3LMJH

Structure of human anti hiv 21c fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
225
Chain Sequence
QVQVVQSGAEVRKPGASVKVSCKVSGFTLTGLSIHWVRQAPGKGLEWMGGFGPEENEIIYAQKFQGRVSMTEDTSTNTAYMELSSLRSEDTAVYYCATGGNYYNLWTGYYPLAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a clade C HIV-1 gp120 bound to CD4 and CD4-induced antibody reveals anti-CD4 polyreactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Heavy chain of anti HIV Fab from human 21c antibody
total genus 43
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2010-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lmjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lmjH01
5I74B 1AGBB 4LEOA 1NEZA 3REWA 3JV5A 3QFDA 4OM0L 1PG7L 1I9EA 1PZ5B 1X4ZA 1NCAH 5DMGC 1LEIA 1GL4B 5D71L 4TRPH 5EOCJ 1A1NB 1T83A 2EC8A 1KCLA 4JY6B 3QHTC 4FQHA 3ALXA 2RFXA 1A6ZB 2F5BH 5LGJA 1CLYL 4Y16B 4CN6A 5ESVA 5C0JA 3WJLC 4NQED 5KTEH 1A21A 3MA9L 5I76B 2UYLA 4XBGB 1CLZH 1CZ8H 4HXAL 5D1QD 1HK6A 1P4BH 12E8H 1OLLA 4S1RH 3OKEA 2NTSP 4MNQA 2OR9H 3MRIA 4XVTH 4XWOD 4MB4A 4QGTA 5E7FA 2AJYH 1EK3A 2JB6B 4JQXC 4HV8A 4RNRA 5HHMD 5HVFB 1N2RB 3TNMA 3I3EA 5EU4A 2KBGA 3FQNA 2QKIB 3REVB 4XAKE 4X7FC 5SX4H 3O6FC 4D3CL 2NCMA 2VWEC 1P4LA 5C70A 1DQLL 4DN3L 2P24A 3GMOA 4OIBA 1MLCA 4WFED 4MXVE 3KLHC 3LEXB 2PW1B 4JM2C 2IFGA 4S1DC 1A3RH 3ILQC 5BZWB 2EIBA 1C5CL 1WBXA 4DN4L 4H20H 4WUUE 4WWKB 4KI5F 5ISZE 4OF7A 1D5BA 2UWEE 2B5IB 1KGCE 2EDYA 3TJHD 4U1LA 1I9RL 5KSVA 5IROA 3W0WE 5ABDE 5JOFB 1OSPL 3MGOB 3V6BR 5D1QB 4OUOA 1L7TH 4FFWD 3UPAA 1HZHL 3P73A 5JPMB 5FKAB 4QHNA 4MJIB 3GMRA 3IT8D 4HIXL 2OXGA 4MA3B 1WCBB 2A73B 1C5DA 3ESUF 5MENE 2F54B 2M26A 4F9PC 1U8PA 3GKWL 5C09E 4N9OB 3HUJE 1NEUA 4KVCL 2UWEB 1RUQL 2WBJA 5FYJL 3MLZL 4JZJB 2J8UA 3QXAA 4ZS7L 4LCCC 4FNLH 3H3PL 1QKZL 1BQUA 5JOEA 1JYNA 4OGXL 5GRWA 1B4RA 3B5HA 4ZFOB 3QUZA 2BFVH 3TT3L 5TGBB 1YDPA 4GQ9L 4KWUA 2QQLH 5EOCH 3ARUA 4WO4A 3QDGE 2XNAB 4YK4B 1YYML 4JY5L 4K9EL 3ULUL 1J1XL 3PP4H 4CNIA 3L6FB 3CFIC 3MYZA 3QEQD 3FN3A 4M48H 5HGHB 5DA0B 1RZJL 3RIFF 1CICC 4X7CC 2D31A 2EDNA 1HINH 5SWQA 4JKPL 6FABH 1JBJA 4NDMB 3MRFB 1TXKA 2H26B 4FXKA 4OIIL 2VR4A 3KS0J 5GGTH 3BQUB 1H3TA 3WNKA 2VWEE 2AJSH 3MUGA 3IB4A 2AV1A 4DJMA 1VADA 2AP2A 2PXYC 5B8CC 2HRPH 1NBZB 5HYSB 3ULSA 1HNFA 1UG9A 4GKZA 1FVDA 5IB3A 2QSVA 1DBKL 3SGDI 4AM0A 3GI9L 1HCFX 1HSBA 3MRCB 4X6CF 3MLXL 5I75C 4AEFA 1R3IL 1DN0A 3WLBB 4PLKD 2ZOLB 1AIFB 3QSKB 1HQ4A 2PCPA 1L9NA 4FQ2L 1XGYL 3THML 2NY5C 5SWZE 2AK4E 4MAYA 3SBWC 4QF1B 3QFJA 3TFKC 1A1MB 3E8UL 5BRZE 5E99H 1EO8L 3VI3E 1OB1A 1WJ3A 4WGWB 4Y8DC 3BDYL 3MV7A 3OV6A 1FP5A 3O9WB 1AKJB 2WMPA 4AQ1B 4PJIE 4I0PC 4QO1A 4GAGH 4CVUA 4MXWH 3GMNA 5I1HL 3NFNA 3TBSA 4Y5XB 3MLVH 5A1AA 2DMBA 4WO4C 1YN6B 5FKPB 3QCVL 3QXTA 1IKNA 2JCCF 4JRYB 4LLMB 3LZFL 4X98A 5DS8B 1QNZH 2XPGB 4MA7H 1X5AA 4PRID 4IRJA 4J6RH 5EPMA 1HWGB 2FATH 4Y89A 4G6KH 1CL7L 3MJGX 3HMWH 1S9YA 4KXZI 3TC9A 5J3HD 4FQ1L 2Z0BA 3OGOE 3MNWA 2VDNL 5EOQH 3P4MA 3LMJL 2PYEB 4P57B 5EC2A 5BV7H 1YMHB 4O58L 3G5YB 3FRUA 3HC4L 4WI3A 3CIQA 1PVHA 1UC6A 4JN2A 1YN6A 4F80A 5JW4M 4MJ5A 1CXIA 3O6MH 3MV9D 4KJYB 4AIZA 3OKNA 1FQ9C 4HT1H 4K94H 3GK8L 4NKOA 3S36X 2ZCHL 3LN9A 5DJ6A 5AZ2L 5C92A 3LDBC 1MPAL 4XP6L 1JI2A 4BQCA 2HFTA 4FTVA 5C08A 1UWXH 4JJ5A 5E2WH 5E2UH 3IXAA 5HGGS 4POZC 1TVDA 2H1PL 5L8JB 3V7AG 3MPCA 3MRJB 1NUFA 4U1JB 4WTZG 1IC4L 1AIFA 1VCAA 3QNXB 4HK3N 4WI6A 1KPUB 5CP3H 1U3ZA 4KJYA 4DTGL 1HHHA 5DK0B 4XRCA 3EYSL 3NIFF 5IQ7H 3FHQA 3BP6A 2YUZA 3KPQB 1Y6KR 2WAHA 5CGTA 5DSCB 3GJEA 2X09A 5ALCL 2C3VB 4GAFB 2ARJA 3M8OH 2EIDA 3KXFB 1OTSD 5KSAA 2D03H 3IKKA 3NCEB 4GG6F 2VLRA 5EULV 1UEYA 4Q2ZA 1S7WB 2GTZA 2IH1B 2D7PA 2OP4L 3LS4L 1FDLL 1I8IB 2CLRB 4DKFH 1D6EB 5C9JB 3FQRA 4ZUUA 4JKLA 3N9GL 5D4QA 2R0WL 2V2TA 2FZ3B 2W9EL 5DD0H 3IGAA 2BSSB 4JB9H 3NH7H 4OZGF 2X89A 4P5TA 3DXAB 4FXLA 5I19H 5F9DC 2NXZB 4HKBB 1X6NA 1YEDB 3MODL 4NRZA 4R7NB 5IJVB 3TJEL 2WWMD 1KTDB 1JNLL 2FECI 3V8OA 4FN0A 1QFOA 3MRQB 3HE7B 3X3FH 1RPQA 1YEKL 2JJTC 2VRAA 3EJZD 5D6CB 4N0CC 3GMQB 3HRPA 3OGCA 4Y4KA 1YEIL 1XF5A 5C0CE 4PJ9B 1G7JA 3SOBH 3MO1B 4GXUN 2EEAA 4NBZB 1J8HA 5TH2B 4HFUH 1K5NB 1PFCA 3FFCA 4Z7QF 1QZ1A 3DVIA 2HVJA 3LN4B 4JQVA 2N1KA 3R4DA 2YKLL 4L5FL 3IFNH 4Y4FA 5J6GA 3VXTB 1XCQA 2X1XR 1PG7W 1EH9A 5FGSA 1N64H 1T80A 3HNVL 5ANME 3H9HA 1FSKB 4U2ZA 5I8EB 4ISVA 1LK3L 3ME0A 4WO4B 1BZQK 2X4NA 3C5ZD 1JNJA 5ITFA 4OCYL 5DJDA 3G6AA 5AEAA 1N2RA 2YK1L 2RGSA 5EUKA 3SKNA 2EE3A 4XMKH 5F9JA 3VXPA 4YGAB 1E0OB 2VLKE 2FYYA 5EWIL 5FO7B 4BM7A 5IHZB 1JGVH 1IGFL 4HW6A 4YHLH 4OCNC 4KK6C 5B39B 4NQUA 1N3NA 5E5MB 5C86A 3O0RL 3MV7E 2JTDA 1GCFA 2W0FA 2B2XL 1LDPH 3IDIB 5DD6A 2CXKA 1JI1A 3UTTD 3KPLB 5I74C 4MQSB 4K3HA 5KVFL 1J8KA 4NGHH 1F4WH 3FO0L 3KPSB 5BXFB 5CD3B 1GGCL 1UZ8A 4UQ3B 4N5EC 5IHUH 3F12A 1P7HL 4K8RL 4NKMA 3PWPD 4RAVA 4DGVH 1BVKB 3BMVA 3ULVC 5H2BB 4TOYH 3GJFA 3KYAA 1NEZB 1HH6B 4X4MA 2XTJE 2KZ1B 4GMTL 5C0AE 3PWNA 4WDIB 1FNGB 2CRZA 1I8LA 3QIWA 5IT2H 2AXJA 4MYWB 2QL1A 4TVPE 4MJ6B 1HDMB 3CNKA 3VWKC 2BSTB 3O3DA 4GBXB 3TYGH 4ZQKA 2VH5L 1R5IA 2V9TA 2W0KA 4HZAA 3IDJA 5DD6B 1P84K 2AK4B 1C5BL 1A6PA 3KGRA 1DQQA 1MWAH 1QP1A 5CSZA 2IBGA 