3LMOA

Crystal structure of specialized acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
TSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Specialized acyl carrier protein
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
total genus 30
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3lmoA00
4PWVB 1ACPA 2FQ0A 3LMOA 2MF4A 2L0QA 1L0HA 2LKIA 2K0XA 2KOSA 2DNWA 2KGDA 5KP7B 4MRTC 3GZMA 2N50A 3GZLA 2CG5B 2AFEA 4H2WC 4H2XC 2XZ1C 2VSQA 2JGPA 2KGCA 2CGQA 2AF8A 5KP8B 1L0IA 1AF8A 2KG6A 2FVFA 2L4BA 2LPKA 1KLPA 3NY7B 1NQ4A 4H2YC 2KG9A 1HQBA 2PNGA 2KGEA 2JU2A 2LOLA 2FADA 2MD9A 2FVAA 2N98A 2KOQA 4BPHA 2MVUA 4DG9A 3EJDA 2N6ZA 2N5HA 2LIUA 2X2BA 5KP6B 4PXHB 2FQ1A 2FAEA 2LIWA 2K93A 1OR5A 2CNRA 5EJDA 3RG2A 2LMLA 2AFDA 2GDXA 1DV5A 2L9FA 4BPGA 5CZDB 2KGAA 2EHSA 2GDWA 2XZ0D 2KORA 2LL8A 5HV8A 2EHTA 2MVVA 2JQ4A 4IZ6A 2GDYA 1T8KA 2K94A 3EJBA 1HY8A 2FACA 2M5RA 2L22A 4CA3A 2AVAA 2KG8A 1VKUA 2KW2A 2K0YA 2N6YA 2JU1A 2K92A 1F80D 2FVEA 4HKGA 2FQ2A 1X3OA 4R0MA 2QNWA 2MR7A 4BPFA 5HVCA 2KOOA 3EJEA 2N5IA 2KOPA 2FHSC 2MR8A 4NEOA 2CQ8A 2LTEA 2KWLA 2KR5A 1DNYA 2MY5A 3CE7A 2K2QA 2ROQA
chains in the Genus database with same CATH superfamily
1AUMA 2WPTA 1MZ8A 2L0QA 1L0HA 2LKIA 3CMEP 2PEQA 2K0XA 2KGDA 3CXCO 5KP7B 2P9XA 3GZMA 1QVFO 2AFEA 2CG5B 4H2XC 2VLNA 3CCUP 2JGPA 2CGQA 2AF8A 3G4SP 5KP8B 3CPWO 2Z46A 1HQBA 2PNGA 1VQ8P 1IMPA 2FADA 1K9MQ 4DG9A 4BPHA 1CEIA 1RNIA 2MVUA 3EJDA 2N5HA 2LIUA 4UHPB 4PXHB 2ONTA 2EIAA 3P05A 2M8LA 4U0CA 5EJDA 3RG2A 2LMLA 1UNKA 3G1GA 1E0HA 4BPGA 7CEIA 3G1IA 3CMAP 1VQKP 1BAJA 1GPJA 1M6EX 2OTJP 2M8NA 1RO2A 2ERHA 1YJ9P 1A8OA 2K94A 5HGMA 5JPAA 3DS0A 4CA3A 2EG5A 2OARA 2K0YA 1F80D 2FVEA 4HKGA 4R0MA 4XFYA 3I56P 2LF4A 1VQ9P 2OTLP 2LTEA 2JYLA 2KR5A 2MY5A 1RO0A 1Q82Q 1KQSO 5F2NA 2MF4A 2PEMA 1VQ6P 2DGYA 1Q86Q 3H47A 4MRTC 3G71P 3CCRP 2QEXP 2EFJA 3CCLP 2VLQA 2XZ1C 1IUQA 3DS2A 3CCQP 2KG6A 1KLPA 1NQ4A 3GKLC 4H2YC 3Q20A 3NTEA 2LOLA 5DCKA 2MD9A 2PEOA 2KOQA 2N6ZA 1EIAA 1M74A 2X2BA 