3LMGA

Crystal structure of the erbb3 kinase domain in complex with amp-pnp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
280
structure length
268
Chain Sequence
VLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ErbB3/HER3 intracellular domain is competent to bind ATP and catalyze autophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-3
total genus 66
structure length 268
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lmgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lmgA01
4BZDA 2F2UA 5CSWA 5FTGA 2BPMA 3ORIA 4XLIA 3GUBA 4PDSA 1FVTA 5AR8A 5M44A 2HAKA 3CR0A 4A07A 3NYNA 3TG1A 1KE9A 4G16A 3QUEA 4IIRA 5ANOA 3SC1A 2P33A 4AA4A 2GHMA 5JFVA 3OD6X 1CMKE 4QP4A 1H8FA 4W4XA 4WBOA 4TWPA 4AZSA 5D41A 1PW2A 4I0RA 2OFVA 5HX8A 5BVWA 2QOFA 3DQWA 3MBLA 2PSQA 4FTJA 4QMVA 1YOMA 1H1WA 2JDOA 3QBNA 3Q4TA 5F95A 3WYXA 2ONLA 2VWWA 4PPAA 3QQLA 3Q6WA 4CCBA 2PZIA 4TNBA 5JK3A 3L9LA 5HICA 4OTGA 4GJ3A 1UV5A 1J1CA 3F66A 1QL6A 4N6ZA 4ASZA 4RPVA 5KHWA 2WXVA 4ANLA 2VTSA 4BYJA 2BRNA 3HMOA 3NYVA 4QMSA 4G31A 2JKMA 2XYNA 4JX7A 3KULB 5IQHA 4YTHA 3R1YA 2BALA 4LRJA 4FV5A 4EORA 2YCQA 5CSVA 5HLWA 3OEFX 2C6EA 3V5LA 5E8ZA 2JKQA 4NTSA 4CV9A 4ZLYA 4ZZNA 4CKRA 2YEXA 4X6RA 5ANJA 4E5WA 2WMRA 4EH3A 3LFQA 3PG1A 4WUAA 3Q9ZA 2P0CA 4DG2E 4K9YA 5KHXA 3OXZA 3ORXA 4XRJA 4X3FB 5FEQA 4ALUA 2QOHA 5KMKA 4Q5EA 5AR2A 2X4ZA 4QMMA 3OOGA 4AGWA 1IASA 3WIGA 3CTHA 3H0ZA 3OCSA 4L68A 4R5YA 3FL4A 3RK5A 1NY3A 3KA0A 4F9AA 1Q8TA 2R3FA 3E93A 3OF0A 5IPJA 5BYLA 4DFBA 4B8MA 5BYYA 4XUFA 4GL9A 4UZHA 2VGPA 4DCAA 1JWHA 3NSZA 1YQJA 4OTHA 2IVTA 3SG8A 3BYSA 4FSZA 5A4TA 4IDTA 4FEVA 4YP8A 4BCPA 3C1XA 3EWHA 4FTOA 3D7TB 3G51A 1WCCA 3TNQB 4EOMA 1K3AA 1MQBA 3F5XA 5FRIA 2QLUA 4QTAA 5M4CA 4U9AA 4TYHA 2CDZA 3I5ZA 1WVXA 4DEAA 1PKDA 3EQPA 4JI9A 4MXCA 4FEUA 4E3CA 4S30A 4G5JA 3PVBA 2B4SB 1QCFA 3OTVA 3GC9A 5J9LA 4GIHA 3LJ1A 4MD8E 2PL0A 2PZYA 1A9UA 4HYSA 4O7SA 2PUPA 3HP2A 2BIKB 5GZAA 5IDNA 4L7SA 4TKSA 4JRNA 5D7AA 4FSUA 2CKPA 3ZEWA 4MXYA 3H30A 1WFCA 4K11A 3EH9A 3JY0A 4CFUA 4F0IA 5CF8A 3VJNA 4RIXB 4ITHA 5IF1A 2E9PA 1XBBA 4HVHA 4DE4A 2GNJA 2P2HA 2OXDA 3MVMA 3COMA 4KBAA 3W2CA 3LM0A 3FLWA 2W1ZA 3F3TA 3RPOA 1OKWA 3R28A 4X6QC 3VBTA 3G9NA 1T46A 4PNIA 1JLUE 4JVGA 4AWIA 3U55A 3R8LA 3SV0A 1G8SA 3BZ3A 4MXXA 2XK6A 1PXIA 2C0OA 2FB8A 4WRGA 5C9CA 2W05A 5LVMA 2ZJWA 4GMYA 2JBOA 4TXCA 2WIPA 4FZFB 2J0LA 3MTFA 5TT7A 2CNVA 3P79A 5EI2A 4BDEA 5EOLA 1KE5A 3RZFA 4BCMA 1REJA 2Y8OA 4XP2A 3EB0A 4L3LA 5AIKA 2ZV2A 5F9EA 4N6YA 3R30A 1ZARA 4KIPA 2DQ7X 4J95A 4M84A 3L9PA 5KMMA 2BKKA 3HRFA 3MESA 4XMOA 4D5HA 3THBA 4A9SA 5FUTA 4FL3A 4EK3A 3EL8A 3ORNA 3HYHA 4HGSA 3VBXA 4FV7A 4C4JA 3A62A 3HAMA 4O38A 4ZOGA 2UZVA 3BGPA 4MTAA 4NTTA 4QQCA 2OZAB 5KNJA 1GIIA 4FSYA 3O0GA 1TQIA 2J9MA 3PXQA 2BDJA 3DY7A 2X1NA 4HCUA 2WIHA 4KKEA 4NKSA 4M14A 4ONAA 3ZTXA 4ANOA 3H9OA 4L8MA 4QP8A 4BGQA 3TDVA 5L8JA 3A99A 3FJQE 3C5UA 3PZHA 5EDPA 4FEWA 2VTOA 2BZIB 3NIZA 5FBOA 4RVLA 2QO7A 3OFMA 3KXXA 3QX4A 4U79A 1PF8A 2YAKA 5K9IA 2GNGA 2JFLA 3ZSGA 4F1TA 4F9BA 4AGUA 3PUPA 3IW5A 4ZJVA 2YISA 2QKRA 4XG6A 1Y57A 4GSBA 4BHZA 3EN4A 3ERKA 3NDMA 3NNVA 4FC0A 4PPBA 4U6RA 4X2FA 2CGXA 5EW9A 4L01A 4RIOA 1AD5A 3WARA 2C6KA 3UVQA 4IZAA 4W4YA 3RM6A 3FMHA 5DR6A 3ZO2A 4OAVB 2P4IA 4J8MA 2OH0E 4G3EA 3G6HA 3I6UA 4MXAA 2BAJA 3NAXA 4MHAA 3GCUA 5IMXA 4BWPA 2OJGA 2QD9A 4FL2A 1M17A 5J5TA 2GCDA 3ZZWA 2VUWA 1YI3A 5CVFA 2RG6A 4IEBA 4KKGA 3MY0A 2I0VA 2BROA 2C6TA 2XK3A 3AC5A 3II5A 4I6FA 5DOSA 2R3GA 2HXQA 2B9IA 5FTQA 3HECA 3F3ZA 4ZAUA 2BUJA 3GQLA 5CY3A 4U81A 3TCPA 3QTIA 4DAWA 2EU9A 5A46A 3UIMA 1M52A 4AF3A 1RE8A 3Q53A 3V5JA 2F4JA 4JDKA 5DT0A 2VD5A 3OBJA 4Z9LA 2BRBA 4MWHA 5CF4A 4C58A 5BVEA 4QP2A 5HG9A 3VS1A 2LGCA 2F57A 1KE7A 2C5OA 3CY3A 1QPCA 2XK9A 3QHWA 3PDTA 5D1JA 4XS2A 2WMSA 3MJ1A 5CQWA 3G5DA 3NCZA 3UYTA 3QRTA 5BNJA 5HNBA 5L6WL 3E3PA 4CKJA 4CTBA 1Y8YA 3FLYA 4J97A 5CASA 3QQUA 3I5NA 4IB0A 4UB7A 5M55A 3RJCA 5JEBA 4QP3A 1OZ1A 4EH9A 5E8UA 4EOIA 4O0UA 2CSNA 4S32A 2UUEA 3UIXA 2J50A 4UZDA 3DGKA 3Q3BA 3PVGA 3EN9A 5EKOA 3A61A 3FLSA 3MY5A 4TN6A 3LLAA 4NL0A 3HMNA 5CZIA 4RC2A 4BZNA 1LPUA 3LXKA 5FD2A 1BL7A 5KUPA 2XNGA 2UW3A 3QZFA 5AUWA 2Y4IC 3DS6A 4G9RA 2XYUA 5M4IA 3MPMA 2ZDTA 1FVVA 4DGMA 4EZ3A 3BV2A 4O83A 3FZPA 1Q8ZA 3WOWA 4RIWB 3V8WA 3ROYA 1S9IA 1PMNA 4U80A 3H3CA 5DMZA 4JNWA 3N4VA 3A2CA 5EM6A 4C02A 2CN8A 1Q97A 2O5KA 4OTIA 4TYHB 3VAPA 4ACGA 5CF5A 4PNKA 3KRJA 4KA3A 4ERKA 4V0GA 4JDJA 3U4UA 3D14A 3A8XA 5GHVA 3JVSA 4KIKA 1BLXA 2UW4A 4RZVA 5EYDA 4F9WA 4C37A 1ZOHA 3SHEA 4BCQA 2VO7A 3QQKA 3F3VA 3UODA 5LVPA 2ZDUA 3UMXA 4CFXA 3C4CA 3PRFA 3QCSA 2WHBA 3MW1A 4D55A 4DGGA 5K4JA 5F94A 3KGAA 4JT3A 2XM9A 3KCKA 4P4CA 4BFMA 4XG2A 4ERWA 3FC1X 4EOKA 4RJ8A 1YDRE 3BGQA 4R5SA 2QI8A 4IAFA 4RC3A 5JFWA 3DAEA 4DTKA 2F7XE 2ITZA 3NUUA 4R6VA 5JQ8A 3ID6C 2C6MA 3GQIA 5DA3A 3LCKA 3R21A 4FG7A 4F08A 5KBRA 4C35A 3POOA 3R1NA 3BIZA 4O7ZA 5L4QA 4M69B 2VO0A 3C4XA 4FIEA 3FI3A 3S0OA 3QXOA 3OP5A 4O82A 2ZAZA 2UZBA 4KSPA 5J9YA 5BVOA 2HZNA 2CNUA 2ZMDA 3R83A 4OTFA 4E4MA 3C0IA 5E1EA 2X8IA 3DAKA 4EHGA 4IFGA 2CPKE 2WPAA 3BHVA 3CTJA 4XG8A 3IONA 2HW6A 4ASXA 4EYJA 4AA5A 4FKOA 