3LMOA

Crystal structure of specialized acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
b'TSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Specialized acyl carrier protein
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
total genus 30
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3lmoA00
2X2BA 2QNWA 2AFEA 2ROQA 2EHSA 4CA3A 2JU1A 4R0MA 1HQBA 4BPGA 1KLPA 2LIUA 1L0HA 2FQ1A 2MVVA 2XZ1C 1L0IA 3EJEA 5KP6B 2KORA 4BPHA 2KOPA 2FQ0A 4NEOA 4H2WC 5HVCA 2N5IA 1DV5A 2JQ4A 3EJDA 2LIWA 2LTEA 5EJDA 4MRTC 2MR8A 2CNRA 2DNWA 1NQ4A 2XZ0D 2AVAA 2PNGA 3EJBA 4IZ6A 2AFDA 2LPKA 4PWVB 2KGEA 2N98A 3CE7A 1VKUA 2MD9A 2L0QA 2LL8A 2EHTA 2KG8A 4PXHB 2GDYA 1ACPA 5HV8A 4H2XC 3GZMA 2FAEA 2N5HA 2KG6A 2FVAA 2CGQA 2KGDA 1T8KA 4HKGA 2L9FA 2VSQA 2M5RA 2MF4A 2KG9A 2KOOA 1F80D 1HY8A 2KGCA 4BPFA 2L22A 5CZDB 2FQ2A 3LMOA 2GDWA 2MR7A 2FVFA 1AF8A 2JGPA 2K92A 2K0XA 1OR5A 2N6YA 3GZLA 2K0YA 2AF8A 2KGAA 2KOSA 2K93A 2LOLA 2L4BA 2FVEA 2KW2A 2KWLA 2CG5B 2N50A 2CQ8A 2MY5A 2FADA 2K2QA 2JU2A 2K94A 2LKIA 1DNYA 4H2YC 2N6ZA 3RG2A 2MVUA 2LMLA 2KOQA 2FHSC 2GDXA 5KP7B 3NY7B 2FACA 2KR5A 1X3OA 4DG9A 5KP8B
chains in the Genus database with same CATH superfamily
3CCEP 2GZIA 4U0EA 2M8NA 2WPTA 4QNBA 1YJNP 2EHSA 4IPYA 1NJIQ 3G71P 3CPWO 3HZQA 1GXHA 2PENA 2MVVA 5KP6B 1FR2A 2FQ0A 1YITP 2XXMA 1VQKP 2PEOA 2MR8A 3DS4A 1NQ4A 2XZ0D 4U0AA 2L0QA 3G21A 3GKLC 1VQMP 2EHTA 2LF4A 2VLPA 2ERHA 5HV8A 2BHVA 2N5HA 3DS1A 2OTJP 1YIJP 2M5RA 5DCKA 2KOOA 3LMOA 2FVFA 1AF8A 1YI2P 1VQLP 1KQSO 5F2KA 1OR5A 5HGOA 4COCA 2K0YA 1M6EX 2N50A 1D1DA 5BS2A 2OTLP 1IMPA 2JYLA 2FADA 2JU2A 2JB0A 2NO8A 2QEXP 1M6NA 3B5IA 1EIAA 2EIAA 2FHSC 2PEQA 3NY7B 1IUQA 1A43A 3CD6P 2EFJA 1BAJA 4PH1A 2XT1A 2PEJA 3CCUP 4R0MA 3U43A 1L0HA 1RO2A 2KORA 1N8RQ 3RG6C 3G1GA 2EG5A 2JQ4A 3CCLP 1VHNA 4MRTC 4M0IA 2Z45A 1BXIA 3DS2A 4IZ6A 2AFDA 1RO0A 3CC7P 1AYIA 2GZGA 2L6EA 3CE7A 1VKUA 2MD9A 4XFZA 3CCVP 2LL8A 2KG8A 3WBHA 4PXHB 2PEIA 1QVGO 3DS5A 2L9FA 2VSQA 3DTJA 1KC8Q 2KG9A 2BUOA 1GXGA 1HY8A 2KGCA 4BPFA 5CZDB 1YJ9P 5HGMA 1MZ8A 1VQ4P 2JGPA 