3LMGA

Crystal structure of the erbb3 kinase domain in complex with amp-pnp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
280
structure length
268
Chain Sequence
VLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ErbB3/HER3 intracellular domain is competent to bind ATP and catalyze autophosphorylation.
pubmed doi rcsb
molecule keywords Receptor tyrosine-protein kinase erbB-3
molecule tags Transferase
source organism Homo sapiens
total genus 66
structure length 268
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lmgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lmgA01
4KUJA 3A7HA 3G6HA 5BX0A 3V01A 4FT5A 3GFEA 4UMUA 2BRNA 5DIAA 2OG8A 4WRGA 3VBQA 4CYIA 3KXNA 5KMMA 3DQXA 5CNNA 3PVBA 1Q3DA 3TZ8A 2X7FA 1ZY5A 3R1SA 4MD7E 3IW8A 2VWUA 5AUXA 2B4SB 4M67A 5CSWA 2V55A 4IJPA 5T3QA 3DY7A 4L52A 1W82A 3ORTA 3VVHA 4C57A 3PJ3A 5EI2A 5M55A 4O91A 4RIYB 4KD1A 5DT3A 4LL5A 3CSVA 3BPRA 4TNDA 3ZO3A 2R3HA 4F09A 3ZZEA 4D2WA 3CC6A 2CCHA 4XV2A 5H8EA 1MUOA 1UKHA 3O0GA 4QD6A 4ZEGA 3KFAA 4KIOA 5CX9A 3E62A 2BILB 5M07A 1FINA 5L3AA 2OICA 3P79A 3WILA 3TZMA 2QHMA 3ZFXA 5G1XA 5JK3A 3ATTA 1SNUA 4QYGA 5BUJA 4FKRA 3OBGA 3NRMA 1URCA 3M1SA 3VBTA 4EQMA 2ITXA 4QP3A 2RL5A 2C1BA 2OKRA 4MQ1A 4OUCA 1OVEA 2BDJA 2WEIA 4GCJA 5AJQA 1YDTE 3BYSA 5F1ZA 3BGQA 1M7NA 3HV4A 4AZTA 4OW8A 1OGUA 3FDNA 2OWBA 3C4WA 4YHFA 4JQ8A 4F9WA 5L6PA 4JBPA 2XNOA 4W9WA 4C3PA 4PL3A 3TV7A 4BCMA 4D1XA 2BPMA 3VN9A 3LCTA 5DVRA 5EOLA 5IKWA 3UNJA 2JC6A 2HXQA 5DBXA 1CSNA 4LI5A 2Y6OA 1BMKA 1YXSA 2XF0A 3HGKA 3PXRA 4L53A 5K5NA 3N4VA 3HL7A 4LGGA 4PDYA 1UA2A 2PHKA 2W99B 5HG8A 3FQHA 2XYUA 4IC8A 4NIFA 2O5KA 2WD1A 4AWIA 3DTWA 4YJNA 4A9UA 3KF7A 3ROCA 4NH1A 4DINA 2NRYA 3AG9A 5EKOA 4KWPA 5CTPA 1U46A 5GIOE 4LOOA 4FTKA 2P3GX 5HHWA 5I9WA 4FV7A 4PL4A 4P90A 4X3FB 2CGUA 2P2HA 1HOWA 2GSFA 3GCUA 3MBLA 2VWWA 4TYJA 4XRJA 3KRJA 1TQMA 2BALA 1V1KA 4EK5A 3QWKA 1OUYA 4RJ3A 3QKKA 5IG1A 2WMWA 4S33A 4M12A 4QTCA 1XH9A 2ZB1A 2PVJA 3COMA 4IX3A 2KTYA 3FMLA 3R7UA 3QXPA 4F9CA 4XS2A 3DFAA 1GZKA 4DFZE 3E3PA 3FI4A 4PY1A 1S9IA 4F0GA 2YITA 3IONA 2W05A 3Q4UA 3PDTA 1U59A 4CQGA 2HZ4A 2YCRA 3D9VA 3UC3A 1H25A 2QOLA 4IM3A 3U6IA 4AX8A 2YAAA 3OWLA 5DOSA 3FHIA 4LMNA 4F70A 2EXCX 4RIOA 4MF0A 3OY1A 2BFYA 4MBLA 3E8NA 2R64A 5GJGA 4CTCA 4XYFA 4Q5HA 1M52A 4Z3VA 3LHJA 3C4CA 4IVCA 3HVCA 5AADA 1UV5A 3ORNA 3LFSA 4QYYA 5CT0A 1OPKA 4FI1A 4ZS0A 5C1QB 5M4FA 3PE2A 4I6QA 5ANGA 3R9NA 4QMNA 2QC6A 4PV0A 3WIKA 4KIKB 1OI9A 4UMTA 4IVBA 4JBQA 1IASA 2E9NA 1Y6BA 4QNAA 4DFNA 4FYOA 2OH4A 2UVYA 2XNBA 1KWPA 3FI2A 4KIQA 4TT7A 4ZK5A 3RHXA 2ZVAA 2B9JA 3UBDA 2WMAA 5HCXA 4OTWA 3WE4A 2E9UA 4JIKA 4E4NA 5KZ0A 1YXUA 5EQYA 2RFDA 2XK8A 4QMZA 5K3YA 3FWQA 3G2FA 1PRYA 2JEDA 4U9AA 5E8XA 2UUEA 3UZPA 2RKUA 3LCKA 4TWOA 4XP2A 4AN3A 5I9XA 1IG1A 2HY0A 3BLHA 1WBWA 4S30A 4Y83A 4IX6A 5HE1A 3RI1A 3VW8A 1OMWA 2E9VA 4FBXA 4L67A 2Z7RA 5B0XA 4AF3A 3IS5A 1OIRA 3F7WA 3U6JA 2XEYA 2OJ9A 4R77A 3RPVA 3QCXA 4I5MA 4YZCA 4R7HA 4CGAA 2C3IB 3ZDIA 3KK8A 5FDXA 4GVAA 4DT9A 3I79A 2CGXA 3D14A 3TNQB 4W9XA 4JRVA 4O1PA 4W8EA 1SYKA 3MSSA 4IZ7A 4BWKA 2F7XE 1GAGA 4X2NA 4PQNA 1JSVA 4TL0A 1OIYA 4IWQA 5E8WA 4BZDA 4Q2AA 2VGOA 4GT3A 4F64A 3ORLA 1M7QA 4D9TA 3VUKA 2NP8A 4TYHB 1PXKA 1NW1A 5BVDA 4DF3A 4QMOA 4CVAA 3RK7A 2R3RA 3OUKA 4FV9A 3AD4A 3N4UA 2IVUA 4R5SA 1MRVA 2QG5A 2WTKC 4CYJA 1I09A 5DMZA 5KE0A 5KCVA 5JGAA 5BYLA 3COKA 4BCNA 5HO6A 2XJ1A 3ACKA 4EH9A 3IG7A 3L8PA 2R4BA 3C5IA 3MH0A 3A99A 3R21A 4IC7A 3K2LA 1CDKA 2IVSA 3MN3A 4ZJJA 1RQQA 5IQFA 2J0MB 4O1OA 3S3IA 3KL8A 3TTJA 1BLXA 4CSVA 3RK5A 5I5ZA 3JS2A 2JBOA 2XNMA 4BKJA 2R7BA 4DGLC 5DR2A 4CLJA 3OCBA 3PIZA 2R5TA 3IOPA 4H05A 2XM8A 3ZXZA 4UX9A 4EKLA 1P5EA 3DB8A 4CFUA 3TUBA 2A27A 2VV9A 3CLYA 4U80A 4EBVA 3GC0A 4RWIA 4CRSA 1Q8YA 3SQQA 1FGIA 2VTNA 1OIQA 1V0PA 1JNKA 2WIHA 4FKPA 5ETIA 4AOIA 2XCKA 2H6DA 1PXPA 3MI9A 3L8XA 5CI6A 4YZBA 4F1MA 2O63A 2YJRA 3F66A 3MH2A 3UOKA 4HVIA 5HGIA 3P7BA 3UC4A 5FXSA 4HW7A 4BIBA 2QCSA 2VTIA 4NUSA 3RPOA 2QD9A 2XP2A 5DEYA 4E93A 5C8NA 4O7ZA 3FZOA 2UZUE 3RALA 4L8MA 4EH7A 4QMLA 3CY2A 4X6RA 3SOCA 4ASEA 5JRSA 3NVKI 3ZU7A 3L9PA 3MW1A 2UZWE 3PSDA 4RC4A 3FJQE 4D5KA 5FTGA 3RAWA 4RIXB 2ZMDA 4BDJA 2Y9QA 2C5YA 1G8AA 5IA3A 3DAJA 5E92A 3SW4A 2VRXA 5CEPA 4TYGA 4O0TA 3UTOA 1JAMA 4J71A 3I0OA 2W0JA 4MD8E 4ZSGA 3CQEA 3LXPA 4QPAA 4ANLA 3AC4A 3E3BX 3PA4A 3Q9XA 4FT0A 4CTBA 3BV2A 2P4IA 3HP5A 4K1BA 1UU7A 1WCCA 2RG6A 1WBPA 3PWDA 2OJGA 3VS6A 4GVJA 5ANOA 2ETRA 4M68A 3D94A 4U3YA 3AMYA 2WFYA 2G2IA 2A19B 5B2LA 3BE9A 5F4NA 4F6WA 3OCGA 4NYEA 4P2KA 4EUTA 3E63A 4I5CA 4C59A 2Y6MA 3NAXA 1K2PA 1YXXA 2W96B 2HZNA 4XUFA 1VEBA 5DT0A 4FZDB 5KMNA 2GMXA 2QODA 2R3NA 3ZS5A 2PVNA 3FLYA 4IBMA 4QO9A 3RGFA 3NIEA 3QTZA 2ETMA 4LRKA 4AGCA 4BBMA 2NNWB 2Y4IB 3JYAA 3O8TA 1OBDA 4IX5A 3AC2A 3QD3A 4AT5A 5A4TA 4FKJA 4M69B 4ORKA 2YCSA 2FYSA 3BE2A 3PA5A 2XM9A 2VO0A 2ZYBA 1YQJA 2R3MA 5FXQA 3RJCA 4K0YA 4DH5A 3Q04A 5J9YA 3NZ0A 5C26A 3LOKA 3Q2JA 2X7OA 5M09A 2XA4A 3FAAA 3QQFA 3PXFA 2YIXA 4R6VA 2OGVA 3RMFA 3FZPA 4DAWA 2X1NA 2QOOA 2BTRA 4GFOA 1WBNA 5E91A 4M0ZA 3TKIA 2C30A 3DAKA 3LM0A 4R5YA 1JKKA 1Q61A 2O8YA 3ELJA 5E8UA 4O22A 4HYSA 3UYTA 4YTCA 