4TYIA 4R77A 3DBEA 4FOBA 3FAAA 3A7GA 2OW3A 4EC9A 4OLIA 2C6LA 1DS5A 5AUZA 3K3JA 4U45A 4FX3A 3RCJA 1QPDA 1RJBA 4BDKA 4F65A 3BYVA 2G1TA 2G2HA 2OJJA 5IEYA 3UZRA 5BYZA 3NEWA 2XUUA 1YHVA 4HYIA 4B8LA 2VX1A 3AMAA 3LIJA 4CMUA 3R1QA 3PXFA 3ZZEA 4C59A 2Q0BA 4EH5A 4W9XA 4FV6A 1J3HA 4J71A 4YJPA 5M4FA 4XOYA 3NVMB 5FP6A 4RC4A 5JZNA 4BIBA 2QR7A 1JKSA 4HCVA 5EM5A 3NPCA 3AG9A 2OU7A 4CRSA 4DH8A 4R3PA 3LM5A 3GU5A 4U8ZA 5AUYA 3TM0A 2PMOX 4FV8A 3VS3A 2QR8A 2R5TA 3ODZX 4EJNA 2UZUE 4O2PA 2X81A 1A06A 1U46A 4MD9E 1OKZA 2GMXA 4FSTA 2WQEA 3DKFA 3QZHA 4FKSA 1W83A 3RPRA 3DTCA 5KZ0A 4KIQA 1WMKA 3IW6A 4FKWA 2ITYA 3H9FA 2R3IA 4Q9ZA 2R2PA 1YOJA 5A14A 3ZLSA 3FY2A 3ORZA 3GU8A 3COKA 4AZFA 4HVGA 3BCEA 4DEEA 4CFVA 3JXWA 3R7YA 2GSFA 2EWAA 1OIRA 4DYMA 2XB7A 3NYOA 5F20A 2GFCA 4ZJIA 5CAVA 5KMIA 4L00A 3R02A 4FICA 4YJUA 2PZRA 1UKIA 2B54A 3UNJA 2EB3A 1ND4A 5E8VA 4U7ZA 5EQYA 5CSPA 1OIUA 1M7NA 3H4JA 1OL1A 4IE9A 4MF0A 4LGGA 4ACMA 2WAJA 1CSNA 2VWZA 3O96A 3EN5A 1AGWA 1IEPA 3R1SA 3FL5A 1GZNA 5AJQA 4EEVA 3TNIA 5A6NA 3IECA 5FBNC 4F99A 3DJ6A 3UC3A 4M15A 4QTCA 4HVIA 2PVRA 3GC8A 1K2PA 1P4FA 2O65A 4NJ3A 4X3FA 3K5VA 3MPTA 2XKFA 4S2ZA 5M57A 3QZIA 3OXTA 5AFVA 2A4LA 1PYEA 3M2WA 5HNIX 2XKDA 5KE0A 5L6PA 2VTLA 2WQOA 1V0PA 4XH6A 4A4LA 4BGGA 3KRXA 1NT2A 2W4JA 3UC4A 4I6BA 4CQGA 2JDSA 3OS3A 3UZTA 5AP7A 2VZ6A 3IOKA 4YZDA 4GK3A 4JAIA 4I94A 1ZY5A 5LVOA 4USDA 4Y5HA 2NP8A 4BDIA 3DOGA 4ZJJA 1YDSE 3ZUTA 5AEPA 5CYIA 3VWAA 1YVJA 2QO9A 4GT5A 4GU9A 3HV4A 3NGAA 5C8MA 3VNTA 3NX8A 3M42A 2BTRA 5AV4A 4ZS4A 5LMAA 4YSJA 3AT3A 3QTUA 3PPJA 4YTIA 3ZEPA 5M07A 1VJYA 2XF0A 3EQHA 3HUBA 4D9UA 3O51A 4IZ5A 3QTSA 5EH0A 3VF9A 3QC9A 3NS9A 4K2RA 4DFNA 4AACA 4CXAA 5LCKA 1XH4A 3ORTA 3SW7A 4BDGA 5DWRA 4IFCA 4YUQA 2ZV9A 1I44A 2PUIA 2XKEA 3FZSA 4GFOA 4AW2A 5K3YA 4AXAA 2YDKA 4O84A 1F5QA 4ASEA 4Q9SA 3SDJA 3GC7A 2HY0A 4U5JA 1UWJA 1YI4A 4NU1A 2CHLA 4V0GB 3CP9A 2IJMA 1QPJA 1YXTA 2ZVAA 1SVEA 5DRBA 4DFLA 3Q60A 5BUEA 4FYNA 2OKRA 2FYSA 1JBPE 2UZTA 5D9HA 4IZ7A 4BIEA 4ZY6A 5M09A 4AZVA 4X2NA 2IVSA 4X3FC 4FUXA 4UMQA 4DTBA 5C4LA 2I0EA 5TO8A 1Q3DA 4FV2A 5IA3A 2VTPA 4CFNA 4CQEA 5J9ZA 3MV5A 3CD3A 4L53A 4R3RA 3MVLA 1ZZLA 3MA3A 2PVMA 5J1WA 1MQ4A 5CEOA 2IVUA 4PDYA 1M7QA 5LJJA 2UZDA 5CWZA 4F0FA 5ICPA 3QYWA 4NM0A 2XH5A 4C38A 1PMVA 4LYNA 2BHHA 1ZXEA 5IISA 3CLYA 2RGPA 5I9UA 3QRJA 4HYUA 4AGDA 3PFQA 2C6DA 4AN3A 2OIDA 3BYUA 5T6KA 2OZAA 4D1SA 3TKUA 5AP2A 4M69A 3R8MA 4N57A 1GZKA 2Z7RA 2Q83A 3FZTA 3CE3A 3ZONA 3QCQA 5GZ8A 4A4XA 4C7TA 5C4KA 1GZOA 3EFKA 3QUPA 1JPAA 1W8CA 3EQGA 3FWQA 4IWQA 3QRKA 1Q99A 4C4IA 1OUYA 1ZRZA 4Y46A 4BF2A 4GK2A 4YPSA 4NH1A 4C8BA 4E4XA 5M56A 4RX9A 3Q04A 4XBUA 2ZB0A 3MFUA 4I6HA 4MQ2A 3Q52A 4GKIA 3CKWA 4QMLA 3TKIA 2GTMA 4YO6A 5KZIA 4UMRA 3JR1A 2YIXA 1SZMA 3LQ3A 4GYIA 2HY81 4EKKA 1KUTA 5EI8A 4QTDA 2X9EA 2J5FA 4E6QA 4O7NA 4FSRA 3NVKI 5AMNA 5CU0A 3R0TA 5L2IA 4DT8A 4XRLA 3MTLA 3QQHA 3D5WA 3T9IA 4XBRA 2RL5A 3NNUA 2WQNA 2W5HA 4MBLA 1XHAA 4AA0A 3FV8A 3KVXA 4WOVA 4K77A 3PY3A 4E4LA 3A7IA 4RIYB 5HKMA 3TUDA 4WNPA 4FIHA 2PPQA 5HG8A 4NUSA 3QCYA 3V5PA 3ZC5A 5M06A 2A27A 1OGUA 4N4SA 3OWJA 3SOAA 5CAQA 3FI8A 3GFWA 4BBFA 3U87A 4KS8A 5HD7A 1PXOA 4NM5A 3MJ2A 1B6CB 4E20A 5JMSA 3A4OX 2UVYA 5H9BA 1GIHA 5J79A 2X7OA 3MY1A 4UY9A 4A7CA 2PYWA 3AGMA 4BKZA 1YXSA 2HZIA 3KN6A 4FL1A 4U3YA 3PPKA 5H8GA 4AGCA 2Y6OA 3ZUVA 5EOBA 2B9HA 3WZEA 3UDBA 4QPMA 2YM6A 3CCNA 5E7RA 5JKGA 4USFA 1PXLA 1EH4A 3IS5A 4IX3A 3ZDUA 4PTCA 3T8OA 4K1BA 2X7FA 3UE4A 3NUPA 4DA5A 3F6XA 5HZNA 4HVSA 2QOOA 2G01A 2WD1A 4RLKA 3FLNC 5CU2A 3WIKA 1WBTA 1QPEA 3BE9A 3KK8A 2BKZA 2XK8A 2V7OA 4ANSA 4EK8A 2IZUA 4CT1A 3UQFA 2PVHA 1WBVA 2UVXA 4FV4A 5K5XA 2XRWA 3WF6A 5ANDA 4ZS0A 2WTKB 1E9HA 2IN6A 2XA4A 3CPCA 3ZO4A 4U43A 3W55A 3MB7A 3VVHA 1OB3A 1OPJA 1S9JA 2W06A 2J2IB 1Z57A 3FMNA 5DVRA 1OITA 3DNEA 2F9GA 3T3VA 2PUUA 2O64A 4XNEA 4HW7A 2DS1A 4IX5A 4BN1A 1H0VA 3FHRA 5E92A 3RWPA 2CGVA 1GOLA 4LOOA 5HGIA 4ZSJA 1T45A 2RFNA 1YXXA 4S31A 4C34A 2YCSA 2ZMCA 5LCJA 3EZRA 2YZLA 5F1ZA 4XV3A 3P5KA 2A1AB 3MFTA 5FXSA 1YOLA 3UIBA 1Z5MA 4AZWA 2X4FA 4L52A 4ACDA 3AMYA 3ITZA 4FVPA 4BR3A 2CKQA 3GU6A 4PTGA 4D1ZA 3PJ3A 4ZLZA 4OBPA 3SA0A 4CG9A 1H07A 2CKEA 2PHKA 2UV2A 2YJSA 4PTEA 5EW8A 3HDNA 1WBSA 2VO3A 1IA9A 3FSKA 3O7LD 3QGWA 4QP6A 3NYXA 2QCSA 3LFSA 2JIIA 3SXFA 5AV1A 2CGUA 4M7IA 2O2UA 4II5A 4A4OA 4NW6A 4YGAA 2OLCA 3ENHA 2YLFA 2YIQA 4ZSAA 3QFVA 4FNWA 4JQEA 4FT9A 4MXOA 4EOSA 3RCDA 5IDPA 5GINE 1TQPA 4I6QA 1PXMA 3S4QA 5EQPA 5HU3A 4LI5A 3IGOA 1IR3A 4A06A 4FF8A 3TI1A 3UMWA 3ZXTA 4JR3A 1OIYA 5AA9A 3DJ7A 2Z7LA 3DDPA 4GU6A 4DFUA 5CVGA 4C4EA 3FXZA 2PMIA 3ZDIA 2Q0NA 3FUPA 4BVUA 4BL1A 2OBJA 3HA6A 2GQSA 3EKNA 2RSVA 3SX9A 3DXPA 5HD4A 3D7ZA 4AW1A 4MQ1A 3A7JA 3IGGA 3Q9YA 3OBGA 4R8QA 4QP9A 3GT8A 3EFJA 3KRRA 4IVDA 3HL7A 5CVHA 4PMTA 3VUIA 5EW3A 3F9NA 4NCTA 4U97A 3UTOA 2XM8A 4OGRA 2X39A 5LARA 3GU4A 4L44A 3HMIA 4F70A 4I0TA 5GJDA 2EVAA 3KC3A 3AMBA 3RM7A 3UPZA 4FNXA 1PXKA 3LFCA 4WA9A 1G5SA 5LMKC 2ZB1A 1J1BA 3D4QA 3LFEA 5A54A 5JN2A 3U6IA 5HI2A 2UW7A 2WB8A 3D5UA 3PJ8A 4FTRA 4YHFA 4FV3A 4BKJA 4D2WA 4RMZA 5HBHA 5HORA 1KSWA 3Q9XA 2WTKC 4CGAA 3WF8A 2OJFE 4CZYB 2ERZE 4CV8A 3WZKA 2FH9A 5EFQA 