3DPHA 4U0AA 5HGLA 1JJ2O 2VLOA 3CCMP 4IPYA 2L9FA 1VQ4P 2GZFA 4XFXA 3G29A 2EHSA 2GDWA 3HZQA 3CC4P 2XV6A 1K73Q 4IZ6A 4QKOA 3DS3A 3B4QA 1ZNVA 3DS1A 3H4EA 3EJBA 3GJNA 1QVGO 4M0IA 1YHQP 3CCEP 1ZMBA 2N6YA 2JU1A 2K92A 1M90Q 2QNWA 3U43A 4GR2A 5F2OA 2KOPA 4NEOA 2VLPA 1DNYA 1S72P 2JO0A 3CE7A 2ROQA 1GXGA 3CC7P 3LMOA 2KOSA 1YITP 1Z6MA 2DNWA 1E6JP 4PH1A 2GZJA 1YJWP 4QNBA 5HGOA 3GZLA 2BHVA 2VSQA 2JYGA 1AF8A 1M6NA 2LPKA 3NY7B 1GXHA 1IMQA 2KG9A 2KGEA 3MGEA 2JU2A 4U0FA 2PEKA 3H0DA 2N98A 1D1DA 2GZGA 4COCA 1QRJA 3OW2O 1VQOP 2FAEA 2LIWA 1EMVA 2K93A 4XRQA 5BS2A 1VQLP 2AFDA 2GDXA 1DV5A 2M8PA 1Q7YQ 4F37A 1K30A 3CCJP 2JAZA 2KGAA 5EW5E 2XZ0D 3E2DA 3DS4A 3G6EP 2MVVA 2GDYA 4XFZA 1NJIQ 1HY8A 1YIJP 3B5IA 3G28A 2FACA 2AVAA 2KG8A 2KW2A 2FQ2A 4WYMA 5HVCA 2KOOA 2FHSC 2PEIA 2MR8A 2CQ8A 2KWLA 2GYKA 2XT1A 1YI2P 2K2QA 2NO8A 1KC8Q 2Z45A 2Z44A 4PWVB 1ACPA 5I4TG 2BUOA 2FQ0A 1UJZA 1BXIA 3HYBA 1AYIA 1EOQA 1VQMP 2N50A 4GR6A 4H2WC 1A43A 2PEJA 3DS5A 1VQ7P 2CWOA 2KGCA 3G26A 3VRLC 4PH0A 1L0IA 4U0BA 1Q81Q 4COPA 2FVFA 2L4BA 3CCSP 2E1MA 3WBHA 3M1MA 1VQPP 5HGNA 2FVAA 3G21A 2PENA 3I55P 5KP6B 1FR2A 1VHNA 2FQ1A 1OR5A 1KD1Q 2CNRA 5BS1A 3RG6C 2XXMA 2K0DX 3DTJA 5CZDB 1K8AQ 3G0VA 2KORA 2JB0A 2LL8A 5HV8A 1M1KQ 2EHTA 4U0EA 2JQ4A 1T8KA 2PY8A 4XROA 2GZIA 3CC2P 2JBGA 2M5RA 2L22A 1YJNP 1VKUA 1N8RQ 2KODA 2QA4P 1X3OA 5F2KA 2GZEA 2MR7A 2L6EA 4BPFA 2K5XA 3EJEA 4U0DA 2N5IA 3CD6P 3CCVP 1W2BO 1VQ5P 3LRYA 1VQNP
chains in the Genus database with same CATH topology
4PWVB 1ACPA 2FQ0A 3LMOA 2MF4A 2L0QA 1L0HA 2LKIA 2K0XA 2KOSA 2DNWA 2KGDA 5KP7B 4MRTC 3GZMA 2N50A 3GZLA 2CG5B 2AFEA 4H2WC 4H2XC 2XZ1C 2VSQA 2JGPA 2KGCA 2CGQA 2AF8A 5KP8B 1L0IA 1AF8A 2KG6A 2FVFA 2L4BA 2LPKA 1KLPA 3NY7B 1NQ4A 4H2YC 2KG9A 1HQBA 2PNGA 2KGEA 2JU2A 2LOLA 2FADA 2MD9A 2FVAA 2N98A 2KOQA 4BPHA 2MVUA 4DG9A 3EJDA 2N6ZA 2N5HA 2LIUA 2X2BA 5KP6B 4PXHB 2FQ1A 2FAEA 2LIWA 2K93A 1OR5A 2CNRA 5EJDA 3RG2A 2LMLA 2AFDA 2GDXA 1DV5A 2L9FA 4BPGA 5CZDB 2KGAA 2EHSA 2GDWA 2XZ0D 2KORA 2LL8A 