5CF5A 4ASZA 4DTAA 3ODZX 4X3FC 1GIIA 1U54B 4IZAA 4KBAA 4TPTA 4CKIA 4EOOA 4DFUA 3ZRLA 2GS2A 2ZM4A 3DXPA 4G3DA 4W4VA 3UIBA 5AUTA 3UQCA 5A14A 5AEPA 1H1SA 5EKNA 4HGTA 3NUPA 4BYJA 4E26A 3I5ZA 4FTIA 5KKRC 4XV3A 1QL6A 2XNGA 3G9LX 4TY1A 1PXLA 4G3GA 2OZAA 3D83A 1XJDA 4AU8A 4B0GA 4DFXE 1M2PA 5IQHA 4V0GA 3AMBA 4M97A 5AP1A 4FK6A 2XH5A 3EJ1A 5KMKA 2KULA 3UVRA 3F3TA 2C3LA 3CEKA 4XJ0A 3DA6A 2WHBA 4YLLA 5DT4A 5A46A 2BIYA 3SA0A 2VO6A 3HYHA 3MFUA 3EQHA 3MESA 2I0EA 4AN9A 3S4QA 3FSFA 2ZV2A 4C36A 5IQIA 2I1MA 3Q60A 4JDJA 3FZTA 5FEEA 4IDTA 3LFEA 4JDKA 1XH5A 2CKOA 3CD3A 5JGDA 4QMQA 2OK1A 4YPSA 4D2VA 1FOTA 3QTRA 3QTUA 3R1QA 4LYNA 4C4FA 2A1AB 1KE9A 3NUUA 4AW5A 5IA0A 2B0QA 1JBPE 4RRVA 2QOFA 4WNPA 4FT7A 3F5GA 5AR5A 3QFVA 4LG4A 4EHGA 2X2MA 4YTIA 4O7TA 2CLQA 2VTJA 4L42A 3SW7A 2BRMA 1YXTA 3KCFA 3W2SA 4I6HA 3UVPA 2JIIA 2E9PA 1Q97A 4MNFA 4RX7A 3REPA 4XG8A 4WBOA 4YTHA 3FKOA 4U0IA 1JOWB 2XCHA 1SZMA 3AXWA 4YBJA 3WIGA 2YDIA 4ITHA 4EK3A 2GQRA 4BFMA 3NYXA 5CS6A 5FBOA 1SVGA 4FIHA 1Q8WA 4IB1A 2EUFB 4UYNA 4AW0A 1J3HA 4EOLA 4EH6A 2QO2A 3LW0A 1OBGA 3WZEA 3ID6C 3PXYA 4F7SA 2WOTA 4FV4A 3HDNA 3OD6X 4U44A 4DC2A 3VC4A 3BGZA 4BWXA 3UMXA 3HZTA 2J0JA 1OM1A 3N9XA 4W4YA 4E5AX 3OXIA 5IA2A 3MTLA 5BYZA 1JPAA 3VNTA 2VWBA 4KABA 4NW5A 2AC3A 5J5TA 1W8CA 3MS9A 3MPMA 4UZDA 5HORA 2C5XA 5EHOA 5TR6A 3FY0A 3ZDUA 2X7GA 5HE0A 3F61A 5J87A 2OH0E 4ZAUA 5C8KA 5DEWA 5L6WL 3AT4A 3U9CA 2XK9A 3QZGA 3GGFA 3BI6A 5LVLA 5M4UA 2PYWA 4N57A 5AAEA 4FGBA 2BDFA 2HWOA 2GNHA 3BHVA 3QD0A 1NY3A 4LRMA 3PG3A 2UW7A 3RZBA 2BRHA 3TZ9A 2QR7A 3UP7A 4ZP5A 4BBFA 4NCTA 3VUTA 1J1CA 2P33A 2F49A 2EXEA 4PNIA 5DR6A 4BIDA 3BIZA 3RM7A 3V8SA 2ZB0A 3QF9A 3FXZA 3WZKA 4BHNA 4RX9A 4CFWA 2PULA 5AP0A 4ZS4A 4EOJA 4L6QA 4KNBA 4ZXTA 2OXXA 1NA7A 4A4OA 2WEVA 2CCIA 5E8YA 4WKQA 2P0CA 3LVPA 4EK6A 4IAIA 4OAVB 4O82A 4FTUA 5HE2A 2FA2A 4FKSA 4EZ7A 1IA9A 5DHJA 5FM3A 1BL6A 1OL1A 2VTOA 3O17A 4M15A 5DLSA 4R3PA 2ETKA 3MJ1A 2WMQA 2YACA 2A2AA 3NYVA 3MVJA 3MVMA 4BN1A 2GS6A 3ORKA 4QMSA 5HVYA 4M13A 3WZJA 2R3PA 3KA0A 4LOPA 2XK6A 4NFNA 1ZARA 3V6RA 2WMBA 4IQ6A 4FIGA 5AM6A 4XG7A 1MP8A 4GL9A 3CTQA 4L7FA 5CF6A 5LCJA 3ORMA 3PVGA 5C9CA 2IVVA 4EJ7A 4PRJA 4JRNA 3W18A 4CG8A 2Z8CA 2CN5A 4AA0A 3OT8A 4ACDA 5JFSA 3TXOA 2ZJWA 3VF9A 1WVXA 2C69A 3AQVA 5IUGA 3HLLA 3QHWA 5C01A 3DK3A 5AP5A 3TJCA 4WNOA 3W2CA 3D4QA 4WRSA 2X8DA 4FV8A 3PPKA 4YJRA 4RFZA 3U55A 4U42A 3R71A 2YIWA 2WKMA 4EYMA 1S9JA 2QOBA 3MTFA 1T46A 3HAVA 3TDWA 1QPEA 2YFXA 4YZ9A 3PPZA 4GIIA 2PL0A 3DDPA 3D5UA 3Q4ZA 3QCQA 4FL2A 4V05A 4GW8A 3R28A 3SG9A 4C8BA 3DBDA 3D7ZA 4CT1A 4P5ZA 4RQKA 4CXAA 2GQGA 4GU9A 2OI4X 4HCVA 4FV3A 4RFMA 3A8WA 3DZOA 3H0ZA 3I0QA 5CVFA 5L8KA 3A8XA 4F08A 2JDVA 4CMTA 3QQLA 5BVEA 4JLCA 3A61A 4K8AA 3G6GA 4QNYA 4F1OA 2E2BA 3JY9A 3KXZA 3PVWA 3BQRA 3GCPA 4ZTLA 4UEUA 3NCZA 2B7AA 3ET7A 4OTGA 4GT5A 4TW9A 5FQDC 2ACXA 3AMAA 3RCJA 4ZSJA 3UG1A 4K18A 4EK8A 3HNGA 3VS5A 4D2PA 3ERKA 3TNPC 2IG7A 2UW5A 4DG0E 2V5QA 3C4ZA 3O51A 2OLCA 2HOGA 4KRCA 2YM7A 2FH9A 4DG2E 2ERZE 2H9VA 5DPVA 5HBHA 5F9EA 4C33A 2YN8A 4USFA 5J9LA 2PTKA 3KC3A 2CLXA 3DNEA 3QQKA 4E7WA 1H1RA 3R9HA 3FMMA 1OL5A 3H9OA 5C4KA 3T3UA 3G90X 4FEQA 3FMKA 5AV2A 4HVDA 4WNKA 3HRFA 4Y46A 5ANDA 4AT3A 1R1WA 4IWDA 4R3CA 5A54A 3EQGA 4C0TA 3ZM9A 3RINA 3S2PA 4HCUA 2JIUA 2WZJA 4CKJA 4KINA 4G9RA 3ROYA 4BTFA 1W7HA 5IA5A 5HIEA 3GBZA 2VWVA 4J98A 4C37A 5HZNA 3F9NA 3NUYA 3DXQA 3TDVA 2QKWB 4FZAB 4C4HA 2C6IA 4YJQA 3PJCA 3LCOA 1AQ1A 5C27A 1REJA 5EM7A 5EW8A 3V5QA 3D2IA 4UWCA 5ETCA 1UU3A 3QGWA 1YI6A 4JJRA 3U4UA 3EWHA 2J5EA 4JOAA 2XNEA 2PE2A 2J7TA 2W5HA 4KKGA 4ACHA 3CS9A 4FR4A 3QCSA 4MF1A 4C35A 3P7CA 3SVVA 3COIA 3TN8A 4HNFA 1CTPE 3HRCA 3OS3A 2VNWA 3D5VA 3IOKA 4ANBA 4IE9A 4P7EA 4XOZA 4YLKA 4WD5A 2E9OA 3QAME 2C6KA 4ACGA 2R2PA 3ACJA 3N51A 4NJ3A 5EG3A 3VBWA 2J2IB 5DRDA 2JDOA 4I1ZA 3QUEA 5A6NA 4IX4A 3MDYA 3SXRA 2C6DA 2GHLA 3F88A 1YDRE 4G3FA 1O6KA 3FPMA 4CCUA 4QMWA 3SXSA 4F7JA 4K9YA 4EH4A 3ZEWA 4BVUA 5KMLA 2W4KA 4WSQA 3AT2A 3DKOA 3DXNA 3G0FA 3Q9WA 1PMVA 4EZ3A 4EH3A 1H01A 4CCBA 4DEGA 5ETAA 2G01A 3CY3A 4DCAA 4Y73A 2ESMA 5CZIA 1R39A 3VRZA 2UZLA 3W16A 4DLIA 1YHVA 2IZUA 3G33A 5JKGA 4EWHA 4LOQA 3V3VA 3E92A 2EWAA 3OFMA 1GJOA 2PMOX 4KRDA 4H58A 5LARA 4BTMA 4KKHA 4RFYA 3VS3A 5GZAA 4PX6A 1J91A 2I7QA 3PP0A 4D1SA 5H8GA 3O7LB 4MX9A 5BVWA 3LE6A 3FY2A 4GV1A 3ZONA 2VTPA 5HLPA 2B55A 2WQNA 3LFAA 2X8IA 4JR7A 2PUUA 3LPBA 3CIKA 4MQ2A 3OMVA 1BI8A 1BKXA 5CU3A 2ITOA 2BRGA 2XIKA 4BGQA 3R7EA 3KN6A 2QKRA 5JMSA 1YI4A 3IKAA 3DBEA 2PVKA 2YZLA 4JBOA 3R6XA 5EYDA 5T6KA 3SD0A 2WAJA 4FX3A 3KK9A 3LFQA 4M84A 2FSOX 2YM5A 3AT3A 3ZHPC 3WF9A 4QYFA 4L46A 2IW6A 2Z02A 2UZBA 4O21A 5HNBA 3DJ7A 5FTOA 4FKOA 4ANOA 5E4HA 4XP0A 1BYGA 2G2HA 5AP7A 4BCFA 3C0GA 3HMNA 3C4XA 1PJKA 4I4FA 5EI8A 3UGCA 5BQ0A 4IM0A 3QTXA 4ACMA 3FQSA 4F1TA 3GC8A 3R9DA 5EQPA 4DH3A 2UZEA 2QURA 4MYGA 4FC0A 4XNEA 1JSTA 4BYIA 3FZ1A 3PUPA 3GFWA 5AP4A 5AV0A 4IM2A 3MYGA 2W1ZA 4YTFA 3OC1A 2BUJA 4X2GA 2NPQA 3NUXA 3UMWA 2B54A 4M7IA 3POOA 2VD5A 4BB4A 1JWHA 2DS1A 1PMEA 2J9MA 2YWPA 4I6BA 3FLQA 1NVSA 1XH6A 4WG5A 4I0SA 2ERKA 1Y57A 3EQRA 4O0YA 2HZIA 2B9IA 4MNEA 3EN7A 1ZY4A 4BI0A 4U7ZA 3VJNA 4ALUA 2UW6A 3NGAA 