4E1ZA 4IVAA 2A2AA 1JWHA 2C5OA 5CEKA 1QPDA 1LEWA 1NY3A 3LFFA 3MA3A 4EJ7A 3ITZA 3B2WA 3MVHA 4NU1A 2WTIA 3I0OA 4FIIA 1L8TA 3LCDA 4CTCA 3IO7A 3EKKA 4ZTRA 5C8KA 4IAAA 4F64A 4RC3A 2O5KA 1DI9A 4FI1A 4RJ7A 2X8IA 2XNBA 4APPA 5AUUA 3ZO1A 3C5IA 5EDRA 2J6MA 4GFOA 1Y91A 1PRYA 5LWNA 5FDPA 4FKLA 5CEPA 4O7SA 4FR4A 1QPJA 4G3CA 3Q6UA 2IPXA 5CLPA 3RK5A 4M68A 3FI3A 3IW5A 4WG3A 2HCKA 3UQGA 3MA6A 4ZJJA 1UNLA 2W96B 5AR2A 1J7IA 5KKRC 5EFQA 2WMUA 2OIBA 5I9VA 4FIEA 4CGAA 3QTZA 3HLLA 3BHUA 3Q4TA 4IAFA 4IXPA 4WOVA 4JAJA 4FV7A 3ZBXA 5LVOA 2ITXA 5JZNA 3HAVA 5IISA 4IANA 4KSQA 4YLLA 4LGGA 3ZUVA 4D55A 1A06A 4FYOA 3TZ9A 5HVYA 3VJNA 5KMLA 3BHVA 2R3JA 4X3JA 3D15A 4U80A 2VX3A 2Y6MA 3HECA 1U54B 3UYTA 1QPEA 5BYYA 2C5YA 3MV5A 3VAPA 3RZBA 1H8FA 2XK8A 2HZNA 2WKMA 3PZHA 3WILA 3QD0A 3WARA 4EORA 4FT9A 4R7IA 3UDBA 3EWHA 2VX1A 5BX0A 3DNDA 2ITWA 4BGQA 4FKVA 5FD2A 5GINE 1ZY5A 2QKRA 5T68A 1YOMA 3KRRA 3L8XA 4W8DA 1Q97A 1U5RA 4X3FA 2J5EA 1ZY4A 5DIAA 5A4CA 2IZUA 4P4CA 3O2MA 4GKIA 1W98A 3FLYA 1BMKA 5E8TA 4DFXE 3HV3A 3A7FA 5DH3A 3BE9A 3BQCA 3O0GA 2H9VA 4R1YA 5BVOA 3PE1A 1QL6A 3PJ3A 5JSMA 3Q3BA 4QTDA 3CKXA 4IVDA 5IU2A 4ZMFA 4DFYA 3C0HA 4AN9A 4QOXA 2PZIA 4BDDA 3MW1A 3WYXA 2KULA 4G6NA 4BIDA 3S1HA 1FQ1B 3GUBA 3VBWA 1MQ4A 5IQEA 4GK4A 2JDSA 1H0WA 3LJ2A 4GU9A 3QUEA 3R73A 5FXQA 2PE1A 2YHVA 4FTAA 4BCIA 4BWKA 3SW7A 4FA2A 4K1BA 4X3FC 1OL2A 2YERA 4RWJA 3RGFA 3PIXA 2Z2WA 3WF5A 4DITA 4D2TA 1SM2A 2IVTA 1SMHA 3BHHA 3KVXA 4M14A 4XHKB 5IKWA 3FMEA 3NNVA 3LM5A 5EW9A 3DK7A 2GNLA 3OW4A 4GKHA 3MWUA 2YCQA 4UZHA 3NMUF 2UW4A 1JKLA 2B9FA 5AR7A 3GOKA 1MP8A 4QMUA 5AP0A 5LCKA 4EH7A 4N4SA 4JBVA 4EEVA 5CQWA 3D83A 4ZJIA 4EOJA 4J98A 2BZIB 2PVJA 3B8QA 4KINA 5AP7A 4EYMA 5H8EA 3VBTA 3GCQA 3ZH8A 3N51A 3SW4A 5J79A 2EXEA 3NWWA 4CNHA 5C26A 5IQCA 2W4KA 3A4PA 3H0YA 5LMBA 1H28A 2OJ9A 2YLFA 4D1ZA 4DFNA 5HIDA 4A06A 3DBCA 1RQQA 3I1AA 2VTIA 4IM0A 4UBAA 5I5ZA 3C4FA 4ACHA 5E4HA 3U55A 3WZKA 3NVKI 3LXKA 3ZBFA 3SGCA 4UYNA 4EH3A 3TZMA 3O7LD 1OIUA 4AQCA 1BX6A 2ITZA 2BKZA 4CKIA 1UV5A 5CAUA 4J97A 5AP3A 1IRKA 2X6EA 4FIGA 4YJQA 2AC5A 4IFGA 4GIIA 3ATTA 2PE2A 4JDIA 2Q0BA 2XUUA 4FF8A 4PTGA 5HE0A 3MY1A 4GS6A 3IGOA 4HVDA 3EIDA 3RWQA 2W05A 3TTJA 3ZO4A 2YISA 1H1PA 5IQBA 1LPUA 4O38A 4G17A 4V0GA 5HBJA 2ERZE 1XHAA 5EKNA 5JQ8A 5KMIA 1XWSA 2CKOA 4H39A 3L9MA 4JBQA 4Z7GA 4ACDA 4NM0A 3A7IA 2OJGA 5J87A 5JGAA 4FV5A 4UXQA 2WTVA 4FSWA 4IB1A 3O71A 4FTCA 5GZ8A 2B0QA 3BHTA 3OWPA 4NW5A 3NW6A 3V6RA 1GIJA 4JG8A 3HRBA 3HMIA 2IO6A 3ODYX 3KA0A 4K77A 3AC2A 3ZUTA 1FVRA 5HOAA 4EZ3A 2UVZA 4PTEA 1WBVA 3U6JA 3TDVA 2XA4A 1Y8GA 2HZ4A 3L9PA 5JQ5A 3R8ZA 3PXKA 3DXNA 4LV8A 1JKSA 4XS2A 