4JRXE 2JLLA 1J05B 4RFOL 5E1HB 4Z7WF 2CLZB 3LOWA 1TZIB 2VN4A 1NCAL 2JIXD 1FVCB 1OAXL 2DQGL 5C7XH 2WK2A 3BVNB 5K9KA 4UAOB 1A7QL 1JZ3A 1FVEA 1AI1H 4MGXA 4U1KB 5F1IB 3TWCL 2F5BL 4MJ4A 1HILB 3D25B 5EZOL 1OWRM 2FO1A 3D39B 5I1KL 3H0TB 2P8MB 4PJXE 3GO1H 2AI0H 4TQEH 2V7NB 2W59A 5AUMB 2P42B 5EZLA 3FOMA 4UNVA 1TJIH 2FWOA 6CGTA 4IIQC 3SHSA 5KVDH 5HYQB 3CSYB 3ZMRA 1MVFA 4OD1H 1QLEL 2CR6A 2J5LC 3KLHD 2LAGB 5E1AB 3CDGA 3E3QC 3HNTH 5HHVH 3TZVA 2FJFB 4P2QE 1U3HA 2F8OA 4CVWA 1V8HA 3L3IA 1DUYA 5T1DL 5ACZB 2R23A 4LNRA 5J6HA 5I18H 3G9AB 3RZCA 1G7LA 3X17A 2DQCL 1QA9A 4I77H 4O4YL 3HI5H 2WUCL 4U49A 5ESQA 3GSOA 1TVBB 2ADIB 5DZOA 2RR3A 2X4OB 4N1EA 3WDHA 2C4FT 4Y2DC 5GRVL 2WM0A 3RKPA 2R9HC 3QB7C 2XZCL 4QHKJ 1OARL 35C8H 4L3ED 5D1ZD 4HWEH 4C56B 3ZE1F 5B8CA 1FJ1A 2Y23A 4LVEA 5ENWB 5HVHB 2AJXH 3ZL4H 1NC4D 2Q76B 5EIIA 4I2XA 2FEEL 3BDXA 5J13C 5BMFH 4KMTH 3DX6B 5FYKH 2YRPA 1FV1B 3O11A 3WKML 3QNZB 3WLWD 4ZO9A 1RK1B 3BW9B 4GLRI 1CDCA 2E8YA 4O02H 3VCLB 1U91A 4JFDA 4Y4HA 3QAZB 1ZWIB 4JKWA 1T6VN 4OZIB 3L3KA 1H5BC 1IGIH 3CZJA 4YE4H 1AH1A 3GSOB 2L0DA 2E5EA 3ZKXC 2E3VA 1F8TH 4ORGB 4KJQC 5KSAC 1TETL 3ARBA 4ONFH 1BD2B 4XX1G 3UBXA 4TUKH 5DJ2A 3QJHA 5H37G 1EEQA 1ADQA 1MJJA 3BP6B 3SGJA 1KENH 1NAMA 4O5LL 3FN0L 3HFML 1L6ZA 1NDMB 1T3FA 2PNDA 5LG1A 2L7JA 4G5ZH 1M71B 3TH4T 2XZQH 3AS3A 5ICXB 3MGAA 1UCBH 3O6LH 1ORSA 3DOSA 4FXGB 4ZS7H 1D5XB 2W65B 3PDDA 2PW2A 1GGIH 4JJ5B 1ACZA 1S5IH 1T5WB 1Y6MR 2GJZA 4Z7VF 3WYRA 3NCYP 3OB8A 1D5MA 3KPPB 3JXAA 4E9LA 5D70H 1W8NA 5DVKA 3EBAA 4HXBL 5KANI 3MV9E 4GQPH 2HG5B 5DGQA 1QQDA 5DQDL 4ELKB 5GS0C 5IKCA 4W4NA 3GSNA 5I1IH 5IWLA 2NXZC 4BKLB 3C8KA 2EIZA 1IGJB 4YZFE 3VI4E 3O6FA 1DQQB 3MRBA 3MUZ1 3HR5A 5L2KA 4OKVA 1CLOH 1U93A 1S9YB 2HP4A 4X4XB 3HRZB 3BDYH 3IVKB 3BXNA 2UZIH 2QLVB 3A67H 4BH7A 1EZVX 2AABL 5CINH 3VWJC 1FNGA 1UQSB 3ULUC 4HS8H 1EJOL 3RX8A 1KT2A 3SDDB 3WL9A 5DJZA 5BW7A 2ADFL 3GRWL 3W82A 1XGRA 1ZLVH 4IOIB 3N1FC 4TNVF 4PJ7A 2EIEA 3PNWA 5SX4I 3L3GA 4NQDD 5CMAA 3O9WA 2ZSWB 3D87B 4PJDB 3AY4C 4JO4L 2GT9A 1VEPA 3GBNL 3MRHA 4E41E 3LV3A 3HLAB 5F88A 2OMNA 3MFFB 1RFDL 4N90D 3BSZL 4I0PA 1G1CA 4MAYB 5CKAA 3J8F7 3IJSA 5L9DH 4ELMB 4GRLA 1KPRA 3VD5A 2OZ4H 5GHWH 5D1ZC 1RZFL 1K8IA 2VXVH 3TVMC 4K7PH 4I3SH 3VFPB 1NCBL 4EOWH 4YWGH 2EYTB 2EC9T 3C8HA 4PJFE 1KJ2A 3DYMA 1YYLL 5BQ7B 5F6HJ 4X6EA 3T4AB 3U2SB 2FR4A 2D0HA 4JPVL 2IEPA 2FATL 3W39A 4JZNB 3WFBH 3QDAA 4AT6A 4OM0H 5KG9A 4PY8I 4G6JH 1NGQH 4Z7UE 4WHCA 1EEZA 4OLUL 5CUSL 2YPKA 1ADQL 3RWGA 5F8QC 3VXTA 2BOBA 4MNGE 1R3HA 3QI9A 2B1AL 4N1CA 4X6DA 3W9DB 5JW4Q 3K8MA 4YZFF 3VI4F 2ZSWA 4PJDA 1RU9H 2YUWA 3MRDB 1NMBL 1A6UH 2LU7A 2FB4H 1GAFL 2J7LA 3CXDL 4JQVC 4RIRB 4X9IA 5ADPH 1ZA6A 4LLVA 4OQTH 2R56L 3QWOB 1CDJA 3ARYA 4D9LL 5CGYD 5FHAH 2DB8A 1MPAH 4PJAF 3D3VA 4AJ0A 4UOW0 4JFEE 4KFZC 5E00B 2IFFL 3BYTA 4XBPB 5E2UL 5HPOA 2R9HD 4ZPTB 4NSKA 2P5WD 3VH8G 2OLDA 1AY1L 4GSDL 4JN1L 5B8CB 4JZJA 1TCRB 3MLYL 3UC0H 4U3HA 4G7YH 2Y5TB 4M7LT 4ODBD 1SJHA 5GGTA 5E8DH 4X7EC 4N9GA 5EU5B 3CMOH 1I8KB 3C5JB 1C5DB 5I16B 1PGRB 4QRTA 4WW1A 1F58H 3MRBB 4FZ8L 3O2WL 1BFOA 3O3BA 5T3XL 5TQ0L 1AD0B 1E4XI 4TN9A 4P5TD 2CO7B 2DQFA 3DXAD 3HPJA 5CEZE 5I19L 1G84A 5DRZA 1NDGA 1UB6A 2FHBA 4IJ3B 3RI5K 5MENA 2X6MA 5IB2A 3DWTA 4Z78B 4PYGA 3V0WL 4U4BA 4U1LB 5KSVB 1HXMA 4UAOC 3WNLA 2VXUL 4QHMB 1VFAB 1NUNB 3HA0A 4G42B 4XWOC 4NUJB 1JHKH 1ED3B 2R8SL 4RFEB 1IQWH 1SBBA 5I1EH 3MJ7B 4PJGA 5TPWH 1A2YB 3SE9L 1PYWA 3ARTA 2E6JA 3F5WA 2BVOB 2XWJB 3DRQA 1NLDH 4IRSC 4MNQD 1U8OA 5EU6A 3SGDH 3U6RB 3IFPA 3EIFA 2APXA 3SGKA 4MAYD 4HFUL 3BOVA 4EUPG 1WAAF 1HE7A 2GEEA 3TT1L 4NNPL 4GW1A 1QD0A 3TNMB 4P2OA 3O41B 1CFVL 1G0YR 4LFHD 5DFTA 3BVNA 1I1YA 1NGXA 2HRLA 2V9QA 3N85L 4RGNB 5BCAA 5T3ZD 3RPIA 5FCSH 1D5ZA 1ZT7B 4WW2B 5HHME 3RWFA 5IMLB 1U95A 2N4IA 4CAGA 1QFWM 4XPGL 4JQXA 1M1SA 5D7LD 3IDJB 2A77H 4U2YA 1TTGA 3IXAB 4M00A 1JK8A 3OXSA 4G8GA 2O26U 1I7RA 2CD0A 1S7SA 5DVLA 2YK1H 5IR1B 2JJUA 2D2OA 3H9YA 4AIZB 3QEUB 4OLWL 4ONGL 3DO7B 4FG6C 2PTTA 3X12B 5D2NC 3WDJA 1IAKA 2ZOKA 1ZMYA 4J4PA 4LAQL 4C59B 1HHGB 1RHFA 5IF0A 5BZDB 4EXPX 5KAQG 3UTSE 1FJ1B 3GI9H 4L4VE 5HHOD 4JGUA 1N6UA 3MMEB 1KN4L 4OGYH 1JE6A 1MI5A 3NTCL 5A2IH 4JFDD 2CDFA 1K8DB 2HKFL 1OAUH 3DROA 4IRJD 1NCUA 3SGKC 1S78D 2CRMA 1HKFA 3HUJA 2A6KA 4K8RH 5HGAA 2XPGA 4OF8A 3FQXB 3LHPL 3O2VL 3B9EA 1D6VL 4LK4A 2XZZA 4HKXA 3I85A 4TSCH 4XZUA 1FIEA 1U2HA 3MRMB 3NN8B 1U8MA 5K9QG 4PJ7E 1OCWH 4OFYD 1BD2D 2BY0A 4XCNA 5DJDB 2NQCA 4HUUA 3RX7A 1JPSH 4IIQB 1QLRA 4WWKD 1XR8B 5ACZA 4JE4B 2DI7A 4XPTH 1CD0A 2P5ED 1OW0A 4RQQA 2GTWB 3BUYB 4NGHL 5IW6A 3VG0L 4D2NA 5CHNB 2JJWA 3QWRA 5D7IA 1S7RB 2HTLD 3P77A 1U8IA 3CSGA 4LBEB 2W38A 1AO7B 4ZUWA 4G8GB 5I8KH 2DN7A 2PCPB 4PP1D 1FN4B 4HUWB 5SWSE 25C8L 2HTKD 1WZKA 5IHLB 1MLBA 4TOYL 4PB0L 3CUPA 4FHBD 4GMTH 3ZYJA 5DD3H 2GJ6D 2XN9E 3CCHB 1JTOA 1F4XL 3HPLB 4LSUL 5HYIA 2KL6A 4PJCA 3GZKA 5DQ9A 4HG4K 1WEJH 1G7LB 3RBSA 3SDAD 1P4IH 5C0GB 1KXQE 1ERNA 3HC4H 1A3LL 5LGHH 1O0VA 3I50L 2EDEA 4HAFA 4NJAL 1IEBA 5C0CB 1CU4L 3KPOB 5J1AA 3X3GL 4HUWA 4XPBH 3ZKND 2B39A 4OD1L 3VFUA 3AM8A 3OJDB 4F15B 1K4CB 3IAQA 1XEDA 4G9DB 5C0EA 3GK8H 5HHOE 3TBWB 1S7RA 3P77B 3ZTJG 2CGRL 3K4DA 