5HV8A 2EHTA 2MVVA 2JQ4A 4IZ6A 2GDYA 1T8KA 2K94A 3EJBA 1HY8A 2FACA 2M5RA 2L22A 4CA3A 2AVAA 2KG8A 1VKUA 2KW2A 2K0YA 2N6YA 2JU1A 2K92A 1F80D 2FVEA 4HKGA 2FQ2A 1X3OA 4R0MA 2QNWA 2MR7A 4BPFA 5HVCA 2KOOA 3EJEA 2N5IA 2KOPA 2FHSC 2MR8A 4NEOA 2CQ8A 2LTEA 2KWLA 2KR5A 1DNYA 2MY5A 3CE7A 2K2QA 2ROQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWV B;  1ACP A;  2FQ0 A;  3LMO A;  2MF4 A;  2L0Q A;  1L0H A;  2LKI A;  2K0X A;  2KOS A;  2DNW A;  2KGD A;  5KP7 B;  4MRT C;  3GZM A;  2N50 A;  3GZL A;  2CG5 B;  2AFE A;  4H2W C;  4H2X C;  2XZ1 C;  2VSQ A;  2JGP A;  2KGC A;  2CGQ A;  2AF8 A;  5KP8 B;  1L0I A;  1AF8 A;  2KG6 A;  2FVF A;  2L4B A;  2LPK A;  1KLP A;  3NY7 B;  1NQ4 A;  4H2Y C;  2KG9 A;  1HQB A;  2PNG A;  2KGE A;  2JU2 A;  2LOL A;  2FAD A;  2MD9 A;  2FVA A;  2N98 A;  2KOQ A;  4BPH A;  2MVU A;  4DG9 A;  3EJD A;  2N6Z A;  2N5H A;  2LIU A;  2X2B A;  5KP6 B;  4PXH B;  2FQ1 A;  2FAE A;  2LIW A;  2K93 A;  1OR5 A;  2CNR A;  5EJD A;  3RG2 A;  2LML A;  2AFD A;  2GDX A;  1DV5 A;  2L9F A;  4BPG A;  5CZD B;  2KGA A;  2EHS A;  2GDW A;  2XZ0 D;  2KOR A;  2LL8 A;  5HV8 A;  2EHT A;  2MVV A;  2JQ4 A;  4IZ6 A;  2GDY A;  1T8K A;  2K94 A;  3EJB A;  1HY8 A;  2FAC A;  2M5R A;  2L22 A;  4CA3 A;  2AVA A;  2KG8 A;  1VKU A;  2KW2 A;  2K0Y A;  2N6Y A;  2JU1 A;  2K92 A;  1F80 D;  2FVE A;  4HKG A;  2FQ2 A;  1X3O A;  4R0M A;  2QNW A;  2MR7 A;  4BPF A;  5HVC A;  2KOO A;  3EJE A;  2N5I A;  2KOP A;  2FHS C;  2MR8 A;  4NEO A;  2CQ8 A;  2LTE A;  2KWL A;  2KR5 A;  1DNY A;  2MY5 A;  3CE7 A;  2K2Q A;  2ROQ A; 
#chains in the Genus database with same CATH topology
 1AUM A;  2WPT A;  1MZ8 A;  2L0Q A;  1L0H A;  2LKI A;  3CME P;  2PEQ A;  2K0X A;  2KGD A;  3CXC O;  5KP7 B;  2P9X A;  3GZM A;  1QVF O;  2AFE A;  2CG5 B;  4H2X C;  2VLN A;  3CCU P;  2JGP A;  2CGQ A;  2AF8 A;  3G4S P;  5KP8 B;  3CPW O;  2Z46 A;  1HQB A;  2PNG A;  1VQ8 P;  1IMP A;  2FAD A;  1K9M Q;  4DG9 A;  4BPH A;  1CEI A;  1RNI A;  2MVU A;  3EJD A;  