2JBGA 3OW2O 3M1MA 2N6YA 2XV6A 3DS3A 1Z6MA 2ONTA 4QKOA 5EW5E 1IMQA 1Q82Q 2K93A 2KW2A 2CG5B 4U0BA 3CCJP 2LKIA 1VQOP 3RG2A 2LMLA 2VLQA 2GDXA 5BS1A 1VQ6P 2FACA 1X3OA 5KP8B 5HGNA 2QNWA 1E6JP 4CA3A 2JU1A 1HQBA 1KLPA 2LIUA 1Q81Q 2FQ1A 3EJEA 3I56P 2GZJA 2M8PA 1S72P 4BPHA 2VLNA 1AUMA 3P05A 5HVCA 1DV5A 3EJDA 2LIWA 2GZFA 3G29A 3G6EP 2E1MA 2CNRA 4XROA 4WYMA 1E0HA 1K30A 2GZEA 7CEIA 2PNGA 4U0CA 2LPKA 3LRYA 3CCSP 4GR2A 4PWVB 4GR6A 2N98A 4UHPB 2KODA 1ACPA 4H2XC 4XFXA 2FVAA 4HKGA 5I4TG 3GJNA 1Q86Q 5JPAA 3E2DA 5HGLA 3NTEA 5F2NA 1F80D 1VQ8P 2L22A 2GDWA 2MR7A 1ZMBA 3CMAP 2K92A 2K0XA 1UJZA 1JJ2O 4U0FA 1VQ9P 2Z44A 3H47A 1ZNVA 2AF8A 2PEMA 2KOSA 2FVEA 1YJWP 3CCRP 1QRJA 2MY5A 2CWOA 3VRLC 4COPA 1YHQP 1DNYA 4H2YC 2N6ZA 1W2BO 1EMVA 2KR5A 3G28A 3CC2P 2M8LA 1RNIA 1VQ7P 3MGEA 2X2BA 3G1IA 3CXCO 2AFEA 2ROQA 3H0DA 4BPGA 3G26A 2P9XA 1M90Q 2XZ1C 3I55P 1QVFO 1L0IA 2KOPA 1M74A 4NEOA 4H2WC 2Z46A 2N5IA 2LTEA 1A8OA 1K9MQ 5EJDA 2DNWA 2AVAA 2K0DX 2PY8A 3EJBA 4U0DA 3H4EA 5F2OA 4PH0A 2KGEA 1VQ5P 1KD1Q 1UNKA 2K5XA 2QA4P 3CCQP 4XRQA 4F37A 2GDYA 1K73Q 3GZMA 3CC4P 2FAEA 3DS0A 1VQPP 1Q7YQ 2KG6A 2CGQA 2VLOA 2KGDA 1T8KA 3DPHA 3B4QA 2MF4A 3CCMP 2JAZA 3Q20A 3CMEP 2FQ2A 2JO0A 2JYGA 4XFYA 1GPJA 3GZLA 1M1KQ 2OARA 2PEKA 1K8AQ 2KGAA 2LOLA 2L4BA 2KWLA 2DGYA 3G0VA 2CQ8A 1CEIA 2K2QA 2K94A 1EOQA 2GYKA 3G4SP 2MVUA 1VQNP 2KOQA 3HYBA 5KP7B 4DG9A
chains in the Genus database with same CATH topology
2X2BA 2QNWA 2AFEA 2ROQA 2EHSA 4CA3A 2JU1A 4R0MA 1HQBA 4BPGA 1KLPA 2LIUA 1L0HA 2FQ1A 2MVVA 2XZ1C 1L0IA 3EJEA 5KP6B 2KORA 4BPHA 2KOPA 2FQ0A 4NEOA 4H2WC 5HVCA 2N5IA 1DV5A 2JQ4A 3EJDA 2LIWA 2LTEA 5EJDA 4MRTC 2MR8A 2CNRA 2DNWA 1NQ4A 2XZ0D 2AVAA 2PNGA 3EJBA 4IZ6A 2AFDA 2LPKA 4PWVB 2KGEA 2N98A 3CE7A 1VKUA 2MD9A 2L0QA 2LL8A 2EHTA 2KG8A 4PXHB 2GDYA 1ACPA 5HV8A 4H2XC 3GZMA 2FAEA 2N5HA 2KG6A 2FVAA 2CGQA 2KGDA 1T8KA 4HKGA 2L9FA 2VSQA 2M5RA 2MF4A 2KG9A 2KOOA 1F80D 1HY8A 2KGCA 4BPFA 2L22A 5CZDB 2FQ2A 3LMOA 2GDWA 2MR7A 2FVFA 1AF8A 2JGPA 2K92A 2K0XA 1OR5A 2N6YA 3GZLA 2K0YA 2AF8A 2KGAA 2KOSA 2K93A 2LOLA 