5GRJL 2BSTA 4LFHG 3DVGA 1ZHKB 3CX5J 4NQEA 4BYHA 3KPMB 2ED8A 1YEDA 4RFEA 3T2QA 2JCCB 4XPHL 3MOQA 3PQYB 5I18L 1MCEA 1V3LA 1CIDA 4NT6A 4CJ0A 2DQCH 1RZ8A 2MOVA 1WUNT 1HSAA 5FV1L 4MQXC 4PJEB 3IU3A 2L4OA 3WUWA 2AXFB 1U8MB 5FEBA 2BSSA 1H8SA 4LSQL 4YEFA 4O2EA 3TVMD 4J3XA 4LGPB 4Z78A 2YRZA 1U8NA 1GC1L 3VFWB 5C9JA 3NAAL 4K7PX 1UZ6E 1NGPL 3EZ8A 2BERA 3I02A 1MCPL 3S4SG 3RWJB 3T0WA 5C3TA 3S3SA 3MJ9L 4PRIE 3C5JA 4WUUD 5FECA 4ZOEA 2AGJH 4MXVF 1KC5L 2XG4A 3TO4D 2HJKA 4NP4L 3V52H 3ZL4L 2FL5B 4KVNL 3HZVB 2GAZA 3KLSA 1KLGB 3VFGH 1PLGH 2WUCH 1MFNA 4GKNA 2DQUH 1XGTB 2B0SL 3MV9B 4GKSA 3HAEG 3HC0B 1HH6A 1EEYA 2Z93A 4P4RB 4POZD 4OBRA 3QNXA 3H7LA 3UTQA 2A83B 2IH3B 1KCSH 2BNRD 1E4WL 3QO0B 3FRPA 4XAWL 4LLWB 1QVOA 1Z5LA 3ZDYF 4BZ2H 4FQCL 1YZZA 1LE9A 5CJBA 3D9AH 3BPLB 1QBLH 5C08B 2P7TB 4LOUC 5B3JF 4HGMA 3KPTA 3QEQB 1ETZB 5J6GB 1H3XA 3RJDA 1IQDA 3B2VL 1WWBX 3EDKA 1BWWA 4CW1A 3EZJB 4TULL 5FO9B 1D5ZB 4GBXC 3FN0H 3HFMH 2FGZA 2ILLA 4M7KH 2IPKA 3O3EA 1U0QA 3E6HA 4P9HC 1PX3A 4KUCF 4HJ0C 3VXPB 1KLFA 4K3DH 4HMCA 3G5YA 3G6AB 2XKSA 1AGFA 1YMHA 2AJVH 2X4RB 3I6KA 1MHCB 1F4HA 4JHWL 4PJ8B 4EI5D 4PJ5B 2VE6B 5TQ2L 1ES0B 1MIMH 4Z0BH 2ORBL 5HDOA 3KJ4B 3QQ4B 3F58L 1S5IL 3TA3B 4HQQL 3C9NB 5E4EC 4FFVD 4ZFFA 3H9SD 1I3VA 3T2NH 5L2JB 1KOAA 1RJLB 1KENL 3CPLB 1DVFB 5IMKB 4HKBA 3HNVH 3MCLL 1JGDB 3AB0B 3RX5A 4ERSL 1U3HD 2N7BA 4XX1E 3DGGA 1KGCD 2QV2A 2YC1B 4I0CC 3DARA 3T2OA 5TE4L 3FFCB 2NXZD 1UCBL 3CX5K 1RURH 1RHHA 4Y19B 3QZWG 8FABA 2LV4A 3DSFL 4KRPC 3WN5B 5TDNB 2V5YA 3HI1B 4I5BB 4TVPL 3LQMA 5C0BB 1RQ5A 5F7HA 1MNUH 4M93B 2UZIL 1I1FA 2DD8H 2JK5B 1IKFL 3VXUE 1CD8A 2GJ6A 2NX5A 3O0RH 5D70L 2ZOLA 2A9NL 4NFDA 2EYSB 1IGTB 3LH2H 5HVHC 3QDME 5I1IL 1I1AA 3HR6A 3S3PA 2BX5A 5C0DB 3C09B 3VXME 2VDLL 2VLJE 4NKIL 4KXZH 1CBVL 1A4JB 2HG5A 5IKCB 1KG0B 2DJUA 2BVQA 1UCTA 1AC0A 2GJJA 1RFDH 1IC7L 2V5MA 4H1LH 2MTPA 5F71A 2DOCA 2X7LA 1WIOA 1CDHA 1IM3B 2Z91A 5T3ZL 5IHBA 2BOBB 1I85C 3VMNA 4KJQD 5KSAD 2J3SA 1FZKA 1FZMA 2VXVL 5ICZA 1EAJA 5E2TH 3NVQA 3R1GH 2F19H 1LE9B 2DI8A 4EOWL 2K7QA 1JHLH 1QVOB 1AFVL 3BGFC 4I18A 4HWZB 5LBSH 2XNAA 1MWAL 1JZ7A 1UM4H 5I8OH 4HDIA 4L29A 1O7SA 3RPIB 4OLYL 2A6IA 1SBSH 2J8UF 4LRNL 4G6AD 2HLAB 4I1NB 2X5PA 4LLAA 1YNLH 2ESVE 4ZG1A 4PGDA 1ZLUK 1CK0H 3HI6L 4PRDA 4RGOH 3QQ9D 1HXYB 4PJ5D 4JFQB 3GO1L 5EORL 4M62H 5DMIH 3HLAA 1QBBA 1KCRH 3JV6A 4R2GD 4PJGB 1GAFH 5F1KC 2WQ8A 2ADJA 3BGAA 2GY7B 1CQKA 1QLEH 1IGYA 5FHAL 5IVXE 5D1QA 4MX7B 3DBXB 2OJZH 1P1ZB 3ARRA 1MRDH 1E6OH 2XTJB 4PTTA 4JRXB 4WHDA 1BQHG 1T0MA 1PKQB 1CFQA 1AE6H 2P4AB 4NWTL 4YBQD 1GYAA 1LVEA 1ZVHA 4K94C 3UZEA 4XNXL 1BOGA 3DVGB 5KVEL 3DIFA 4NYLB 2NY5L 1JPGA 1WC7A 4QF1A 2WWKO 1A6UL 2I24N 3G08A 4MD5B 4PRDB 1CVRA 3VA2C 3IF1A 5MI0B 5GXBB 5LWYL 4XBPA 1YNKH 2YD2A 3S88L 2OBGA 4Z7NE 3GIZH 4GH7B 3BKYL 4K3EL 4KJWC 4A6YH 4UU9A 1C1EL 3MRIB 2F15A 5DTFB 3OKEB 1FNSL 1OD7A 1ONQA 4WUKL 43CAB 4H25B 4AQOA 3L3IB 1AC6A 2ZP0T 5TDPA 5E4EB 3TLRA 4JKKA 4R96B 4LU5H 5BMFL 3FQUA 1FNHA 3L3OB 2PETA 4FZ8H 3SE3A 4R7DA 1EGJA 1ZTXH 3U7YH 1OAKH 2VR5A 4FXGA 1A14L 1AO7A 1I1AD 4HPOL 2XOTA 4TUJA 4M7ZC 3TT1H 5CP3A 4JY6A 4LKXA 2BZDA 4JPKH 4Q9RL 4KKAC 4FABL 3AREA 3CJJA 2K7PA 3CFCL 4P2QA 3HC3H 1NBYB 3PE9A 3I6KB 3MRCA 3FQWA 4K23H 5CP7A 5LCVL 4HUUB 2CIKA 1DBJL 4XHJD 1LQSR 4P23C 4X6EB 5JW3L 3IAPA 2VDPH 3RVWC 1Q9LA 1IQWL 5DJXA 3HMXH 2QR0B 3I6GB 5EOTA 3EOTL 1FG2A 5DD5L 4OLZH 3VI3F 4TUOA 1C08A 2BOCB 1K8IB 2G5RA 4KY1L 4OZIA 1EMTL 3FONB 4M6NL 4NM4L 2YD4A 4KRLB 4NQDB 2JK5A 2F54A 3ARFC 3VXUD 3GSUA 4ZNEE 1WCBA 1IAII 3MBEB 3QI9D 2EYRA 3QHFH 4MJIA 1JGUL 4NUGL 3QNZA 3RVVC 2BVPB 8FABB 3T1FA 5IESH 1L4IA 2R4RH 4UV4L 4HGWB 4WJ5B 3IFLL 5EBWB 2P8PA 4HK3J 4HCRH 4KJPC 4BH8A 4KK6D 4ZFOA 1XH3B 4UTAH 3GMMA 5M95B 1YJDH 1F90L 2D7NA 3BE1H 4I4WA 3C5ZB 3RVWD 4PP2A 1OP5H 4DCQA 1A3QA 2QQQA 1IBGL 3S34H 1P9MC 3D48R 1MHPH 4O2FA 5HJ3A 5HD8C 5I1DB 1IC5L 1XCTB 4E41D 3BI9X 4LARH 5IVXB 1MSPA 3WLWC 4R8WL 4YHYB 3MQIA 3V5HB 1KFAL 5L7XH 3SKJH 1F6FB 3JV4B 4PJ5A 2AXGA 1IAIH 1IGMH 4KZEH 4U33A 3VXMA 2AABH 5CINL 1E4KA 2AVGA 3RIAF 3P4OA 2ZWLT 3SKUD 3I6LE 1I7ZA 5DUML 4M8QA 2XZAH 3QG7L 5L88H 1OGAB 5JO5B 1EBAA 1BGXH 2W1NA 1H0DA 5IFAH 1ETZA 4FTVE 1U8OB 5EU6B 1JNHB 1B6UA 2FEDD 2VZUA 1MCQA 4JO4H 4DVRH 5EU6D 4OFIA 4NKDB 4XXDA 3O2DA 1WAAA 4PFEA 5FCUL 3EYQC 3CFKB 4F7MA 1A6ZA 3JWDC 1F4XH 1KJ2H 2BVUA 2HJFB 2XQYK 5LGJB 1TTUA 4X80H 4ZOAA 3FQNB 1JPSL 3OKOA 5C0NC 4ZXBA 1F4YL 3ZO0A 3VMOA 3UYRH 4PB9L 3ZKNC 4PLOB 3N1PC 3I2CL 3GSRB 4PRPE 4C4KO 1DQML 3A6BL 5SWZA 3WXWH 4JG1L 3UBXB 1T03H 1DL7H 3QHZL 3U0TA 4AEIL 2A0LC 1P9MA 5I8KL 3ARGC 4OFKA 3U1SL 2Q87A 2D0GA 4XP4L 3WIFA 3STZA 4JFXA 4P4KB 3NFPA 3VXNA 3MOAH 3ARGD 4HF5H 2ED7A 2WLZA 2P5WE 4XCEB 2FEDC 4EIZC 5IIEB 5C0BD 5I1DA 3LSOA 3PWUB 1EFXD 4IMLA 4Y8AA 4XP5H 1HI6B 2BNQA 3HCVB 5L8LB 4QXUL 1GGYA 4KDVA 4G6ML 4NCC1 5CGYC 1GZQA 1P4IL 1RK1A 3FO2B 3W9EA 4JHAL 1A1NA 4Y1AA 1A3LH 1CLCA 3LKRB 4C54A 4DWHA 3QQ9C 2HTLC 1B0WA 2EE9A 2OL3A 4OJFH 3O4OC 1CFBA 3QH3A 1AGBA 4LEOB 5EIIB 4XPBL 4KDTC 3F12B 4S10A 1JZ6A 3MJ9H 5E8PA 3U36A 1D6EA 4XNUL 1BFVL 1PG7H 1TZHB 1IILE 4YPGA 3VH8B 2DBLH 2IFFH 5H35B 1QBML 4PUBH 4TRPL 1CXEA 4UT7H 4L9LC 3QUZD 