3R28A 4QMXA 4RX7A 3UPZA 4G5PA 4J71A 2W7XA 2BTRA 2Z60A 1MRVA 4LUEA 2VGPA 3TN8A 3OP5A 1H4LA 2WIPA 5FP6A 1MRYA 4K18A 4IWOA 4FT5A 3BGZA 3OZ6A 4KIOA 3P0MA 3QCYA 4PNIA 2R2PA 1SYKA 4RIYB 2UZVA 2PZ5A 5AX3A 1UWJA 2FH9A 2QO9A 3DA6A 4FC0A 2UW3A 3LCKA 3L8PA 4WSQA 2VWYA 4YZ9A 2VV9A 3FMKA 3S2PA 5AV4A 5JGBA 3OVVA 2XIYA 3IONA 4XG3A 3G0FA 3QD3A 3LLAA 2H34A 4C3PA 2XIXA 4HNFA 4J8MA 1V1KA 4KIKB 4AW1A 5M08A 2R9SA 4QP8A 3IW7A 4WUNA 3GVUA 5AUXA 4WNOA 4HYIA 4PUZA 2IVVA 3R6XA 3AGLA 5L4QA 3C4CA 3F88A 3PFQA 4QQ5A 3DBQA 3MPAA 3JY0A 4FL1A 4KBAA 3UOJA 4G1WA 5AAFA 2RFNA 3B2TA 3CGFA 4TY1A 4I93A 4UN0C 4YMJA 2BDWA 3F9NA 3HP5A 4FEWA 3LHJA 3QRJA 4I5CA 1P5EA 3A61A 4YTFA 4XLIA 4MXXA 1XR1A 1ZARA 3MPTA 1RW8A 3DJ7A 4GFMA 4F9BA 2R3GA 2GNGA 3TV4A 3L8VA 4HGTA 3R71A 1Q8UA 3VRYA 1OIRA 4H1JA 4L7SA 3OCBA 3WZUA 3HA6A 2GFSA 1JVPP 1XH4A 2P2IA 2XYNA 1H1WA 4YJPA 1PXPA 3UIUA 2PVHA 3E3PA 4FV4A 3ENMA 1U4DA 3DB6A 3LFAA 4IX5A 3A2CA 4QTCA 4AZFA 5E8YA 4ACMA 3SVVA 3R7IA 2YIRA 4K6ZA 4CFVA 4B6LA 4GK2A 4FUXA 4EWQA 4JRVA 3W10A 2FSOX 4FKGA 2BAQA 2OJIA 2YM8A 2BPMA 3FPMA 5H8GA 4TNBA 5EYCA 3F3TA 4MNEA 3QXPA 3EFLA 2PMOX 1YHSA 4BBFA 1UNHA 4YO6A 3F6XA 2EXMA 4EHVA 3FI2A 5IQFA 2YIXA 3BZ3A 2HZ0A 4HJOA 1XKKA 2ITOA 4BHNA 5CZHA 5JN2A 2VWXA 5BVDA 3E93A 3QD4A 4YJTA 5M07A 1RE8A 3ZRLA 3FKNA 4BKYA 3TIZA 3LM0A 2QU5A 4I20A 4PQNA 4QMQA 4BGGA 4MVFA 3KN6A 2WTDA 4D4YA 4XG9A 3BBWA 5HKMA 1W82A 1M7QA 2YACA 2QR7A 1Y8YA 1W7HA 1VYWA 3MFSA 1BI7A 1DAWA 1OPJA 2PVNA 2RG6A 4QPAA 3UMWA 4LGHA 5IQGA 1YXTA 2EB3A 4USDA 2C69A 1I44A 2GNFA 2B9JA 2JITA 4E4LA 1WVWA 2WZJA 3MGYA 2VWVA 3GXLA 2X7FA 3QWKA 3QX4A 1S9IA 2OK1A 3EL8A 3O50A 3OF0A 4XG7A 3CBLA 5E90A 2R0UA 5KZ0A 2C4GA 3ZRMA 2XIZA 3LFCA 3W8QA 3I5NA 2UZEA 1GAGA 4FNWA 4C35A 5JEBA 5C03A 3QALE 2WTCA 3R00A 2UVYA 2PVLA 3RWPA 3F2NA 4YZBA 4RX5A 3KRLA 2OO8X 2C3IB 4AT4A 4BBMA 2IW8A 1MUOA 2PTKA 3WF8A 3PY3A 4L52A 3DY7A 4HZSA 1Y57A 2QVSE 2PU8A 2WOUA 5J9ZA 5IQDA 2HY0A 2JIIA 4IX6A 3IDPA 1BL7A 1PXOA 4DG2E 3QLGA 4FTLA 4XBRA 4I22A 2FO0A 4L3JA 5C9CA 3PPJA 3VS5A 1VEBA 4BGHA 4Z55A 2PPQA 3R9OA 3OTUA 1Q24A 4ERWA 3LFQA 4FTJA 3FI8A 2E2BA 2E9NA 1OB3A 4FKUA 1TVOA 5DT0A 4BZDA 3PVUA 5TR6A 2B9HA 5KO1A 1XH6A 4AN2A 4EWHA 2G2IA 3SD0A 2ITUA 2ZDUA 3PVWA 3ZSHA 4EOPA 2BDFA 3QTWA 4ZSAA 5CZIA 4ZY4A 2X7GA 1JSUA 3O7LB 1UKIA 5A6NA 3QCQA 2I0HA 2OSCA 3BYOA 3KMWA 4FTRA 2WTJA 3RAHA 3E8NA 1PW2A 5EM7A 2PUNA 2ESMA 5AFVA 4FTTA 1CM8A 4F6WA 4FV1A 3PXYA 3FV8A 4PRJA 4DEEA 1M52A 3R7YA 3OMVA 4O91A 3TKIA 5DRDA 4DBNA 2OH0E 4O96A 4CQGA 2VTAA 4HZRA 4X0MA 5IEYA 2PUIA 4C33A 4NEUA 2EU9A 5T3QA 3CPCA 4CLIA 2YWVA 1PMNA 5I9XA 2BHEA 4AF3A 4FV2A 4HYSA 3ZSIA 1PKGA 