2L4BA 2FVEA 2KW2A 2KWLA 2CG5B 2N50A 2CQ8A 2MY5A 2FADA 2K2QA 2JU2A 2K94A 2LKIA 1DNYA 4H2YC 2N6ZA 3RG2A 2MVUA 2LMLA 2KOQA 2FHSC 2GDXA 5KP7B 3NY7B 2FACA 2KR5A 1X3OA 4DG9A 5KP8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2B A;  2QNW A;  2AFE A;  2ROQ A;  2EHS A;  4CA3 A;  2JU1 A;  4R0M A;  1HQB A;  4BPG A;  1KLP A;  2LIU A;  1L0H A;  2FQ1 A;  2MVV A;  2XZ1 C;  1L0I A;  3EJE A;  5KP6 B;  2KOR A;  4BPH A;  2KOP A;  2FQ0 A;  4NEO A;  4H2W C;  5HVC A;  2N5I A;  1DV5 A;  2JQ4 A;  3EJD A;  2LIW A;  2LTE A;  5EJD A;  4MRT C;  2MR8 A;  2CNR A;  2DNW A;  1NQ4 A;  2XZ0 D;  2AVA A;  2PNG A;  3EJB A;  4IZ6 A;  2AFD A;  2LPK A;  4PWV B;  2KGE A;  2N98 A;  3CE7 A;  1VKU A;  2MD9 A;  2L0Q A;  2LL8 A;  2EHT A;  2KG8 A;  4PXH B;  2GDY A;  1ACP A;  5HV8 A;  4H2X C;  3GZM A;  2FAE A;  2N5H A;  2KG6 A;  2FVA A;  2CGQ A;  2KGD A;  1T8K A;  4HKG A;  2L9F A;  2VSQ A;  2M5R A;  2MF4 A;  2KG9 A;  2KOO A;  1F80 D;  1HY8 A;  2KGC A;  4BPF A;  2L22 A;  5CZD B;  2FQ2 A;  3LMO A;  2GDW A;  2MR7 A;  2FVF A;  1AF8 A;  2JGP A;  2K92 A;  2K0X A;  1OR5 A;  2N6Y A;  3GZL A;  2K0Y A;  2AF8 A;  2KGA A;  2KOS A;  2K93 A;  2LOL A;  2L4B A;  2FVE A;  2KW2 A;  2KWL A;  2CG5 B;  2N50 A;  2CQ8 A;  2MY5 A;  2FAD A;  2K2Q A;  2JU2 A;  2K94 A;  2LKI A;  1DNY A;  4H2Y C;  2N6Z A;  3RG2 A;  2MVU A;  2LML A;  2KOQ A;  2FHS C;  2GDX A;  5KP7 B;  3NY7 B;  2FAC A;  2KR5 A;  1X3O A;  4DG9 A;  5KP8 B; 
#chains in the Genus database with same CATH topology
 3CCE P;  2GZI A;  4U0E A;  2M8N A;  2WPT A;  4QNB A;  1YJN P;  2EHS A;  4IPY A;  1NJI Q;  3G71 P;  3CPW O;  3HZQ A;  1GXH A;  2PEN A;  2MVV A;  5KP6 B;  1FR2 A;  2FQ0 A;  1YIT P;  2XXM A;  1VQK P;  2PEO A;  2MR8 A;  3DS4 A;  1NQ4 A;  2XZ0 D;  4U0A A;  2L0Q A;  3G21 A;  3GKL C;  1VQM P;  2EHT A;  2LF4 A;  2VLP A;  2ERH A;  5HV8 A;  2BHV A;  2N5H A;  3DS1 A;  2OTJ P;  1YIJ P;  2M5R A;  5DCK A;  2KOO A;  3LMO A;  2FVF A;  1AF8 A;  1YI2 P;  1VQL P;  1KQS O;  5F2K A;  1OR5 A;  5HGO A;  4COC A;  2K0Y A;  1M6E X;  2N50 A;  1D1D