3I75B 4NNXA 2ZZUT 5F3HA 2X4PA 1MWAA 1IM9B 4OZHB 3WEXB 1W72L 2PTVA 3JWOC 2XKUA 2VLKD 3V4PH 3BWAB 1VB9A 3R06B 2YPLE 4JR9H 2F9BT 4XTRC 3S35L 2CIKB 1KJ2B 3BZDA 4POUB 5GPRA 1EXUA 5T1KB 4XVTL 1HHHB 3W11C 5F7FA 3ARQA 3QDJA 3JBG7 1KJVB 1C12A 3CDGB 1SJVA 4OTXH 5C0IA 4FG6D 5IR1A 1SEQL 1VFUA 5CD5C 4JFZL 3O9WC 3WNNA 5JIIA 5JXAH 5HYQA 2R8SH 1DLHA 3BJ91 3VFGL 4I9WD 3WSQH 3NABL 2Z8VC 3LV3B 4LDEB 4GFTB 3IS1X 5KJRH 4NHUA 1A7PL 1LO5A 2EDOA 5HGBB 1JRHI 1RZIA 1XIWA 4PS4L 5JW5B 5ADOH 3W2DH 3WN5C 4FZEH 5GGVY 1N5YL 4V2CB 4F33A 3QI9C 4P3WA 3VMPA 3FT4A 5JUEL 2AJVL 2HN7B 3C5ZC 3T0AA 4JHWH 4CMHC 4IDJL 4MCYA 3VG9C 5I73C 1CFVH 2NY4B 3MO1A 4M6MH 2J1KA 1LWRA 4ZNEA 1EGJH 1I7TA 1FCCA 4ONHA 1H3UA 5JHLL 4K55A 4M5YH 4XNZC 4NQSB 3B2VH 3U6RA 1UWXK 1BOGB 1A2YA 1HN1A 2YWZA 4L9LA 3NPZB 1MJUL 3I6GA 4K3DL 2BJMH 4S1QH 4JAMA 4XNMA 3IU4H 3BHBB 4G8GD 1HNGA 5IVOA 5AD0B 3CDCA 5A40E 5E9DA 3ISWA 3M45A 1PKQA 4K2UH 1K6QL 1B90A 3C2AL 4JM2B 4PTTB 2VLLB 1Z2KA 4LPVA 4TVPH 3B43A 3OJVC 5I9QC 1VGEL 3GB7A 1BD2E 2DD8L 1IKFH 4HJ0D 1PQZB 1ACYH 2V17H 4PJ5E 4Z7OF 1JL8A 4IHOA 1I7RB 5F7LB 4YDKH 3QFJB 2OL3L 2OTUB 5DQJB 4QT5A 1JF1B 2XFXA 2A2QT 3ULVF 3W0WB 3DVFA 4WW2F 1KELL 4HBCL 1J1PL 5EU6E 1ORSB 2Y5TA 1I75A 5E5MA 2FIRT 1SJEB 2VXQL 4M5ZH 1ZHBA 1IEHA 5B39A 5IMLA 3RDTC 5ISZB 5K9JH 4I3RH 4F37K 4RGND 2W60B 1X7QA 2XN9D 4OCLC 4S1SH 3SKNB 1XF2B 3S5LB 3VRIA 4WV1A 3SDAA 2AV1B 5D5ME 3MR9A 3DMMD 3IF1B 5EIQA 5EA0H 2Y36L 4H26A 2Y06L 3VDCA 1TZGH 3FO1B 2VISA 3IDNA 2XFXB 2HFGH 5GRUH 4ZAKC 3QUMB 3LH2L 2DTML 2XTJC 1CR9H 1OTTC 4FTVB 3VG0H 2CLVA 3UO1H 4NQCE 3ZDZF 2UVEA 1MRFL 3MJ7A 4J3SA 1VFMA 3O4OB 4WEUD 3QWRD 3EOBB 5D8JL 5BJTB 1X5ZA 4X6FB 1JRHH 3W0WD 2WANA 4LKCA 1RMFL 4PJFF 4LHUG 4LF3B 2AJ3B 1AGDA 1VKXA 5EH1A 4PRHB 4N1HB 2MPAL 4QHUA 5E0QA 1KB5H 4MQXD 2YPVH 4UDUB 2Q86B 1CTOA 1RZKH 2A74A 2XICA 5EO1B 5CCKH 2VAJA 2LTQC 3SDYL 3TCLA 5F88B 3UPRA 1N4XL 5INDB 1I7TB 2ADIA 3EO1A 2MCPL 5JQ6H 3RNQB 1ZVYA 3DECA 4GRWB 1J0JA 3D39E 3KLDA 2AJUL 1UKSA 4M1DH 4O2CB 5GS3A 1K85A 1EZVY 4Y19D 3F7PC 5BOPA 4RMRA 5JOFA 4WJ5A 1YMMB 1XIWB 1J5OH 5EU3B 2EYRB 3MBEA 4X4ZA 1FYTB 1T66D 1RJLA 3GSNH 4QNPF 4JKMA 1OGAD 5BZWA 4WCYL 1DLHB 3QA3A 3BXNB 4L8SB 4JFFA 5C07A 1T04A 1QSED 1U93B 2Z91B 1UWEL 4YX2H 3I3BA 3RY6A 3WLBA 3HR5B 5GSVA 4ODUB 1Q94A 2OR7A 2VE6A 1AE6L 5EO9A 4PJXB 2X4RA 3UJIL 3L7FB 3X11B 5DJXB 3SDAB 3MV01 1FVEB 4I0PD 3KJ6H 4BJLA 4D3CH 4JFHE 4JFED 3ZDZE 5HHXH 2HT3D 2EYSA 4WRLA 3HG1D 1A14H 3IDMA 3I75A 3ZKMD 4MNQE 4U6VH 2NY0B 4FA8A 5C07B 3ZKQD 3FT3B 2I9TB 2MQ3A 3LKQA 3QEQE 5GGVL 5LWYH 5GJSH 4GRWF 2X05A 4XAWH 1Q9KA 1RULL 4ZQKB 5HXMA 2W65A 1FYTA 4JFYB 1I9RH 1IKNC 4F7TA 2IBZY 1IRAY 1NSNH 3H42L 1C1EH 4KH2A 2PYEE 4EQ2A 1U3HC 43CAA 2JE8A 2LU4A 3UDWC 1KCVH 1F3DJ 5I71B 4X0KB 4TULH 4UU9B 5HI5C 5JXEA 1FDLH 1QR1A 3REWB 3F65A 5IMKA 5JQHC 3U7YL 3VDBA 1EMTH 3ARBB 3BISA 3PDOB 4HHAB 4G80A 4XH2B 4Y2OA 1RV6X 3T4YB 5MEND 3D2UD 1RZ7H 1A7BA 1G7MA 1LEKB 4WHTB 2BNQB 3B9KA 1F6AA 3IVKA 1KJ3L 3KPLA 3LSOB 3MODH 3PWUA 4XC1H 3QQ4A 3QHFL 4OKVB 4MD4B 1M6OB 4JFDB 1U91B 1LO4L 4Z7WB 1URLA 2R0LH 1DEEA 1DBJH 1I3UA 2X4QB 1KULA 3U0TB 3BW9A 4LLDA 3T3PF 1Y18B 4CJ1A 2FBJH 2O5YH 3DX9A 3L7EA 3QG6A 1F90H 5SWZB 3RL1B 4DKEH 4OCMC 1YEIH 4U6XA 1T0MB 1E4XL 4TSAH 1VFBA 3HAEA 3O3EB 4G6FD 3DSNA 4RAUA 3GMNB 1D3CA 3FT4B 4WUUA 1NQBA 1N5AB 4KKLC 3OTTA 4XTRD 4OQTA 5F44A 2N7AA 4DAGL 4OT1H 4YNYB 1NKOA 2HJFA 5GIRA 1NGZB 5I15H 1LHZA 3Q1SL 5FA4A 3DUUA 4HUVB 2VISB 2Z31B 2C4XA 4ZTPL 1IGML 4UV4H 3QEHA 2J5LB 4HULB 2E6PA 3MR9B 3GI8L 5ICXA 3IETA 2AEWA 2LVEA 4OCRH 5HBBA 2X4OA 1V3KA 4N5UA 4W81A 2DI9A 2EH8H 2OQJB 1R3IH 1BAFL 4KQ4H 4BSJA 5DD1L 5IB3B 2F53E 1F42A 3M17A 3HPLA 1EIBA 4FQPA 5I8CB 4NO0D 4OV5A 4JFOA 4EUPH 4ORGA 3S5LG 3MRNB 3ZTJH 4KTEH 5ICYB 3CFEA 2XTJD 1FL6B 3H9ZA 3MJ6A 2X4PB 3V5HA 4YC2C 1BX2A 4JFDE 3MRFA 5E99L 4DGYL 1KFAH 3B8YA 1NC4A 1WFNA 2FRGP 2FX9H 3Q5YA 5AUMA 5EFIA 1I1CA 4GAJL 3NCBB 3O3AB 3GMMB 2AERT 1KG0A 2QTEA 4M7ZB 2VDML 4OCSL 4L8CA 3IJYA 5IBUB 1LO0L 1ORQB 1CG9A 4MA1B 1I8IA 2CLRA 4DVRL 5J57B 2DICA 4L9LB 1UXWA 2VUYA 2D0FA 4QRUB 5CJQL 4AG4H 3QCTL 4KK8C 3SDAC 2Q7NA 1JJUA 1U9KA 2DM3A 1OOAA 5CEZH 3CFEB 1TVBA 4OJFL 4PD4J 5IF0B 3QQ3B 2AEPH 1NC2A 4JG1H 1TJGH 2IC2A 3VD7A 5IGXH 5JIHA 3MGOA 4L8CB 4AEIH 1RZJC 3PWNB 3SCMC 3QFJE 3VGGA 1OD9A 4OGZA 2XIDA 4PP1C 4XNUH 1U6AH 1MY5A 5H2BA 2J4WH 4WO4D 3QIWC 2ENYA 2UUDK 4Y5VA 5BXFA 3QEHB 1HKLH 3V8CA 5KVMC 5I1KH 1NC4B 5C6TL 4ZAKB 4KKLD 4JRYD 5IB5B 4ZO6A 1KJVA 4RQQB 2DQJH 2V7NA 4LEXH 1ZOXA 2J6EL 1N3NB 4JDTL 2VZVA 2CK0L 4GS7B 5I8CA 2ZSVB 2X42A 4RNRB 3H7BB 3GSWA 3L5XH 1YNKL 5E56A 3VXRB 2OQJA 1BFVH 2UUDH 43C9A 5A2KH 3S88H 1S78C 1DBBH 3E6HB 2YD6A 1BQHB 3OB0K 1GSMA 3MLUH 2X4NB 4UI2A 4XBGA 1IQDB 4PJDE 2PYEA 3G5ZA 3KNBA 3WSQL 3B5GA 4YDIL 4PGBB 4TNWK 1IARB 2LVCA 1P53A 4KI5D 5KJRL 2QHLA 2QBWA 5FK9A 3W11D 1FZOA 1SM3H 3B8SA 5HY9B 5EBLB 4IEFB 1OAKL 1ED3A 1ZT1B 5CIPA 4G80B 1QUNA 4G42A 2PUQT 4RFNC 1EHAA 5KSBF 4YDVA 4OB5H 3BH8A 2JJSC 5DLMH 4BH8B 2D9QB 5IB2B 4NZUL 3RA7H 3LKRA 3TIDA 3OG6B 4HGWA 1U8JB 1YEKH 2W07A 3LPFA 4Z77B 4MAYC 4YHKH 1F11A 5JXAL 1NC2B 3ARGB 4YHML 4O9HL 3A6OA 4U05A 1HI6A 3IRZA 5KS9E 1ZGLB 