1Q41A 4HOKA 1YHWA 1UKHA 2XNNA 1REKA 4G2FA 4RLLA 1WAKA 1JKKA 5ANKA 4WG5A 3S1HA 3LCDA 3V5QA 4PL3A 2F7EE 4BKYA 3V01A 3R01A 1UWHA 3UO4A 4DC2A 2XBAA 5JFSA 2YHVA 3NUYA 5H2UA 5HE0A 3ZM9A 4YZNA 3F88A 2Z8CA 5AUTA 4BDAA 4FGRA 3GI3A 3CGOA 3G9LX 4XOZA 2OWBA 5HESA 1XBAA 1V0BA 4JG6A 3CIKA 4E26A 4FTIA 3QC4A 3QD3A 4ANQA 2BMCA 2A0CX 3RWQA 4NW5A 3HVCA 3EQFA 1TKIA 2OIQA 5LXMA 3R7UA 3OOMA 4G6LA 3P7AA 4PY1A 4QD6A 1PRYA 4DFZE 3OT3A 5EM8A 3ATTA 4ZTNA 4YBJA 2ETKA 3E7OA 3PP1A 4OT6A 4J1RA 4APPA 5E8SA 3PVUA 4E5BA 3BU3A 5JRQA 5J8IA 4G3GA 2NO3A 1VEBA 4QQTA 3P7CA 3QYZA 4FSMA 2X8DA 4PX6A 4D4RA 2XNPA 3DKCA 2GQGA 4AE9A 3AQVA 4YR8A 3ZBFA 3PWDA 4I4FA 2E2BA 3VS7A 4Y8DA 3ZRLA 3ZXZA 5HX6A 5CXHA 3O8TA 4RWIA 4FTNA 2UZOA 3WYYA 2VWIA 1PXJA 1XR1A 4WNMA 5CF6A 2JKOA 4O91A 4BYIA 2IZRA 3V04A 4QTEA 2PY3A 3CQEA 4GFMA 5FXQA 4NK9A 4AS0A 5IQBA 1FQ1B 2XJ2A 3Q96A 5T68A 3G90X 4E6DA 4F7LA 1YKRA 1E1VA 2FGIA 3DK3A 3OY1A 3MGYA 4JAJA 3VBWA 1VYZA 3IW7A 2W5AA 5KKRC 4I92A 2BRGA 1O6KA 2ZM3A 1O6LA 3EQRA 3Q4CA 2NNWB 3DB8A 3ZLXA 2WU7A 1H00A 3DZQA 3N51A 3RAWA 1LP4A 4QMUA 2C0TA 2BTSA 4RA5A 3P1AA 2ITNA 3QU0A 2RF9A 4FV1A 1H25A 3D2KA 5CX9A 3HP5A 5BPYA 5E4HA 2QURA 2W99B 4WKQA 1R39A 1G3NA 4AE6A 4BWKA 4IC7A 4O96A 4TYJA 3QA0A 2UW9A 3OEZA 3IKAA 4O7TA 2REIA 4X21A 4FODA 2XKCA 2G2FA 4FKTA 4NM7A 3MI9A 3PPZA 3JVRA 2YCRA 1MRUA 3OCTA 3U9CA 4APCA 3VUHA 1BMKA 2QG5A 4IVAA 3ZRMA 4IDVA 4HYHA 1XH7A 1FGKA 2Z2WA 1ZYLA 4QMPA 4Y72A 2XZSA 4HZSA 4GK4A 3DXNA 4ZLOA 4B0GA 4EOOA 4OBOA 2PE0A 3IPHA 3TV7A 1J7UA 5J95A 1BI8A 4KAOA 3TWJA 3FPMA 3HV6A 5GJGA 4UMPA 3Q9WA 3V5WA 4AZTA 1PKGA 4LL0A 3HLLA 1OKVA 1IAJA 2J0KA 4G3DA 3QXPA 1R0PA 4QYEA 4AG8A 2UZEA 3EIDA 1WBOA 2PVKA 4RT7A 1ERKA 4FTAA 3HAVA 1FBNA 5TKDA 5FM2A 3SOCA 1H1PA 5E91A 3H0YA 4O7VA 4PDOA 5FDXA 4ZMEA 3KXHA 4L7FA 3KN5A 2W7XA 4MWIA 4Q5HA 1IG1A 3BHTA 4EHVA 5I3RA 5GIOE 2FSLX 4FTKA 5HTBA 1H1RA 3WF9A 4C4GA 3ORMA 5FM3A 3NUSA 1VYWA 3ZH8A 4AU8A 4LRMA 3ATSA 4O7YA 4R7IA 1M2RA 3VQUA 4Z55A 2WELA 4U3ZA 1J91A 1TQMA 3AC1A 3RTPA 4QQ5A 4F6SA 2CGWA 4JIKA 3S3IA 2C6IA 3E7VA 5KBQA 4NFNA 4ALWA 4EH6A 2VTMA 1H4LA 3OWPA 3OTUA 1ZMUA 3LQ5A 4QMQA 2OJ9A 1ZOGA 4G34A 4EZ5A 4Y95A 3CXWA 3M11A 2BR1A 3F5GA 4RFMA 4KABA 4EBWA 1Q3WA 5IQCA 4O22A 3P08A 3FQSA 3MVJA 4RBLA 5AR7A 4BTMA 4O7RA 2YM8A 3U54A 3QUDA 4GG7A 2O8YA 4G9CA 4I22A 4QMZA 4DH1A 1P2AA 4FZAB 3BHYA 3ACKA 3MA6A 4YU2A 4H36A 3W16A 3ZOSA 4M3QA 2QOQA 2C47A 3E8EA 3R00A 4XG3A 3W2RA 4X0MA 4CRLA 2P3GX 3FBVA 2CJMA 5EYCA 2ITWA 2GNIA 3R71A 1H0WA 3KQ7A 4FNYA 4U44A 4FK6A 3RBWA 5B2KA 5BQ0A 5M4UA 2RIOA 2YIWA 3F2NA 2VTJA 2R0IA 3E8NA 4FKQA 3C13A 4CZTA 4DF3A 3O17A 3FYJX 3DXQA 5HE2A 3C4WA 1U54A 4KINA 1M2PA 3DFCB 2DUVA 3ACJA 3OUNB 1OL2A 4Y5QA 5AX9A 3TACA 4QTBA 2GDOA 4E7WA 4FSQA 4XG7A 4F9YA 2OFUA 2H9VA 2R3RA 5HIDA 1JNKA 5H3QA 4LRKA 1KE6A 1TVOA 4WO5A 3ZO1A 2R9SA 5IEXA 3V8SA 2JC6A 4FR4A 5J87A 3KL8A 4PQNA 3GBZA 4F7SA 2VNYA 1UNHA 3MH2A 5IA1A 3KU2A 2GPHA 4GEOA 3FC2A 5AV0A 3OW3A 5J7BA 3PLAE 4E73A 5IQAA 3EZVA 3O23A 2I40A 1PYXA 4FEQA 2XJ0A 4JQ8A 2HOGA 3MH3A 3TZMA 2JEDA 2R7BA 3NW5A 4PRJA 1YW2A 1Y6BA 4QMTA 4NIFB 3FDNA 3V6RA 4I5MA 4Y85A 3W2SA 1CM8A 5BVFA 2Z02A 4UWBA 3RVGA 4XV9A 4LQMA 4MBJA 4P90A 3QHRA 4AT4A 4NWMA 5CANA 2W1CA 3D94A 5M53A 4NFMA 3TIYA 3KRLA 4UWYA 1H08A 4AP7A 3AC4A 3SRVA 3KXMA 2GQRA 2HCKA 5GZ9A 4QNAA 4C3PA 5C8KA 3FZRA 3DB6A 3HMMA 4D2TA 3ROCA 4IAYA 4KKHA 3L9MA 1SNXA 3RK7A 4J7BA 1FGIA 1YXUA 1KV1A 2OGVA 3QRIA 4W4WA 5AM6A 4AAAA 4YJOA 5AUVA 3NZ0A 2X2KA 4R3CA 2ITOA 4H1JA 5CI6A 3SD0A 2ERKA 2SRCA 2YLEA 5A3XA 5B2LA 2Y6MA 3FY0A 3IK3A 4DG0E 5AP6A 4K18A 4L42A 5AR4A 4E5AX 5B0XA 2YN8A 2J0JA 3HNGA 2WMWA 3AD6A 3R63A 4I1ZA 4LG4A 4YBKA 2ZV7A 3SG9A 5C26A 1CDKA 1F3MC 3F61A 2JIUA 4EOQA 4O0RA 4HVDA 2W1EA 2ZM4A 5HLPA 4MCVA 4UX9A 2HZ0A 2PMNX 2R0UA 4EQMA 1BI7A 2VX3A 5ETFA 4WG3A 2QC6A 3OROA 4ID7A 2QODA 2VWYA 5CEQA 3JY9A 2XS0A 4P5QA 4BDJA 4CYIA 2B9FA 4CSVA 1JAMA 3DTWA 3KK9A 2ITTA 3PIZA 5CT7A 3EKKA 1P4OA 4CZUA 4FZDB 4TPTA 4Z3VA 1R3CA 4AZEA 3BWJA 1XJDA 2WNTA 5E8WA 5LMBA 4FKPA 3LCTA 4D0XA 4ITIA 4NZWB 5B7VA 1ZZ2A 4EOLA 5C01A 4JOAA 3QKLA 5IQEA 1BL6A 4B99A 1LUFA 3RP9A 3EN7A 4PDPA 5CEMA 3BU5A 4DT9A 5DT4A 2YWVA 5JRSA 3OXIA 4X2KA 3E63A 5DYJA 3P86A 4LUEA 3DK6A 4EWHA 4OR5A 4TWNA 1K9AA 3ZCLA 4D2RA 1SVHA 3G0FA 4XV2A 1FPUA 4MF1A 5AR3A 3BRBA 3TJDA 3MDYA 1G8AA 3FQEA 1YWNA 3F3WA 2CLXA 4HCTA 3TN8A 4HJOA 3UVPA 3UP7A 3CQWA 5TR6A 1SYKA 1Q8YA 4IANA 3VF8A 2QG7A 3DLZA 4O0YA 3G2FA 4IAAA 1FVRA 3TNHA 3PXYA 4EH4A 4D2VA 1P14A 3ANRA 5FG8A 5K4IA 5CALA 3LXPA 2WU6A 4ACCA 3W2PA 3ORPA 3MFSA 4ITJA 4R78A 3TKHA 3UGCA 4EK5A 4UXLA 4QMNA 5GJFA 3VN9A 4ORKA 4LFIA 1KE8A 2FSTX 5M08A 3UNKA 4LV5A 3RI1A 4A9RA 5AP1A 3E8DA 3QTWA 3D5VA 3OT8A 2X9FA 2HWOA 3M1SA 4GS6A 4PMSA 4UEUA 5J7HA 2XNMA 2W1IA 3OY3A 4M0ZA 4MD7E 4MYGA 2VWVA 4OTPA 4UYNA 2GNLA 3WE8A 3EL7A 4YJQA 4O81A 3I79A 4GH2A 2UZLA 3Q4ZA 5HG7A 4BICA 4HGLA 5F4NA 4OAUC 4H05A 3R9DA 4IX6A 5ITAA 2OO8X 3KCFA 4NSTA 2VNWA 4YJRA 3PSBA 4JIAA 3RNYA 3V6SA 3VS6A 4A9YA 2XCHA 4AOIA 5JSMA 5KMOA 3OUKA 5FWKK 4EI4A 5CEIA 4GT3A 5HVJA 4TRLA 3UBDA 3GU7A 1O9UA 2Z60A 2V0DA 3FE3A 2PMLX 3H9RA 3EHAA 1LEWA 2OF2A 3Q2MA 4GG5A 3ZU7A 