A;  5BS2 A;  2OTL P;  1IMP A;  2JYL A;  2FAD A;  2JU2 A;  2JB0 A;  2NO8 A;  2QEX P;  1M6N A;  3B5I A;  1EIA A;  2EIA A;  2FHS C;  2PEQ A;  3NY7 B;  1IUQ A;  1A43 A;  3CD6 P;  2EFJ A;  1BAJ A;  4PH1 A;  2XT1 A;  2PEJ A;  3CCU P;  4R0M A;  3U43 A;  1L0H A;  1RO2 A;  2KOR A;  1N8R Q;  3RG6 C;  3G1G A;  2EG5 A;  2JQ4 A;  3CCL P;  1VHN A;  4MRT C;  4M0I A;  2Z45 A;  1BXI A;  3DS2 A;  4IZ6 A;  2AFD A;  1RO0 A;  3CC7 P;  1AYI A;  2GZG A;  2L6E A;  3CE7 A;  1VKU A;  2MD9 A;  4XFZ A;  3CCV P;  2LL8 A;  2KG8 A;  3WBH A;  4PXH B;  2PEI A;  1QVG O;  3DS5 A;  2L9F A;  2VSQ A;  3DTJ A;  1KC8 Q;  2KG9 A;  2BUO A;  1GXG A;  1HY8 A;  2KGC A;  4BPF A;  5CZD B;  1YJ9 P;  5HGM A;  1MZ8 A;  1VQ4 P;  2JGP A;  2JBG A;  3OW2 O;  3M1M A;  2N6Y A;  2XV6 A;  3DS3 A;  1Z6M A;  2ONT A;  4QKO A;  5EW5 E;  1IMQ A;  1Q82 Q;  2K93 A;  2KW2 A;  2CG5 B;  4U0B A;  3CCJ P;  2LKI A;  1VQO P;  3RG2 A;  2LML A;  2VLQ A;  2GDX A;  5BS1 A;  1VQ6 P;  2FAC A;  1X3O A;  5KP8 B;  5HGN A;  2QNW A;  1E6J P;  4CA3 A;  2JU1 A;  1HQB A;  1KLP A;  2LIU A;  1Q81 Q;  2FQ1 A;  3EJE A;  3I56 P;  2GZJ A;  2M8P A;  1S72 P;  4BPH A;  2VLN A;  1AUM A;  3P05 A;  5HVC A;  1DV5 A;  3EJD A;  2LIW A;  2GZF A;  3G29 A;  3G6E P;  2E1M A;  2CNR A;  4XRO A;  4WYM A;  1E0H A;  1K30 A;  2GZE A;  7CEI A;  2PNG A;  4U0C A;  2LPK A;  3LRY A;  3CCS P;  4GR2 A;  4PWV B;  4GR6 A;  2N98 A;  4UHP B;  2KOD A;  1ACP A;  4H2X C;  4XFX A;  2FVA A;  4HKG A;  5I4T G;  3GJN A;  1Q86 Q;  5JPA A;  3E2D A;  5HGL A;  3NTE A;  5F2N A;  1F80 D;  1VQ8 P;  2L22 A;  2GDW A;  2MR7 A;  1ZMB A;  3CMA P;  2K92 A;  2K0X A;  1UJZ A;  1JJ2 O;  4U0F A;  1VQ9 P;  2Z44 A;  3H47 A;  1ZNV A;  2AF8 A;  2PEM A;  2KOS A;  2FVE A;  1YJW P;  3CCR P;  1QRJ A;  2MY5 A;  2CWO A;  3VRL C;  4COP A;  1YHQ P;  1DNY A;  4H2Y C;  2N6Z A;  1W2B O;  1EMV A;  2KR5 A;  3G28 A;  3CC2 P;  2M8L A;  1RNI A;  1VQ7 P;  3MGE A;  2X2B A;  3G1I A;  3CXC O;  2AFE A;  2ROQ A;  3H0D A;  4BPG A;  3G26 A;  2P9X A;  1M90 Q;  2XZ1 C;  3I55 P;  1QVF O;  1L0I