3RBGA 4MD4A 5EU5A 5DD5H 4EVNB 3PHOB 1FYTD 1FGNH 1CDYA 5EUOF 4JRXD 5D6CA 3UTTE 3CVHL 2YZ8A 4M9PA 1NBQA 4LCWA 4O02L 1SHMA 4K2UL 4E5XB 3EJZC 1JYVA 3LIZL 1IGIL 1MY7A 2R69H 2JF1A 1EGJL 4PJGE 4L5FH 4GBXD 3WHXB 2XRAL 1F8TL 3QWOA 5CGMA 1ZSDA 4FQXA 2XG5A 1PBYA 4Z95H 4CVXA 2QADC 3O3AA 2B7DT 1CFTA 4NN6B 1Q94B 2IPUG 1WCQA 2NW3A 4FXKB 2B8OT 4YEEA 2VNCA 2VL4A 4XXDB 1MRCH 3BE1L 4Q2ZB 4G9FE 4JFFB 3JTSA 2R1XB 1JNNL 2R2BB 5D7JD 4OCYH 1NC2D 4JFFD 2FD6H 1MHPL 4NUJA 3SKOA 3OAZK 5GRYA 3G6DH 2ZNXA 3D39D 4LARL 4R96A 2DQIH 1I9IH 5EB9A 3F7YA 4OKDA 2WIIA 1UWGH 3RWHB 2BHUA 2PO6B 4FQXB 4LCIL 4OFVA 1H5BB 1N8ZB 4FQXD 1NDGB 3CLEH 2E9JA 1WVZA 1R24B 1U3JA 1OF2A 1WZLA 4HWUA 1CGVA 1NCCL 2OI9C 5FDWB 3AAZA 3N50A 2H8PB 1XCTA 1G9MC 1S7XA 1KPRB 3HE6B 4NO2A 4AMKL 5D7KD 5HJ3B 4LHJB 5A2JH 4YFEA 5IHUL 1HQRB 2IADB 4DVBA 3HE7A 3ESVF 1L7IH 2V7HB 2R2CA 1VDGA 4UTBL 3ZE1E 4ALAL 4OF3A 5JPMA 4NKOB 1MEXL 4Z77A 4GRMA 2MPAH 1V7NL 1NL0H 5F3BB 4HJGA 1I3RB 3F7VB 3VG9B 3U48A 4YDLB 3L1OL 1A64A 3CPLA 1CR9L 3D1MC 3PHQB 3BEWB 4NQDA 4YHOH 4PRPB 2VLRB 4B7IA 5F6HI 1G9EA 4WFHE 3KPNB 3D85D 4LDLB 1ZANH 3T3MF 3G5ZB 4HD9A 1NFKA 1WFOA 4JZNA 4RGNC 1JF6A 5DS8A 4QXUH 4WW2C 4S2SA 3VRIB 4PGDB 3GSNB 1BQSA 1BQHA 5IBTH 2M8XA 1E27B 2HLAA 1U8QA 3K8KA 3PJSA 2R1WB 3QUXD 5KN5B 5DDHB 2OSLB 4L4VA 4LIQL 4DQOL 1YYLH 4D9RE 1T4KA 4ZD3L 1AKJA 3T65B 4NBYB 2Y9RT 1UJTA 3RWCB 3O8XC 4TUJB 4JFYA 1BREA 4ZUVA 2P7TA 4QT5B 5FA3A 4N0FB 4G6JL 4XT1C 5F7DB 5J3HC 3C08H 1QBMH 1MF2H 3GSXB 1MCDA 4FRWA 5CUSH 1I4FB 3TFKD 4AK1A 4HEPG 3RWFB 1M71A 3OKMB 2BRRL 4RX4A 4C4KT 1EFXA 1KBGH 3BKCL 4RBPK 2B1AH 5I17A 5I66A 2NY3B 4J12A 4NN5B 3WIIH 2W60A 1IZKA 4BUGA 5DRXB 2HKHL 2MWCA 5JLZA 4KKAD 3PL6D 5DMJB 3ARDC 3NFSH 4U1GC 1INEL 3T0ED 4QEGA 2ENSA 1OARH 35C8L 1MAML 1YC8A 2WW8A 3B4NA 5B38G 5D2LB 5E24E 4HC1L 4KHTH 1RUKL 4LASL 3KPRA 2E9WA 3DUHA 2HJLA 5SWSA 1KSRA 3EFDH 5JMRA 4NRXA 3MNZB 4ZFGL 4JN1H 3VCLA 1N0XH 4YFLF 4NQSA 5FUZH 1AD9A 4PYHA 4IRZH 3OL2A 4CADB 1NCWL 5HHXL 4W4OC 4OZGA 2J88L 1TQCB 1CICA 3PWPA 3IDYB 1CGWA 1AGCA 1YDPB 3SCMB 5F3BA 1RIHH 1N5YH 4PJIB 4U6VL 3GUTA 1B4JH 4I2XE 2D7OA 2DQFB 4N8PA 4O2CA 2EDJA 2VYRE 4NT6B 4UIKL 4KC3B 5ECJE 2IALB 1PW3A 3HN3A 1RIUH 4FQIL 1NCDL 4Z7UF 3TCLB 1NLBL 3QIBD 4OQ1A 5C09A 2VTFA 1N7MH 2PO6C 1X5YA 1C12B 4O5LH 3V79C 5J1AB 3CC5B 1U36A 3MRNA 1OGTA 4AH2A 3D3VB 4R90L 1MJUH 2J8HA 4Q6IC 4GKZB 5J11B 1FE8H 1NMAH 3L5JA 3BZFA 4URTB 4PJAE 3MBED 1CTNA 4ONOA 5F7EL 4FFWC 4YJZL 3MBXL 5HI3C 1OQOA 4S0SD 4ZTPH 1WWCA 2WQRA 3T0BA 5GGRA 4FS0A 3NA9L 4ZUWB 4ELME 1M7XA 4DZ8A 4NQCB 2V17L 3GI8H 3QUMA 2A6DB 2J8UE 3B6SB 3IDNB 3S97C 4IDLA 1DN2A 4G6AC 4JVPA 5DQDH 1RZKC 4MA1C 4PJAB 1CI5A 3GMPB 4YNYA 1WITA 2WV3A 4I2XB 2FO4B 1MQKH 4P4RA 2WSKA 4JO2L 2KZWA 4ODSL 4BFGA 1EEYB 2B5IC 2AJZB 5JPNB 4JO3H 3MV9A 4GKSB 3RL1A 2EXYD 4Y4KD 3LKNB 3AGVA 1OL0A 3MRRA 2R2HB 5D7LA 5GS1B 1R3JB 1YQVL 4JHZA 2ESVB 3OG4B 4ZO8A 3O45B 1FFNB 3MGTA 5TE6L 1KIQB 5I76A 2BRQA 5MHSE 4DKAA 3NACH 5C0BA 2QQNH 4IHOB 4ZSOA 4LLUA 5DMYA 3B9KB 3MMEA 4L4TB 2JJTA 4GW4B 3U36B 4FQHB 3WXVL 1F11B 1MRFH 3L3GB 4NC1E 3LS5H 4WEBL 4F58L 2WLYA 4HIHA 3TIDB 4R26L 1PZ5A 3EOAA 5DR5H 1FL3B 3O6KL 1Z3GH 2HVKB 1QR1B 3GBNH 4YDVB 2GJ6E 2R29H 1N6QL 1BPVA 4RAVB 1Q1JL 3I84A 4DGYH 1RMFH 4LQFL 1OCWL 2XA8L 4ODWA 5BW7C 4YK4C 4KI5E 4LSTH 1SVZA 4LGSB 5KW9L 4WI2A 4YWGL 2HTKC 5BRZA 1ZGLM 2A6JB 5IQ9A 3ARBC 1MHEA 3QIUB 1H0DB 4R4ND 3CFBA 2EECA 1RJZA 5CCKL 1IGJA 2YSSB 3IDMB 4FFZH 3H8NA 4RRPG 1INDH 5F1IA 4PGEA 3VFRB 2VIRA 4JANA 5D7SL 2JKXA 5D93B 1R0AL 4V1DB 2AJZA 2EDHA 3NPSB 5C08E 4ETQB 3EYOA 2AJUH 5DD3L 2BY1A 3BD3A 3IFOB 3SDCC 2EDDA 5ILTH 2CLZA 3KR3H 5D5MA 4A6YA 4J7RA 1LO5B 1UM5L 3MYJB 4AYFA 3JVGA 5F93C 3S35X 4QOKE 2ZCLH 2BC4B 4FTVD 4DFIA 1CU4H 5DJAA 3F5WB 5ESVB 5DRWA 3OR7A 5ADPL 2E8ZA 3JZ7A 4U1MB 4NQCD 3IDYC 1NBVL 1OGAA 5JO5A 4PG9B 3PHSA 1YPZF 2RJMA 4KROC 2EDBA 4N5ED 2J4WL 5BV7C 4L8BB 1FL3A 1AY1H 2JB5H 2P8PB 1A7OH 4XCNB 3VXMB 3OKDB 5DEFB 1KF9B 4X4YB 5LAXB 5DUPL 4G7YL 2FSEB 2NY1C 1DE4B 2BVPA 5C6TH 1N0LA 2NXYB 3W5NA 4LSQH 4Y4KB 2FHFA 5GGSY 2ICES 2NZ9D 4ZSOB 2DQJL 3CVHB 5DJ0A 1PSKL 2FGWL 2KH2B 4P9HL 5CZVH 2F54D 3LRSA 5FGRA 4QRRD 3DMMB 1AQKL 2BNUB 5DEGB 5GGVH 3RWDB 7FABH 2YN3A 1FG2B 3L5XL 4L8DB 1SY6H 5GS0D 4BFBD 4FFVC 3TBTB 5E8PB 2D7MA 1FV1A 7CGTA 4EI6B 4O2EB 2Z31D 4YBLB 1ZXQA 3D0VB 2OR8A 4KVNH 3C09C 1G6RH 3NGBC 4Y88A 1TJHL 4M9OA 4MSWB 1WF5A 3ZE0F 4RWHA 5BJTA 5C8JA 2P1YA 1XZ0B 2ZNWA 5HHNB 3W9DA 4N0CD 1MCRA 4ZUSA 1PG7X 3C2SA 2ZG3A 3O9WD 4ODHL 5J89A 3LDBB 4QRQA 3TBWA 4H20L 2YPKB 1JZ8A 5GGRB 3HG1A 4YLQT 4NNPH 5FF6A 3N1MC 1EEZB 3EDFA 4XCEA 5IIEA 3EO0B 4IM8A 3KPRB 4LP4A 3A6CH 5TDPB 5ICYA 4R3SA 4G8FB 4H26B 1QBLL 2JCCE 1GPOL 3KPQA 2YHGA 3WIHH 4C58B 3H9SB 4UUJA 1N59A 5HYJE 3QPXL 3BWUC 5GS2D 3I6LD 3LN5B 4JFHD 1UH4A 5GJTL 3S36H 4MQ7A 4XCCH 3OKOB 2EDQA 3S96B 3AREB 1MCWW 3RWIA 1ZHNB 5E08H 3UZQA 2GY5A 4ELMA 5IP4A 3BZEA 1U8IB 4LBEA 5C0ND 4PJGF 4P59L 3S37X 1MIML 5HVGB 4RMVA 4YH6A 3TV3H 1S5HB 1XR9A 2GTWA 3BUYA 2MKWA 1EA9C 4R7NA 5I30H 5IJVA 4XPFL 3VD3A 1J8HE 5C0CD 3U82B 1T4KB 1FRGH 2XWTB 1LP9A 2XXMB 1QLRB 1BM3H 2HYMA 4LAQH 4PRBA 2G60H 4H8WL 4P5TB 4LGRB 3NA4A 2RIKA 