5HVKA 1JSUA 3DNDA 4LMNA 4O7WA 1R78A 2C4GA 4DEBA 2VTQA 5AAEA 2V55A 3NUAA 4KNBA 4EH7A 3TL8A 5M51A 3I7CA 2FO0A 2R7IA 2WKMA 3TUCA 4MEDA 3QTXA 5FGKA 3LMIA 4L6QA 3FMDA 4RQKA 4RFYA 5BVNA 3P78A 3FXXA 3EQBA 4O7LA 5IQDA 1YHSA 3HV5A 3QD4A 4K6ZA 3O2MA 3JUHA 3I0OA 4BCNA 4BDFA 4DLJA 3BLHA 3E3BX 4YLLA 3HRCA 2CLQA 5CTPA 3R7EA 3RPYA 4PMPA 4S33A 4XHKB 5LQFA 2BZKB 3AGLA 3KF7A 3RAIA 4FSNA 3V5TA 2WTWA 4G6NA 4BHNA 1CKPA 3FI2A 3PJ1A 5EK7A 2V62A 3GGFA 3P4KA 3PE2A 4QMWA 4EONA 3BGZA 3DJ5A 2KTYA 3ZMMA 1FMOE 3I1AA 3GENA 4AW5A 3GP0A 3U6HA 2JDRA 2B0QA 4FNZA 3EQDA 5C1QB 3HDMA 5CQUA 4C57A 2C3IB 3F2AA 3FSFA 4W4VA 2W9FB 3LJ0A 5I0BA 3LPBA 4JQ7A 2BZHB 4RJ4A 5ETIA 4RVKA 5K5NA 4M97A 5AP0A 3BBWA 2VV9A 4C3FA 2YM7A 5DFPA 3FXWA 4C2VA 5J5SA 2IO6A 3UQGA 3FMMA 2B55A 3GCVA 3PA3A 4L45A 1H1QA 2RFSA 2XNOA 3F3UA 3PTGA 4FG9A 5AX3A 4BDDA 4D5KA 3BBTB 2YIRA 4QT1A 4IJPA 1SNUA 2R64A 3V51A 3SXRA 3F2RA 2BCJA 4O1PA 5BMMA 4NM3A 5HO6A 3PA4A 4TW9A 3REPA 4DINA 2VTRA 5KMJA 2GFSA 3QTRA 2PK9A 3FHIA 3DA6A 4CCUA 4AW0A 2ITXA 3QX2A 1UVRA 2HXLA 3LZBA 4FIFA 3RAHA 3UO5A 2VTIA 3PA5A 5IA2A 3IW8A 4I3ZA 4ZZMA 5H8EA 2XEYA 3JYAA 5CU4A 4B9DA 4DGOA 3O8UA 1YWRA 1W7HA 3O71A 2IW8A 5HCZA 2WGJA 3ZM4A 3MFRA 5ACBC 3TXOA 5L2TA 4EQCA 5AIRA 3KFAA 2OXXA 1FINA 3NUXA 4QO9A 2ZYBA 3U8WA 3D15A 4ENYA 4KBCA 2IW6A 4UBAA 4CVAA 5I9YA 3G6GA 3HV7A 4AT5A 1LEZA 2BRMA 4RZWA 1XH6A 2WTDA 4TWOA 1OIQA 2JD5A 3DBFA 1OM1A 2WOUA 3COHA 1SM2A 3W18A 3PSDA 2QU6A 3RINA 3HGKA 3EN6A 4IZYA 3PXRA 4UWCA 4PUZA 4F7NA 2XIKA 4GUBA 1IAHA 5FDPA 1ZY4A 2B53A 4ZSLA 2C5XA 3R04A 4I0SA 1O6YA 2I0YA 2J5EA 3P0MA 2YM4A 3EYHA 4NCTC 4ZSGA 4BCIA 4JBQA 4G5PA 2IZSA 4ZSEA 4IVCA 4KD1A 3P23A 4WD5A 3D83A 3PVWA 5JT2A 5DI1A 3ZFYA 3B2WA 5TOZA 3N9XA 4S34A 2ETMA 3HKOA 4LL5A 3W33A 4CMTA 5A6OA 4MNEA 3PIXA 3K5UA 3OCBA 4FKRA 3OHTA 3FEGA 2G15A 3BYMA 1W0XC 2J0MB 3MIAA 5DRDA 4HGTA 4WBBB 5T3QA 4M67A 3VBQA 4FEXA 4J53A 3AD5A 3HA8A 3MH0A 1RDQE 4JX3A 2YCFA 4A9TA 1ZYDA 2OH4A 3VUTA 3UOHA 4EC8A 4YJNA 2XMYA 5H8BA 4R7BA 4ANMA 2GS7A 3S00A 2JDVA 4QP7A 3DKGA 4XEYA 4ZIMA 4AX8A 5LWMA 3RAKA 5FEEA 3FMEA 3VUGA 2PVNA 2QLQA 4TWCA 3SKCA 4HNFA 3R8PA 5IH4A 4LV8A 4L67A 3BV3A 4AFEA 2VWXA 2W17A 3PWYA 1U4DA 2YZAA 2VAGA 4FGBA 1P5EA 4DH5A 3QQJA 3I0QA 2R3OA 2YA9A 3GCSA 5DH3A 3KREA 4WUNA 5DR2A 2R3HA 3LCOA 4E1ZA 4X2JA 4E6CA 4UN0C 2C1AA 3VULA 3NMUF 3GFEA 4WNOA 2I7QA 3BELA 5IQIA 2CN5A 2J51A 2XVDA 2IZTA 2PVYA 2W4OA 3ALOA 3GOKA 4FKVA 2RFDA 5DBXA 5AP4A 5EDRA 3AT2A 4MKCA 2RFEA 1LR4A 2WEIA 2WEVA 4KSQA 4IJ9A 1ZOEA 1Z9XA 4C33A 4F4PA 4FT7A 3DBCA 2P55A 1PXNA 2WMTA 2YM5A 3LLTA 4R1VA 3ZRKA 2VTAA 4KUJA 2W1GA 4FIIA 3R7VA 5IQGA 4M68A 2J6MA 4DH3A 3TNPC 3KY2A 4WSYA 4YC3A 3IDPA 5FLFA 1GZ8A 2YFXA 4IB3A 1OL7A 4D9TA 3GC0A 1R1WA 1YDTE 4QNYA 5HCXA 4D58A 3AT4A 4I5HA 4FK3A 5FQDC 3ZSIA 2R3MA 3ZLYA 1UNGA 3RALA 3DBQA 3LFNA 4BBEA 4GVJA 3EOCA 4ZTHA 5E1SA 2GTNA 5HEZA 5GIPE 5K0XA 4X7QA 2W96B 2ETRA 3MVHA 4RG0A 3LAUA 5AWMA 2HZ4A 3E88A 2QONA 3VHEA 3DZOA 2JITA 2UW5A 3GCPA 3C7QA 4XP3A 2VRXA 5DR9A 4U0IA 5CAPA 5EI6A 3W2QA 2JKKA 3QF9A 3D5XA 3PRIA 4OT5A 5LWNA 3NNXA 5AUXA 4QYFA 1JSTA 3UOKA 2JAVA 1OL6A 3NR9A 3QAME 5HOAA 4CKIA 4F63A 4JG8A 2R3NA 2XIRA 1UA2A 4K0YA 4AOJA 4B6LA 4YURA 4F6UA 5JZJA 4F9CA 4CLJA 5L3AA 3QLFA 5D11A 4PP9A 4D1XA 3MS9A 2C5NA 3EYGA 4E93A 4HPUE 2CCHA 3HRBA 4GRBA 3ZS5A 4FT0A 4ZZOA 3CKXA 2XIYA 4MBIA 2I6LA 2OF4A 2R3JA 3CGFA 4F64A 5KO1A 5L6OA 3F5PA 3VS4A 4NT4A 4FV0A 4GCJA 4YZ9A 5HE3A 4RFZA 5JH6A 4YNEA 4IBMA 1I09A 4D0WA 3ETAA 2GHGA 4WHZA 1W84A 2BIYA 3OZ6A 3P9JA 3KVWA 4H3BA 4Y73A 3TTIA 3UPXA 2R3QA 2V5QA 4FI1A 4LM5A 3DLSA 4LOQA 2JAMA 4Z7HA 1OL5A 3KXNA 5AM7A 4BDCA 4C2WA 1XH5A 5G1XA 1GJOA 4IVBA 4MH7A 4U41A 3UZPA 4BIDA 4DTAA 1XH9A 2A19B 2C3KA 1OUKA 2HELA 5CENA 3DQXA 2VX0A 3FKOA 1JKLA 3N4UA 1CKIA 3U6JA 1HCKA 1YRPA 4KBKA 2VN9A 5C27A 4DN5A 1L8TA 1JSVA 3E64A 1B39A 2C1BA 4GFGA 4XV1A 2HW7A 3ZFXA 2OZOA 2BHEA 2HWPA 3KF4A 2O0UA 2ZM1A 3RHKA 4GW8A 3RMFA 5I9WA 4UYAA 2B1PA 3UOJA 2IG7A 2XK4A 2WFYA 2B9JA 5L8LA 4RA4A 2BRHA 2IVVA 4EHZA 2WQMA 3QTZA 5BVDA 2RKUA 5CZHA 4IADA 1KWPA 3LMGA 5EKNA 3SGCA 4H3PA 5DIAA 3OVVA 4CFWA 4CFMA 2JLDA 5CT0A 1V0OA 4C61A 3LKMA 4BZOA 2QVSE 3O50A 2WMBA 5I9VA 4L43A 5I9XA 1WBWA 2W1FA 3G15A 1H27A 3KKVA 4PWNA 3KRWA 2RG5A 3BWFA 2BAQA 3LW0A 4R7HA 4AT3A 4WNKA 4CG8A 1Q62A 3AD4A 3FZ1A 5AA8A 3MN3A 3ELJA 3A7FA 2BDFA 1WVWA 3MH1A 4XG4A 3R7GA 3DKOA 5AR5A 5LOHA 3IW4A 3BEAA 4BCFA 4F7JA 4M66A 4MNEB 3PP0A 5EHOA 5CEPA 2WZJA 3PE1A 3T9TA 4HZRA 4BDBA 4Z16A 4RWKA 2J4ZA 1PMEA 4P7EA 5I5ZA 3AC3A 2GNFA 3WZJA 3CPBA 5A4EA 4IB1A 4EK4A 3R2YA 5BUJA 4FKGA 1DI9A 4GV1A 3LFBA 4ZY4A 3LFAA 2R4BA 3C51A 4RIWA 5C03A 2W1HA 3VS2A 4GUEA 2AYPA 1J7LA 1YWVA 2B7AA 3HV3A 3L9NA 5KX8A 3BYOA 4RVMA 4QMXA 4FZ7A 3EMGA 4M8TA 5AP5A 1PJKA 5IH5A 4NYEA 5DEWA 4JS8A 4YMJA 5CI7A 2BILB 5CAOA 3IDCA 2PVLA 2C0IA 3CSVA 5HTCA 1H28A 2YWPA 4K33A 1BYGA 2X6DA 4O0TA 2J7TA 3VIDA 4KIOA 3MPAA 2AC3A 4BI1A 2FVDA 3NWWA 5DT3A 3R9OA 3P7BA 1WBPA 3FQHA 3W32A 4LGDA 4YLKA 3N4TA 5I4NA 2C68A 4EBVA 1B38A 4DITA 2BFXA 4DFYA 2GNHA 4A9UA 4YC6A 1PMUA 2UW6A 3VO3A 1IRKA 4FKIA 2C30A 5DLSA 4C62A 4YHTA 2HYYA 4TY1A 5EHYA 3AC8A 1OMWA 2WMAA 4MAOA 