2N5H A;  2LIU A;  4UHP B;  4PXH B;  2ONT A;  2EIA A;  3P05 A;  2M8L A;  4U0C A;  5EJD A;  3RG2 A;  2LML A;  1UNK A;  3G1G A;  1E0H A;  4BPG A;  7CEI A;  3G1I A;  3CMA P;  1VQK P;  1BAJ A;  1GPJ A;  1M6E X;  2OTJ P;  2M8N A;  1RO2 A;  2ERH A;  1YJ9 P;  1A8O A;  2K94 A;  5HGM A;  5JPA A;  3DS0 A;  4CA3 A;  2EG5 A;  2OAR A;  2K0Y A;  1F80 D;  2FVE A;  4HKG A;  4R0M A;  4XFY A;  3I56 P;  2LF4 A;  1VQ9 P;  2OTL P;  2LTE A;  2JYL A;  2KR5 A;  2MY5 A;  1RO0 A;  1Q82 Q;  1KQS O;  5F2N A;  2MF4 A;  2PEM A;  1VQ6 P;  2DGY A;  1Q86 Q;  3H47 A;  4MRT C;  3G71 P;  3CCR P;  2QEX P;  2EFJ A;  3CCL P;  2VLQ A;  2XZ1 C;  1IUQ A;  3DS2 A;  3CCQ P;  2KG6 A;  1KLP A;  1NQ4 A;  3GKL C;  4H2Y C;  3Q20 A;  3NTE A;  2LOL A;  5DCK A;  2MD9 A;  2PEO A;  2KOQ A;  2N6Z A;  1EIA A;  1M74 A;  2X2B A;  3DPH A;  4U0A A;  5HGL A;  1JJ2 O;  2VLO A;  3CCM P;  4IPY A;  2L9F A;  1VQ4 P;  2GZF A;  4XFX A;  3G29 A;  2EHS A;  2GDW A;  3HZQ A;  3CC4 P;  2XV6 A;  1K73 Q;  4IZ6 A;  4QKO A;  3DS3 A;  3B4Q A;  1ZNV A;  3DS1 A;  3H4E A;  3EJB A;  3GJN A;  1QVG O;  4M0I A;  1YHQ P;  3CCE P;  1ZMB A;  2N6Y A;  2JU1 A;  2K92 A;  1M90 Q;  2QNW A;  3U43 A;  4GR2 A;  5F2O A;  2KOP A;  4NEO A;  2VLP A;  1DNY A;  1S72 P;  2JO0 A;  3CE7 A;  2ROQ A;  1GXG A;  3CC7 P;  3LMO A;  2KOS A;  1YIT P;  1Z6M A;  2DNW A;  1E6J P;  4PH1 A;  2GZJ A;  1YJW P;  4QNB A;  5HGO A;  3GZL A;  2BHV A;  2VSQ A;  2JYG A;  1AF8 A;  1M6N A;  2LPK A;  3NY7 B;  1GXH A;  1IMQ A;  2KG9 A;  2KGE A;  3MGE A;  2JU2 A;  4U0F A;  2PEK A;  3H0D A;  2N98 A;  1D1D A;  2GZG A;  4COC A;  1QRJ A;  3OW2 O;  1VQO P;  2FAE A;  2LIW A;  1EMV A;  2K93 A;  4XRQ A;  5BS2 A;  1VQL P;  2AFD A;  2GDX A;  1DV5 A;  2M8P A;  1Q7Y Q;  4F37 A;  1K30 A;  3CCJ P;  2JAZ A;  2KGA A;  5EW5 E;  2XZ0 D;  3E2D A;  3DS4 A;  3G6E P;  2MVV A;  2GDY A;  4XFZ A;  1NJI Q;  1HY8 A;  1YIJ P;  3B5I A;  3G28 A;  2FAC A;  2AVA A;  2KG8 A;  2KW2 A;  2FQ2 A;  4WYM A;  5HVC A;  2KOO A;  2FHS