3WS3B 4U6XB 1NFDE 3TPUB 4OLEA 4WI9A 2R1YB 3L7EB 3QG6B 4OZGB 4PTUA 1MJ7H 4NKQB 4JVWA 3K4ZA 1G9NC 1U42A 4M48L 1RZJH 3GMLB 4MJIE 5CWSA 3LQAC 1RURL 5MI0C 3QIUC 4LCCA 1XF3B 3KPNA 1P2CB 5ESAA 1Q72L 3DROB 4PV8A 3IYLW 4NQXB 2DQIL 5ANMA 5CLWA 5DFVC 5GSRB 5EPMB 2EO9A 4QTIL 3PQYE 3O6FB 1XT5A 2HRPL 4HHAA 2FX9L 4X98B 3KS0H 5SV4A 1IAKB 4P2RE 3UJTH 3RUGB 4G8GE 5HHOB 2D7TL 1XH3A 1CFQB 5ALBL 1BVLB 2BCKB 1UKQA 5DK0A 4EDXA 4Y5XA 3GBMH 3MJ8A 4NKMB 4NWUH 2GCYB 4G3YH 3ZYIA 4XP9H 4BSVB 4FQ2H 4HG4J 3THMH 3T1FB 1G1YA 3TO4B 5BS0E 1D5MB 4QYOB 5IVZB 4HWZA 1XIWD 3OX8A 1JMXA 1L7IL 4AIXA 3GJFK 5E6ZA 1ZANL 1MFAL 1JMZA 3BO8B 4NFCA 2NY3C 1AGEA 3TN0B 1UT9A 3HE6A 4NO2B 3SKMB 2VDRH 5DJ6B 1IM3A 4EJ1C 2X9XA 3VFMA 5T3XE 5CBEA 1VEMA 3FL7A 2ARJQ 2NY6C 5E8OA 4Z76A 3ARFA 1R24A 3TA3D 2VXTH 2W91A 4LSSL 2R2EB 1H8OA 2A6IB 4ZD3H 1W0WA 3X14A 3INUH 2PO6A 4BZYA 1SBSL 2FHCA 4LRNH 4M1GL 3VXSE 3K1DA 1IM9A 3QDJE 4OZHA 1A4KB 4UT9H 5D96C 4ODUA 1U6AL 4HS3B 3ALWA 2XWJA 2ERJB 4HIIB 1ND0B 2R15A 4NIKB 4ZTOL 5ESAB 4CRPA 1PYWB 1DLFL 5CEXB 3WS6A 4E42B 1HOCB 1KCUH 3DI3B 3I9GL 1CLYH 1JUFA 3PHQA 3L3OA 2NW3B 2H2SC 3G04B 1KTLB 1DP0A 3SE8L 1KCKA 2R1YA 3EHBD 3V5KA 4PR5A 1FNAA 2OJEA 1CZ8L 4HXAH 5TGBA 4MCZA 5D2NA 4D0DA 1MAMH 3TPKA 1CWVA 1UJ3C 3MC0A 4HC1H 4KHTL 3Q6FB 3KYNA 4D0CA 2DJSA 1DVFA 4CN4A 1VERA 4YIQA 2P5EB 5I16A 4FQJL 3QCUL 2UWEA 3HB3C 2Z92A 4R0LB 4JFEB 4V2BA 4TPRH 4ESKA 1TQBB 5GS0H 5B38B 1A9BB 3B9VA 1MAKA 3O4LB 1JPGB 1WC7B 4NCC2 3HS0A 3AAZB 1KTDA 2DDQL 3VD4A 3WIFB 4G7VL 1DBML 3TNNB 1ZAGA 5FYJU 3EOYG 5E00A 5FIEA 4AENB 4RAHA 3NFSL 2XT1B 5ACMA 3WFEH 1B4JL 2FECL 3ULSB 2DLFH 3RZCB 1VADB 3IGAB 1RUKH 1MCWM 2OR9L 4JREB 2MCG1 1RIUL 3TBVB 4BZ2L 4OB5L 3JWOH 1UJ3A 4A6YL 4G6FB 5DLML 4WWKA 1OSPH 2ICWA 4WFFE 3SKOB 2YBRA 4Y5XC 2F58H 1UYWH 1HZHH 3RWGB 1FZOB 3LS4H 4KU1A 3OAUL 3H2WA 4NZRL 4LU5L 1IMHC 1A22B 1ZV5A 5HYJA 3QUZC 3STLA 1Q9WA 2NLJB 5IV2A 4R2GC 1G9MH 3QDGA 3GKWH 1OTSC 5KZCB 1WZ1H 1AGFB 3IS0X 4XVJH 1C5CH 4RISH 1YPZB 2MSPA 3CDYA 2JB6A 5C0AD 3LIZH 4WIQA 3FMGL 1QYGL 3TJEH 1QKZH 4O00A 1OWWA 5DJ2B 1KPUA 5FO9A 1LO2H 3QPQC 1P6AB 2BFVL 1ZHBB 2MJWA 1DUZB 2B4CH 2NXYC 3QRGH 4HPYL 2IPTL 1HHJA 4OBSA 4IOFC 4Z7WE 5DT1L 3SO3B 3EOTH 4YAQA 3PHOA 1CIUA 4NBXB 2RCSL 1FZMB 3DMMC 5ICZB 1MQKL 1JNNH 2A83A 2DQTL 5HGDB 5IG7A 2ID5A 3C5ZA 1YY9C 4JO3L 3CFJB 4MNGB 5FGCE 3MJ8B 2F53B 1RIVL 3O11B 4ETYA 4D9QE 4P2RD 4NN5C 4G8IA 3C87A 5CSBA 3H3PH 4FNLL 5L2KE 4D94A 4FMKA 3MLRL 4XNMB 4XAKD 5KZCD 1OPGL 3X13B 2X4UB 3CLEL 1P69B 4QOKD 5DUBB 1FAIL 5MEOB 4CMMB 3LEXA 3MZTA 1DQJA 3U46A 3MLXH 3P0VL 2DQDH 1F4AA 3RU8L 4JY5H 3SDXA 1G0XA 1LK3H 2C1PA 3IDIA 4GW5A 5D93C 3VXUA 5IW1A 3TH3T 4QRUA 2EDTA 3WFCH 4ODSH 3REVA 5MERB 1MJ8L 4CU8A 4M6AA 4S0TD 1Z3GL 1ZHLB 1WWAX 2P48B 2WP3O 3IKCA 4LLMA 4GO6B 5EWIH 4YXKL 3E8UH 5ID1B 1EJ6A 3BQUD 4V1DA 4Y19E 3SKJL 4L3AA 4P3DA 5D96B 2AJSL 3MV8B 1FLRL 1QFHA 4PJCB 2DQHH 1V3MA 2CKBB 2YMXH 2G5BA 4XGZB 3MBEC 5BVJA 2HMIC 2N56A 4CVZB 1XF1A 3QCVH 1WFUA 3K80A 1W72A 3BMWA 3L1OH 4PJ9D 3NCMA 3MOBL 1F4WL 5IJKA 3FO0H 2H32A 1LK2A 3WXVH 2RB8A 5HHPB 3GDBA 3C9NA 4P9ML 3LS5L 2AK1H 1RJCA 1FBIL 2VZTA 4DGVL 2FBOJ 2VERN 3VA6A 2W9DH 3Q5TA 4EKXA 1S7UB 4G8EB 4LVHB 5FCUH 4HEME 1D9KC 4LHQB 2O61B 4WI8A 5CFHA 4X80L 1EHNA 3QWQB 3LEYH 4AIOA 2CSPA 2CO6B 3GIVB 1UM5H 4CMHB 5IBTL 2IGFH 3CCHA 3EFFB 1YNTA 1T89C 3QUMH 2VJXA 3QP3A 3UYRL 2G75B 5F3HB 2WNGA 4J1UA 3TIEB 4E41A 9CGTA 3F7RA 3C60A 3WXWL 3RVVD 5GZNC 3HTLX 3QEQA 5ERWA 3ULUD 1NCNA 2E27L 4KDTA 3DETD 3O2DL 1YEFL 3AUVA 4MDJA 2CDGA 4XP6H 1MI5B 1KB9K 3NGBB 4X6DE 4XPAH 4U6TA 2DQGH 5DHYB 3LKOA 3WUWG 4AEHL 1K4DB 2OCFD 5BS0B 2Z8SA 2P46B 5JPNA 4XXCA 4ZXBC 4JHAH 3LVEA 1KBGL 4PD4K 2AI0L 4A2MA 3BKCH 4MJID 4O51A 3GJFB 4DTGH 4QCIA 5F9OL 5ENWA 3WIIL 1Y18A 3BYYA 2OTWB 5IG7B 5LQBL 4X6CE 3FQXA 4QXGH 2CMRL 1QFWI 4MMZC 5FDYA 1M6OA 5CJOH 5KSAB 2YD9A 1T21B 3VRJA 4OV6F 4YHIA 5GISL 2HT3C 4NOFA 5E7BA 2JB5L 4U3CA 1N0XL 4RMTA 4RBPH 1CL7I 5KOVC 1VSCA 1G6RL 5DUPH 2ZOKB 2OMBA 1HEZB 1TJHH 2ITDB 3MRPA 3B9DA 4R97C 3GSRA 4L8BA 1CE6B 5HDLA 3K3QA 4AH2B 3BD5A 1W72H 1EERB 4CU6A 5IQ7L 1PSKH 5CZVL 2VDOL 3DV4B 4KJWD 5D1XD 2PR4L 5CJXA 4QRSA 5ALCH 5A16A 4IMKC 4YBHA 1RSFA 2ZUVA 3GMOB 1Z0MA 4JM2D 1XCQB 3WIHL 5AZEL 3QO1A 3H0TA 4RDQG 5JW3H 3KYOA 3MUY1 4RA3A 3C6LD 3OHXA 3QYCA 4OF0A 2DS4A 1N7ML 5F89A 2OP4H 3EYOB 3OB0H 4HV8B 3LN4A 1K9TA 4JM2F 2GYSA 3KHOA 3PWPB 4DKFL 4H8WC 1BBDL 4EIGB 3RTQC 3NPSC 2VR9A 1VFOA 5F7KC 4YBQC 1I1AB 1HYSC 4ZFZB 3NOIA 1MFCH 4M6NH 2J6EA 3QZWB 1BQLH 1D5IL 3JV0A 1QFUH 3QULB 1OAQL 2F74B 5C2UB 5JDJA 1MHEB 4Z7WA 5C6WH 1MLBB 1NANH 5DVMA 3C5SA 1R5IB 3O4LA 1A9BA 1FN4A 2XWBA 4ACPA 3MBXH 2BVOA 4MQTB 4U0QB 5C2BL 4E0RB 4O2FB 4WI7A 3NA9H 1WGOA 3ECBA 4TSBL 2EZ0C 1T20A 3QPXH 3T0EB 1LEIB 4M3JA 4JG0L 5KAQF 2JIXB 3K81A 3PIQB 4YFDB 1F13A 1SMAA 2OJEB 5JHDE 3VXSD 4PRIB 1YEEL 4XNQB 3KYMA 4PJCF 4Q0XH 4DGIH 4L4VD 3MV7B 3TEUA 1QPPA 5E94A 5INDA 4P3CH 4HK0B 1R3HB 1HIML 3QI9B 1IGFH 3VWKD 2V2XB 1B0RB 2NPLX 2R0KH 3FKUS 3PWLB 4QTIH 2MMXA 3SPVA 1OTUD 4JM4H 1HHJB 1A9EA 3FT3A 3FONA 4X4ME 5T1KD 2Y4SA 4K9EC 1AJ7H 5H37H 5TE6H 2Q86A 3FT2A 1Z9SA 4LAJH 1N64L 4AT6B 5D7JC 1SYVB 5ALBH 5CEYA 