4EH2A 3PIZA 3KMUA 5HLNA 4X2JA 2BUJA 4EH5A 4O7YA 4PF4A 4NKSA 4Q5EA 4MKCA 3K3JA 4RVKA 5AJQA 4F09A 2XEYA 4FT7A 1KOAA 5CEIA 1OPKA 2PY3A 4O2ZA 4AGDA 3T3UA 4CFMA 5BQ0A 3TZ8A 3O51A 4TWNA 1ZMUA 2O63A 5AX9A 5KHXA 3Q4UA 4CRSA 5I9YA 4B0GA 2X9EA 1OPLA 4FIFA 2QOOA 4XBUA 1JSTA 5T6KA 3OT3A 3SXRA 3SX9A 3ZLWA 4BDHA 3A4OX 5A3XA 4FZ6A 3KRJA 2HIWA 2WFYA 3KY2A 4LFIA 4MX9A 2GMXA 4L3LA 2Y4PA 2AYPA 3HRCA 3H9OA 4NFNA 4G6OA 4U8ZA 4GUBA 4DN5A 4QMVA 4QP6A 3ULZA 3GU4A 3PA3A 2J0IA 2OZOA 4D2RA 2CLXA 4J7BA 1G8SA 5FXSA 3QQHA 4YNOA 3HKOA 3U6IA 5AP5A 3VS0A 3E5AA 3NIEA 4IMYA 4AUAA 3DTCA 3PWYA 3W2SA 2BAJA 4OLIA 4DLJA 4C62A 3R7UA 4FIHA 1E9HA 4Y5QA 3SKCA 5B7VA 1GY3A 3PJ1A 3BKBA 3WYYA 3HDMA 3QTXA 4BWPA 2QI8A 3FLQA 4BDBA 2XK9A 3L9NA 3TL8A 3F3ZA 4Y85A 3IOPA 3MH3A 4QMSA 4YC8A 4NKAA 4KA3A 2FVDA 2XJ2A 5ANJA 3VS7A 3O23A 4GT5A 3ZYAA 3UC3A 4HVSA 3MDYA 4R8QA 4I0TA 4RIXA 1ZRZA 3FMHA 3PG3A 5EH0A 2BRHA 3BLHA 4FV6A 3ORPA 3CTHA 4AA0A 5C01A 2J0LA 4CFUA 2VU3A 3TUCA 3QQGA 2BZHB 5CI7A 3I0QA 2QOKA 4CXAA 4F65A 2ZV2A 3PJ2A 3NUAA 3LFNA 3DK3A 5DNRA 4EK5A 4BCHA 4IH8A 4EOIA 3D9VA 5HX8A 1QPCA 4O0VA 1TQMA 2W0JA 5AV3A 3ZDIA 2JKKA 3QZHA 4LG4A 4BHZA 2ZB0A 3ENHA 5FEEA 1H25A 4HPTE 1LR4A 2A19B 4EK3A 3G6HA 2WOTA 3ET7A 4FKRA 2R3LA 4EOQA 5J1WA 3EQHA 4GW8A 2BVAA 1PXJA 3CTQA 2VO3A 3JPVA 3FJQE 3QGWA 2VO0A 2NNWB 3QTSA 2R3QA 2VRXA 5DR2A 5HO8A 3D4QA 4E5BA 3VQHA 3AMYA 4IEBA 4L7FA 3MS9A 4EOKA 3CD8A 2GNJA 2CCHA 3F5GA 4YC3A 4JQ8A 2Y0AA 3ALNA 4XLVA 3CJFA 3VUKA 1JOWB 2Y4IC 4G16A 2BTSA 4QTBA 4M0YA 5DHJA 5LARA 4RMZA 4RVMA 4JIKA 1CSNA 2I0VA 3EFJA 2PHKA 4O0WA 4FBXA 4FK6A 3I7CA 4HYHA 4AW5A 2E9PA 4YBJA 4W4WA 1ERKA 3I79A 1ZZ2A 2O2UA 3DKCA 3PTGA 5EI2A 3UVQA 2GNIA 3H4JA 3PSCA 3QF9A 5A6OA 2FB8A 4O83A 1YI3A 2I0EA 3D7TA 3R30A 3WOWA 2YWPA 4AOIA 4E4NA 1OI9A 3FC1X 5HU3A 4F4PA 3CQWA 2HXQA 4TT7A 3DXQA 2IVSA 4QNYA 4H3PA 3MY0A 4I3ZA 3G6GA 1M14A 4LOOA 1CDKA 3GC7A 5FEQA 1AGWA 3HEGA
chains in the Genus database with same CATH superfamily
4CSVA 1OBGA 3IECA 4IIRA 2BDJA 3HAMA 4LQMA 1OKWA 3DNEA 4EZ5A 5CX9A 4NL0A 3FXWA 5C8NA 3V01A 3RKBA 5AP4A 3LFDA 2UW5A 2HWOA 4TYEA 4ZTHA 2X2LA 4I6FA 4QPMA 2AC3A 3VS1A 3TTIA 4RBLA 4ZXTA 3TJCA 4QQCA 3L1SA 5KBRA 4G9CA 1IEPA 3EQIA 3QQLA 4MXZA 4R1VA 4F7LA 1OUYA 3FLNC 4PNKA 1IA9A 5AMNA 4M69B 4DCEA 4YO4A 4TYIA 2QOQA 5D11A 2CN5A 3TNPC 4ALVA 2ZVAA 2YM5A 4QYYA 1ZOGA 3TI1A 2A1AB 3V5TA 2IN6A 4F7SA 3E87A 4X2GA 3TKUA 3VBVA 3GC8A 5TT7A 4YJVA 3VF8A 2CMWA 3DQXA 1JKTA 3G0EA 3QZFA 3A8XA 4IJPA 2PK9A 3QRKA 4TYGA 3JR1A 3TNWA 4X6RA 2XP2A 3E7VA 3DBEA 4O7WA 3N9XA 4KIPA 3BLAA 4TKSA 3QAME 3UO4A 1UU3A 4BKZA 2P55A 5EHYA 3ZTXA 4F99A 1G8KA 4YSMA 