3LMOA

Crystal structure of specialized acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
TSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
total genus 30
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3lmoA00
3GZMA 2FACA 5EJDA 4CA3A 2KG8A 2MVVA 5KP6B 2LMLA 2LL8A 2N5IA 4DG9A 2KGAA 3GZLA 1OR5A 2KOOA 2ROQA 2KR5A 2K2QA 3EJBA 4HKGA 4PXHB 3RG2A 2KOQA 1HQBA 2KW2A 2FHSC 2VSQA 2KORA 2K0YA 4BPHA 2JQ4A 3EJEA 2N5HA 2LTEA 2LIUA 2LIWA 2EHTA 5HV8A 2N50A 3NY7B 2FQ0A 4PWVB 2QNWA 2GDYA 2CGQA 2L9FA 2AF8A 2MVUA 2XZ1C 2DNWA 2N6YA 4IZ6A 2KOSA 2KG6A 2MD9A 2JGPA 1NQ4A 2L4BA 1VKUA 2KWLA 2MR7A 2N6ZA 5KP7B 5KP8B 4H2WC 2FAEA 2FADA 1DV5A 2FVFA 2LOLA 2KGEA 2JU2A 2K93A 2AFEA 2JU1A 3CE7A 1KLPA 2PNGA 2AVAA 2LPKA 1DNYA 1L0IA 2K0XA 2KOPA 1HY8A 2AFDA 2L22A 4R0MA 5CZDB 2FVAA 2GDWA 1ACPA 5HVCA 1F80D 4NEOA 1AF8A 1X3OA 2FVEA 2L0QA 2CQ8A 3LMOA 2MR8A 1L0HA 2K94A 4MRTC 4BPGA 4BPFA 2LKIA 2EHSA 2MY5A 1T8KA 2CG5B 2GDXA 2XZ0D 3EJDA 2KGDA 2MF4A 2X2BA 4H2YC 2KG9A 2N98A 2M5RA 2FQ1A 2KGCA 2CNRA 2FQ2A 4H2XC 2K92A
chains in the Genus database with same CATH superfamily
1E6JP 2FACA 2MVVA 2GZIA 2LMLA 3HZQA 3CCVP 2N5IA 1YITP 1VQ5P 2KR5A 3CC4P 3CCLP 4HKGA 4PXHB 5BS2A 4QNBA 3G1GA 2VSQA 4XFZA 1JJ2O 2LTEA 2LIUA 2EHTA 3B5IA 3G4SP 1A43A 2CGQA 2GZFA 3CCUP 5DCKA 5HGOA 3DS0A 2XZ1C 3M1MA 3CMEP 2MD9A 2JGPA 2KWLA 1BXIA 1D1DA 2XT1A 5JPAA 5KP7B 2BUOA 5KP8B 4H2WC 4XROA 2OARA 1K8AQ 2FVFA 3B4QA 2K93A 2JYGA 1Z6MA 3G0VA 1KLPA 3Q20A 2AVAA 1K30A 2LPKA 1YI2P 1E0HA 2K0XA 1K9MQ 2KOPA 1HY8A 4R0MA 2GDWA 2GZJA 2L6EA 5HVCA 2M8NA 2NO8A 5BS1A 1K73Q 2CWOA 3RG6C 2K94A 2CG5B 3I55P 5HGNA 2Z44A 2X2BA 4H2YC 2KGCA 2M5RA 1EIAA 2GYKA 1IMQA 2FQ2A 3GZMA 3CXCO 3NTEA 4CA3A 4GR6A 1VQOP 1Q7YQ 4IPYA 3CCQP 3CCRP 2KODA 4DG9A 1GXGA 2KGAA 3GZLA 1OR5A 2ROQA 1VQKP 4GR2A 1M74A 1BAJA 3EJBA 2GZEA 1M1KQ 1IUQA 1VQPP 3CCJP 3RG2A 1HQBA 3G28A 4U0CA 2Z46A 4U0AA 4COPA 1M6NA 3GKLC 2N50A 1UNKA 2QNWA 2AF8A 2MVUA 1KC8Q 5I4TG 2N6YA 3G1IA 2PY8A 2JB0A 2KG6A 2L4BA 2ERHA 4COCA 1QVFO 2FADA 2K5XA 3G21A 1DV5A 