2QQNL 1YUHA 4IRJC 3OF6A 4PJDF 5JW4R 1HHGA 4Y4HD 2CPCA 5I1LA 3VFOA 3DTXB 3F7QA 3KWWA 4WGVB 1NBYA 1S9KC 4NFBA 2F5AH 1U8KA 1NUDA 4APQA 1EX0A 3RVUC 3ARFD 4ZNCD 3UTSD 5JTWA 4YBLC 3U30C 4I0KA 3MJ9A 2PN5A 3A67L 1FO0H 1A9EB 1T04B 4BQ6A 3MFFA 2D4FA 1QPXA 1ZEAH 1KNOB 4PJEE 3WFHA 4HS8L 4C56D 1X5JA 1M7IB 3MRLA 3K2MC 2Y72A 2EH7H 3BX7C 1II4E 3MTRA 3KYMB 3F7VA 1A7RH 3GBML 1JGEB 2E9IA 1XF2A 3T4AA 3U2SA 4KK9D 4D9RD 3OF6D 2ITCB 3CH1B 3HC0A 1MVUB 3OSKA 3V6FB 5HHOA 2R4SL 4X9FA 5E8NA 3HZKA 4PJ9A 4M7JL 3QXAB 1U8LA 4XP5L 3HS0B 5MP6L 1SJEA 2WBJB 5K93A 1BZ9A 3AU1B 4GRLB 5EZOH 5A3IC 4X4XA 1CDUA 4I3SL 5EO1A 5F1OB 1A1OA 2NZ9C 5FGBA 1DEDA 3ARZA 4PREA 4TQEL 3UCRA 4NYLA 3TZVD 5SWSD 4LCCB 3EGSB 3I02B 4RMQA 1OW0C 2EIZB 4YQXL 4YUEH 5D7JA 1PQZA 5CMAB 3SDYH 1FAKT 4JPVH 1KB5B 4LPYA 3PNWB 3D5OF 4LF3A 3EDDA 2GKIA 4UT9L 1J88A 5TFSH 1KT2B 2DBLL 3F7YB 4DW2H 3DBXA 3NFNB 1UB6B 4X6BA 1F2QA 2H2PC 1HSAB 5T1DH 5MENB 2ZCKL 3UTPD 4H88L 5DMKA 2VSCA 2BNQD 4JO1L 4K71C 2CH8A 1MCOL 5FO8A 3KPMA 4O4YH 5CD5D 1TPXC 2YUXA 4WW1B 1I85A 3UTOA 4OI8A 2NR6D 4NRXB 2PW2B 1DBMH 1MLCB 4M1CD 2LFGA 1A4KA 4AY0A 4JR9L 4KMLB 2OS7A 2GSGA 3D69B 2H32H 3BESR 3RWIB 2RQ8A 1LNUA 1NUGA 4NJ9L 1AHWA 4QGYA 3ZSTA 2ICEB 2ZKHH 1W0WB 3X14B 1XGUB 3PF2A 4DEPC 3P30L 5JLZB 1SY6L 1ZA3A 2DKSA 5IB4A 5IUSA 2JELH 4PJ8C 1AR1C 4XRCB 3L3HB 4L29B 4XNYL 1L9MA 3UC0L 1UYWL 3NZ8A 4HX1A 1RZIB 1JTTA 1WV7T 2ZUXA 1V3JA 2Q8AL 4JQIL 3CMOL 4J23A 5FYKL 2X70A 1KTRL 2DDQH 3VU2A 1BMGA 1RUAL 4G9FA 1ZWIA 4JEGB 1UM6L 5SWQB 3IRPX 5FYJE 1YC7A 3ROOA 2K9UA 4JPWH 3L5IA 4WY7H 3WNMA 4XVJL 4RISL 2AQ1A 4XCFH 2ZUWA 5C0IB 2C3WA 5JOPE 5I1GH 4M4PA 3K1KC 2GITB 3QXWA 4DOHE 4NN7B 2BVQB 3G9VA 2COQA 4PJBB 4L8SC 1NAMB 4X5XB 4P2OC 3JSSA 1OSZA 1JHKL 4GMSL 2Y7QA 5JHLH 4M1CC 2F58L 3QRGL 4S2SB 1OM3L 2NY7L 4M93C 1YUHB 15C8H 3TBTA 3KDMA 3PGDA 1JHTB 2Z35A 3OKYA 3UYPA 3MNWB 1H9VA 4Y2DA 2DLGA 1KXVC 4MDJB 2RCSH 1CYGA 1P2CA 2GJ6B 4YXLH 5E08L 3IJSB 2BJML 4PJBE 5DI8B 1H3PL 4IRJB 5EG6C 3B2UD 4I5BA 3WO4C 3MRHB 1EPFA 1P7QB 1TZHA 2NNAB 4JRYA 4XC1L 1T22A 3TVMA 5FGBC 2M1KA 1A47A 1EUUA 2YD5A 4HLJA 4NZJA 4OAWB 3U9PL 3ZLQC 4B7LA 1I3RA 4PLJC 1FRGL 1TETH 2VQ1B 4PRBB 4KMQA 2YC1A 5JHDA 1ZLWK 4QRRB 5L0QC 2ICCA 2NX5E 3EYQD 4YDKL 5IFHH 1FO0A 4U6HB 3VGFA 3ABZA 1E4XH 3K2UH 5IOPA 3DUSA 4LSVH 1DVFD 2PKDA 1IT9L 3HZYA 3RGVB 2XZQL 4NQDE 5FYKE 4BK5A 3ILPA 2H3NB 4F7CB 1JWMB 1MJ8H 3VWJD 4IMLB 1TQBC 4HWBH 1HQ4B 5EZLB 1F02I 2YEZB 4ODTL 4KGLA 4P2YA 5H94B 1CLOL 4OLWH 4Y1AD 2F8XC 3MLSL 5EU4B 1M05A 1ZT7A 2YMXL 4RWYH 1FAIH 3H9SA 2LAAA 1FVCA 1G7QA 4PPTA 3EDEA 5EUOB 1GHFL 3SE4A 2WIIB 2DQDL 3GJFH 4RMUA 5JMOC 3MRKB 3VGHA 3UBXG 1QLFB 2ADFH 5HHMB 4MNHA 3UO1L 2CDEB 3BIKA 1NFDB 3WDIA 1BWMA 5AWNL 3BP4A 4MVBD 1W0YT 2AV7A 3BPCB 4R4BB 5IMMA 2FWOB 3MZGB 1JIBA 3S9DB 1C8PA 2XA3A 4YXKH 4Z8FH 1X3DA 2Q7YA 4CN1A 4TSCL 4MJ6A 4P46D 4UNTA 1NAMH 1TQCC 2NYYD 32C2A 4M3KB 1NEZG 1HILA 3D25A 4NC1C 3C6LA 2Z93B 2PXYD 4IMKA 4G43B 5IMOB 3QUML 5LXGL 5MEQA 3OXRB 1MCBA 2OL3B 4GKNB 3OPZL 3HNSL 1TPXB 4HIHB 3G5VA 4IOSD 1UZ8B 4UQ3A 3U4BH 5JORB 1T1ZB 3T0DA 1LO0H 1BOYA 4L1DA 1SYSA 2FX8H 4LSRH 3TYFB 4H1LB 5IM7A 5IVXA 2DWEB 3BT2H 2IBBA 3MA7A 4Q9QL 1C7TA 4R97B 3BSZH 2XKNB 5T1MA 3CDFA 5FKAA 1QRND 1NPUA 4Q6IB 4X6CB 2AEQH 2PYED 2F53D 3PL6C 5GS1A 3KLAB 2ZUUA 2IQ9L 4ZPTA 3MRRB 1P7QD 2FCBA 4N0UB 5DHVB 4P2RA 3NCJH 5DWUL 5HVWA 5C08D 1QSFD 1KIPA 3PWPE 5IROC 3Q0HA 2D7QA 2QSCH 4PLKC 3WUWB 2FB4L 3LQZB 5CEZD 2FO4A 2CKBH 3PXHA 2X4SB 4WCYH 4X6DF 32C2B 5CIPB 1PKOA 3KPSA 4EUPA 3WFBL 1C16B 5HYJB 4GXUM 1YEGL 4M43L 2AAVA 3O8XD 4OGAC 4JLRB 1ODAA 4FQJH 3D3VE 3UJIH 3EUUA 1JWUB 4NZDA 1HKLL 4I48B 3KJ6L 1ADQH 3C60B 4TPRL 1KIRB 4QTHB 5GS0L 1IEBB 5C0CA 1GC1H 3QBTB 4OD2A 1T66C 3GSWB 4QY8B 4QXGL 4QNPE 4PIRF 2AQ2A 4W6YB 2UY7A 4UNUA 1KN2H 4D9LH 2HWZH 5F96H 3UJJL 1G7JB 2UYLB 2I5YL 2ARWA 1DQDL 3V6OC 3OGCB 3ARPA 2G9HB 1F00I 2YZ1A 5LJYH 1ZT4A 3H42H 2DMCA 2WINA 5HHPA 4Y16A 5DHXB 3CZFA 4I0PB 5KANG 4R0LA 4TVSa 3MRQA 1P6FA 3FOMB 4KZDL 3DUSB 1R5WB 4NZRH 1FYTE 4PP2B 4DCQB 2FEEI 4X7SH 2IALA 5GGQL 2P8MA 4P2QD 1OQXA 4RGMB 4H25A 2Q1EA 2X1WL 4F57L 1D9KB 5T3XD 2VB5A 3P11H 1J18A 2DYPB 2VDOH 1XGRB 3CLFL 4HH9A 2HFEB 3OJMB 3SDDA 1MCFA 3WL9B 3QQ3A 1KTKE 4GRWE 1BZ7B 4FQCH 1FLTX 3IJHA 4ZOCA 1UQSA 1XGQA 4JJHA 4NO5B 2ZG2A 1JWSA 1QYGH 1TZIA 1VA9A 4NO3B 5IFJB 3B5TA 3G5XA 4BH7B 3TJHC 4E42A 2OYPA 4HPYH 2QHRH 4Y16D 1UH2A 2CJUL 5TPWL 4HS3A 1C08B 2PYFB 1K3ZA 3JWDL 4NQVB 5IWLC 4DKEL 5F9WB 4S1DD 3WE6A 3FB6B 4MAUL 1CG9B 3Q6GL 2QR0A 4B5EA 1G7QB 1WZMA 1ZK9A 2ZPKH 5L6YL 4DAGH 5GRXG 4R6UA 4NO0A 4H5SB 4DGIL 1D5IH 5E6IB 3QQNA 2BK8A 4UB0H 1RIVH 4CKVX 3FB7A 3ARVA 1HIMH 3SQOH 3BIAX 1HH9B 5FGCB 1FORH 3DX8A 4KROD 3BZ4A 4H0IA 1CD9B 1I8LC 2A6DA 3MRJA 2IANA 2I25N 3ROOB 3BO8A 1ZLSH 4CDGC 4TSBH 3S4SA 2APVA 4X7TB 5FV2A 5D1QC 3EJYC 4MLIA 2VDQL 3O8XA 3NTCH 3ETBF 2C3VA 4ZPVA 1GZPA 3NZ8B 1KLUB 2MFNA 3BH9A 3BAEL 4N0RA 2XQBL 3GGWB 1CXKA 5DDHA 3GEWB 4Q0XL 2HFFA 2NY1B 1BVLA 1WWWX 2BCKA 1Q0XH 1J1OH 3VXRE 3WFZA 1NGYB 3LB6C 4HBQA 1E27A 4IRSA 4JDZB 4P2OB 3PV7A 1T22B 1Y0LB 3QISA 1P7QA 2NNAA 2GSGB 3D69A 2DQHL 4JM4L 1YJDC 2A1WL 4HLZG 4MZ3A 5EZJA 3H9HB 4HIEA 5ANMB 