5DNRA 1WVYA 3CY2A 2YIYA 3SQQA 4BB4A 4GKHA 5AV2A 3UVRA 5EM7A 3BLRA 5GNKA 2J0IA 4O0WA 2WTJA 1URWA 3OC1A 3CC6A 3IDBA 3KMWA 4FTLA 4MX9A 5KKRB 4BC6A 5D7VA 2NRYA 4IWPA 5BX0A 4QPAA 4JBOA 2C3LA 3C9WA 3AOXA 4O6EA 4ALVA 4D4SA 1U54B 1W98A 3I6WA 1F0QA 3F7WA 2GS2A 4J8NA 4O0SA 3D7TA 4XP0A 2XIZA 4FIGA 4O86A 4GJ2A 2X6EA 2CMWA 1Q4LA 4MXZA 3SXSA 3QKKA 3VQHA 4FKLA 3ANQA 4H3QA 4XYFA 4DEHA 1XBCA 5EQEA 2QQ7A 4OUCA 2R3PA 3I4BA 3NW7A 5LVLA 5ACKA 1RW8A 4I41A 2OXYA 3DAJA 1KV2A 2VTTA 3CD8A 3DK7A 4FV9A 4JBVA 2R3LA 4MK0A 2XEZA 4IB5A 4NJDA 4EL9A 5E8YA 5JGBA 2JBPA 1A48A 4BCHA 2EXEA 3GNIB 4YZMA 3KEXA 3MWUA 3DPKA 4TZRA 5HCYA 4AFJA 1Q24A 4KWPA 4RJ6A 2XCKA 3LXLA 5CU3A 5JQ5A 3HZTA 4MNFA 2QOKA 3ZO3A 3FZOA 4IX4A 3R22A 3C0GA 2JGZA 3I81A 4PPCA 5ANEA 1JQHA 2ITVA 3R6XA 4O2ZA 4E4NA 3Q5ZA 4N0SA 4RWLA 2DYLA 3KMUA 4I23A 4XJ0A 5ETCA 3R73A 4QOXA 3FPQA 3LCSA 4PL4A 2W1DA 1VR2A 3NLBA 3PLSA 3QD0A 4FKUA 4FUYA 4U42A 5EYKA 2ZV8A 4C4HA 3ENMA 3O8PA 2WTIA 4IHPA 4P2KA 2W4KA 3B8QA 4BDHA 5IU2A 4YO4A 1ZMWA 2PUNA 5A4CA 4PL5A 3ZHPC 4AN2A 3R8UA 1ZYCA 3FYKX 5CSHA 1PY5A 4DEGA 3G0EA 4YZCA 5HG5A 2XBJA 1XQZA 4ZTSA 3VRYA 4C3RA 3UO6A 4ZEGA 2XJ1A 2P2IA 4QQJA 3RHXA 1W82A 2J90A 4W8EA 4X3JA 4JRVA 2E9VA 4DG3E 5DHJA 4YC8A 5HVYA 5HIEA 2Y4IB 2H96A 5CNNA 5L8KA 1Q8UA 4YPDA 2XP2A 3TT0A 2C5YA 2Z7QA 5DPVA 5IZFA 2I0HA 1ZYJA 4FMQA 4QYHA 4DEIA 1L3RE 2F49A 5E8TA 5CS6A 2C6OA 3QGYA 1DAYA 4WSQA 4AOTA 2BZJA 2X0GA 3ET7A 4I5CA 4RJ3A 3DCVA 3UP2A 2BFYA 3TEIA 3W8LA 1DI8A 2VWUA 2Z7SA 4C0TA 4HNIA 3JS2A 5IUHA 5L2WA 3D9VA 2E9OA 2V22A 4G3CA 2YAAA 4TYEA 2BVAA 5JFXA 4JDHA 3VW6A 4CYJA 3R7IA 5HLNA 3IG7A 3TTJA 2QOBA 2QOLA 3QA8A 3BQCA 1OBDA 4JR7A 4FT5A 5HE1A 3E8CA 2XNEA 4G1WA 3QQGA 4BTKA 4I93A 4CMOA 4M13A 2C5VA 4JBPA 3CQUA 3UIUA 2FSOX 5BMSA 4IACA 5ANGA 3WF7A 4FIJA 3CEKA 2H34A 3L1SA 2O63A 4KIKB 4YLJA 2AUHA 1XO2B 4KRDA 4DHFA 2X8EA 1XH8A 3QQFA 4RVTA 4I24A 3NUNA 4ZMFA 2VGOA 2ONLC 2IWIA 4YTCA 3GOPA 4IQ6A 3DFAA 1FMKA 4FTUA 4O27B 2OICA 5D10A 4EK6A 4PP7A 4O1OA 3MYGA 4C4FA 4RQVA 4WT6A 1UU7A 2A2AA 4QYYA 3OWKA 2KULA 4H1MA 4G17A 1H24A 2JIVA 3D0EA 3PYYA 4J96A 3EFWA 1NVSA 2AC5A 4YZBA 1NXKA 1PHKA 4CTCA 3L8VA 2OI4X 4WIHA 2BAKA 5G6VA 4O6LA 4P5ZA 3AXWA 1NW1A 2JDTA 1R0EA 2X2LA 3PJ2A 3E5AA 4OTRA 3TZ8A 5DG5A 4YJSA 5CAUA 2YJRA 3S2PA 1X8BA 3B2TA 3LMHA 5FTOA 4YJTA 4FG8A 3MB6A 4D2PA 3BEGA 5IH6A 2PZ5A 3B8RA 3DDQA 2Y7JA 5IUGA 3RNIA 1ZMVA 1J7IA 2EXCX 4WG4A 5CSXA 1DM2A 4YSMA 5HO7A 4DFXE 2W0JA 3R7OA 3U4WA 5CU6A 2JFMA 3TZ7A 5AADA 5IA5A 2YABA 4V04A 4OW8A 4V05A 3OG7A 4B4LA 5IG1A 2PE2A 5LMKA 3BQRA 4CNHA 3FKLA 2YDJA 3OWLA 4ZTQA 4EH8A 2ITPA 2HIWA 4BCJA 4QYGA 2W5BA 3LFDA 5CLPA 3R8VA 1WBNA 3QCXA 3BKBA 1H1SA 3C4EA 3S95A 4RX8A 5BVKA 3ZSHA 3CBLA 4UXQA 4Z7GA 4J99A 1ZWSA 3GVUA 4EOJA 5JGDA 5IA0A 1MP8A 4OBQA 5AAFA 4OTWA 4UALA 3QKMA 3K54A 4NKAA 5IEVA 1ZAOA 2UW8A 2F2CB 4ZY5A 2HK5A 3HEGA 4FTQA 4IM3A 1OI9A 2GHLA 3SRVB 1CKJA 3CTQA 3ULIA 4ASDA 3UG1A 2O3PA 5DE2A 3BX5A 1U59A 4CFFA 3QL8A 5C8NA 1BUHA 5KMNA 4DGLC 3FMJA 3ORLA 3WF5A 1MRYA 4YNOA 4ZTRA 3RZBA 4UMTA 4CD0A 2VO6A 2CCIA 4CEGA 3QRUA 5FP5A 2OK1A 4F1MA 4FYOA 2QNJA 3K2LA 4RX7A 3WBLA 4EUUA 3GXLA 4IAZA 2OJIA 1YI6A 5CNOA 1Q8WA 3CJGA 3EQIA 5ANIA 2X2MA 3W10A 1KOAA 2PULA 4B7TA 4EH2A 5AP3A 3GB2A 4F6WA 1E1XA 3O7LB 2CKOA 4WRSA 4TT7A 4RRVA 4O0XA 4ZP5A 3CJFA 4EKLA 2R3KA 4R1YA 3LHJA 1CTPE 4L9IA 4PMMA 2LAVA 5HIBA 4D28A 5HBJA 3RK9A 3BPRA 1BX6A 1DAWA 3VBYA 1U5RA 3TUBA 3QWKA 4QMYA 3OW4A 4YJVA 4BGHA 3VW8A 4IAKA 5IKWA 5BUIA 2EB2A 3IO7A 3R2BA 4FTCA 3WE4A 4D2SA 3ALNA 4GYGA 4IWOA 3UJGA 1SVGA 1QMZA 3VJOA 3PZEA 4IWDA 4HGEA 4IM2A 4D4VA 5HTIA 3BU6A 4C36A 1Y6AA 2PZPA 3LE6A 5IQFA 2ACXA 2WMXA 2B52A 3F7ZA 1ATPE 4FTMA 3KULA 3BHHA 4YHJA 5JGAA 4RJ5A 1UU9A 5A4LA 3EFLA 4USEA 3L8XA 3U51A 1OKYA 1M2QA 3NCGA 4H58A 4L3PA 4GIIA 3RKBA 3WILA 1M14A 1APME 3MSSA 4FOCA 2VWBA 4Q2AA 4JXFA 5D12A 4W9WA 5K0KA 2XIXA 3A8WA 4XX9A 1MUOA 1NVRA 2PVFA 4BTJA 5IUIA 4FZ6A 3ZUUA 2CNQA 4CLIA 5E9EA 3VUMA 3SW4A 3RGFA 3ULZA 4FE2A 1RQQA 5DGZA 3LQ8A 2QOCA 4LMUA 3C50A 3HUCA 5CXZA 5IA4A 5IMEA 3DT1A 5AV3A 2YM3A 2QHMA 3KXGA 4FT3A 1OECA 4AUAA 2UVZA 2YDIA 3ORKA 4I5PA 2EXMA 4BCOA 2XK7A 3BE2A 4JJRA 3VUDA 2H6DA 3LOKA 3R9NA 3QALE 4DBNA 4QMOA 4EQUA 5DN3A 5FXRA 4N70A 3LJ2A 1IA8A 3A60A 3QWJA 4PF4A 4RJ7A 3PG3A 4JDIA 3TZ9A 2EUFB 3ZC6A 4IAIA 3PXZA 2NPQA 5FEDA 5A4QA 3TV4A 3FMLA 2ESMA 4FVRA 5TF9A 2QKWB 4DH7A 2Y9QA 3GEQA 3QZGA 4EHEA 4IM0A 2E9NA 3TIZA 4ZK5A 2F7ZE 3LFFA 5EHLA 4L46A 5HHWA 1YXVA 2Y0AA 3Q4UA 1VZOA 3BI6A 3IQ7A 4FVQA 4I20A 4LUDA 2WTVA 1NA7A 3CS9A 4JL9A 4BTFA 3OMVA 3I7BA 3BHUA 3PY1A 1JKTA 2DWBA 2I1MA 4ZTMA 2NRUA 3EJ1A 3POZA 4I4EA 4QP1A 4L3JA 5ETAA 4QPSA 2OSCA 4IXPA 3PY0A 5AAGA 4FKJA 3E92A 1XKKA 4J52A 3ODYX 2XNBA 3SVVA 2W9ZB 4M0YA 2QOIA 4LGHA 1JVPP 3UNZA 3DU8A 3I60A 1UNLA 2QHNA 3G33A 5CEKA 3C0HA 4K8AA 1BKXA 5E8XA 3ZYAA 4ZXTA 4FA2A 3NIEA 4XLVA 4KB8A 3FKNA 3TNWA 4XG9A 2VTNA 1Q5KA 4RWJA 2WMQA 2C69A 5L2SA 4FTTA 4RSSA 4TNDA 4J98A 4V01A 3D2IA 3Q6UA 3KMMA 3KB7A 4AQCA 3OCGA 4OTDA 5A9UA 4Y83A 4BWXA 1H26A 5HQ0A 2VU3A 4IW0A 3FMKA 3L8PA 2X7GA 4GT4A 2IW9A 1PXPA 2C3JA 3H10A 4E8AA 3F69A 2OIBA 3R9HA 3RPVA 3TV6A 2QO2A 2G9XA 3A4PA 