3NUNA 3ZSGA 4A07A 3W0RA 3GOPA 4NH1A 3DJ5A 1PXMA 4ZMEA 5ACKA 4TPTA 3IDCA 4A4LA 3EHAA 2BRBA 3R8MA 4HVGA 4JIAA 5FM2A 3E8CA 4IB5A 5CAPA 1UU9A 2BIKB 3OUKA 3PP1A 2VTLA 1A9UA 2XH5A 1Q8WA 4RT7A 4EBWA 1OMWA 4NYEA 3V8WA 4M13A 3FEGA 4PPAA 2O64A 4EQUA 3DGKA 2WQBA 4LOQA 3CTJA 4U9AA 4IM3A 4H3QA 5GNKA 5HCYA 3UGCA 1YOJA 2SRCA 1Z57A 2VO7A 4C37A 2JBOA 4DYMA 2J50A 3QCSA 3LCTA 3VN9A 3GNIB 4CLJA 3TUDA 3KQ7A 1DS5A 3DT1A 3TG1A 4BDFA 4CQEA 4UY9A 4I5PA 1SNXA 3TKHA 3HMPA 4O7TA 4U44A 1WZYA 4F0FA 1DI8A 5F9EA 4AWIA 3NFGB 4IZ7A 2UW8A 4AG8A 1WVYA 3PSDA 2IW6A 1GIHA 2F4JA 5E92A 5M06A 2W9ZB 4L01A 3VUGA 4JBPA 3M2WA 3POZA 3VUDA 5K0XA 2HENA 5CS6A 4ZS0A 5L6OA 4CEGA 2UVXA 1SZMA 5K4IA 4J1RA 3R9DA 4IAIA 3HUCA 4O6LA 3LMHA 4MBLA 4ANBA 4DGGA 2G15A 3W2OA 5ANOA 3WE4A 1DAYA 4OR5A 2C3JA 3G2FA 4QYFA 5HEZA 3QUDA 4AW2A 4Y83A 4C4HA 1ZOHA 2G1TA 4YTHA 5L2WA 2GS6A 3BLRA 4ANQA 3UMXA 2OH4A 3FUPA 5EOLA 2O65A 5IA4A 2VTSA 2JDRA 2RKUA 3MFUA 2QU6A 4YZNA 1TQPA 4BCNA 3R04A 3R7VA 4DHFA 1OKYA 3KGAA 5CY3A 3R01A 5G6VA 4DEBA 5AUZA 5IZFA 4PV0A 3RM6A 3ETAA 4O4EA 1KOBA 5IDPA 3SDJA 4DE4A 4R3CA 3QHRA 3QCXA 5JK3A 4B4LA 4M69A 1LUFA 4OTFA 3O5AA 5EHLA 4AAYA 3OY3A 4QMOA 4EOLA 4IDTA 4JX3A 2UUEA 4EOSA 4OTIA 3FSFA 2WMRA 3C5UA 4RGJA 4ASEA 4EK6A 4L67A 3ZFYA 5L8KA 5JFSA 4AXAA 5KNJA 4PDOA 3MH0A 1NW1A 1Q62A 5DT3A 3RAKA 1YXSA 5HLWA 3C0IA 3Q9WA 3DOGA 4GU6A 4RA5A 3LOKA 2CN8A 3Q6WA 5FQDC 4CV8A 5CVFA 2XRWA 5C8MA 3OUNB 5B0XA 4G34A 4GVJA 1V0OA 3E7OA 2FYSA 1YI4A 2OI4X 5KBQA 2JAMA 1PHKA 1WBNA 1HCKA 1VZOA 4B8LA 4CFXA 3PXQA 1Q8ZA 3D5VA 3HV6A 5FEDA 3KK9A 3C4ZA 3Q32A 4ZP5A 4LRKA 5C4KA 4BIEA 5DI1A 4MQ1A 1VR2A 3B8RA 3QQUA 5DFPA 3RJCA 3ZONA 2VTMA 4E5WA 4D5KA 4F1MA 3M11A 5M57A 3MJ2A 3CIKA 4UMQA 1UNGA 5M4IA 5BUIA 3NDMA 2XNGA 3NEWA 3VUIA 2YM3A 4D1SA 3DLZA 4O6EA 4FIJA 4CG8A 3KULA 5AEPA 1STCE 5CALA 4YZMA 2J7TA 4O4FA 3V5QA 5LVNA 3H3CA 3DKFA 3C1XA 4DDGA 3P23A 2BROA 1YXXA 2C1AA 5GIOE 1MQBA 2YZLA 2JFLA 3H9FA 1P4OA 4GH2A 4J8NA 3OT8A 2I40A 5J7BA 4X2FA 3OXZA 2PVKA 1FGIA 4IB0A 5TF9A 2C5XA 4EUUA 1UU7A 5HTBA 3SRVB 3E8EA 1XJDA 4I92A 4G9RA 5FGKA 5A14A 5LQFA 2E9VA 2VTJA 4Y72A 3FZOA 3EQCA 3TJDA 3RVGA 2RGPA 3WZJA 4YP8A 4NCTA 5H9BA 2V0DA 4FTOA 4XNEA 3VUTA 4AE6A 3DBDA 4BTMA 4C4EA 4ZLZA 3FBVA 3WBLA 5GZ9A 4FYNA 1PYEA 4C3RA 3C4XA 1Q3WA 3TDWA 3EOCA 5IA0A 3MBLA 3F3VA 2DYLA 1NVQA 4GFGA 1O9UA 2X0OA 5I9UA 1T45A 3E88A 2WPAA 4CFNA 3NYNA 3QKKA 4YHJA 5AA9A 3FKOA 3FMLA 1RDQE 2WXVA 4M97A 5DWRA 4Z3VA 3LQ3A 3CE3A 5HG5A 4IX3A 5HGIA 1PY5A 4AP7A 4GIHA 4QQJA 2CKEA 5D10A 4HVHA 4MD7E 1YXUA 3GQLA 3ERKA 3OWKA 3HP2A 4NCTC 2WMBA 4WHZA 3W0PA 4DFBA 1W8CA 3ZLXA 1U5QA 4ZY6A 2C5NA 1AD5A 