2A9NH 3STLB 2DKUA 1J12A 1FFOB 5GGSA 1B6DA 1BIIB 2BNRA 4PRPA 3WD5H 1Z6JT 2Y5EA 2CIIB 4F9LA 1E6JL 5E70A 1JZ2A 1TVHB 2VDLH 3MXWH 1HXMB 3DX7A 4PB0H 5FHBL 5IEHB 2W9DL 4GAYA 3ZHLA 3RTQB 4X6FA 5DRZB 4HJGB 3DX9B 5T1LB 1JV5A 1MEXH 1LP9B 3U4EA 1LEGA 4HZLB 2Z8RA 5E2TL 4IRSD 1TCMA 1Z9LA 2XN9A 3P4MB 1S5HA 1XR9B 4XVUC 1A1MA 5T33H 3QRFM 4K07A 3AXLA 4MA8H 5B38A 2RAMA 1MCNA 3FOLB 1SJHB 4YQXH 4JFQA 1A7RL 3U0WL 4PG2C 3SY0B 1U8LB 1DN0B 2W0PA 4TTDD 2DRUA 4KQ3H 5TDNA 4GOSA 1YY9D 1OF2B 4C55A 4XPAL 5DRXA 5HPMB 4OCXH 4X9BA 2P43B 5TDOA 4ENEC 4UUJB 5IVNA 2C1OB 4J3UA 3TBSB 3BPOC 1EFXB 1CK0L 3HI6H 4Y4FD 5JDSA 3AC0A 1KLUA 3V5KB 4Z7VB 3A0OA 4J2XA 1T6WA 4I18B 1A8JH 3I50H 4M62L 4LCYB 5DMIL 4NJAH 2UY6A 4NC0B 5CBAB 5J8OA 1JUFB 4WFGD 2IH1A 4LIQH 3U0PB 1HOCA 5LQBH 5B4MC 4ZFFB 4QRPA 3OZ9L 2CMRH 1FZKB 1J8HD 5DA4A 1YECL 5HDBE 5DMKB 1E6OL 3BZ4B 1FSKC 2FH8A 3JTTA 2APBA 4X6BB 1T1XA 2VLLA 1KC5H 1R5VA 2APTA 4DW2L 4P46B 1U8QB 4XPHH 4WHYG 4XNYH 2V5TA 5I73B 3QUYD 2BXZA 5JW4N 1FVDB 5AD0A 1T1YA 5F97E 1S3KL 5K9KB 1MCOH 1YEHH 4JAMB 5D7JB 1AR1D 5CEYB 4LCUA 3NIFE 5AAMA 2I60L 4U1JA 3EYVA 4BQ8A 3V6ZB 2PO6D 4N8VG 3VFVB 2YD1A 4KAQL 1TNMA 3BIBX 4P5MA 3GMRB 1S7TA 2AJYL 2NR6C 4LLWA 3U30B 4NO5A 3D9AL 2AGJL 2IH3A 4XNQA 4MCYB 3RWEA 4GG6E 2ITCA 3CH1A 4WENB 4PJ7B 3D0LB 4WUKH 3BH8B 4HMEA 5KVGL 3MRGB 2IJ0C 1Q0YH 4APQD 3E1F1 2DQUL 1BVKA 3RUGE 4U1NB 5I6XC 1S7VB 1UM6H 5DRNB 4YXLL 3UPRB 3F6IA 4GXVH 1G6RA 2FL5A 1JZ4A 1EAPA 3OR7B 3TN0C 1FZJB 1KCSL 4LHUD 3KXFE 4F7EA 1UACL 4KRMB 5FECB 1REIA 3P4LA 4JPIA 5E2JA 3V4VL 3WBDA 2FH6A 2P24B 2X1OA 3VXOA 5M7QA 3UTTA 3UTSB 4LCWE 4J4PD 4OZIF 2R0ZL 3GMLA 2C7UA 1QR4A 4OF6A 4QHUB 3VFWA 1ZGLP 15C8L 2GFBB 3OAYH 1JF5A 3BWAA 3NIGE 1J10A 4LKCB 4M7KL 4D0BB 3K2UL 1YYMH 4PJBF 5EU7C 4ZFOL 5HDBF 2ZSVA 1SYVA 3SDCB 3PP4L 2DLTA 1PJ9A 4LPWA 5TE4H 1W2KT 1S9VB 4M7LH 4N68A 2YXFA 4Z0BL 5GGTL 4P3CL 3VXQB 4N0YH 3QXDB 4GG6B 1MNUL 4PV9A 3MLSH 4K71B 4M61B 1FH5L 4OSUH 3T2NL 1ZHNA 4GQ9H 3UXFA 4PRHE 1INQA 1G6VK 4WV1B 1T3FB 4RGNE 2JIXA 1GHFH 3PIQA 4ZMAT 5IFHL 3B9KD 5DK3A 1KEMH 3VJ6B 3EJYD 5K9OA 1MCKA 4PRAB 2BNRE 3IDUA 4UT6L 4JO2H 5TH2A 4AMKH 4XMLL 1HINL 3TGXA 2XKNA 3LEVL 3QDMA 5T1MB 5IK3A 3ZE2F 1LP9E 2F5AL 4P4KD 3GMQA 1IGCL 2DWEA 2DL9A 5DQJA 2PXYA 3FCTA 4XI5D 4KDWA 1FPTH 5D7IB 1V7NH 1OAYL 4BQ9A 1XZ0A 5J9PB 1G0DA 3DX6A 1ORQA 2QSTA 1LDSA 1WSST 5DUMH 2KPNA 2EH7L 1FG9C 1X5IA 3DXAA 3UPCA 4NHCH 4MA7L 4OLXH 4WEBH 3PGCB 4OLYH 3T2PA 4OZFH 5AWNH 4NKIH 1ZT1A 2DM4A 4G6KL 3PQYA 2G2RB 3BKJL 2R4SH 1K3IA 4P23D 1BIIA 3TH2T 3ZSSA 5DC4B 5DEGA 4P23B 3SN6N 1TMCB 3LRGA 3LRSB 2ZG1A 5EZJB 2DLHA 1JN6B 3T1WA 3CVHA 5DJ0B 4RGOL 3CXHJ 1WISA 4Z7UB 1MCLA 4HCRA 1FL6A 1JHLL 1JPFB 4BFIB 3EFFA 3P73B 5DURB 3AREC 1UENA 5LAXA 3M17B 1QNZL 5JZ7D 1UM4L 4P5KB 5I8OL 4FFZL 4F33B 1XAUA 3F6LA 4QRPE 2W9LA 2FX8L 3S8WA 5C07E 3QUYC 5L0QB 4GJTB 2NW2B 4J3VA 4JZJC 2FJFA 3PP3K 3SO3C 4WI5A 1D5BB 4Q9QH 3C08L 5E1AA 5JHDD 5EOQL 3AY4A 4QWWC 1OVZA 4TVPD 3BFOA 4RGMC 1QSEE 1MCIA 1JWMA 2H32B 2AEQL 1L6XA 4O58H 2IANB 4B53A 1LO3L 1QRNE 1Z9MA 3ZT7A 3VFSA 2Y07L 3RGVC 3D39A 4A6YB 4XBEL 2W92A 3KPSD 4H0GA 1N5AA 5EBWA 1DZBA 4N8CL 1CICB 2W0LA 3F62A 2OJZL 3BEVB 4F2MA 1K4DA 3P30H 4JN2B 4XMPH 4UV7H 2FJHB 1UVQA 4XB7A 4HUXA 2PYFA 2A9ML 4NQVA 1BEYH 3GSUB 2A6KB 5HGAB 3W81A 4OIAA 3QIUA 1HHIA 4LLQA 4JQIH 5K9QI 1KV3A 1IFHH 2R0WH 4CMMA 5JIKA 1G7MB 2RFXB 1AQDA 4GKOA 1U41A 4U0RC 3FB5B 1CFSB 2X89D 4WY7L 3S35H 3KPRE 4L4JA 5D5MF 1KN2L 3VWJB 2NY0D 1F5WA 3LD8C 4LRIC 4FABH 2O61A 5DJYA 3SDDC 3UBXI 2VITB 1DQDH 5I66B 4K8RC 1S7UA 4FQIH 4G8EA 1K2DA 3GIZL 2FLRT 2RHEA 3L5WB 5C0FB 3ILQD 4ZXBD 1L7TL 4QHKI 5IW3A 4GW4A 3VGAC 4JY4B 1FNSH 2FJGA 5I0ZA 2NY7H 1KB9J 3MV7D 5KSUA 4QHLB 1SY6A 1I8KA 3RDTB 1S7QA 2BDNH 1S9VA 1A7PH 1GOHA 3O6FD 1BX2B 3RWCA 2W0FB 3NFPB 3VXNB 4FZEL 3ZT6A 4HPOH 5L6YH 2E7BA 5JDSB 4OV5B 2UVFA 3KYKL 4P4KC 1ZLWH 2YA0A 4B0MM 3SJVD 3BRDA 2EE6A 3LKNA 4JPKL 4Q9RH 4QXTB 2WBKA 1HSBB 4V1DE 3OMZA 4RCAA 1XF4A 4OD3H 5GGUA 3QIBB 3T77B 1GPOH 4M5YL 1D7FA 4OZ4B 3PL6B 4WFGE 5J4MA 4RIRA 1J0KA 4M61A 4PJAA 4HCRL 3LPGA 2B20A 1HYRC 2YA1A 5ITBH 4F7MB 2Q8BH 1YJDL 3FOLA 2DWDA 4X6DB 3VXQA 2Y6SC 3DRQB 4KKBD 5TF1L 4OLZL 3H9SE 1QHOA 2H9GB 4M02A 4YXHL 5HGHA 4S1QL 2XQBH 1IBGH 1HHKA 5DRNA 5EDXA 5KG9B 5FFLA 2BVEA 2E7CA 1AXIB 2DL2A 4R8WH 4XCYA 4F37F 5CJ8A 2KDGA 1VGEH 2VZOA 1E28A 4EN3D 2F53A 3ARBD 3ZHDA 2X9WA 1X5KA 4X99A 1ACYL 3WNPA 5T5FL 5EC1B 3EKCA 1TVHA 3SCMD 1ZE3C 1BM3L 5F9AC 4H8WH 3QUKB 4X9HA 4LVOB 1MH5A 2DBJA 4QRTB 2IADA 4JPIB 4R0LC 5M94B 5I1JL 5L88L 4H1LA 3RIFK 3TO2A 1LE5B 2WBJD 4FQQA 3RNKA 3CXHK 5I1AA 3EYVB 1U92A 5I1CH 4NRYB 4JDVA 5FM5O 3BPOB 1FL5A 3RZCC 4NQEE 5DR5L 5FDWA 1T83C 5C0BE 1SQ2N 5MEPA 5HYJD 5JXED 2Z4QB 1JGVL 1KPVA 3OQ3B 2DAVA 2YD8A 5IJKC 1YPZA 2XA8H 1RVFH 3SJVE 2DQEL 2A1WH 3B2UC 1BJ1J 1QFPA 4P46A 3P4NA 3GKZA 1GZPB 1F4YH 4XCYB 1UADC 4WVRA 1YA5A 3TYGL 3G04A 2HFGL 5GRUL 5AYUH 2LE9A 2EDLA 4LSPL 1PD6A 4PBWD 1S7WA 3WD5L 2AV7B 2XZAL 3BPCA 3QG7H 2ADGB 1NGWB 3OKKB 2VLKA 2WWMC 2EC9U 2XYCA 1T5XA 1S9WA 4KQ3L 3UROR 5IFAL 2LU3A 3RKDC 1CD1A 4G9FD 5J1SC 3RZWA 1FNEB 3Q3GB 1UFUA 2VDNH 1GGUA 4UOW1 4YDJB 4OZ4A 1A4JA 2GIYA 4WV1C