4FBXA 4E6AA 3C5IA 2XRUA 4TTHB 5AUUA 1AQ1A 3WZUA 4XCUA 4NEUA 2E9UA 3E87A 3TJCA 4CT2A 3WI6A 3UQCA 1UU8A 5EDQA 4DGNA 2UW0A 5I9ZA 1Y8GA 4FSWA 4JLCA 3SLSA 3VRZA 4EWQA 1JOWB 3NW6A 5J1VA 2WOTA 2HENA 4DBXA 3COIA 3ZFMA 3TDWA 1STCE 1OPKA 5L2QA 3IOPA 4QRCA 3WZDA 4YTFA 3FLZA 3F5UA 5KCVA 4O21A 1ZLTA 1GY3A 3QD2B 1OPLA 3T3UA 3VS0A 2WMUA 3NRMA 1URCA 2WMVA 3VHKA 2H8HA 1HCLA 2Y4PA 4RX5A 4BY9E 5HU9A 1GAGA 3E62A 4U40A 2FSMX 3MIYA 4IMYA 5LVNA 3A7HA 4D4YA 2PVJA 3C4ZA 4RIXA 3F82A 2ITUA 3LXNA 4HPTE 3UYSA 1SMHA 2OG8A 4NIFA 4LOPA 2PWLA 4EZ7A 4F09A 4BCKA 1WZYA 4TL0A 3DBDA 2PTKA 3VS5A 2GS6A 1GNGA 3UG2A 2PU8A 3R9RA 4EJ7A 4H39A 2PE1A 2FUMA 1U5QA 2UZWE 3RPSA 3PXKA 3U9NA 4KS7A 1H01A 4ENXA 3NAYA 4PV0A 2WTCA 1Y91A 4DLIA 4RGJA 1GIJA 3VUKA 4UMUA 1HOWA 5E90A 3LVPA 4F1OA 5KMLA 3Q5IA 5HBEA 2WQBA 1XWSA 3V3VA 4AN9A 4O0VA 5DEYA 5I3OA 5EG3A 3HX4A 4I21A 3PSCA 3BLQA 4UV0A 3UOLA 3W8QA 1KOBA 4W8DA 2VTHA 4OTQA 5HO8A 4G6OA 5EYMA 4DCEA 3V8TA 4BBMA 3Q2JA 1OVEA 5TE0A 4EYMA 4IH8A 3W1FA 3DV3A 4BCGA 4M12A 2YERA 5HNGA 3W2OA 4BI0A 3VC4A 4KRCA 3QLGA 2BDWA 4EOPA 2QU5A 4RIYA 1V1KA 2GU8A 3C4FA 3SAYA 3GCQA 1ZYSA 4MVFA 2V7AA 3QTQA 2ZOQA 1NVQA 3FI4A 4EUTA 3HMPA 4ARKA 1FOTA 4JG7A 3Q32A 2G2IA 1OBGA 3AC2A 3ZLWA 3L8SA 2WO6A 4G3FA 4ANNA 4DEDA 3ZBXA 4GVAA 2IPXA 4BI2A 4X2GA 2FA2A 3NNWA 4BRXA 3EQCA 2ITQA 4F0GA 2YITA 3K3IA 2UZNA 3JPVA 4IC8A 4TYGA 4ZTLA 1Q61A 3KXZA 4ANBA 2YACA 3PIYA 3R8ZA 3PJCA 3FLQA 3VBVA 1UU3A 5B2MA 4ACHA 1MRVA
chains in the Genus database with same CATH superfamily
4BZDA 2F2UA 5CSWA 5FTGA 2BPMA 3ORIA 4XLIA 3GUBA 4PDSA 1FVTA 5AR8A 5M44A 2HAKA 3CR0A 4A07A 3NYNA 3TG1A 1KE9A 4G16A 3QUEA 4IIRA 5ANOA 3UDZA 3SC1A 2P33A 4AA4A 2GHMA 5JFVA 3OD6X 1CMKE 4QP4A 1H8FA 4W4XA 4WBOA 4TWPA 4AZSA 5D41A 1PW2A 4I0RA 2OFVA 5HX8A 5BVWA 2QOFA 3DQWA 3MBLA 2PSQA 4FTJA 4QMVA 1YOMA 1H1WA 2JDOA 3QBNA 3Q4TA 5F95A 3WYXA 2ONLA 2VWWA 4PPAA 3QQLA 3Q6WA 4CCBA 2PZIA 4TNBA 5JK3A 3L9LA 5HICA 3NFFB 4OTGA 4GJ3A 3W0NA 1UV5A 1J1CA 3F66A 1QL6A 4N6ZA 4ASZA 4RPVA 5KHWA 2WXVA 4ANLA 2VTSA 4BYJA 2BRNA 3HMOA 3NYVA 4QMSA 4G31A 2JKMA 2XYNA 4JX7A 3KULB 5IQHA 4YTHA 3R1YA 2BALA 4LRJA 4FV5A 4EORA 2YCQA 5CSVA 5HLWA 3OEFX 2C6EA 3V5LA 5E8ZA 2JKQA 4NTSA 4CV9A 4ZLYA 4ZZNA 4CKRA 2YEXA 4X6RA 5ANJA 4E5WA 2WMRA 4EH3A 3LFQA 3PG1A 4WUAA 3Q9ZA 2P0CA 4DG2E 4K9YA 5KHXA 3OXZA 3ORXA 4XRJA 4X3FB 5FEQA 4ALUA 2QOHA 5KMKA 4Q5EA 5AR2A 2X4ZA 4QMMA 3OOGA 4AGWA 1IASA 3WIGA 3CTHA 3H0ZA 3OCSA 4L68A 4R5YA 3FL4A 3RK5A 1NY3A 3KA0A 4F9AA 1Q8TA 2R3FA 3E93A 3OF0A 5IPJA 5BYLA 4DFBA 4B8MA 5BYYA 4XUFA 4GL9A 4UZHA 2VGPA 4DCAA 1JWHA 3NSZA 1YQJA 4OTHA 2IVTA 3SG8A 3BYSA 4FSZA 5A4TA 4IDTA 1ST4A 4FEVA 4YP8A 4BCPA 3C1XA 3EWHA 4FTOA 3D7TB 3G51A 1WCCA 3TNQB 4EOMA 1K3AA 1MQBA 3F5XA 5FRIA 2QLUA 4QTAA 5M4CA 3KIOC 4U9AA 1TFFA 4TYHA 2CDZA 3I5ZA 1WVXA 4DEAA 1PKDA 3EQPA 4JI9A 4MXCA 4FEUA 4E3CA 4S30A 4G5JA 3PVBA 2B4SB 1QCFA 3OTVA 3GC9A 5J9LA 4GIHA 3LJ1A 4MD8E 2PL0A 2PZYA 1A9UA 4HYSA 4O7SA 2PUPA 3HP2A 2BIKB 5GZAA 5IDNA 4L7SA 4TKSA 4JRNA 5D7AA 4FSUA 2CKPA 3ZEWA 4MXYA 3H30A 1WFCA 4K11A 3EH9A 3JY0A 4CFUA 4F0IA 5CF8A 3VJNA 4RIXB 4ITHA 5IF1A 2E9PA 1XBBA 4HVHA 4DE4A 2GNJA 2P2HA 2OXDA 3MVMA 3COMA 4KBAA 3W2CA 3LM0A 3FLWA 2W1ZA 3F3TA 3RPOA 1OKWA 3R28A 4X6QC 3VBTA 3G9NA 1T46A 4PNIA 1JLUE 4JVGA 4AWIA 3U55A 3R8LA 3SV0A 1G8SA 3BL9A 3BZ3A 4MXXA 2XK6A 1PXIA 2C0OA 2FB8A 4WRGA 5C9CA 2W05A 5LVMA 2ZJWA 4GMYA 2JBOA 4TXCA 2WIPA 4FZFB 2J0LA 3MTFA 5TT7A 2CNVA 4BJJA 3P79A 5EI2A 4BDEA 5EOLA 1KE5A 3RZFA 4BCMA 1REJA 2Y8OA 4XP2A 3EB0A 4L3LA 5AIKA 2ZV2A 5F9EA 4N6YA 3R30A 1ZARA 4KIPA 2DQ7X 4J95A 4M84A 3L9PA 5KMMA 2BKKA 3HRFA 3MESA 3W0SA 4XMOA 4D5HA 3THBA 4A9SA 5FUTA 4FL3A 4EK3A 1W2FA 3EL8A 3ORNA 3HYHA 4HGSA 3VBXA 4FV7A 4C4JA 3A62A 3HAMA 4O38A 4ZOGA 2UZVA 3BGPA 4MTAA 4NTTA 4QQCA 2OZAB 5KNJA 1GIIA 4FSYA 3O0GA 1TQIA 2J9MA 3PXQA 4O4FA 2BDJA 3DY7A 2X1NA 4HCUA 2WIHA 4KKEA 4NKSA 4M14A 4ONAA 3ZTXA 4ANOA 3H9OA 4L8MA 4QP8A 4BGQA 3TDVA 5L8JA 3A99A 3FJQE 3C5UA 3PZHA 5EDPA 4FEWA 2VTOA 2BZIB 3NIZA 5FBOA 4RVLA 2QO7A 3OFMA 3KXXA 3QX4A 1VLRA 4U79A 1PF8A 2YAKA 5K9IA 2GNGA 2JFLA 3ZSGA 4F1TA 4F9BA 4AGUA 3PUPA 3IW5A 4ZJVA 2AEGA 2YISA 2QKRA 4XG6A 1Y57A 4GSBA 4BHZA 3EN4A 3ERKA 3NDMA 3NNVA 4FC0A 4PPBA 4U6RA 4X2FA 2CGXA 5EW9A 4L01A 4RIOA 1AD5A 3WARA 2C6KA 3UVQA 4IZAA 4W4YA 3RM6A 3FMHA 5DR6A 3ZO2A 4OAVB 2P4IA 4J8MA 2OH0E 4G3EA 3G6HA 3I6UA 4MXAA 2BAJA 3NAXA 4MHAA 3GCUA 5IMXA 4BWPA 2OJGA 2QD9A 4FL2A 1M17A 5J5TA 2GCDA 3ZZWA 2VUWA 1YI3A 5CVFA 2RG6A 4IEBA 4KKGA 3MY0A 2I0VA 2BROA 2C6TA 2XK3A 3AC5A 3II5A 4I6FA 5DOSA 2R3GA 2HXQA 2B9IA 5FTQA 3HECA 3F3ZA 4ZAUA 2BUJA 3GQLA 5CY3A 4U81A 3TCPA 3QTIA 4DAWA 2EU9A 5A46A 3UIMA 1M52A 4AF3A 1RE8A 3Q53A 3V5JA 2F4JA 4JDKA 5DT0A 2VD5A 3OBJA 4Z9LA 2BRBA 4MWHA 5CF4A 4C58A 5BVEA 4QP2A 5HG9A 3VS1A 2LGCA 2F57A 1KE7A 2C5OA 3CY3A 1QPCA 2XK9A 3QHWA 3PDTA 5D1JA 4XS2A 2WMSA 3MJ1A 5CQWA 3G5DA 3NCZA 3UYTA 3QRTA 5BNJA 5HNBA 5L6WL 3E3PA 4CKJA 4CTBA 1Y8YA 3FLYA 4J97A 1W2DA 5CASA 3QQUA 3I5NA 4IB0A 4UB7A 5M55A 3RJCA 5JEBA 4QP3A 1OZ1A 4EH9A 5E8UA 4EOIA 4O0UA 2CSNA 4S32A 2UUEA 3UIXA 2J50A 4UZDA 3DGKA 3Q3BA 3PVGA 3EN9A 5EKOA 3A61A 3FLSA 