5BYZA 4GUEA 3FMDA 5DG5A 2OZAB 2XK4A 5ETCA 2VTPA 3CS9A 2BR1A 4L44A 4YPDA 4FG7A 2XKFA 1FINA 2R3IA 3BELA 1S9JA 4BDAA 1OGUA 1I09A 2XYUA 2JIVA 3E64A 5CSWA 3RINA 3EN5A 5JKGA 4DFZE 2FUMA 3FI4A 3NZ0A 4IZAA 3AD5A 2WMQA 3PXRA 3T8OA 3I5ZA 3W0SA 3BL7A 3O17A 3ZHPC 3BYVA 3GB2A 5D9HA 1FMKA 3DJ6A 3LFSA 1YWRA 2VWUA 3PLAE 1U54A 1JQHA 3H0ZA 3NW5A 4L42A 3LIJA 4UB7A 3VF9A 4YURA 5F1ZA 1EH4A 2VO6A 2Z7RA 2C6IA 4JT3A 4HGEA 3EYGA 3NCZA 1JKKA 1XH7A 2BALA 4FL2A 5HCXA 1OVEA 4BC6A 3NFFB 3QQFA 4JG6A 5L6PA 3U54A 2XKEA 3ZEPA 5KMNA 3BIZA 3NW7A 5CEQA 2IWIA 3GP0A 2QOCA 4V04A 5DGZA 1GNGA 5FBOA 4QT1A 4O84A 5AV1A 4RLLA 3NLBA 4CMTA 2X0GA 5J95A 3OD6X 1WBWA 2OGVA 1KWPA 5IH5A 2B9IA 3Q52A 5D12A 1H08A 2VTTA 4DH7A 5C4LA 5CASA 3LW0A 5M51A 4CRLA 4JLCA 2V7AA 3VBQA 2C30A 4C4IA 1UA2A 3EMGA 3BYMA 4RJ4A 3Q9YA 4I6HA 2OWBA 4IAZA 2DQ7X 5FWKK 5JRSA 4P90A 5K5NA 1W83A 3OROA 4JI9A 2PYWA 3IGGA 3FY0A 5I3RA 3M1SA 3Q5ZA 3D0EA 4U7ZA 1H07A 3H10A 3FSKA 4KS7A 4FKSA 3HMOA 4RJ3A 4TYHB 1F0QA 2Y7JA 3IW4A 4PDSA 3V8SA 4F08A 3C4EA 5KMOA 5AP2A 2WHBA 2X4FA 3DAKA 2YM7A 3ZXZA 1OL6A 5FTGA 1VYZA 3OOMA 2RFSA 4E73A 1YHVA 2RSVA 2WMAA 2OF4A 1B6CB 2R3OA 4K33A 4L68A 4ZTLA 2DUVA 5LVPA 2ZMDA 4X6QC 3ZMMA 4OTPA 3W2PA 3SA0A 1YOLA 2Z7LA 3OY1A 4ZSEA 4E26A 4R5SA 4F1OA 3D2KA 4L45A 4XRLA 4HCVA 2VZ6A 4CYJA 2OXYA 3AG9A 5ANDA 3U6HA 3DXPA 4M8TA 4U42A 2EVAA 3HYHA 1G3NA 3MTLA 2CNVA 2Q83A 4KRCA 5E91A 3KF4A 1J3HA 4F78A 3LPBA 5HE2A 4I6QA 4IQ6A 4O2PA 4WUAA 2QOHA 3QRIA 5EKOA 4GJ3A 4N70A 3LQ8A 5L2IA 2X1NA 4YU2A 5ACBC 3EZRA 4AE9A 3RM7A 4CZUA 3CKWA 3NS9A 2UW6A 2CHLA 4XCUA 5HG8A 3RP9A 2JAVA 3II5A 4EQCA 4Q2AA 2X81A 4LRJA 1CKPA 2A4LA 3OHTA 1M2RA 4I5MA 3TCPA 2ONLA 4U41A 4BCFA 3BU6A 3CP9A 4FSZA 3UIMA 3WF6A 4GEOA 3UPXA 4O22A 4NT4A 4QMWA 4UXLA 3SC1A 5CWZA 3UODA 3PXFA 5AV0A 3NUUA 3DCVA 4N6ZA 2RFEA 3GFWA 4ZZNA 5EM6A 2YLEA 4RC4A 2X9FA 4FL3A 4CMOA 4HNIA 4TNDA 3BGQA 3UP2A 2XNEA 3UOHA 4BCGA 2Y9QA 4QMTA 3E8DA 4FVQA 1QCFA 3MFTA 4XV2A 4C4GA 3GCVA 2ZM4A 1FVTA 3NUYA 3ZLYA 4ERKA 4FKJA 2PZYA 4J96A 5IH4A 3GEQA 2ITTA 3PY0A 3ZEWA 3C50A 1W0XC 4F0GA 5EHOA 4NJDA 4QP3A 1KSWA 4BCJA 3UZRA 3HMNA 5EQEA 5CT7A 2YDJA 4DH3A 4GVAA 5AUTA 2XJ0A 2ONLC 2J0JA 2XCHA 3GC9A 4IBMA 5DMZA 3AT2A 4KKGA 4UX9A 3ZU7A 2VWIA 3FWQA 5HO7A 3ORIA 3LXLA 4YJNA 5FTQA 2W1FA 4NIFB 2UZDA 5CEMA 3UJGA 2WGJA 4ANMA 3ZDUA 3CD3A 2OLCA 3PPZA 5IPJA 4BCQA 3DQWA 1OBDA 3I6UA 4F9YA 4BBEA 3QKLA 2HZIA 4KB8A 3CY3A 3K5UA 3KXGA 4MBIA 3VS6A 2Z7SA 2G9XA 3F66A 4ZEGA 5LXMA 4KWPA 1PXIA 4M66A 3THBA 4S30A 2NP8A 2HXLA 2Z7QA 4IAYA 4EHZA 4YZDA 3R1SA 3QC9A 3ZLSA 4CG9A 1Z9XA 5I4NA 4EHGA 3RTPA 4RIOA 4OTQA 4TYHA 3LCOA 2OJFE 2YDIA 4NM7A 4WSYA 