3NSZA 3GQIA 5EHYA 5E7RA 1XH7A 4U81A 5AR2A 4AZWA 4GIHA 4G3CA 3SLSA 3Q52A 3PLAE 2QR8A 2Z7LA 2LGCA 4RVKA 5GHVA 1WFCA 2F57A 1YRPA 4FICA 3DT1A 3O96A 5HTBA 3KULA 3DGKA 3RTPA 4C34A 1A48A 4BWPA 3NMUF 3WZDA 2B1PA 4YJPA 3BWJA 3KGAA 4Z7HA 5EYCA 1SM2A 3FL4A 4ZTSA 4C38A 2Q0BA 2ZV9A 3QC9A 1YWNA 1HCLA 4CFMA 1J7IA 4BTKA 3NYOA 3BU5A 3CTHA 2WB8A 2R3LA 3UJGA 2VTQA 5IUIA 3IO7A 4FTOA 3IW6A 3TI1A 4C02A 2WMRA 3DKGA 4LV5A 4O0UA 3AD6A 1Z57A 3P5KA 3Q4TA 4FZ6A 4RLLA 3VBYA 1YXVA 3F69A 3L1SA 4OTQA 5AP3A 4EOQA 2Z7SA 3ORPA 1PKGA 4IMYA 3DJ6A 5LMAA 3W2QA 3GT8A 1CMKE 2YM8A 4FODA 1OKZA 5HTCA 1YWRA 4MXCA 1OZ1A 5I3RA 4IVAA 3FL5A 3GU7A 4ALVA 4BCGA 4HGSA 4PMPA 5M4IA 4KSQA 2CGWA 5HU3A 4RWKA 3BZ3A 4MTAA 2VAGA 2W1FA 1H28A 3R1YA 4FIFA 4OTDA 4PPAA 3UOLA 3NR9A 2C5OA 4PDSA 3E64A 3E7OA 2ZMCA 4EH5A 2XIRA 4OR5A 3TWJA 3RWPA 3II5A 5TOZA 4AA5A 1CM8A 4ITIA 5JQ5A 4ARKA 4QP6A 3I1AA 4PPCA 4BBEA 1P4OA 2C3KA 4RBLA 4DE4A 3F5XA 4OLIA 4ZY6A 4JAIA 3MVHA 3DOGA 4K11A 5M57A 2R0IA 3FKNA 3RZFA 3SKCA 4FSQA 3NDMA 4YLJA 3QLGA 1KE6A 1YOLA 3IW7A 4YUQA 3Q6WA 4N6YA 4BZOA 3WYXA 5JFVA 1UNGA 2PMNX 4RX8A 3ITZA 3ZFYA 2F2CB 4YZNA 4AG8A 4EHVA 2X0GA 2IJMA 5CAOA 1XWSA 4O7WA 2VO3A 5AP2A 1XKKA 4B99A 1Q41A 3ZO2A 2CMWA 2R7IA 3E87A 3Q4CA 4I5HA 5IZFA 3LJ1A 3S0OA 3AD5A 3LIJA 5D41A 3QXOA 4DH1A 1PMNA 2HIWA 5J95A 3W33A 5KX8A 1WVWA 4QMUA 1FBNA 4QPSA 1IA8A 4XBUA 1FMKA 4YO6A 4Z7GA 4O86A 4QMXA 4J53A 2JBPA 5CWZA 5GZ8A 4K33A 3IK3A 1J7LA 4NIFB 5IA1A 2AC5A 4LRJA 2RGPA 4OGRA 1Q3WA 3L9LA 5EOBA 3KULB 3ZRKA 4IIRA 5AR3A 3OCTA 4BF2A 2PWLA 2QOQA 3DQWA 4QTBA 4ZZMA 4BDGA 5HKMA 3HV7A 2XRWA 3ORIA 4B8LA 4C4EA 3NS9A 4NW6A 1GY3A 3UOHA 3UO4A 4IFCA 4H39A 4XG3A 5J7BA 5EH0A 2PSQA 1REKA 2UW0A 3ULZA 3FZRA 3GOPA 3A2CA 3GU5A 4GS6A 3LFFA 4O96A 3UNKA 4FNYA 2J51A 4EONA 3EQIA 3DTCA 4DITA 4D5HA 4J8MA 3T9IA 3PE1A 3CJGA 4J7BA 4AACA 4AGDA 4ZY5A 4D58A 3KRWA 2C5NA 4C2WA 3QLFA 5HIDA 3I6WA 3NNVA 1JSUA 3LCSA 2JKOA 2HW7A 4U79A 3NUAA 1Q62A 2UZVA 4YNOA 2PUIA 1DM2A 5CT7A 2XRUA 4Q9ZA 5CAUA 5ANIA 5GIPE 3QZHA 4JDIA 2X4ZA 4I24A 4WNMA 1U4DA 3QALE 4FUXA 2OF4A 2QG7A 3F6XA 3ZLSA 2W9ZB 4MHAA 1UWHA 3QTIA 2OIBA 3AOXA 2FSMX 2VWYA 3QA0A 4O0WA 4R1YA 2WPAA 4ZJIA 4FSTA 3R22A 2X81A 5M4CA 2IW9A 2IZTA 3QYWA 3E7VA 2XNPA 4KA3A 3NWWA 4PTCA 3EFLA 2J0KA 2J90A 5E90A 3H9RA 5HEZA 5I3OA 3W1FA 4O84A 4CG9A 4JVGA 1U5RA 3IDCA 2BAKA 2WMUA 4YJSA 3JPVA 4FL3A 3E8CA 2PVHA 2ZM1A 5EYKA 1URWA 5HIBA 4JDHA 4X2FA 3RPRA 4P4CA 1Q8UA 5K5XA 5LJJA 4BDKA 5J1VA 4YJOA 5JN2A 3JR1A 2PVLA 3FLZA 3R8UA 1R78A 3H9FA 4HVHA 2QU5A 3UVQA 2VTAA 1LP4A 4S31A 1F0QA 1ZMUA 4G2FA 4UB7A 2JDTA 3OY3A 5IU2A 1NVRA 5B7VA 5J5SA 3ZCLA 1F3MC 3EQCA 4PMTA 4EHZA 3MPTA 4L3PA 4WUAA 5FM2A 3HRBA 4ZOGA 3MIYA 5KBRA 1ND4A 2HWPA 3OP5A 1JVPP 3PWYA 4L9IA 2W4JA 2JLDA 3NYNA 3CXWA 2VO7A 4FSYA 5JH6A 4DG3E 5BMSA 2QOKA 2RFSA 1W0XC 3HX4A 3L8VA 3QTWA 3TT0A 3QYZA 1L3RE 2CHLA 3UIUA 2QONA 3VQHA 4QTEA 2VTLA 1Q99A 3P08A 2W1HA 1PYXA 3F82A 3BKBA 5TE0A 3R8MA 4G31A 1H0WA 5I4NA 3OHTA 3NW6A 3FXWA 2HYYA 5EM8A 5HG9A 1OITA 2QVSE 3FLSA 5HNGA 3RPYA 4ENYA 3IPHA 3OUNB 3GEQA 4AGUA 5F95A 3ZC6A 4YC8A 4BGHA 2VTHA 3SAYA 5EDQA 5L2SA 4KBKA 1FVRA 4O6LA 1XBAA 3W8QA 5GJFA 3RPSA 2R3JA 1P4FA 2ZDTA 2AYPA 3LLTA 4YJVA 2C6MA 4O7SA 3BWFA 3HDMA 4EWQA 4E5WA 3ATSA 2W1GA 3ZUTA 2XB7A 3C7QA 4QP8A 3NNWA 1JKLA 4TN6A 5EYMA 4WA9A 4ZTQA 3EFJA 4L3JA 4QQ5A 4JIAA 4USDA 5CEKA 2B9HA 4DA5A 3KRXA 4BCIA 5CU2A 3Q9YA 3OXTA 4XCUA 3WE8A 4EBWA 4IEBA 2W17A 4M66A 3R8PA 3O23A 4H1JA 3LMHA 2O65A 2ZV8A 1R0PA 4FSNA 2VTSA 4YMJA 4ZTHA 5LVOA 5CYIA 2Z7QA 3T3VA 3ZMMA 3HV3A 1Q4LA 3H30A 3R1NA 4CQEA 4A4LA 5K4IA 2ITWA 3BEAA 1XBCA 4AUAA 2PVYA 3ALNA 3LMGA 5HE3A 3OBJA 3R7IA 3NUSA 4ZY4A 4HNIA 4MH7A 5CEIA 4AAAA 4U97A 4QTAA 4IZ5A 4TWCA 2XVDA 3GP0A 3L9NA 3QD4A 1TVOA 3PXZA 1Y91A 3W10A 2RFNA 4RJ6A 4O83A 2OIDA 2IVTA 2OZOA 3O50A 2XUUA 1A9UA 4FTNA 2C6EA 2XEZA 3DCVA 3E8DA 4CRLA 4PP7A 4ZMFA 4F9YA 1PY5A 4HGEA 4CNHA 4RT7A 5IMEA 4DBXA 5HNIX 3A7IA 4OTFA 2WMTA 4MVFA 4TWPA 2W06A 4BDHA 4AE6A 5IQGA 4JT3A 3BEGA 4ANMA 3ORZA 3A4OX 5HLNA 4RWLA 2X4FA 3BCEA 5IQBA 1YKRA 3NCGA 4WBBB 4AOJA 3GC7A 4TZRA 4HVSA 3Q5ZA 3GENA 4MWHA 5D7VA 4L68A 4DCEA 2PMLX 2JIVA 3EN5A 3RBWA 2PU8A 4J95A 4FKQA 3BELA 4ERKA 4RGJA 4DEDA 4XHKB 4IACA 3V5WA 2IWIA 4QP4A 3KU2A 5EI6A 3DKCA 5CAVA 2ITNA 3RNYA 4EK4A 4F4PA 3GCQA 3RAHA 3OG7A 5KMOA 4FNXA 3ZXTA 1Q8TA 2C0OA 3ZRMA 3QTSA 2PUPA 3MH3A 4W4WA 1GZNA 2O3PA 2YCQA 2G9XA 3SRVA 1KV1A 4O0SA 5AIRA 4D28A 2NO3A 5HVJA 5AWMA 2GQSA 1UWJA 3TV4A 3I7BA 2XBAA 3G15A 4TRLA 1IEPA 4L44A 3R7GA 4FTJA 4UV0A 1O6YA 2PVRA 3C9WA 3OEZA 3K54A 4RQVA 4N4SA 2VNYA 2YM4A 2P55A 3R2YA 4S32A 2QOHA 5M53A 1QPJA 5HVKA 5KMJA 2Y4PA 3EFKA 3ZLXA 3TV6A 4GU6A 2WTIA 3PIYA 4BCQA 4I6FA 3F2RA 3QTQA 4PF4A 3BLQA 4JS8A 4BDBA 3EN6A 4OBQA 2GHMA 4BDFA 3MFSA 1XQZA 4KKEA 5BVKA 2OXDA 1OUKA 4E4MA 5E8ZA 2GNGA 4HJOA 1IAJA 3TKHA 3OCSA 4IJ9A 1UKIA 3R04A 4O27B 2UZOA 4FNZA 3QGYA 4FKVA 3FEGA 4FTMA 3ZUVA 4FTCA 2RIOA 4DEHA 5L6OA 5FWKK 5BPYA 5HX8A 5FP5A 3T8OA 4RJ5A 1G8SA 5CNOA 3AC3A 2WIPA 3CGOA 5JT2A 4Z9LA 5L2IA 3RHKA 4FIEA 4CZTA 3B8QA 2R3IA 3U87A 4NEUA 2QO9A 3EQBA 4KAOA 5A3XA 2OF2A 5HBEA 2BVAA 3P23A 3QQGA 4GEOA 3V51A 3QRUA 