3MY5A 4TN6A 3LLAA 4NL0A 3HMNA 5CZIA 4RC2A 4BZNA 1LPUA 3LXKA 5FD2A 1BL7A 5KUPA 2XNGA 2UW3A 3QZFA 5AUWA 2Y4IC 3DS6A 4G9RA 2XYUA 5M4IA 3MPMA 2ZDTA 1FVVA 4DGMA 4EZ3A 3BV2A 4O83A 3FZPA 1Q8ZA 3WOWA 4RIWB 3V8WA 3ROYA 1S9IA 1PMNA 4U80A 3H3CA 5DMZA 4JNWA 3N4VA 3A2CA 5EM6A 4C02A 2CN8A 1Q97A 2O5KA 4OTIA 4TYHB 3VAPA 4ACGA 5CF5A 3UDSA 4PNKA 3KRJA 4KA3A 4ERKA 4V0GA 4JDJA 3U4UA 3D14A 3A8XA 5GHVA 3JVSA 4KIKA 1BLXA 2UW4A 4RZVA 5EYDA 4F9WA 4C37A 1ZOHA 3SHEA 4BCQA 2VO7A 3QQKA 3F3VA 3UODA 5LVPA 2ZDUA 3UMXA 4CFXA 3C4CA 3PRFA 3QCSA 2WHBA 3MW1A 4D55A 4DGGA 5K4JA 5F94A 3KGAA 4JT3A 2XM9A 3KCKA 4P4CA 4BFMA 4XG2A 4ERWA 3FC1X 4EOKA 4RJ8A 3BLAA 1YDRE 3BGQA 4R5SA 2QI8A 4IAFA 4RC3A 5JFWA 3DAEA 4DTKA 2F7XE 2ITZA 3NUUA 4R6VA 5JQ8A 3ID6C 2C6MA 3GQIA 5DA3A 3LCKA 3R21A 4FG7A 4F08A 5KBRA 4C35A 3POOA 3R1NA 3BIZA 4O7ZA 5L4QA 4M69B 2VO0A 3C4XA 4FIEA 3FI3A 3S0OA 3QXOA 3OP5A 2XAOA 4O82A 2ZAZA 2UZBA 4KSPA 5J9YA 5BVOA 2HZNA 2CNUA 2ZMDA 3R83A 4OTFA 4E4MA 3C0IA 5E1EA 2X8IA 3DAKA 4EHGA 4IFGA 2CPKE 2WPAA 3BHVA 3CTJA 4XG8A 3IONA 2HW6A 4ASXA 4EYJA 4AA5A 4FKOA 4TYIA 3P5JC 4R77A 3DBEA 4FOBA 3FAAA 3A7GA 2OW3A 4EC9A 4OLIA 2C6LA 1DS5A 5AUZA 3K3JA 4U45A 4FX3A 3RCJA 1QPDA 4LV7A 1RJBA 4BDKA 4F65A 3BYVA 2G1TA 2G2HA 2OJJA 5IEYA 3UZRA 5BYZA 3NEWA 2XUUA 1YHVA 4HYIA 4B8LA 2VX1A 3AMAA 3LIJA 4CMUA 3R1QA 3PXFA 3ZZEA 4C59A 2Q0BA 4EH5A 4W9XA 4FV6A 1J3HA 4J71A 4YJPA 5M4FA 4XOYA 3NVMB 5FP6A 4RC4A 5JZNA 4BIBA 2QR7A 1JKSA 4HCVA 5EM5A 3NPCA 3AG9A 2OU7A 4CRSA 4DH8A 4R3PA 3LM5A 3GU5A 4U8ZA 5AUYA 3TM0A 2PMOX 4FV8A 3W0PA 3VS3A 2QR8A 2R5TA 3ODZX 4EJNA 2UZUE 4O2PA 2X81A 1A06A 1U46A 4MD9E 1OKZA 2GMXA 4FSTA 2WQEA 3DKFA 3QZHA 4FKSA 1W83A 3RPRA 3DTCA 5KZ0A 4KIQA 1WMKA 3IW6A 4FKWA 2ITYA 4QDEA 3H9FA 2R3IA 4Q9ZA 2R2PA 1YOJA 5A14A 3ZLSA 3FY2A 3ORZA 3GU8A 4F78A 3COKA 4AZFA 4HVGA 3BCEA 4DEEA 4CFVA 3JXWA 3R7YA 2GSFA 2EWAA 1OIRA 4DYMA 2XB7A 3NYOA 5F20A 2GFCA 4ZJIA 5CAVA 5KMIA 4L00A 3R02A 4FICA 4YJUA 2PZRA 1UKIA 2B54A 3UNJA 2EB3A 1ND4A 5E8VA 4U7ZA 5EQYA 5CSPA 1OIUA 1M7NA 3H4JA 1OL1A 4IE9A 4MF0A 4LGGA 4ACMA 2WAJA 1CSNA 2VWZA 3O96A 3EN5A 1AGWA 1IEPA 3R1SA 3FL5A 1GZNA 5AJQA 4EEVA 3TNIA 5A6NA 3IECA 5FBNC 4F99A 3DJ6A 3UC3A 4M15A 4QTCA 4HVIA 2PVRA 3GC8A 3PUFC 1K2PA 1P4FA 2O65A 4NJ3A 4X3FA 3K5VA 3MPTA 2XKFA 4S2ZA 5M57A 3QZIA 3OXTA 5AFVA 2A4LA 1PYEA 3M2WA 5HNIX 2XKDA 5KE0A 5L6PA 2VTLA 2WQOA 1V0PA 4XH6A 4A4LA 4BGGA 3KRXA 1NT2A 2W4JA 3UC4A 4I6BA 4CQGA 2JDSA 3OS3A 3UZTA 5AP7A 2VZ6A 3IOKA 4YZDA 4GK3A 4DDIA 4JAIA 4I94A 1ZY5A 5LVOA 4USDA 4Y5HA 2NP8A 4BDIA 3DOGA 4ZJJA 1YDSE 3ZUTA 5AEPA 5CYIA 3VWAA 1YVJA 2QO9A 4GT5A 4GU9A 3HV4A 3NGAA 5C8MA 3VNTA 3NX8A 3M42A 2BTRA 5AV4A 4ZS4A 5LMAA 4YSJA 3AT3A 3QTUA 3PPJA 4YTIA 3ZEPA 5M07A 1VJYA 2XF0A 3EQHA 3HUBA 4D9UA 3O51A 4IZ5A 3QTSA 5EH0A 3VF9A 3QC9A 3NS9A 4K2RA 4DFNA 4AACA 4CXAA 5LCKA 1XH4A 3ORTA 3SW7A 4BDGA 5DWRA 4IFCA 4YUQA 2ZV9A 1I44A 2PUIA 2XKEA 3FZSA 4GFOA 4AW2A 5K3YA 4AXAA 2YDKA 4O84A 1F5QA 4ASEA 4Q9SA 3SDJA 3GC7A 2HY0A 4U5JA 1UWJA 1YI4A 4NU1A 2CHLA 4V0GB 3CP9A 2IJMA 1QPJA 1YXTA 2ZVAA 1SVEA 5DRBA 4DFLA 3Q60A 5BUEA 4FYNA 2OKRA 2FYSA 1JBPE 2UZTA 5D9HA 4IZ7A 4BIEA 4ZY6A 5M09A 4AZVA 4X2NA 2IVSA 4X3FC 4FUXA 4UMQA 4DTBA 5C4LA 2I0EA 5TO8A 1Q3DA 4FV2A 5IA3A 2VTPA 4CFNA 4CQEA 5J9ZA 3MV5A 3CD3A 4L53A 4R3RA 3MVLA 1ZZLA 3MA3A 2PVMA 5J1WA 1MQ4A 5CEOA 2IVUA 4PDYA 1M7QA 5LJJA 2UZDA 5CWZA 4F0FA 5ICPA 3QYWA 4NM0A 2XH5A 4C38A 1PMVA 4LYNA 2BHHA 1ZXEA 5IISA 3CLYA 2RGPA 5I9UA 3QRJA 4O4CA 4HYUA 4AGDA 3PFQA 2C6DA 4AN3A 2OIDA 3BYUA 5T6KA 2OZAA 4D1SA 3TKUA 5AP2A 4M69A 3R8MA 4N57A 1GZKA 2Z7RA 2Q83A 3FZTA 3CE3A 3ZONA 3QCQA 5GZ8A 4A4XA 4C7TA 5C4KA 1GZOA 3EFKA 3QUPA 1JPAA 1W8CA 3EQGA 3FWQA 4IWQA 3QRKA 1Q99A 4C4IA 1OUYA 1ZRZA 4Y46A 4BF2A 4GK2A 4YPSA 4NH1A 4C8BA 4E4XA 5M56A 4RX9A 3Q04A 4XBUA 2ZB0A 3MFUA 4I6HA 4MQ2A 3Q52A 4GKIA 3CKWA 4QMLA 3TKIA 2GTMA 4YO6A 5KZIA 4UMRA 3JR1A 2YIXA 3W0QA 1SZMA 3LQ3A 4GYIA 2HY81 4EKKA 1KUTA 5EI8A 4QTDA 2X9EA 2J5FA 4E6QA 4O7NA 4FSRA 3NVKI 5AMNA 5CU0A 3R0TA 5L2IA 4DT8A 4XRLA 3MTLA 3QQHA 3D5WA 3T9IA 4XBRA 2RL5A 3NNUA 2WQNA 1W2CA 2W5HA 4MBLA 1XHAA 4AA0A 3FV8A 3KVXA 4WOVA 4K77A 3PY3A 4E4LA 3A7IA 4RIYB 5HKMA 3TUDA 4WNPA 4FIHA 2PPQA 5HG8A 4NUSA 3QCYA 3V5PA 3ZC5A 5M06A 2A27A 1OGUA 4N4SA 3OWJA 3SOAA 5CAQA 3FI8A 3GFWA 4BBFA 3U87A 4KS8A 5HD7A 1PXOA 4NM5A 3MJ2A 1B6CB 4E20A 5JMSA 3A4OX 2UVYA 5H9BA 1GIHA 5J79A 2X7OA 3MY1A 4UY9A 4A7CA 2PYWA 3AGMA 4BKZA 1YXSA 2HZIA 3KN6A 4FL1A 4U3YA 3PPKA 5H8GA 4AGCA 2Y6OA 3ZUVA 5EOBA 2B9HA 3WZEA 3UDBA 4QPMA 2YM6A 3CCNA 5E7RA 5JKGA 4USFA 1PXLA 1EH4A 3IS5A 4IX3A 3ZDUA 4PTCA 3T8OA 4K1BA 2X7FA 3UE4A 3NUPA 4DA5A 3F6XA 5HZNA 4HVSA 2QOOA 2G01A 2WD1A 4RLKA 3FLNC 5CU2A 3WIKA 1WBTA 1QPEA 3BE9A 3KK8A 2BKZA 2XK8A 2V7OA 4ANSA 4EK8A 2IZUA 4CT1A 3AKKA 3UQFA 2PVHA 1WBVA 2UVXA 4FV4A 5K5XA 2XRWA 3WF6A 5ANDA 4ZS0A 2WTKB 1E9HA 2IN6A 2XA4A 3CPCA 3ZO4A 4U43A 3W55A 3MB7A 3VVHA 1OB3A 1OPJA 1S9JA 2W06A 2J2IB 1Z57A 3FMNA 5DVRA 1OITA 3DNEA 2F9GA 3T3VA 2PUUA 2O64A 4XNEA 4HW7A 2XARA 2DS1A 4IX5A 4BN1A 1H0VA 3FHRA 5E92A 3RWPA 2CGVA 1GOLA 4LOOA 5HGIA 4ZSJA 1T45A 2RFNA 1YXXA 4S31A 4C34A 2YCSA 2ZMCA 5LCJA 