2OW3A 3EZVA 5M4FA 3GQIA 3UZTA 4O86A 1F3MC 5I3OA 4FTIA 4O0XA 5TOZA 3U8WA 4G5JA 4C4JA 5JFVA 4TN6A 3LLTA 4RIYA 5EW8A 5AV2A 3V5WA 3LKMA 3FAAA 3QTQA 4FSMA 4RX8A 1Y6BA 2XK3A 3JVRA 5A4LA 3IK3A 4MF0A 1KE6A 4GV1A 4H05A 4BY9E 5HD7A 5LWMA 3DAEA 4AX8A 5ANEA 4IB3A 4WNPA 5LOHA 3BHYA 2YAAA 3W2QA 4G3GA 3PRIA 4DGMA 5ITAA 4LYNA 2QCSA 4F63A 2B4SB 2PL0A 5AR8A 2W1ZA 5F94A 4DC2A 4KIKA 4PMTA 3PE2A 3DU8A 3LFBA 4D1XA 5FXRA 1U46A 2UZLA 1L3RE 5LCJA 2RF9A 1BYGA 3BRBA 3MFRA 3P79A 4BDCA 4DT9A 2VTNA 4CT1A 2OIQA 1FBNA 2J9MA 1O6LA 2PZRA 3UNZA 3D94A 2DS1A 4O27B 4C4FA 2ITPA 3ORKA 4FOBA 4FSYA 5LVMA 2VX0A 3CCNA 5HTIA 2F7ZE 4E6QA 4Q9ZA 2RL5A 4FX3A 5CQUA 3REPA 4G3FA 4O4DA 2B53A 2ITVA 3ULIA 4DEIA 5JT2A 3V5LA 2W5HA 4R7HA 3W18A 4FKQA 4QMZA 5E8XA 3AOXA 3O96A 1WBPA 3Q60A 4DHJA 5CU3A 5IH6A 4Y5HA 4MD8E 1GZNA 4CKJA 5ICPA 5GIPE 2CGUA 2HWPA 2BRNA 3ZS5A 1Q61A 3R9HA 2GQRA 4CKRA 5KUPA 4WBOA 4PY1A 3PWDA 3WI6A 3U4UA 4JX7A 3BBTB 3D2IA 1H24A 3JS2A 3KVWA 4ZK5A 4TXCA 5FRIA 2QR8A 3VO3A 3BWJA 2I1MA 1GIIA 2QHMA 4CT2A 3PDTA 4BCOA 4FEXA 2YIWA 4PX6A 3WZDA 4B8MA 4U81A 4U97A 5HICA 2YEXA 4IWQA 4W4XA 4ANNA 5DVRA 4OBOA 4YHFA 4C57A 2IG7A 4AT3A 4DHZA 3Q9ZA 1UVRA 4OBQA 3LAUA 3OEZA 4AT5A 1P4FA 3R7EA 1ZMWA 2R7BA 4TWOA 4J95A 3LZBA 1AQ1A 4NTSA 4W9WA 1XH8A 4S2ZA 3ZXTA 4AXFA 3LE6A 4Y95A 4FTNA 3MJ1A 3NAYA 4B9DA 3AT3A 4IJ9A 3GCSA 5BVKA 4AACA 4GK3A 4NJ3A 3A60A 5IMEA 4FODA 4U3YA 1PMVA 4JR3A 4C61A 3OBJA 4RWIA 5JH6A 3LMGA 2YITA 4IVCA 5E1SA 5KCVA 4E4MA 1Q3DA 3QZIA 5CVGA 4ANLA 2IVUA 3ROCA 3LJ1A 1PJKA 3FMMA 4O7RA 4PMPA 4JS8A 5K5XA 4C58A 1Q5KA 3QRUA 3R63A 4BWXA 4O7LA 3UO5A 4FSQA 1ZYJA 4EH4A 3PFYA 3R2YA 3D14A 3CY2A 4LL0A 4UV0A 2YAKA 3ODZX 1GOLA 3EQFA 1BLXA 4ZZMA 2JLDA 4KD1A 3RHXA 2P33A 2JBPA 4RFMA 4MXCA 3Q4CA 5ANIA 5G1XA 5HCZA 2H96A 3ORTA 3CGOA 2REIA 2GTMA 5DEWA 4MYGA 5JFWA 4UMUA 3DK6A 2WIHA 3FXZA 3FYJX 4CZTA 3HRFA 4EZ7A 4BI1A 3ZO2A 5TO8A 4OTRA 4QYHA 2ZYBA 2F2UA 3BYSA 3ML1A 2C6DA 2YCFA 2XAMA 3ZCLA 4RZVA 1M17A 3QX2A 4IZYA 1PXNA 2C6LA 2XS0A 2AUHA 3MSSA 4ALUA 4UWCA 3UQFA 3FQSA 4FT3A 3UE4A 3WIGA 4R7BA 4WD5A 3VIDA 1HOWA 3UIXA 3DZOA 5EI6A 2QLQA 4RRVA 5KE0A 1R0EA 4KIQA 4KRDA 5BVWA 2QNJA 2WTWA 3PVGA 4EK8A 1ST0A 5AUWA 3QC4A 4QYGA 4BDKA 4UWBA 3UDTA 1XBAA 4NTTA 3EL7A 4U6RA 5IA5A 4YR8A 4W9XA 4FZFB 2HAKA 3OCSA 4M7IA 1GJOA 4I0RA 5D41A 2CGXA 4CV9A 4DH5A 3EH9A 3AXWA 4U45A 1ND4A 4M3QA 1JLUE 1WVXA 1ZXEA 1R3CA 2E9OA 3COHA 3NRMA 5IQAA 3EN7A 4IVBA 4QD6A 5BUEA 4XMOA 2F7EE 4FTQA 4LGDA 4TYJA 1Q8TA 2GU8A 2ETKA 3UVRA 3KRWA 5CXZA 4M15A 3PPKA 4NM3A 4ASZA 3I4BA 4BJJA 5FTOA 2GCDA 4XP3A 4RSSA 2FSMX 4C34A 4CFWA 1ZYDA 1V0PA 1PXKA 4AW0A 4ZTSA 1WBSA 5CAOA 