A;  2KOP A;  1M74 A;  4NEO A;  4H2W C;  2Z46 A;  2N5I A;  2LTE A;  1A8O A;  1K9M Q;  5EJD A;  2DNW A;  2AVA A;  2K0D X;  2PY8 A;  3EJB A;  4U0D A;  3H4E A;  5F2O A;  4PH0 A;  2KGE A;  1VQ5 P;  1KD1 Q;  1UNK A;  2K5X A;  2QA4 P;  3CCQ P;  4XRQ A;  4F37 A;  2GDY A;  1K73 Q;  3GZM A;  3CC4 P;  2FAE A;  3DS0 A;  1VQP P;  1Q7Y Q;  2KG6 A;  2CGQ A;  2VLO A;  2KGD A;  1T8K A;  3DPH A;  3B4Q A;  2MF4 A;  3CCM P;  2JAZ A;  3Q20 A;  3CME P;  2FQ2 A;  2JO0 A;  2JYG A;  4XFY A;  1GPJ A;  3GZL A;  1M1K Q;  2OAR A;  2PEK A;  1K8A Q;  2KGA A;  2LOL A;  2L4B A;  2KWL A;  2DGY A;  3G0V A;  2CQ8 A;  1CEI A;  2K2Q A;  2K94 A;  1EOQ A;  2GYK A;  3G4S P;  2MVU A;  1VQN P;  2KOQ A;  3HYB A;  5KP7 B;  4DG9 A; 
#chains in the Genus database with same CATH homology
 2X2B A;  2QNW A;  2AFE A;  2ROQ A;  2EHS A;  4CA3 A;  2JU1 A;  4R0M A;  1HQB A;  4BPG A;  1KLP A;  2LIU A;  1L0H A;  2FQ1 A;  2MVV A;  2XZ1 C;  1L0I A;  3EJE A;  5KP6 B;  2KOR A;  4BPH A;  2KOP A;  2FQ0 A;  4NEO A;  4H2W C;  5HVC A;  2N5I A;  1DV5 A;  2JQ4 A;  3EJD A;  2LIW A;  2LTE A;  5EJD A;  4MRT C;  2MR8 A;  2CNR A;  2DNW A;  1NQ4 A;  2XZ0 D;  2AVA A;  2PNG A;  3EJB A;  4IZ6 A;  2AFD A;  2LPK A;  4PWV B;  2KGE A;  2N98 A;  3CE7 A;  1VKU A;  2MD9 A;  2L0Q A;  2LL8 A;  2EHT A;  2KG8 A;  4PXH B;  2GDY A;  1ACP A;  5HV8 A;  4H2X C;  3GZM A;  2FAE A;  2N5H A;  2KG6 A;  2FVA A;  2CGQ A;  2KGD A;  1T8K A;  4HKG A;  2L9F A;  2VSQ A;  2M5R A;  2MF4 A;  2KG9 A;  2KOO A;  1F80 D;  1HY8 A;  2KGC A;  4BPF A;  2L22 A;  5CZD B;  2FQ2 A;  3LMO A;  2GDW A;  2MR7 A;  2FVF A;  1AF8 A;  2JGP A;  2K92 A;  2K0X A;  1OR5 A;  2N6Y A;  3GZL A;  2K0Y A;  2AF8 A;  2KGA A;  2KOS A;  2K93 A;  2LOL A;  2L4B A;  2FVE A;  2KW2 A;  2KWL A;  2CG5 B;  2N50 A;  2CQ8 A;  2MY5 A;  2FAD A;  2K2Q A;  2JU2 A;  2K94 A;  2LKI A;  1DNY A;  4H2Y C;  2N6Z A;  3RG2 A;  2MVU A;  2LML A;  2KOQ A;  2FHS C;  2GDX A;  5KP7 B;  3NY7 B;  2FAC A;  2KR5 A;  1X3O A;  4DG9 A;  5KP8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...