3EZRA 2YZLA 5F1ZA 4XV3A 3P5KA 2A1AB 3MFTA 5FXSA 1YOLA 3UIBA 1Z5MA 4AZWA 2X4FA 4L52A 4ACDA 3AMYA 3ITZA 4FVPA 4BR3A 2CKQA 3GU6A 4PTGA 4D1ZA 3PJ3A 4ZLZA 4OBPA 3SA0A 4AXCA 1H07A 2CKEA 2PHKA 2UV2A 2YJSA 4PTEA 5EW8A 4CG9A 3HDNA 1WBSA 2VO3A 1IA9A 3FSKA 3O7LD 3QGWA 4QP6A 3NYXA 2QCSA 3LFSA 2JIIA 3SXFA 5AV1A 2CGUA 4M7IA 2O2UA 4II5A 4A4OA 4NW6A 4YGAA 2OLCA 3ENHA 2YLFA 2YIQA 4ZSAA 3QFVA 4FNWA 4JQEA 4FT9A 4MXOA 4EOSA 3RCDA 5IDPA 5GINE 1TQPA 4I6QA 1PXMA 3S4QA 5EQPA 5HU3A 4LI5A 3IGOA 1IR3A 4A06A 4FF8A 3TI1A 3UMWA 3ZXTA 4JR3A 1OIYA 5AA9A 3DJ7A 2Z7LA 3DDPA 4GU6A 4DFUA 5CVGA 4C4EA 3FXZA 2PMIA 3ZDIA 2Q0NA 3FUPA 4BVUA 4BL1A 2OBJA 3HA6A 2GQSA 3EKNA 2RSVA 3SX9A 3DXPA 5HD4A 3D7ZA 4AW1A 4MQ1A 3A7JA 3IGGA 3Q9YA 3OBGA 4R8QA 4QP9A 3GT8A 3EFJA 3KRRA 4IVDA 3HL7A 5CVHA 4PMTA 3VUIA 5EW3A 3F9NA 4NCTA 4U97A 3UTOA 2XM8A 4OGRA 2X39A 5LARA 3GU4A 4L44A 3HMIA 4F70A 4I0TA 5GJDA 2EVAA 3KC3A 3AMBA 3RM7A 3UPZA 4FNXA 1PXKA 3LFCA 4WA9A 1G5SA 5LMKC 2ZB1A 1J1BA 3D4QA 3LFEA 5A54A 5JN2A 3U6IA 5HI2A 2UW7A 2WB8A 3D5UA 3PJ8A 4FTRA 4YHFA 4FV3A 4BKJA 4D2WA 4RMZA 5HBHA 5HORA 1KSWA 3Q9XA 2WTKC 4CGAA 3WF8A 2OJFE 4CZYB 2ERZE 4CV8A 3WZKA 2FH9A 5EFQA 1Q41A 4HOKA 1YHWA 1UKHA 2XNNA 1REKA 4G2FA 4RLLA 1WAKA 1JKKA 5ANKA 4WG5A 3S1HA 3LCDA 3V5QA 4PL3A 2F7EE 4BKYA 3V01A 3R01A 1UWHA 3UO4A 4DC2A 2XBAA 5JFSA 2YHVA 3NUYA 5H2UA 5HE0A 3ZM9A 4YZNA 3F88A 2Z8CA 5AUTA 4BDAA 4FGRA 3GI3A 3CGOA 3G9LX 4XOZA 2OWBA 5HESA 1XBAA 1V0BA 4JG6A 3CIKA 4E26A 4FTIA 3QC4A 3QD3A 3W0MA 4ANQA 2BMCA 2A0CX 3RWQA 4NW5A 3HVCA 3EQFA 1TKIA 2OIQA 5LXMA 3R7UA 3OOMA 4G6LA 3P7AA 4PY1A 4QD6A 1PRYA 4DFZE 3OT3A 5EM8A 3ATTA 4ZTNA 4YBJA 2ETKA 3E7OA 3PP1A 4OT6A 4J1RA 4APPA 5E8SA 3PVUA 4E5BA 3BU3A 5JRQA 5J8IA 4G3GA 2NO3A 1VEBA 4QQTA 3P7CA 3QYZA 4FSMA 2X8DA 4PX6A 4D4RA 2XNPA 3DKCA 2GQGA 4AE9A 3AQVA 4YR8A 3ZBFA 3PWDA 4I4FA 4QDVA 2E2BA 3VS7A 4Y8DA 3ZRLA 3ZXZA 5HX6A 5CXHA 3O8TA 4RWIA 4FTNA 2UZOA 3WYYA 2VWIA 1PXJA 1XR1A 4WNMA 5CF6A 2JKOA 4O91A 4BYIA 2IZRA 3V04A 4QTEA 2PY3A 3CQEA 4GFMA 5FXQA 4NK9A 4AS0A 5IQBA 1FQ1B 2XJ2A 3Q96A 5T68A 3G90X 4E6DA 4F7LA 1YKRA 1E1VA 2FGIA 3DK3A 3OY1A 3MGYA 4JAJA 3VBWA 1VYZA 3IW7A 2W5AA 5KKRC 4I92A 2BRGA 1O6KA 2ZM3A 1O6LA 3EQRA 3Q4CA 2NNWB 3DB8A 3ZLXA 2WU7A 1H00A 3DZQA 3N51A 3RAWA 1LP4A 4QMUA 2C0TA 2BTSA 4RA5A 3P1AA 2ITNA 3QU0A 2RF9A 4FV1A 1H25A 3D2KA 5CX9A 3HP5A 5BPYA 5E4HA 2QURA 2W99B 4WKQA 1R39A 1G3NA 4AE6A 4BWKA 4IC7A 4O96A 4TYJA 3QA0A 2UW9A 3OEZA 3IKAA 4O7TA 2REIA 4X21A 4FODA 2XKCA 2G2FA 4FKTA 4NM7A 3MI9A 3PPZA 3JVRA 2YCRA 1MRUA 3OCTA 4I6LA 3U9CA 4APCA 3VUHA 1BMKA 2QG5A 4IVAA 3ZRMA 4IDVA 4HYHA 1XH7A 1FGKA 2Z2WA 1ZYLA 4QMPA 4Y72A 2XZSA 4HZSA 4GK4A 3DXNA 4ZLOA 4B0GA 4EOOA 4OBOA 2PE0A 3IPHA 3TV7A 1J7UA 5J95A 1BI8A 4KAOA 3TWJA 3FPMA 3HV6A 5GJGA 4UMPA 3Q9WA 3V5WA 4AZTA 1PKGA 4LL0A 3HLLA 1OKVA 1IAJA 2J0KA 4G3DA 3QXPA 1R0PA 4QYEA 4AG8A 2UZEA 3EIDA 1WBOA 2PVKA 4RT7A 1ERKA 4FTAA 3HAVA 1FBNA 5TKDA 5FM2A 3SOCA 1H1PA 5E91A 3H0YA 4O7VA 4PDOA 5FDXA 4ZMEA 3KXHA 4L7FA 3KN5A 2W7XA 4MWIA 4Q5HA 1IG1A 3BHTA 4EHVA 5I3RA 5GIOE 2FSLX 4FTKA 5HTBA 1H1RA 3WF9A 4C4GA 3ORMA 5FM3A 3NUSA 1VYWA 3ZH8A 2ZFYA 4AU8A 4LRMA 3ATSA 4O7YA 4R7IA 1M2RA 3VQUA 4Z55A 2WELA 4U3ZA 1J91A 1TQMA 3AC1A 3RTPA 4QQ5A 4F6SA 2CGWA 4JIKA 3S3IA 2C6IA 3E7VA 5KBQA 4NFNA 4ALWA 4EH6A 2VTMA 1H4LA 3OWPA 3OTUA 4LDTA 1ZMUA 3LQ5A 4QMQA 2OJ9A 1ZOGA 4G34A 4EZ5A 4Y95A 3CXWA 3M11A 2BR1A 3F5GA 4RFMA 4KABA 4EBWA 1Q3WA 5IQCA 4O22A 3P08A 3FQSA 3MVJA 4RBLA 5AR7A 4BTMA 4O7RA 2YM8A 3U54A 3QUDA 4GG7A 2O8YA 4G9CA 4I22A 4QMZA 4DH1A 1P2AA 4FZAB 3BHYA 3ACKA 3MA6A 4YU2A 4H36A 3W16A 3ZOSA 4M3QA 2QOQA 2C47A 3E8EA 3R00A 4XG3A 3W2RA 4X0MA 4CRLA 2P3GX 3FBVA 2CJMA 5EYCA 2ITWA 2GNIA 3R71A 1H0WA 3KQ7A 4FNYA 4U44A 4FK6A 3RBWA 5B2KA 5BQ0A 5M4UA 4AAYA 2RIOA 2YIWA 3F2NA 2VTJA 5BV3A 2R0IA 3E8NA 4FKQA 3C13A 4CZTA 4DF3A 3O17A 3FYJX 3DXQA 5HE2A 3C4WA 1U54A 1G8JA 4KINA 1M2PA 3DFCB 2DUVA 3ACJA 3OUNB 1OL2A 4Y5QA 5AX9A 3TACA 4QTBA 2GDOA 4E7WA 4FSQA 4XG7A 4F9YA 2OFUA 2H9VA 2R3RA 5HIDA 1JNKA 5H3QA 4LRKA 1KE6A 1TVOA 4WO5A 3ZO1A 2R9SA 5IEXA 3V8SA 2JC6A 4FR4A 5J87A 3KL8A 4PQNA 3GBZA 4F7SA 2VNYA 1UNHA 3MH2A 5IA1A 3KU2A 2GPHA 4GEOA 3FC2A 5AV0A 3OW3A 5J7BA 3PLAE 4E73A 5IQAA 3EZVA 3O23A 2I40A 1PYXA 4FEQA 2XJ0A 4JQ8A 2HOGA 3MH3A 3TZMA 2JEDA 2R7BA 3NW5A 1OGYA 4PRJA 1YW2A 1Y6BA 4QMTA 4NIFB 3FDNA 3V6RA 4I5MA 4Y85A 3W2SA 1CM8A 5BVFA 2Z02A 4UWBA 3RVGA 4XV9A 4LQMA 4MBJA 4P90A 3QHRA 4AT4A 4NWMA 5CANA 2W1CA 3D94A 5M53A 4NFMA 3TIYA 3KRLA 4UWYA 1H08A 4AP7A 3AC4A 3SRVA 3KXMA 2GQRA 2HCKA 5GZ9A 4QNAA 4C3PA 5C8KA 3FZRA 3DB6A 3HMMA 4D2TA 3ROCA 4IAYA 4KKHA 3L9MA 1SNXA 3RK7A 4J7BA 4DHIB 1FGIA 1YXUA 1KV1A 2OGVA 3QRIA 4W4WA 5AM6A 4AAAA 4YJOA 5AUVA 3NZ0A 2X2KA 4R3CA 2ITOA 4H1JA 5CI6A 3SD0A 2ERKA 2SRCA 2YLEA 5A3XA 5B2LA 2Y6MA 3FY0A 3IK3A 4DG0E 5AP6A 4K18A 4L42A 5AR4A 4E5AX 5B0XA 2YN8A 2J0JA 3HNGA 2WMWA 3AD6A 3R63A 4I1ZA 4LG4A 4YBKA 2ZV7A 3SG9A 5C26A 1CDKA 1F3MC 3F61A 2JIUA 4EOQA 4O0RA 4HVDA 2W1EA 2ZM4A 5HLPA 4MCVA 4UX9A 2HZ0A 2PMNX 2R0UA 4EQMA 1BI7A 2VX3A 5ETFA 4WG3A 2QC6A 3OROA 4ID7A 2QODA 2VWYA 5CEQA 3JY9A 2XS0A 4P5QA 4BDJA 4CYIA 2B9FA 4CSVA <