4ZSLA 3WIKA 4TRLA 4YJOA 2J2IB 4EH6A 5CVHA 4DAWA 1V0BA 4R77A 4FEQA 5ETIA 3HV5A 3LVPA 3CLYA 2XKDA 3UTOA 3Q2JA 3SG8A 3VC4A 3L8SA 2V7OA 3EQGA 3ATSA 4V01A 5D1JA 4Y73A 4IAKA 3Q4ZA 4O0UA 4RA4A 3UVPA 5ETAA 2XARA 5HI2A 5HZNA 2XZSA 3BCEA 4D28A 2FSTX 2BFYA 5A4EA 3G90X 3G33A 3MB6A 4RIWB 5HU9A 3BPRA 3R9NA 2WAJA 3UC4A 4BDEA 5A4QA 4S32A 4W8EA 5L8JA 3A7JA 2G01A 2OFVA 3P5KA 3TWJA 3M42A 2OJJA 4DBXA 4NFMA 4ASDA 4O4BB 3AD4A 1G8JA 2C5VA 5CF4A 2Y6OA 3CR0A 3KXZA 3PVBA 1M2QA 2IEWA 2JC6A 5BPYA 4RX9A 3ELJA 4QMMA 1KUTA 3PXZA 1CTPE 3VS4A 5IA1A 2W4OA 4DFLA 4LM5A 3U4WA 4B99A 3ANQA 3MTFA 3NIZA 4DGOA 2YJRA 1ZYLA 2GDOA 2H8HA 2FGIA 3BE2A 5J5TA 1BL6A 1FVVA 4ANOA 2B55A 4RLKA 5M44A 3VQUA 4A9RA 4A9UA 4R3PA 1OIYA 5KKRB 1OL7A 2IW9A 4IDVA 4QDEA 1OM1A 1CKIA 2QQ7A 2QOFA 3E63A 1YW2A 3R83A 4MXAA 5IA2A 2ETMA 2YN8A 3HL7A 4DEHA 5DA3A 4RJ8A 2WB8A 4WNKA 3AD6A 2R64A 4JDKA 2VTHA 3I7BA 4H36A 4O1OA 5CSVA 4OUCA 3PG1A 1M7NA 3PJ8A 1KE8A 4L46A 4YJSA 3HDNA 1WMKA 4D2PA 5A9UA 4HCUA 3BI6A 3N4VA 4TZRA 5HIBA 3ALOA 2UZNA 3PZEA 5BMMA 4YBKA 1GZOA 3D5XA 1URCA 2J0KA 3AC4A 4XUFA 4C3FA 2W1HA 3ROYA 3OCTA 4E4XA 3PUFC 2ZDTA 2OFUA 2X39A 3EFWA 1ZZLA 1KE7A 3KN5A 4NSTA 3OOGA 5AM7A 3U9CA 2HK5A 4YSJA 1H27A 2ITYA 4JAIA 3SXSA 4M67A 3COKA 4ZZOA 5HNBA 3PSBA 5JRQA 4ID7A 5CENA 4BFMA 5K3YA 1X8BA 4EH8A 2W1IA 4HGSA 5FDXA 2WTKB 4XX9A 2R7IA 4PP9A 4IFCA 1OECA 3QA0A 1OGYA 3NNUA 2V55A 2YIYA 4O7VA 2B52A 2I7QA 4APCA 2CNUA 3V04A 4DTKA 2W1GA 1IR3A 2B1PA 1PYXA 3DS6A 4A4OA 2WMSA 3P86A 3EN9A 3F82A 5M55A 2ZM3A 2HOGA 2OU7A 4RG0A 4EKLA 4F7JA 4PP7A 5CI6A 3R0TA 5ANGA 4BRXA 4IC8A 4PDPA 2Y8OA 5E8WA 2F2CB 1ZWSA 2CLQA 3FZRA 4EONA 4I23A 5EDQA 4LRMA 3LXNA 4X3FB 5I0BA 2AEGA 3UG2A 3N4TA 3S4QA 3HV4A 4RIWA 2V22A 1WBTA 4FV0A 4U43A 5HG9A 3Q96A 5KMKA 4OAVB 5DPVA 3FMJA 3NNWA 5HLPA 3C9WA 4EYJA 2PE0A 4YTIA 3BV2A 3KRXA 4A9TA 3L9LA 4D4VA 3VWAA 3JYAA 2JKOA 4QP9A 2R3MA 2X4ZA 3LXPA 4KABA 4R6VA 4MUQA 3DZQA 1P14A 5CXHA 3AQVA 3FL4A 2YDKA 4I94A 4BZOA 2WD1A 5K9IA 5KHWA 3MIAA 2VWWA 4FZAB 5BV3A 5IG1A 4IWPA 4FOCA 3DFAA 4UZDA 5J8IA 2E9UA 4BB4A 3NSZA 3DV3A 3CQUA 4PPCA 4ORKA 3W2RA 3UQCA 3HA8A 3G9LX 2LAVA 2H6DA 2X8DA 5CNNA 3R22A 3GU8A 3RK7A 2ACXA 3DKGA 3GT8A 4LMNA 5ANKA 4FRFA 2C6MA 4FK3A 2ZOQA 2UW0A 3ZC6A 4E20A 4XV1A 5M53A 5H8BA 4EJNA 3VVHA 3EFKA 1WFCA 5CF5A 5HIEA 4FEVA 4RJ5A 4I21A 2UZUE 2OICA 2GTNA 3QYZA 4EBVA 3ORXA 4KKHA 4ACGA 3HNGA 3E3BX 3U9NA 2F7XE 3IKAA 4OBPA 4EL9A 3EB0A 4A7CA 1H0VA 2VWBA 4DTAA 5DE2A 1H01A 2ZAZA 4M0ZA 5FUTA 3CEKA 4ZIMA 2CNQA 4FV3A 3GENA 5CNOA 5CAQA 4PDYA 3HVCA 4Q9SA 4NK9A 3MB7A 5CF6A 3FDNA 2CSNA 2O0UA 3FPQA 5EG3A 4WIHA 3FZPA 3N4UA 5KMJA 4MK0A 4RFZA 