2CKEA 4BR3A 3ZYAA 5IF1A 3HV5A 3Q6UA 3ZUUA 2YERA 4IAKA 1GOLA 4KBCA 4O2PA 4QQTA 3A7JA 2GNLA 2RSVA 2NRUA 2WMVA 4K2RA 3TG1A 1YWVA 4QT1A 4YZMA 2OZAB 1FMOE 4H36A 3KY2A 2C0TA 4V0GB 5LVMA 1P14A 2H96A 1ZYSA 4X3JA 3BRBA 2PZPA 3MY5A 5HCZA 3Q9ZA 4XG2A 2IPXA 1VJYA 1WAKA 4JXFA 3OF0A 3ANQA 3CQWA 1SVEA 2QLUA 4HPUE 1VR2A 2XK4A 1M2QA 2C6LA 3OWPA 5KMIA 3KXGA 3VS1A 1ZLTA 4NM5A 5HI2A 2IO6A 2GS7A 1YI3A 4ZTNA 4CZUA 5CF4A 3P9JA 4UXQA 3GI3A 5IH4A 2WU6A 5AV3A 4C4JA 1OB3A 2WMSA 3ANRA 3IECA 3LZBA 4GT4A 4CFVA 4FKTA 4AZEA 3JUHA 3HAMA 3NNXA 2HELA 2WTWA 4FEXA 2GFCA 5J7HA 5AV4A 5M08A 4MXAA 2R3QA 5DFPA 4UN0C 5HG5A 4G5PA 4FSRA 2W1DA 4IAAA 3BU3A 4NTTA 3ZEPA 3BV3A 4JG6A 1ZAOA 4ZLOA 5A9UA 1R0EA 5KHXA 1VYWA 3Q96A 3TNIA 4Z16A 1OIUA 4EL9A 2JD5A 2Y8OA 3H0YA 2BTSA 3ENHA 4K77A 5EM5A 4APCA 4HVGA 4W4XA 4D2TA 2P2IA 4RLKA 4LMUA 5HBJA 3OXZA 1O6LA 5L4QA 3TUCA 2GCDA 1OECA 5A4CA 5G6VA 3C1XA 3GCSA 3T9TA 1APME 3B2WA 4DYMA 2Y0AA 4L7SA 2YA9A 3EQFA 3WBLA 3I7CA 5I9UA 3BGPA 3F3WA 2C68A 4MK0A 2VX0A 4EJNA 3OW3A 5CU6A 3KREA 3VRYA 3DAEA 2R3FA 5L8LA 3THBA 4GK3A 3VHEA 4YO4A 3VUGA 5LQFA 3OOGA 2V0DA 2I40A 4O2ZA 2R9SA 4ZMEA 3GXLA 4UYAA 3UYSA 4ASXA 4FTRA 4U43A 4AW2A 4AFEA 4BDIA 4YU2A 3R00A 2OJJA 1Y8YA 3OTUA 1CKIA 3DLZA 2PE1A 3CTJA 2C5VA 1OKYA 4HGLA 4PTGA 3JVRA 5HG7A 2UW3A 2EB3A 1PHKA 2PZYA 2XJ2A 3KKVA 2ZV7A 3DNDA 5BVNA 1OPLA 2XJ0A 1H0VA 1ZYDA 1KUTA 3MWUA 1DS5A 4NU1A 1PXJA 4AA4A 5IUHA 1O9UA 4F6SA 4JX7A 3C0IA 4DFBA 1E1VA 3LFBA 4Q9SA 3I60A 5EK7A 4PP9A 2UZTA 4RC2A 5LCKA 2Y4IC 3E93A 5D1JA 4FV0A 1LUFA 4FA2A 2HXLA 4QP2A 4E4XA 3O2MA 2O2UA 4BL1A 1MRYA 3PXKA 4EZ5A 2VZ6A 3KQ7A 3EZVA 4D1ZA 3HMIA 2B52A 3PRFA 1WZYA 2JKKA 3FLNC 2AUHA 3Q5IA 3LQ3A 3ZSHA 4XG6A 4ACCA 4A9TA 4BCPA 3U6HA 4V04A 4ZLZA 3TJDA 2C6OA 5AIKA 5D9HA 5AAGA 2XBJA 4GYGA 2WQEA 4A7CA 4IVDA 4O7VA 5E8SA 3NEWA 3ZBFA 2I0VA 3MFTA 4PMMA 4BKYA 5BNJA 1L8TA 1ZOGA 3R30A 3C50A 5K9IA 5ACBC 3A7GA 4Y95A 2WO6A 3HMPA 1ZZ2A 3PZEA 5IQEA 2B9FA 4OTIA 3FE3A 1Q5KA 1OPJA 2HENA 4WUNA 4YURA 5A6OA 3TCPA 2JKMA 3GVUA 4IB5A 4NKSA 3CP9A 5D10A 2ZDUA 3QRTA 2RG5A 2JITA 1KE8A 4O6EA 1H26A 4A4XA 2W1CA 2ZAZA 3DDQA 3I5NA 3FMNA 3UPZA 4IB0A 3RAIA 2C6TA 2WMXA 1YHSA 1W98A 3BHHA 5H2UA 3FLWA 4ZJVA 2BRBA 3IQ7A 2BHHA 4RA5A 5F20A 4TWNA 3FMHA 3QC4A 4PDOA 4PTEA 1FPUA 4M0YA 4A9SA 2WXVA 4YJUA 3DBQA 3V5LA 2XIYA 1IRKA 5KZIA 3SV0A 3KRRA 2BCJA 4X7QA 5CSVA 3FMEA 3ULIA 2YCFA 1GZOA 3PIXA 4GKIA 3LFNA 3LAUA 4YR8A 3CGFA 3GC9A 4WIHA 3MPAA 4C4IA 4ANQA 3PLSA 4HZSA 4QYEA 4QYHA 3P78A 3GU4A 3R02A 4JI9A 5EW3A 3CJFA 4ZZOA 2WOUA 3VUHA 4BCKA 2W5BA 3FZSA 3ETAA 4HOKA 4TNBA 2HCKA 4OTHA 5CAQA 3EIDA 5L2TA 4D4SA 4IWPA 2FVDA 5T68A 4DTKA 5FXRA 5IH6A 4J99A 4QP1A 2SRCA 2J50A 4NJDA 4GK4A 4CMOA 4QMPA 4D2SA 4F9BA 3D5XA 5HICA 3LLAA 2XZSA 3MY1A 2W4OA 5E8VA 3UO5A 2OU7A 2OW3A 3B2TA 1WBTA 3KRLA 4IAYA 4JG7A 1LEWA 3ZTXA 2I0HA 5HQ0A 3KMMA 3R9OA 4X3FA 3QZFA 4H3QA 3UNZA 4EOIA 3COHA 4RIWA 1Q8ZA 5AUZA 2PY3A 4I94A 4F65A 2RF9A 4KS8A 1TKIA 2BZIB 2VUWA 3EKKA 4EKKA 3KCKA 5LOHA 3KXXA 4RVTA 2H34A 1PKDA 4NT4A 3RVGA 5H3QA 2QLQA 3D5WA 4I23A 5FDPA 4X6QC 4A9RA 3TTIA 4NM0A 4DH7A 3D2KA 2PVFA 2FSLX 3MA6A 3V04A 4WOVA 5HD4A 2JDRA 4EOMA 3D0EA 2JAVA 5EDRA 4EOPA 4D4VA 3RCDA 4IADA 4ZIMA 1FGKA 3LQ8A 3ZFMA 3K3JA 4U40A 3TACA 4BGGA 4EH2A 4LGHA 4YSJA 1M17A 4MBJA 4BHZA 3F7ZA 3OWJA 3TUDA 3UG2A 4FIJA 2OO8X 3RKBA 5J79A 2X8EA 2X39A 5JZJA 1ATPE 2V7OA 2GDOA 1SNXA 4LQMA 3DFCB 5LWNA 4CV8A 4DGNA 5L8JA 4MXXA 3SGCA 3LFCA 2OFVA 2PK9A 3QD2B 4XMOA 3NIZA 4G5JA 3SOAA 3H4JA 3EYGA 4XV1A 3TKUA 4BCJA 3W32A 1ZXEA 5AA8A 4KIKA 3EKNA 1H24A 2YLEA 3QKLA 5AUWA 1X8BA 3PJ2A 3VWAA 3UIMA 4JR3A 2YIYA 4YP8A 4DGOA 4QTDA 4BI2A 5FRIA 2ONLC 3L9MA 4I41A 4J96A 1QCFA 1QPCA 4MD9E 5CVGA 5BUIA 1J7UA 1LEZA 5GJDA 2BZJA 2YABA 4GJ2A 4FKWA 4N6ZA 3PZHA 4ALWA 2QOCA 3WOWA 4AP7A 3QX4A 3Q2MA 2VTTA 3OZ6A 3G5DA 4BTJA 3LMIA 4FTAA 2WQBA 4IHPA 5CQUA 4GFGA 4J52A 5EDPA 3UZTA 1ZOHA 1XH8A 1H1QA 2FGIA 4FYNA 4KSPA 4PWNA 2GHGA 4O81A 3NW5A 2R0UA 4LL0A 1WBVA 2GU8A 3VBVA 4QMTA 5CSHA 3V5PA 4BC6A 3VS0A 1DAWA 3PXQA 3PY1A 4FK3A 4S2ZA 1JKTA 4GUEA 2OSCA 1DAYA 1WBSA 3KMWA 4E6CA 5IQAA 4EUUA 2UW8A 1J1BA 4I0RA 3DKFA 5AUVA 5L2QA 1H08A 2WELA 4YHTA 1H07A 3FXXA 3V8TA 1AGWA 3OEFX 4ANNA 2JGZA 2ITUA 3Q3BA 2I6LA 3DB6A 4FSMA 4FZFB 3CE3A 3UO6A 3ZH8A 4CLIA 2JFLA 4RIWB 4F7LA 4TYHA 5D7AA 1DI8A 2XYNA 4GG5A 4XV9A 3TIYA 4C4GA 2ITTA 2OIQA 5FP6A 1Y8GA 5CZHA 3G9NA 2W7XA 2G2FA 1FVVA 4GMYA 3LXKA 5KKRB 3FSKA 4QP9A 4CFFA 5LWMA 3R7YA 2QO7A 3CQUA 1YW2A 3EQDA 3QRIA 5CU0A 5DYJA 5D12A 3EH9A 4I20A 3C0HA 3KEXA 2EVAA 2BIKB 3SX9A 5IEVA 1YOJA 3FI3A 4L00A 2W9FB 3MY0A 4TTHB 4ZTMA 3NUNA 4FIIA 3GQLA 4CV9A 2EXMA 4NM3A 3LXLA 3ZM4A 4F99A 2IZSA 5IDNA 2C4GA 2FUMA 4CT2A 2VU3A 3L8SA 4I92A 3U54A 3NX8A 4RX5A 3WYYA 4F9AA 5AUUA 5HD7A 5JFWA 4FKGA 4Y5HA 1E9HA 4QMMA 5CEQA 5IDPA 1GNGA 4K6ZA 2IN6A 4FOCA 3ENMA 2X2LA 3R8VA 2BDWA 3RP9A 4USEA 5CEOA 4IAFA 2YM6A 3W2OA 3LKMA 3BYVA 3R8ZA 1YVJA 4DEBA 5M06A 3MV5A 5J1WA 4MNEB 4NCTC 4YJTA 3CKWA 4I5PA 2Z60A 2YDJA 2YAKA 4DLJA 4J8NA 2VX3A 3SDJA 3UP2A 5HU9A 3CPCA 1W83A 3LJ2A 1UVRA 2Q0NA 4YBKA 1VZOA 2QQ7A 4XP3A 5KBQA 4MKCA 4AZSA 4D9UA 5CSPA 5GINE 3F3VA 2XKFA 3A7FA 2YDKA 4LFIA 