2PEJA 2JU1A 3CE7A 2PNGA 3H4EA 1VHNA 3U43A 3G6EP 4U0FA 5CZDB 3DS1A 1X3OA 2FVEA 3H47A 2L0QA 3LMOA 3DS3A 1VQMP 4MRTC 3HYBA 4BPGA 3CC7P 2XXMA 3CCMP 1T8KA 4WYMA 3EJDA 2P9XA 2DGYA 1VQ9P 2N98A 2PENA 3CC2P 2CNRA 4H2XC 2E1MA 2K92A 3P05A 3DS5A 3I56P 2KG8A 2XV6A 1QRJA 1VQLP 1AUMA 2KOOA 1UJZA 2JYLA 2WPTA 3DS2A 1Q81Q 3H0DA 3CMAP 2PEMA 1M90Q 2KORA 4UHPB 2LIWA 2VLNA 3CPWO 1FR2A 3NY7B 2FQ0A 4PWVB 2OTLP 2GDYA 2L9FA 3DPHA 2LF4A 1GXHA 4QKOA 4XFXA 2DNWA 1RO0A 3VRLC 2M8PA 1NQ4A 1VKUA 2PEKA 2MR7A 1VQ6P 2EIAA 5F2NA 2FAEA 1KQSO 1W2BO 2LOLA 2AFEA 3G71P 3G26A 4XRQA 1VQNP 4U0EA 2ONTA 2AFDA 1YHQP 1YJWP 1ACPA 2FVAA 1F80D 1AF8A 1NJIQ 3GJNA 1EMVA 4PH0A 2CQ8A 1L0HA 2GZGA 2LKIA 2MY5A 1YJ9P 1Q86Q 3DS4A 2GDXA 2XZ0D 2KGDA 4U0DA 1N8RQ 3CD6P 1VQ4P 3MGEA 5EJDA 2BHVA 5HGMA 2VLOA 5KP6B 2PEQA 2QEXP 1A8OA 3WBHA 2LL8A 1ZMBA 1RO2A 1RNIA 2K2QA 4PH1A 2M8LA 1CEIA 2KOQA 2KW2A 2FHSC 1MZ8A 2K0YA 3DTJA 4BPHA 2JQ4A 3EJEA 2N5HA 1QVGO 5HV8A 1EOQA 1YIJP 1AYIA 2PEOA 3LRYA 5F2OA 1YJNP 4IZ6A 2KOSA 1ZNVA 4U0BA 4M0IA 2N6ZA 4F37A 1GPJA 3E2DA 2OTJP 2K0DX 3CCSP 1KD1Q 5F2KA 2KGEA 2JU2A 1VQ7P 1S72P 2EG5A 2JBGA 1DNYA 1L0IA 4XFYA 2L22A 2EFJA 4NEOA 2Z45A 7CEIA 3CCEP 2MR8A 5HGLA 2VLPA 4BPFA 1IMPA 1Q82Q 1M6EX 2EHSA 5EW5E 2JAZA 2VLQA 2JO0A 2PEIA 1VQ8P 2MF4A 2QA4P 2KG9A 2FQ1A 3G29A 3OW2O
chains in the Genus database with same CATH topology
3GZMA 2FACA 5EJDA 4CA3A 2KG8A 2MVVA 5KP6B 2LMLA 2LL8A 2N5IA 4DG9A 2KGAA 3GZLA 1OR5A 2KOOA 2ROQA 2KR5A 2K2QA 3EJBA 4HKGA 4PXHB 3RG2A 2KOQA 1HQBA 2KW2A 2FHSC 2VSQA 2KORA 2K0YA 4BPHA 2JQ4A 3EJEA 2N5HA 2LTEA 2LIUA 2LIWA 2EHTA 5HV8A 2N50A 3NY7B 2FQ0A 4PWVB 2QNWA 2GDYA 2CGQA 2L9FA 2AF8A 2MVUA 2XZ1C 2DNWA 2N6YA 4IZ6A 2KOSA 2KG6A 2MD9A 2JGPA 1NQ4A 2L4BA 1VKUA 2KWLA 2MR7A 2N6ZA 5KP7B 5KP8B 4H2WC 2FAEA 2FADA 1DV5A 2FVFA 2LOLA 2KGEA 2JU2A 2K93A 2AFEA 2JU1A 3CE7A 1KLPA 2PNGA 2AVAA 2LPKA 1DNYA 1L0IA 2K0XA 2KOPA 1HY8A 2AFDA 2L22A 4R0MA 5CZDB 2FVAA 2GDWA 1ACPA 5HVCA 1F80D 4NEOA 1AF8A 1X3OA 2FVEA 2L0QA 2CQ8A 3LMOA 2MR8A 1L0HA 2K94A 4MRTC 4BPGA 4BPFA 2LKIA 