2HW6A 4CVAA 5L8LA 1REKA 2XK7A 3LMIA 3BYUA 5EYMA 4BVUA 3SQQA 2X2KA 3S0OA 4YJUA 3AC5A 2QODA 4D2SA 4ZY5A 2PMLX 2BAKA 1XH9A 4O0RA 5CYIA 3DTWA 3HX4A 3NCGA 5B2KA 3KXNA 3VNTA 2VWZA 5CSHA 4IADA 3VW6A 4XG6A 3NGAA 4E93A 5A54A 3SV0A 2P0CA 5EI8A 1G8AA 4OT5A 4R78A 2Z02A 5BVNA 3BU3A 3FYKX 4QQTA 2HELA 3D7ZA 4MWHA 2XNPA 4AZEA 4C7TA 5JFXA 3AC1A 4G3DA 4V0GB 4AU8A 4MTAA 5FBNC 5DR6A 4BI2A 4AXEA 2PMIA 2V62A 4FSRA 4I4EA 3NAXA 4E6DA 4XP2A 3C4WA 3UZPA 2PUUA 3QQJA 4RJ6A 4FG9A 4FNYA 4D0WA 4R3RA 4MH7A 3C13A 3QHWA 3MVJA 4BI0A 2WTKC 2YJSA 3R9RA 4UALA 2YCRA 3R1YA 4TL0A 1J91A 4JQEA 4DH1A 2C3KA 3ACJA 3CXWA 3F7ZA 5HNGA 3I81A 1VJYA 5AR5A 4ZS4A 4FZ7A 4P7EA 2HYYA 1PF8A 3QQKA 3V3VA 4AAAA 4AXDA 2BILB 2P4IA 3V8TA 1URWA 3KCKA 4R5YA 2ZV7A 3WZEA 5AP1A 1OL5A 4ZLOA 3EN6A 4IX4A 2GS7A 5CU2A 2A27A 5CU4A 3DPKA 3ANRA 4LOPA 4YZCA 1O6YA 1YI6A 2JFMA 2WEIA 2X0QA 3NYVA 4MBJA 2OG8A 3UOKA 2NO3A 4AZSA 5J9LA 4AFEA 4O82A 1M2PA 1PMEA 4ZTQA 3U87A 3LFEA 3MESA 1FOTA 1PXLA 3HGKA 1R39A 3VHKA 1FPUA 2WMVA 3PYYA 4MAOA 5I9ZA 4USEA 4IWDA 4HYUA 1XBBA 1APME 5KZIA 4RZWA 2WMWA 3OS3A 4X21A 3TNIA 2IF8A 5M4CA 2CKPA 4H58A 4TWCA 4II5A 3FLWA 3A99A 3A62A 4GRBA 1XMMA 1UWHA 4CCBA 4FE2A 4I6BA 4U79A 2F57A 4KSPA 3R8VA 3TUBA 5EM5A 4ARKA 4XRJA 2QD9A 2XALA 4EK4A 4BL1A 3VS2A 4RQKA 1SNUA 5AP6A 2NRYA 1U59A 4FTKA 1YKRA 4BCKA 1O6KA 5AUYA 5F4NA 3BX5A 2NPQA 2UZOA 3HV7A 3V6SA 2GHLA 3W8LA 3FKLA 3UP7A 1HCLA 3LJ0A 4ITHA 5LVLA 3SXFA 4ONAA 3RPOA 3P7CA 4XEYA 1RJBA 3VULA 3W0OA 2NRUA 1ZAOA 3QLFA 4L9IA 3UO6A 4IM2A 3AT4A 4QPSA 4RFYA 2F49A 3G15A 4FEUA 1YDTE 4N6YA 1JBPE 3F5UA 3O8UA 4BIBA 3W0QA 2QLUA 3RMFA 4EC8A 3QFVA 1H00A 2VTRA 5H3QA 3OG7A 4KNBA 4WNMA 3TV6A 3VW8A 4C02A 5IQHA 4P5ZA 2ZB1A 3RPYA 5M09A 3TEIA 2JIUA 4MHAA 4FSTA 2JDOA 4D4RA 1XH5A 3FC2A 2R3NA 4MEDA 4X2KA 3O8TA 3GFEA 4BN1A 5BMSA 5HNIX 3MVLA 4LV5A 3E92A 4BDJA 3KCFA 4OTHA 4RPVA 2QOIA 3OCGA 1IAHA 4H1MA 2R3FA 3IOKA 3F3WA 1F5QA 2HW7A 3JUHA 3SRVA 4OAUC 1IG1A 4MNEB 4FZDB 3FL5A 5BUJA 4IHPA 2BKKA 4I24A 3GC0A 4ZLYA 4LV7A 5D7AA 4HPUE 1K2PA 4N0SA 5E9EA 4K11A 3LCSA 5M56A 3F2RA 3VUMA 4DA5A 5EDPA 3WF9A 4MWIA 3EQPA 2R5TA 4FJVA 2R3PA 4QMNA 2WQMA 3EYHA 4P5QA 3AMBA 4PWNA 4MNFA 3VUHA 3F69A 4X2NA 3UNKA 4RQVA 4DTBA 1J1BA 2XM8A 3CJGA 3ORZA 4GYIA 4QMYA 4WG4A 5GHVA 2YCSA 5L2TA 5LMKA 1Q41A 2VN9A 3DDQA 4NWMA 4AOJA 3ZOSA 5AR3A 1KV2A 3I60A 3OWLA 2C6EA 4F6SA 2J0MB 4V05A 1YWVA 2WEVA 3IW6A 3NPCA 4GL9A 4OTWA 5EOBA 4AN3A 4D9UA 4DGLC 3QYWA 3CQEA 5HVKA 3EJ1A 4BF2A 4BKJA 1XO2B 5CU6A 3T9IA 3WF7A 2CPKE 1R0PA 2UW7A 2RFDA 1YHWA 4GJ2A 4J52A 4O1PA 3RPRA 4CYIA 4F7NA 1J7LA 2C47A 3KK8A 4OT6A 2WU6A 5EQPA 1Z5MA 3D5WA 2UZBA 1K9AA 2OZAA