1KOBA 4XLIA 5JZNA 3BX5A 1KE5A 3DJ5A 4FF8A 2WTJA 3EQPA 1V0BA 4D0XA 2YWVA 4RSSA 4TYIA 5AMNA 3UE4A 4RIXA 3VS4A 3A4PA 3R73A 3GOKA 3FKLA 4B4LA 3B8RA 3FQEA 4AT4A 4A07A 4KS7A 4E20A 5AR8A 2EB2A 3DS6A 3HKOA 5DRBA 5KHWA 3FC2A 4BDAA 1XBBA 4G34A 5DNRA 4BDDA 5A4EA 5FEDA 5M44A 4FSUA 3BHTA 3FV8A 4RVLA 2JKQA 3ODYX 2XKDA 3BQCA 3JY0A 4ZSEA 2VN9A 4W8DA 5DG5A 4X2JA 4DEIA 4YZDA 1RE8A 1NVQA 2JFMA 5HESA 3WZUA 5TO8A 2OXYA 3PJ1A 1H1PA 3PP1A 2YISA 4IFGA 3Q53A 4FVQA 3NW7A 4TYEA 4Y72A 1JLUE 2ITYA 5DI1A 3VHKA 3VW6A 1OL7A 3G0EA 4IH8A 4APPA 5LMKC 3MB7A 2UV2A 4FEUA 3TM0A 1NXKA 2YZAA 4G3EA 3ZSGA 4E3CA 2QI8A 5DE2A 5I9ZA 5CY3A 2GNJA 5CENA 4DFYA 4FEWA 2F2UA 5CANA 3S00A 5C8MA 5TKDA 2BHEA 1UU8A 3QQUA 5CQWA 3UIXA 3WI6A 4JNWA 4AGWA 4FTTA 3IDPA 4XX9A 2BZKB 4CD0A 4WG4A 4FT3A 1NT2A 5IISA 4FVRA 5FG8A 4WO5A 2C0IA 3D15A 4M69A 4N0SA 3VS7A 3A62A 3QZIA 2C1AA 2F7EE 5EHLA 3SHEA 3WF6A 5JRQA 2FB8A 3PFQA 1YOMA 5J9ZA 5JEBA 4IXPA 5CI7A 1YDSE 4XBRA 4D55A 3H3CA 2GNIA 4UMRA 5I0BA 4I0TA 3VS2A 1W84A 3EB0A 4C3FA 5DN3A 5HO8A 3R7VA 1H4LA 3OWKA 4U6RA 4O7LA 1T45A 5EQEA 2YHVA 2VTRA 1UNHA 5B2KA 1KE7A 4F0FA 2IZRA 5FEQA 4CMUA 3AGMA 2HAKA 4DHFA 1U5QA 3BBTB 2J4ZA 2GNFA 5K0KA 2OBJA 1G3NA 5GZ9A 5AUYA 2HY81 1FVTA 5IEYA 1U54A 4BI1A 4FV5A 4D4RA 4R78A 2X6DA 4NKAA 2X6EA 2YEXA 5AR4A 5TF9A 4WSYA 1E1XA 3OTVA 3KXHA 3QRJA 3FUPA 4G9CA 5C03A 3EL8A 5FGKA 1Z9XA 5IEXA 4KIPA 5AFVA 2CPKE 1CKJA 1M14A 2QU6A 3D7TA 3GU6A 3BHYA 4QP7A 5AP6A 3WARA 2BFXA 3BYOA 4MXZA 5M51A 2V7AA 3QCYA 3U8WA 2PE0A 1SVHA 3F2NA 2OFUA 4UY9A 3WF8A 2XS0A 4AOTA 4OTPA 5L2WA 1PXOA 3E5AA 4DH8A 2CKQA 3C51A 1QPDA 3V5TA 4ERWA 4BKZA 2ITQA 4ZTRA 2HZ0A 5AM7A 1WMKA 4MEDA 3SC1A 4WHZA 5FD2A 2EU9A 2XIXA 2WQOA 4P5QA 4F63A 1K3AA 3R0TA 2ITVA 3KVWA 3PY0A 3PY3A 1MQBA 3I6UA 4XH6A 3RNIA 2Z2WA 3FYJX 4IB3A 3VO3A 5IMXA 4FG9A 3VQUA 2HK5A 4FSZA 5KUPA 4D4YA 4LUDA 4NSTA 3TL8A 1H27A 4AZVA 2F9GA 5LVNA 1HCKA 3ZLYA 2WGJA 1SMHA 2DWBA 3CBLA 4AW1A 3UQFA 1PXMA 3U4WA 3BYMA 4XOYA 1ZYCA 5ANKA 3GU8A 4MCVA 2VTMA 1G5SA 5HOAA 4YSMA 3S95A 3ZOSA 3C4FA 4B7TA 5A4LA 3E88A 2O0UA 1IAHA 4OBPA 4EH8A 5GNKA 4AXAA 2I0YA 2CKPA 4ID7A 3PG1A 4O7NA 5BUEA 1ZYLA 3CR0A 5E1EA 2J6MA 2YIQA 4DGGA 4RVMA 3HUBA 1M2RA 1VYZA 2BKZA 3OOMA 1B38A 3PPJA 3CKXA 4U41A 5HO7A 4NL0A 2UVZA 5ACKA 1Q24A 3QL8A 4DGMA 4EEVA 2BR1A 4FE2A 3QQJA 2ZOQA 3I4BA 1V0OA 1XO2B 4BICA 1PMUA 4F0IA 4EC8A 3KF4A 2DQ7X 4QMYA 1ZMWA 3K3IA 4O0VA 2WTCA 5FBNC 1UU9A 2BAJA 4UXLA 3F3ZA 3MJ2A 4HYIA 3POZA 4HYHA 4UMQA 3ZBXA 2CNUA 1TQPA 2CN8A 3HA8A 5DA3A 1XR1A 4EC9A 1ZYJA 1ZOEA 3QA8A 3SXFA 5KO1A 2R3KA 5FUTA 3IW5A 2IW8A 1A06A 4EI4A 4GK2A 3NPCA 5DWRA 4EQUA 4JG8A 4I4EA 4R1VA 4U8ZA 1KSWA 2QOIA 5CXHA 2XIZA 4IWOA 3R2BA 3CCNA 3QU0A 3W8LA 4H1MA 4E8AA 2R3OA 2UW4A 4FV2A 5DH3A 1KOAA 1GIHA 1XHAA 3FC1X 2F7ZE 4I93A 4NK9A 2UZDA 2ITZA 5HCYA 2X9EA 3PSCA 3W55A 2F4JA 3MIAA 4FG8A 5EFQA 4GUBA 3PJ8A 4AS0A 1EH4A 2XMYA 4O0XA 3D7TB 2PUNA 3MGYA 1TQIA 4C61A 1ZRZA 4YHJA 4AFJA 2CJMA 4G6OA 4ASDA 4EOSA 2DYLA 4OT5A 4DTBA 5ANJA 3QWJA 3FI8A 4CKRA 3G51A 5ICPA 4M8TA 1F5QA 2YIRA 3DK6A 3OT3A 2CGVA 4ZLYA 4WT6A 4V01A 1RDQE 3AC1A 4YNEA 4HYUA 2RFEA 2ONLA 4XEYA 4TXCA 3AGLA 4I3ZA 4QRCA 1PXIA 1I44A 2PVMA 4H3BA 5K4JA 4FTQA 2DUVA 3DZQA 4BZNA 5CF8A 5JSMA 4ZSAA 2BKKA 4RJ7A 4TKSA 4PNKA 1PYEA 3TNHA 4FL1A 4G1WA 4A9YA 3R63A 1STCE 4DFLA 4E6QA 4ENXA 4AE9A 4EORA 1H00A 4AN2A 4B6LA 3EYHA 4UMPA 5JGBA 4RZVA 3BBWA 3BHUA 5IQDA 3MH1A 4EHEA 4C2VA 3QQHA 4DT8A 5M56A 5AX3A 3N4TA 2REIA 2Y7JA 2OJFE 3P86A 2GFSA 2J5FA 3DLSA 4WG3A 4LV8A 4II5A 4LUEA 5CU4A 4ANSA 3DK7A 4O7RA 1MRUA 3EOCA 3QX2A 3CD8A 4NZWB 3RM6A 3KN5A 5AA9A 4FG7A 3TIZA 3ZLWA 3FHRA 3F2AA 5CEMA 4FNWA 4U5JA 5B2MA 3F5UA 4UWBA 2G1TA 3ORXA 4UALA 4X2KA 3IW4A 1OKVA 2X2KA 2PPQA 3QHRA 3HA6A 4B9DA 3R9RA 4H3PA 1WVYA 4YC3A 3DBCA 4JAJA 2VX1A 4X21A 3EN9A 3ALOA 4I21A 4JQEA 4HCTA 4NTSA 1Z5MA 1R3CA 2Q83A 1KV2A 4Y8DA 4QQCA 4PUZA 4L43A 1P2AA 4UWYA 4FGRA 2FSTX 3W2PA 5ANEA 2UVXA 3V8WA 5FTQA 5HX6A 1LPUA 3ZO1A 2WTDA 5IH5A 5BYYA 4JL9A 3O7LD 1AD5A 4Q5EA 3NAYA 1PXNA 3UPXA 4YPDA 4G16A 5I9YA 1LR4A 4J97A 1CKPA 5BVFA 4I22A 2VWZA 3DU8A 3E8EA 5IPJA 2X9FA 4R8QA 5TT7A 4PMSA 4BCHA 4B8MA 2CNQA 4NWMA 3ZO4A 3O71A 4A06A 5C4LA 2UZNA 3Q32A 3QUPA 4IDVA 4XLVA 4FOBA 4M14A 3SRVB 3NNUA 2O64A 4RPVA 4BDCA 1ZWSA 2XNNA 4MAOA 2CNVA 3EN4A 4ZSLA 3W2RA 3U9NA 4C58A 4CFNA 4EQCA 1BX6A 4PL5A 3SG8A 3FMJA 4HPTE 3LQ5A 3P1AA 2W1EA 5E8TA 3RWQA 4IANA 4XRLA 5H9BA 4LM5A 3UZRA 4E73A 3KXMA 4FV6A 5JQ8A 4D0WA 4Z55A 4ZZNA 4Y5QA 3U51A 3PSBA 4FZ7A 4BY9E 3R01A 3V6SA 4GYIA 5AX9A 4MBIA 3FYKX 3TNWA 3PA3A 4RC3A 4RMZA 4DEAA 2WU7A 4Y85A 3CPBA 5KNJA 3O8UA 1BI7A 3HUCA 3LM5A 3HMMA 4AZFA 4RJ4A 3LXNA 3C13A 2PZIA 3LJ0A 4EYJA 3FMDA 1OL2A 4O0RA 4JBVA 4E4LA 2C3JA 3BLRA 3VBXA 4C62A 3PYYA 3UQGA 2V62A 2VWXA 4C7TA 4L45A 1WBOA 3EFWA 5A4QA 4RG0A 3IDBA 1JQHA 2BMCA 5DR9A 1ZMVA 2YM3A 5DGZA 4QOXA 1FQ1B 3VF8A 3NLBA 4BRXA 5LMKA 5CLPA 4R7IA 4YGAA 4KB8A 4J1RA 3WF7A 3P4KA 4GRBA 3O8PA 5CSXA 5CASA 3H10A 1GIJA 4R7BA 3UDBA 2FO0A 3EL7A 2CDZA 2QHNA 3VUIA 3R8LA 4CFXA 4FTLA 2ZM3A 4LGDA 5CXZA 3EZRA 4IAZA 4MXYA 4C3RA 1QMZA 5HTIA 3GUBA 3HV6A 3M11A 3HECA 3AC8A 2WQMA 3P7AA 5BMMA 1JKSA 3BYUA 3PVUA 4N70A 