2EHSA 2MY5A 1T8KA 2CG5B 2GDXA 2XZ0D 3EJDA 2KGDA 2MF4A 2X2BA 4H2YC 2KG9A 2N98A 2M5RA 2FQ1A 2KGCA 2CNRA 2FQ2A 4H2XC 2K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZM A;  2FAC A;  5EJD A;  4CA3 A;  2KG8 A;  2MVV A;  5KP6 B;  2LML A;  2LL8 A;  2N5I A;  4DG9 A;  2KGA A;  3GZL A;  1OR5 A;  2KOO A;  2ROQ A;  2KR5 A;  2K2Q A;  3EJB A;  4HKG A;  4PXH B;  3RG2 A;  2KOQ A;  1HQB A;  2KW2 A;  2FHS C;  2VSQ A;  2KOR A;  2K0Y A;  4BPH A;  2JQ4 A;  3EJE A;  2N5H A;  2LTE A;  2LIU A;  2LIW A;  2EHT A;  5HV8 A;  2N50 A;  3NY7 B;  2FQ0 A;  4PWV B;  2QNW A;  2GDY A;  2CGQ A;  2L9F A;  2AF8 A;  2MVU A;  2XZ1 C;  2DNW A;  2N6Y A;  4IZ6 A;  2KOS A;  2KG6 A;  2MD9 A;  2JGP A;  1NQ4 A;  2L4B A;  1VKU A;  2KWL A;  2MR7 A;  2N6Z A;  5KP7 B;  5KP8 B;  4H2W C;  2FAE A;  2FAD A;  1DV5 A;  2FVF A;  2LOL A;  2KGE A;  2JU2 A;  2K93 A;  2AFE A;  2JU1 A;  3CE7 A;  1KLP A;  2PNG A;  2AVA A;  2LPK A;  1DNY A;  1L0I A;  2K0X A;  2KOP A;  1HY8 A;  2AFD A;  2L22 A;  4R0M A;  5CZD B;  2FVA A;  2GDW A;  1ACP A;  5HVC A;  1F80 D;  4NEO A;  1AF8 A;  1X3O A;  2FVE A;  2L0Q A;  2CQ8 A;  3LMO A;  2MR8 A;  1L0H A;  2K94 A;  4MRT C;  4BPG A;  4BPF A;  2LKI A;  2EHS A;  2MY5 A;  1T8K A;  2CG5 B;  2GDX A;  2XZ0 D;  3EJD A;  2KGD A;  2MF4 A;  2X2B A;  4H2Y C;  2KG9 A;  2N98 A;  2M5R A;  2FQ1 A;  2KGC A;  2CNR A;  2FQ2 A;  4H2X C;  2K92 A; 
#chains in the Genus database with same CATH topology
 1E6J P;  2FAC A;  2MVV A;  2GZI A;  2LML A;  3HZQ A;  3CCV P;  2N5I A;  1YIT P;  1VQ5 P;  2KR5 A;  3CC4 P;  3CCL P;  4HKG A;  4PXH B;  5BS2 A;  4QNB A;  3G1G A;  2VSQ A;  4XFZ A;  1JJ2 O;  2LTE A;  2LIU A;  2EHT A;  3B5I A;  3G4S P;  1A43 A;  2CGQ A;  2GZF A;  3CCU P;  5DCK A;  5HGO A;  3DS0 A;  2XZ1 C;  3M1M A;  3CME P;  2MD9 A;  2JGP A;  2KWL A;  1BXI A;  1D1D A;  2XT1 A;  5JPA A;  5KP7 B;  2BUO A;  5KP8 B;  4H2W C;  4XRO A;  2OAR A;  1K8A Q;  2FVF A;  3B4Q A;  2K93 A;  2JYG A;  1Z6M A;  3G0V A;  1KLP A;  3Q20 A;  2AVA A;  1K30 A;  2LPK A;  1YI2 P;  1E0H