2R3GA 5ITAA 4G6NA 4D2RA 4DN5A 5JFXA 4PPBA 1MQ4A 4MXOA 1B39A 4E5BA 4U45A 3RK9A 3OW4A 1ERKA 1PF8A 3WF5A 2PMIA 1H1WA 4FV1A 1YHWA 1OL6A 4RJ8A 5J8IA 3NVMB 3FBVA 2OJIA 3VIDA 2G15A 4G17A 4OTRA 4FKIA 3GB2A 3GNIB 4L3LA 4O38A 3HMOA 1XH4A 4BCOA 5E9EA 3AC5A 3EMGA 3LFDA 3QBNA 4ONAA 5BVOA 2A0CX 3DPKA 4RA4A 2XK7A 5IA4A 1ZZLA 4O7YA 2GTMA 2GPHA 3F3UA 4GJ3A 1RW8A 3OROA 3QUDA 4U3ZA 5CALA 5IQCA 4BIEA 3F5PA 4JX3A 4OBOA 4M3QA 3QKMA 2QNJA 5AV1A 2BAQA 2YJSA 2XK3A 3RAKA 4GKHA 2BZHB 2V22A 1DI9A 2BROA 4OT6A 5EM6A 2VWIA 3M42A 3VAPA 4GSBA 1PW2A 3ZSIA 4FVPA 4FMQA 2B53A 3VUMA 4RIYA 3DV3A 2WTVA 3TZ7A 3V5JA 2YLFA 3R7OA 1RJBA 2W1IA 2JAMA 3MFRA 2J0LA 4CZYB 5CAPA 3K5UA 4CEGA 3R83A 5LXMA 4FKUA 3VJOA 2C47A 4QPMA 3KMUA 2W5AA 4IZYA 3OVVA 2HW6A 2CSNA 3TEIA 4BDEA 4JQ7A 5EW9A 2VGPA 4QQJA 4G6LA 4DEEA 4UZHA 4QMVA 4FKLA 1IR3A 1Y6AA 3FPQA 1H8FA 2A4LA 3ZZWA 3QRKA 3KVXA 4IW0A 2PZ5A 3S1HA 5D11A 2WTKB 5LMBA 5CVHA 5AR7A 2JDSA 4HZRA 3P0MA 2UW9A 2WNTA 4PDPA 2LAVA 4E6AA 5AAFA 4OAUC 1UNLA 4UBAA 3IGGA 1GZ8A 4NM7A 2PZRA 3PRIA 4RZWA 2ITPA 4E1ZA 3HEGA 1OKWA 3HP2A 3C5UA 3VUDA 3C4EA 3MVLA 5FLFA 1K9AA 3I81A 3UODA 4DBNA 3DBFA 2XKEA 3GCVA 5E1SA 2XKCA 5K0XA 4XG9A 4EOKA 4ITJA 3IGOA 3PTGA 1BL7A 4S34A 4FSWA 4FT9A 4F6UA 3EHAA 3JVSA 3UOJA 5I9VA 4E6DA 5ETFA 4AQCA 5F94A 3KB7A 3K5VA 4MWIA 4XG4A 5LVPA 4X0MA 2J0IA 5HLWA 3BU6A 4F7NA 4FEVA 2H8HA 3ZC5A 4FUYA 3M2WA 4L01A 4NFMA 3MB6A 3LCDA 3VULA 4GG7A 1B6CB 3JXWA 3MA3A 4R3RA 4RWJA 2GTNA 4YC6A 1BUHA 4GH2A 4GFMA 5H8BA 3A60A
chains in the Genus database with same CATH superfamily
4KUJA 3A7HA 3G6HA 5BX0A 3V01A 4FT5A 3GFEA 4UMUA 2BRNA 5DIAA 2OG8A 4WRGA 3VBQA 4CYIA 3KXNA 5KMMA 3DQXA 5CNNA 3PVBA 1Q3DA 3TZ8A 2X7FA 1ZY5A 3R1SA 4MD7E 3IW8A 2VWUA 5AUXA 2B4SB 4M67A 5CSWA 2V55A 4IJPA 5T3QA 3DY7A 4L52A 1W82A 3ORTA 3VVHA 4C57A 3PJ3A 5EI2A 5M55A 4O91A 4RIYB 4KD1A 5DT3A 4LL5A 1XMLA 3CSVA 3BPRA 4TNDA 3ZO3A 2R3HA 4F09A 3ZZEA 4D2WA 3CC6A 2CCHA 4XV2A 5H8EA 1MUOA 1UKHA 3O0GA 4QD6A 4ZEGA 3KFAA 4KIOA 5CX9A 3E62A 2BILB 5M07A 1FINA 5L3AA 2OICA 3P79A 3WILA 3TZMA 2QHMA 3ZFXA 5G1XA 5JK3A 3ATTA 1SNUA 4QYGA 5BUJA 4FKRA 3OBGA 3NRMA 1URCA 3M1SA 3VBTA 4EQMA 2ITXA 4QP3A 2RL5A 2C1BA 2OKRA 4MQ1A 4OUCA 1OVEA 2BDJA 2WEIA 4GCJA 5AJQA 1YDTE 3BYSA 5F1ZA 3BGQA 1M7NA 3HV4A 4AZTA 4OW8A 1OGUA 3FDNA 2OWBA 3C4WA 4YHFA 4JQ8A 4F9WA 5L6PA 4JBPA 2XNOA 4W9WA 4C3PA 4PL3A 3TV7A 4BCMA 4D1XA 2BPMA 3VN9A 3LCTA 5DVRA 5EOLA 5IKWA 3TMOA 3UNJA 2JC6A 2HXQA 5DBXA 1CSNA 4LI5A 2Y6OA 1BMKA 1YXSA 2XF0A 3HGKA 3PXRA 4L53A 5K5NA 3N4VA 3HL7A 4LGGA 4PDYA 1UA2A 2PHKA 2W99B 5HG8A 3FQHA 2XYUA 4IC8A 4NIFA 2O5KA 2WD1A 4AWIA 3DTWA 4YJNA 4A9UA 3KF7A 3ROCA 4NH1A 4DINA 2NRYA 3AG9A 5EKOA 4KWPA 5CTPA 1U46A 5GIOE 4LOOA 4FTKA 2P3GX 5HHWA 5I9WA 4FV7A 4PL4A 4P90A 4X3FB 2CGUA 2P2HA 1HOWA 2GSFA 3GCUA 3MBLA 2VWWA 4TYJA 4XRJA 3KRJA 1TQMA 2BALA 1V1KA 4EK5A 3QWKA 1OUYA 4RJ3A 3QKKA 5IG1A 2WMWA 4S33A 4M12A 4QTCA 1XH9A 2ZB1A 2PVJA 3COMA 4IX3A 2KTYA 3FMLA 3R7UA 3QXPA 4F9CA 4XS2A 3DFAA 1GZKA 4DFZE 3E3PA 3FI4A 4PY1A 1S9IA 4F0GA 2YITA 3IONA 2W05A 3Q4UA 3PDTA 1U59A 4CQGA 2HZ4A 2YCRA 3D9VA 3UC3A 1H25A 2QOLA 4IM3A 4AXEA 3U6IA 4AX8A 2YAAA 3OWLA 5DOSA 3VONA 3FHIA 4LMNA 4F70A 2EXCX 4RIOA 4MF0A 3OY1A 2BFYA 4MBLA 3E8NA 2R64A 5GJGA 4CTCA 4XYFA 4Q5HA 1M52A 4AAYA 4Z3VA 3LHJA 3C4CA 4IVCA 3HVCA 5AADA 1UV5A 3ORNA 3LFSA 4QYYA 5CT0A 1OPKA 4FI1A 4ZS0A 5C1QB 5M4FA 3PE2A 4I6QA 5ANGA 3R9NA 4QMNA 2QC6A 4PV0A 3WIKA 4KIKB 1OI9A 4UMTA 4IVBA 4JBQA 1IASA 2E9NA 1Y6BA 4QNAA 4DFNA 4FYOA 2OH4A 2UVYA 2XNBA 1KWPA 3FI2A 4KIQA 4TT7A 4ZK5A 3RHXA 2ZVAA 2B9JA 3UBDA 2WMAA 5HCXA 4OTWA 3WE4A 2E9UA 4JIKA 4E4NA 5KZ0A 1YXUA 5EQYA 2RFDA 2XK8A 4QMZA 5K3YA 3FWQA 3G2FA 1PRYA 2JEDA 4U9AA 5E8XA 2UUEA 3UZPA 2RKUA 3LCKA 4TWOA 4XP2A 4AN3A 5I9XA 1IG1A 2HY0A 3BLHA 1WBWA 4S30A 4Y83A 2IF8A 4IX6A 5HE1A 3RI1A 3VW8A 1OMWA 2E9VA 4FBXA 4L67A 2Z7RA 5B0XA 4AF3A 3IS5A 1OIRA 3F7WA 3U6JA 2XEYA 2OJ9A 4R77A 3RPVA 3QCXA 4I5MA 4YZCA 4R7HA 4CGAA 2C3IB 3ZDIA 3KK8A 5FDXA 4GVAA 4DT9A 3I79A 2CGXA 3D14A 3TNQB 4W9XA 4JRVA 4O1PA 4W8EA 1SYKA 3MSSA 4IZ7A 4BWKA 2F7XE 1GAGA 4X2NA 4PQNA 1JSVA 4TL0A 2X0OA 1OIYA 4IWQA 5E8WA 4BZDA 4Q2AA 2VGOA 4GT3A 4F64A 3ORLA 1M7QA 4D9TA 3VUKA 2NP8A 2XARA 4TYHB 1PXKA 1NW1A 5BVDA 4DF3A 4QMOA 4CVAA 3RK7A 2R3RA 3OUKA 4FV9A 3AD4A 3N4UA 2IVUA 4R5SA 1MRVA 2QG5A 2WTKC 4CYJA 1I09A 5DMZA 5KE0A 5KCVA 5JGAA 5BYLA 3COKA 4BCNA 5HO6A 2XJ1A 3ACKA 4EH9A 3W0MA 3IG7A 3W0RA 3L8PA 2R4BA 3C5IA 3MH0A 3A99A 3R21A 4IC7A 3K2LA 1CDKA 2IVSA 3MN3A 4ZJJA 1RQQA 5IQFA 2J0MB 4O1OA 3S3IA 3KL8A 3TTJA 1BLXA 4CSVA 3RK5A 5I5ZA 3JS2A 2JBOA 2XNMA 4BKJA 2R7BA 4DGLC 5DR2A 4CLJA 3OCBA 3PIZA 2R5TA 3IOPA 4H05A 2XM8A 3ZXZA 4UX9A 4EKLA 1P5EA 3DB8A 4CFUA 3TUBA 2A27A 2VV9A 3CLYA 4U80A 4EBVA 3GC0A 4RWIA 4CRSA 1Q8YA 3SQQA 3W0PA 1FGIA 2VTNA 1OIQA 1V0PA 1JNKA 2WIHA 4FKPA 5ETIA 4AOIA 2XCKA 2H6DA 1PXPA 3MI9A 3L8XA 5CI6A 4YZBA 4F1MA 2O63A 2YJRA 3F66A 3MH2A 3UOKA 4HVIA 5HGIA 3P7BA 3UC4A 5FXSA 4HW7A 4BIBA 2QCSA 2VTIA 4NUSA 3RPOA 2QD9A 2XP2A 5DEYA 4E93A 5C8NA 4O7ZA 3FZOA 2UZUE 3RALA 4L8MA 4O4DA 4EH7A 4QMLA 3CY2A 4X6RA 3SOCA 4ASEA 5JRSA 3NVKI 3ZU7A 3L9PA 3MW1A 2UZWE 3PSDA 4RC4A 3FJQE 4D5KA 5FTGA 3RAWA 4RIXB 2ZMDA 4BDJA 2Y9QA 2C5YA 1G8AA 5IA3A 3DAJA 5E92A 3SW4A 2VRXA 5CEPA 4TYGA 4O0TA 3UTOA 1JAMA 4J71A 3I0OA 2W0JA 4MD8E 4ZSGA 3CQEA 3LXPA 4QPAA 4ANLA 3AC4A 3E3BX 3PA4A 3Q9XA 4FT0A 4CTBA 3BV2A 2P4IA 3HP5A 4K1BA 1UU7A 1WCCA 2RG6A 1WBPA 3PWDA 2OJGA 3VS6A 4GVJA 5ANOA 2ETRA 4M68A 3D94A 4U3YA 3AMYA 3UDTA 2WFYA 2G2IA 2A19B 5B2LA 3BE9A 5F4NA 4F6WA 3O5AA 3OCGA 4NYEA 4P2KA 4EUTA 3E63A 4I5CA 4C59A 2Y6MA 3NAXA 1K2PA 1YXXA 2W96B 2HZNA 4XUFA 1VEBA 5DT0A 4FZDB 5KMNA 2GMXA 2QODA 2R3NA 3ZS5A 2PVNA 3FLYA 4IBMA 4QO9A 3RGFA 3NIEA 3QTZA 2ETMA 4LRKA 4AGCA 4BBMA 2NNWB 2Y4IB 3JYAA 3O8TA 1OBDA 4IX5A 3AC2A 3QD3A 4AT5A 5A4TA 4FKJA 4M69B 4ORKA 2YCSA 2FYSA 3BE2A 3PA5A 2XM9A 2VO0A 2ZYBA 1YQJA 2R3MA 5FXQA 3RJCA 4K0YA 4DH5A 3Q04A 5J9YA 3NZ0A 5C26A 3LOKA 3Q2JA 2X7OA 5M09A 2XA4A 3FAAA 3QQFA 3PXFA 2YIXA 4R6VA 2OGVA 3RMFA 3FZPA 4DAWA 2X1NA 2QOOA 2BTRA 4GFOA 1WBNA 5E91A 4M0ZA 3TKIA 2C30A 3DAKA 3LM0A 4R5YA 1JKKA 1Q61A 2O8YA 3ELJA 5E8UA 4O22A 4HYSA 3UYTA 4YTCA 5CF5A 4ASZA 4DTAA 3ODZX 4X3FC 1GIIA 1U54B 4IZAA 4KBAA 4TPTA 4CKIA 4EOOA 4DFUA 3ZRLA 2GS2A 2ZM4A 3DXPA 4G3DA 4W4VA 3UIBA 5AUTA 3UQCA 5A14A 5AEPA 1H1SA 5EKNA 4HGTA 3NUPA 4BYJA 4E26A 3I5ZA 4FTIA 5KKRC 4XV3A 1QL6A 2XNGA 3G9LX 4TY1A 1PXLA 4G3GA 2OZAA 3D83A 1XJDA 4AU8A 4B0GA 4DFXE 1M2PA 5IQHA 4V0GA 3AMBA 4M97A 5AP1A 3UDSA 4FK6A 2XH5A 3EJ1A 5KMKA 2KULA 3UVRA 3F3TA 2C3LA 3CEKA 4XJ0A 3DA6A 4MUQA 2WHBA 4YLLA 5DT4A 5A46A 2BIYA 3SA0A 2VO6A 3HYHA 3MFUA 3EQHA 3MESA 2I0EA 4AN9A 3S4QA 3FSFA 2ZV2A 4I6LA 4C36A 5IQIA 2I1MA 3Q60A 4JDJA 3FZTA 5FEEA 4IDTA 3LFEA 4JDKA 1XH5A 2CKOA 3CD3A 5JGDA 4QMQA 2OK1A 4YPSA 4D2VA 1FOTA 3QTRA 3QTUA 3R1QA 4LYNA 4C4FA 2A1AB 1KE9A 3NUUA 4AW5A 5IA0A 2B0QA 1JBPE 4RRVA 2QOFA 4WNPA 4FT7A 3F5GA 5AR5A 3QFVA 4LG4A 4EHGA 2X2MA 4YTIA 4O7TA 2CLQA 2VTJA 4L42A 3SW7A 2BRMA 1YXTA 3KCFA 3W2SA 4I6HA 3UVPA 3W0OA 2JIIA 2E9PA 1Q97A 4MNFA 4RX7A 3REPA 4XG8A 4WBOA 4YTHA 3FKOA 4U0IA 1JOWB 2XCHA 1SZMA 3AXWA 4YBJA 3WIGA 2YDIA 4ITHA 4EK3A 2GQRA 4BFMA 3NYXA 5CS6A 5FBOA 1SVGA 4FIHA 1Q8WA 4IB1A 2EUFB 4UYNA 4AW0A 1J3HA 4EOLA 4EH6A 2QO2A 3LW0A 1OBGA 3WZEA 3ID6C 3PXYA 4F7SA 2WOTA 4FV4A 3HDNA 3OD6X 4U44A 4DC2A 3VC4A 2X0PA 3BGZA 4BWXA 3UMXA 3HZTA 2J0JA 1OM1A 3N9XA 4W4YA 4E5AX 3OXIA 5IA2A 3MTLA 5BYZA 1JPAA 3VNTA 2VWBA 4KABA 4NW5A 2AC3A 5J5TA 1W8CA 3MS9A 3MPMA 4UZDA 5HORA 2C5XA 5EHOA 5TR6A 3FY0A 3ZDUA 2X7GA 5HE0A 3F61A 5J87A 2OH0E 4ZAUA 5C8KA 5DEWA 5L6WL 3AT4A 3U9CA 2XK9A 3QZGA 3GGFA 3BI6A 5LVLA 5M4UA 2PYWA 4N57A 5AAEA 4FGBA 2BDFA 2HWOA 2GNHA 3BHVA 3QD0A 1NY3A 4LRMA 3PG3A 2UW7A 3RZBA 2BRHA 3TZ9A 2QR7A 3UP7A 4ZP5A 4BBFA 4NCTA 3VUTA 1J1CA 2P33A 2F49A 2EXEA 4PNIA 5DR6A 4BJJA 4BIDA 3BIZA 3RM7A 3V8SA 2ZB0A 3QF9A 3FXZA 3WZKA 4BHNA 4RX9A 4CFWA 1G8KA 2PULA 5AP0A 4ZS4A 4EOJA 4L6QA 4KNBA 4ZXTA 2OXXA 1NA7A 4A4OA 2WEVA 2CCIA 5E8YA 4WKQA 2P0CA 3LVPA 4EK6A 4IAIA 4OAVB 4O82A 4FTUA 5HE2A 2FA2A 4FKSA 4EZ7A 1IA9A 5DHJA 5FM3A 1BL6A 1OL1A 2VTOA 3O17A 4M15A 5DLSA 4R3PA 2ETKA 3MJ1A 2WMQA 2YACA 2A2AA 3NYVA 3MVJA 3MVMA 4BN1A 2GS6A 3ORKA 4QMSA 5HVYA 4M13A 3WZJA 2R3PA 3KA0A 4LOPA 2XK6A 4NFNA 1ZARA 3V6RA 2WMBA 4IQ6A 4FIGA 5AM6A 4XG7A 1MP8A 4GL9A 3CTQA 4L7FA 5CF6A 5LCJA 3ORMA 3PVGA 5C9CA 2IVVA 4EJ7A 4PRJA 4JRNA 3W18A 4CG8A 2Z8CA 2CN5A 4AA0A 3OT8A 4ACDA 5JFSA 3TXOA 2ZJWA 3VF9A 1WVXA 2C69A 3AQVA 5IUGA 2XANA 3HLLA 3QHWA 5C01A 3DK3A 5AP5A 3TJCA 4WNOA 3W2CA 1ST0A 3D4QA 4WRSA 2X8DA 4FV8A 3PPKA 4YJRA 4RFZA 3U55A 4U42A 3R71A 2YIWA 2WKMA 4EYMA 1S9JA 2QOBA 3MTFA 1T46A 3HAVA 3TDWA 4FRFA 1QPEA 2YFXA 4YZ9A 3PPZA 4GIIA 2PL0A 3DDPA 3D5UA 3Q4ZA 3QCQA 4FL2A 4V05A 4GW8A 3R28A 3SG9A 4C8BA 3DBDA 3D7ZA 4CT1A 4P5ZA 4RQKA 4CXAA 2GQGA 4GU9A 2OI4X 4HCVA 4FV3A 4RFMA 3A8WA 3DZOA 3H0ZA 3I0QA 5CVFA 5L8KA 3A8XA 4F08A 2JDVA 4CMTA 3QQLA 5BVEA 4JLCA 3A61A 4K8AA 3G6GA 4QNYA 4F1OA 2E2BA 3JY9A 3KXZA 3PVWA 3BQRA 3GCPA 4ZTLA 4UEUA 3NCZA 2B7AA 3ET7A 4OTGA 4GT5A 4TW9A 5FQDC 2ACXA 3AMAA 3RCJA 4ZSJA 3UG1A 4K18A 4EK8A 3HNGA 3VS5A 4D2PA 3ERKA 3TNPC 2IG7A 2UW5A 4DG0E 2V5QA 3C4ZA 3O51A 2OLCA 2HOGA 4KRCA 2YM7A 2FH9A 4DG2E 2ERZE 2H9VA 5DPVA 5HBHA 5F9EA 4C33A 2YN8A 4USFA 5J9LA 2PTKA 3KC3A 2CLXA 3DNEA 3QQKA 4E7WA 1H1RA 3R9HA 3FMMA 1OL5A 3H9OA 5C4KA 3T3UA 3G90X 4FEQA 3FMKA 5AV2A 4HVDA 4WNKA 3HRFA 4Y46A 5ANDA 4AT3A 1R1WA 4IWDA 4R3CA 5A54A 3EQGA 4C0TA 3ZM9A 3RINA 3S2PA 4HCUA 2JIUA 2WZJA 4CKJA 4KINA 4G9RA 3ROYA 4BTFA 1W7HA 5IA5A 5HIEA 3GBZA 2VWVA 4J98A 4C37A 5HZNA 3F9NA 3NUYA 3DXQA 3TDVA 2QKWB 4FZAB 4C4HA 2C6IA 4YJQA 3PJCA 3LCOA 1AQ1A 5C27A 1REJA 5EM7A 5EW8A 3V5QA 3D2IA 4UWCA 5ETCA 1UU3A 3QGWA 1YI6A 4JJRA 3U4UA 3EWHA 2J5EA 4JOAA 2XNEA 2PE2A 2J7TA 2W5HA 4KKGA 4ACHA 3CS9A 4FR4A 3QCSA 4MF1A 4C35A 3P7CA 3SVVA 3COIA 3TN8A 4HNFA 1CTPE 3HRCA 3OS3A 2VNWA 3D5VA 3IOKA 4ANBA 4IE9A 4P7EA 4XOZA 4YLKA 4WD5A 2E9OA 3QAME 2C6KA 4ACGA 2R2PA 3ACJA 3N51A 4NJ3A 5EG3A 3VBWA 2J2IB 5DRDA 2JDOA 4I1ZA 3QUEA 3PUFC 5A6NA 4IX4A 3MDYA 3SXRA 2C6DA 2GHLA 3F88A 1YDRE 4G3FA 1O6KA 3FPMA 4CCUA 4QMWA 3SXSA 4F7JA 4K9YA 4EH4A 3ZEWA 4BVUA 5KMLA 2W4KA 4WSQA 3AT2A 3DKOA 3DXNA 3G0FA 3Q9WA 1PMVA 4EZ3A 2ZFYA 4EH3A 1H01A 4CCBA 4DEGA 5ETAA 2G01A 3CY3A 