A;  2K0X A;  1K9M Q;  2KOP A;  1HY8 A;  4R0M A;  2GDW A;  2GZJ A;  2L6E A;  5HVC A;  2M8N A;  2NO8 A;  5BS1 A;  1K73 Q;  2CWO A;  3RG6 C;  2K94 A;  2CG5 B;  3I55 P;  5HGN A;  2Z44 A;  2X2B A;  4H2Y C;  2KGC A;  2M5R A;  1EIA A;  2GYK A;  1IMQ A;  2FQ2 A;  3GZM A;  3CXC O;  3NTE A;  4CA3 A;  4GR6 A;  1VQO P;  1Q7Y Q;  4IPY A;  3CCQ P;  3CCR P;  2KOD A;  4DG9 A;  1GXG A;  2KGA A;  3GZL A;  1OR5 A;  2ROQ A;  1VQK P;  4GR2 A;  1M74 A;  1BAJ A;  3EJB A;  2GZE A;  1M1K Q;  1IUQ A;  1VQP P;  3CCJ P;  3RG2 A;  1HQB A;  3G28 A;  4U0C A;  2Z46 A;  4U0A A;  4COP A;  1M6N A;  3GKL C;  2N50 A;  1UNK A;  2QNW A;  2AF8 A;  2MVU A;  1KC8 Q;  5I4T G;  2N6Y A;  3G1I A;  2PY8 A;  2JB0 A;  2KG6 A;  2L4B A;  2ERH A;  4COC A;  1QVF O;  2FAD A;  2K5X A;  3G21 A;  1DV5 A;  2PEJ A;  2JU1 A;  3CE7 A;  2PNG A;  3H4E A;  1VHN A;  3U43 A;  3G6E P;  4U0F A;  5CZD B;  3DS1 A;  1X3O A;  2FVE A;  3H47 A;  2L0Q A;  3LMO A;  3DS3 A;  1VQM P;  4MRT C;  3HYB A;  4BPG A;  3CC7 P;  2XXM A;  3CCM P;  1T8K A;  4WYM A;  3EJD A;  2P9X A;  2DGY A;  1VQ9 P;  2N98 A;  2PEN A;  3CC2 P;  2CNR A;  4H2X C;  2E1M A;  2K92 A;  3P05 A;  3DS5 A;  3I56 P;  2KG8 A;  2XV6 A;  1QRJ A;  1VQL P;  1AUM A;  2KOO A;  1UJZ A;  2JYL A;  2WPT A;  3DS2 A;  1Q81 Q;  3H0D A;  3CMA P;  2PEM A;  1M90 Q;  2KOR A;  4UHP B;  2LIW A;  2VLN A;  3CPW O;  1FR2 A;  3NY7 B;  2FQ0 A;  4PWV B;  2OTL P;  2GDY A;  2L9F A;  3DPH A;  2LF4 A;  1GXH A;  4QKO A;  4XFX A;  2DNW A;  1RO0 A;  3VRL C;  2M8P A;  1NQ4 A;  1VKU A;  2PEK A;  2MR7 A;  1VQ6 P;  2EIA A;  5F2N A;  2FAE A;  1KQS O;  1W2B O;  2LOL A;  2AFE A;  3G71 P;  3G26 A;  4XRQ A;  1VQN P;  4U0E A;  2ONT A;  2AFD A;  1YHQ P;  1YJW P;  1ACP A;  2FVA A;  1F80 D;  1AF8 A;  1NJI Q;  3GJN A;  1EMV A;  4PH0 A;  2CQ8 A;  1L0H A;  2GZG A;  2LKI A;  2MY5 A;  1YJ9 P;  1Q86 Q;  3DS4 A;  2GDX A;  2XZ0 D;  2KGD A;  4U0D A;  1N8R Q;  3CD6 P;  1VQ4 P;  3MGE A;  5EJD A;  2BHV A;  5HGM A;  2VLO A;  5KP6 B;  2PEQ A;  2QEX P;  1A8O A;  3WBH A;  2LL8 