4DCAA 4Y73A 2ESMA 5CZIA 1R39A 3VRZA 2UZLA 3W16A 4DLIA 1YHVA 2IZUA 3G33A 5JKGA 4EWHA 4LOQA 3V3VA 3E92A 2EWAA 3OFMA 1GJOA 2PMOX 4KRDA 4H58A 5LARA 4BTMA 3UDZA 4KKHA 4RFYA 3VS3A 5GZAA 4PX6A 1J91A 2I7QA 3PP0A 4D1SA 5H8GA 3O7LB 4MX9A 5BVWA 3NFGB 3LE6A 3FY2A 4GV1A 3ZONA 2VTPA 5HLPA 2B55A 2WQNA 3LFAA 2X8IA 4JR7A 2PUUA 3LPBA 3CIKA 4MQ2A 3OMVA 1BI8A 1BKXA 5CU3A 2ITOA 2BRGA 2XIKA 4BGQA 3R7EA 3KN6A 2QKRA 5JMSA 1YI4A 3IKAA 3DBEA 2PVKA 2YZLA 4JBOA 3R6XA 5EYDA 5T6KA 3SD0A 2WAJA 4FX3A 3KK9A 3LFQA 4M84A 2FSOX 2YM5A 3AT3A 3ZHPC 3WF9A 4QYFA 4L46A 2IW6A 2Z02A 2UZBA 4O21A 5HNBA 3DJ7A 5FTOA 4FKOA 4ANOA 5E4HA 4XP0A 1BYGA 2G2HA 5AP7A 4BCFA 3C0GA 3HMNA 3C4XA 1PJKA 4I4FA 5EI8A 3UGCA 5BQ0A 4IM0A 3QTXA 4ACMA 3FQSA 4F1TA 3GC8A 3R9DA 5EQPA 4DH3A 2UZEA 2QURA 4MYGA 4FC0A 4XNEA 1JSTA 4BYIA 3FZ1A 3PUPA 3GFWA 5AP4A 5AV0A 4IM2A 3MYGA 2W1ZA 4YTFA 3OC1A 2BUJA 4X2GA 2NPQA 3NUXA 3UMWA 2B54A 4M7IA 3POOA 2VD5A 4BB4A 1JWHA 2DS1A 1PMEA 2J9MA 2YWPA 4I6BA 3FLQA 1NVSA 1XH6A 4WG5A 4I0SA 2ERKA 1Y57A 3EQRA 4O0YA 2HZIA 2B9IA 4MNEA 3EN7A 1ZY4A 4BI0A 4U7ZA 3VJNA 4ALUA 2UW6A 3NGAA 3NSZA 3GQIA 5EHYA 5E7RA 1XH7A 4U81A 5AR2A 4AZWA 4GIHA 4G3CA 3SLSA 3Q52A 3PLAE 2QR8A 2Z7LA 2LGCA 4RVKA 5GHVA 1WFCA 2F57A 1YRPA 4FICA 3DT1A 3O96A 5HTBA 3KULA 3DGKA 3RTPA 4C34A 1A48A 4BWPA 3NMUF 3WZDA 2B1PA 4YJPA 3BWJA 3KGAA 4Z7HA 5EYCA 1SM2A 3FL4A 4ZTSA 4C38A 2Q0BA 2ZV9A 3QC9A 1YWNA 1HCLA 3BL7A 4CFMA 1J7IA 4BTKA 3NYOA 3BU5A 3CTHA 2WB8A 2R3LA 3UJGA 2VTQA 5IUIA 3IO7A 4FTOA 3IW6A 3TI1A 4C02A 2WMRA 3DKGA 4LV5A 4O0UA 3AD6A 1Z57A 3P5KA 3Q4TA 4FZ6A 4RLLA 3VBYA 1YXVA 3F69A 3L1SA 4OTQA 5AP3A 4EOQA 2Z7SA 3ORPA 1PKGA 4IMYA 3DJ6A 5LMAA 3W2QA 2AEGA 3GT8A 1CMKE 2YM8A 4FODA 1OKZA 5HTCA 1YWRA 4MXCA 1OZ1A 5I3RA 4IVAA 3FL5A 3GU7A 4ALVA 4BCGA 4HGSA 4PMPA 5M4IA 4KSQA 2CGWA 5HU3A 4RWKA 3BZ3A 4MTAA 2VAGA 2W1FA 1H28A 3R1YA 4FIFA 4OTDA 4PPAA 3UOLA 3NR9A 2C5OA 4PDSA 3E64A 3E7OA 2ZMCA 4EH5A 2XIRA 4OR5A 3TWJA 3RWPA 3II5A 5TOZA 4AA5A 1CM8A 4ITIA 5JQ5A 4ARKA 4QP6A 3I1AA 4PPCA 4BBEA 1P4OA 2C3KA 4RBLA 4DE4A 3F5XA 4OLIA 4ZY6A 4JAIA 3MVHA 3DOGA 4K11A 5M57A 2R0IA 3FKNA 3RZFA 3SKCA 4FSQA 3NDMA 4YLJA 3QLGA 1KE6A 4AXCA 1YOLA 3IW7A 4YUQA 3Q6WA 4N6YA 4BZOA 3WYXA 5JFVA 1UNGA 2PMNX 4RX8A 3ITZA 3ZFYA 2F2CB 4YZNA 4AG8A 4EHVA 2X0GA 2IJMA 5CAOA 1XWSA 4O7WA 2VO3A 5AP2A 1XKKA 4B99A 1Q41A 3ZO2A 2CMWA 2R7IA 3E87A 3Q4CA 4I5HA 5IZFA 3LJ1A 3S0OA 3AD5A 3LIJA 5D41A 3QXOA 4DH1A 1PMNA 2HIWA 5J95A 3W33A 5KX8A 1WVWA 4QMUA 1FBNA 4QPSA 1IA8A 4O4FA 1FMKA 4XBUA 4YO6A 4Z7GA 4QMXA 4O86A 4J53A 2JBPA 5CWZA 5GZ8A 4K33A 3IK3A 1J7LA 4NIFB 5IA1A 2AC5A 4LRJA 2RGPA 4OGRA 1Q3WA 3L9LA 5EOBA 3KULB 3ZRKA 4IIRA 5AR3A 3OCTA 4BF2A 2PWLA 2QOQA 3DQWA 4QTBA 4ZZMA 4BDGA 5HKMA 3HV7A 2XRWA 3ORIA 4B8LA 4C4EA 3NS9A 4NW6A 1GY3A 3UOHA 3UO4A 4IFCA 4H39A 4XG3A 5J7BA 5EH0A 2PSQA 1REKA 2UW0A 3ULZA 2XAMA 3FZRA 3GOPA 3A2CA 3GU5A 4GS6A 3LFFA 4O96A 3UNKA 4FNYA 2J51A 4EONA 3EQIA 3DTCA 4DITA 4D5HA 4J8MA 3T9IA 3AKJA 3PE1A 3CJGA 4J7BA 4AACA 4AGDA 4ZY5A 4D58A 3KRWA 2C5NA 4C2WA 3QLFA 5HIDA 3I6WA 3NNVA 4QEBA 1JSUA 3LCSA 2JKOA 2HW7A 4U79A 3NUAA 1Q62A 2UZVA 4YNOA 2PUIA 1DM2A 5CT7A 2XRUA 4Q9ZA 5CAUA 5ANIA 5GIPE 3QZHA 4JDIA 2X4ZA 4I24A 4WNMA 1U4DA 3QALE 4FUXA 2OF4A 2QG7A 3F6XA 3ZLSA 2W9ZB 4MHAA 1UWHA 3QTIA 2OIBA 3AOXA 2FSMX 2VWYA 3QA0A 4DHIB 4O0WA 4R1YA 2WPAA 4ZJIA 4FSTA 3R22A 2X81A 5M4CA 2IW9A 2IZTA 3QYWA 3E7VA 2XNPA 4KA3A 3NWWA 4PTCA 3EFLA 2J0KA 2J90A 5E90A 3H9RA 5HEZA 5I3OA 3W1FA 4O84A 4CG9A 4JVGA 1U5RA 3IDCA 2BAKA 2WMUA 4YJSA 3JPVA 4FL3A 3E8CA 2PVHA 2ZM1A 5EYKA 1URWA 5HIBA 4JDHA 4X2FA 3RPRA 4P4CA 1Q8UA 5K5XA 5LJJA 3BL9A 4BDKA 5J1VA 4YJOA 5JN2A 3JR1A 2PVLA 3FLZA 3R8UA 1R78A 3H9FA 4HVHA 2QU5A 3UVQA 2VTAA 1LP4A 4S31A 1F0QA 1ZMUA 4G2FA 4UB7A 2JDTA 3OY3A 5IU2A 1NVRA 5B7VA 5J5SA 3ZCLA 1F3MC 3EQCA 4PMTA 4EHZA 3MPTA 4L3PA 3W0NA 4WUAA 5FM2A 3HRBA 4ZOGA 3MIYA 5KBRA 1ND4A 2HWPA 3OP5A 1JVPP 3PWYA 4L9IA 2W4JA 2JLDA 3NYNA 3CXWA 2VO7A 4FSYA 5JH6A 4DG3E 5BMSA 2QOKA 2RFSA 1W0XC 3HX4A 3L8VA 3QTWA 3TT0A 3QYZA 1L3RE 2CHLA 3UIUA 2QONA 3VQHA 4QTEA 2VTLA 1Q99A 3P08A 2W1HA 1PYXA 3F82A 3BKBA 5TE0A 3R8MA 4G31A 1H0WA 5I4NA 3OHTA 3NW6A 3FXWA 2HYYA 5EM8A 5HG9A 1OITA 2QVSE 3FLSA 5HNGA 3RPYA 4ENYA 3IPHA 3OUNB 4F78A 3GEQA 4AGUA 5F95A 3ZC6A 4YC8A 4BGHA 2VTHA 3SAYA 5EDQA 5L2SA 4KBKA 1FVRA 4O6LA 1XBAA 3W8QA 5GJFA 3RPSA 2R3JA 1P4FA 2ZDTA 2AYPA 3LLTA 4YJVA 2C6MA 4O7SA 3BWFA 3HDMA 4EWQA 4E5WA 3ATSA 2W1GA 3ZUTA 2XB7A 3C7QA 4QP8A 3NNWA 1JKLA 4TN6A 5EYMA 4WA9A 4ZTQA 3EFJA 4L3JA 4QQ5A 4JIAA 4USDA 5CEKA 2B9HA 4JMQA 3KRXA 4DA5A 4BCIA 5CU2A 3Q9YA 3OXTA 4XCUA 3WE8A 4EBWA 4IEBA 2W17A 4M66A 3R8PA 3O23A 4H1JA 3LMHA 2O65A 2ZV8A 1R0PA 4FSNA 2VTSA 4YMJA 4ZTHA 5LVOA 5CYIA 2Z7QA 3T3VA 3ZMMA 3HV3A 1Q4LA 3H30A 3R1NA 4CQEA 4A4LA 5K4IA 2ITWA 3BEAA 1XBCA 4AUAA 2PVYA 3ALNA 3LMGA 5HE3A 3OBJA 3R7IA 3NUSA 4ZY4A 4HNIA 4MH7A 5CEIA 4AAAA 4U97A 4QTAA 4IZ5A 4TWCA 2XVDA 3GP0A 3L9NA 3QD4A 1TVOA 3PXZA 1Y91A 3W10A 2RFNA 4RJ6A 4O83A 2OIDA 2IVTA 2OZOA 3O50A 2NYAA 2XUUA 1A9UA 4FTNA 2C6EA 2XEZA 3DCVA 3E8DA 4CRLA 4PP7A 4ZMFA 4F9YA 1PY5A 4HGEA 4CNHA 4RT7A 5IMEA 4DBXA 5HNIX 3A7IA 4OTFA 2WMTA 4MVFA