A;  1ZMB A;  1RO2 A;  1RNI A;  2K2Q A;  4PH1 A;  2M8L A;  1CEI A;  2KOQ A;  2KW2 A;  2FHS C;  1MZ8 A;  2K0Y A;  3DTJ A;  4BPH A;  2JQ4 A;  3EJE A;  2N5H A;  1QVG O;  5HV8 A;  1EOQ A;  1YIJ P;  1AYI A;  2PEO A;  3LRY A;  5F2O A;  1YJN P;  4IZ6 A;  2KOS A;  1ZNV A;  4U0B A;  4M0I A;  2N6Z A;  4F37 A;  1GPJ A;  3E2D A;  2OTJ P;  2K0D X;  3CCS P;  1KD1 Q;  5F2K A;  2KGE A;  2JU2 A;  1VQ7 P;  1S72 P;  2EG5 A;  2JBG A;  1DNY A;  1L0I A;  4XFY A;  2L22 A;  2EFJ A;  4NEO A;  2Z45 A;  7CEI A;  3CCE P;  2MR8 A;  5HGL A;  2VLP A;  4BPF A;  1IMP A;  1Q82 Q;  1M6E X;  2EHS A;  5EW5 E;  2JAZ A;  2VLQ A;  2JO0 A;  2PEI A;  1VQ8 P;  2MF4 A;  2QA4 P;  2KG9 A;  2FQ1 A;  3G29 A;  3OW2 O; 
#chains in the Genus database with same CATH homology
 3GZM A;  2FAC A;  5EJD A;  4CA3 A;  2KG8 A;  2MVV A;  5KP6 B;  2LML A;  2LL8 A;  2N5I A;  4DG9 A;  2KGA A;  3GZL A;  1OR5 A;  2KOO A;  2ROQ A;  2KR5 A;  2K2Q A;  3EJB A;  4HKG A;  4PXH B;  3RG2 A;  2KOQ A;  1HQB A;  2KW2 A;  2FHS C;  2VSQ A;  2KOR A;  2K0Y A;  4BPH A;  2JQ4 A;  3EJE A;  2N5H A;  2LTE A;  2LIU A;  2LIW A;  2EHT A;  5HV8 A;  2N50 A;  3NY7 B;  2FQ0 A;  4PWV B;  2QNW A;  2GDY A;  2CGQ A;  2L9F A;  2AF8 A;  2MVU A;  2XZ1 C;  2DNW A;  2N6Y A;  4IZ6 A;  2KOS A;  2KG6 A;  2MD9 A;  2JGP A;  1NQ4 A;  2L4B A;  1VKU A;  2KWL A;  2MR7 A;  2N6Z A;  5KP7 B;  5KP8 B;  4H2W C;  2FAE A;  2FAD A;  1DV5 A;  2FVF A;  2LOL A;  2KGE A;  2JU2 A;  2K93 A;  2AFE A;  2JU1 A;  3CE7 A;  1KLP A;  2PNG A;  2AVA A;  2LPK A;  1DNY A;  1L0I A;  2K0X A;  2KOP A;  1HY8 A;  2AFD A;  2L22 A;  4R0M A;  5CZD B;  2FVA A;  2GDW A;  1ACP A;  5HVC A;  1F80 D;  4NEO A;  1AF8 A;  1X3O A;  2FVE A;  2L0Q A;  2CQ8 A;  3LMO A;  2MR8 A;  1L0H A;  2K94 A;  4MRT C;  4BPG A;  4BPF A;  2LKI A;  2EHS A;  2MY5 A;  1T8K A;  2CG5 B;  2GDX A;  2XZ0 D;  3EJD A;  2KGD A;  2MF4 A;  2X2B A;  4H2Y C;  2KG9 A;  2N98 A;  2M5R A;  2FQ1 A;  2KGC A;  2CNR A;  2FQ2 A;  4H2X C;  2K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...