C;  2PEI A;  2MR8 A;  2CQ8 A;  2KWL A;  2GYK A;  2XT1 A;  1YI2 P;  2K2Q A;  2NO8 A;  1KC8 Q;  2Z45 A;  2Z44 A;  4PWV B;  1ACP A;  5I4T G;  2BUO A;  2FQ0 A;  1UJZ A;  1BXI A;  3HYB A;  1AYI A;  1EOQ A;  1VQM P;  2N50 A;  4GR6 A;  4H2W C;  1A43 A;  2PEJ A;  3DS5 A;  1VQ7 P;  2CWO A;  2KGC A;  3G26 A;  3VRL C;  4PH0 A;  1L0I A;  4U0B A;  1Q81 Q;  4COP A;  2FVF A;  2L4B A;  3CCS P;  2E1M A;  3WBH A;  3M1M A;  1VQP P;  5HGN A;  2FVA A;  3G21 A;  2PEN A;  3I55 P;  5KP6 B;  1FR2 A;  1VHN A;  2FQ1 A;  1OR5 A;  1KD1 Q;  2CNR A;  5BS1 A;  3RG6 C;  2XXM A;  2K0D X;  3DTJ A;  5CZD B;  1K8A Q;  3G0V A;  2KOR A;  2JB0 A;  2LL8 A;  5HV8 A;  1M1K Q;  2EHT A;  4U0E A;  2JQ4 A;  1T8K A;  2PY8 A;  4XRO A;  2GZI A;  3CC2 P;  2JBG A;  2M5R A;  2L22 A;  1YJN P;  1VKU A;  1N8R Q;  2KOD A;  2QA4 P;  1X3O A;  5F2K A;  2GZE A;  2MR7 A;  2L6E A;  4BPF A;  2K5X A;  3EJE A;  4U0D A;  2N5I A;  3CD6 P;  3CCV P;  1W2B O;  1VQ5 P;  3LRY A;  1VQN P; 
#chains in the Genus database with same CATH homology
 4PWV B;  1ACP A;  2FQ0 A;  3LMO A;  2MF4 A;  2L0Q A;  1L0H A;  2LKI A;  2K0X A;  2KOS A;  2DNW A;  2KGD A;  5KP7 B;  4MRT C;  3GZM A;  2N50 A;  3GZL A;  2CG5 B;  2AFE A;  4H2W C;  4H2X C;  2XZ1 C;  2VSQ A;  2JGP A;  2KGC A;  2CGQ A;  2AF8 A;  5KP8 B;  1L0I A;  1AF8 A;  2KG6 A;  2FVF A;  2L4B A;  2LPK A;  1KLP A;  3NY7 B;  1NQ4 A;  4H2Y C;  2KG9 A;  1HQB A;  2PNG A;  2KGE A;  2JU2 A;  2LOL A;  2FAD A;  2MD9 A;  2FVA A;  2N98 A;  2KOQ A;  4BPH A;  2MVU A;  4DG9 A;  3EJD A;  2N6Z A;  2N5H A;  2LIU A;  2X2B A;  5KP6 B;  4PXH B;  2FQ1 A;  2FAE A;  2LIW A;  2K93 A;  1OR5 A;  2CNR A;  5EJD A;  3RG2 A;  2LML A;  2AFD A;  2GDX A;  1DV5 A;  2L9F A;  4BPG A;  5CZD B;  2KGA A;  2EHS A;  2GDW A;  2XZ0 D;  2KOR A;  2LL8 A;  5HV8 A;  2EHT A;  2MVV A;  2JQ4 A;  4IZ6 A;  2GDY A;  1T8K A;  2K94 A;  3EJB A;  1HY8 A;  2FAC A;  2M5R A;  2L22 A;  4CA3 A;  2AVA A;  2KG8 A;  1VKU A;  2KW2 A;  2K0Y A;  2N6Y A;  2JU1 A;  2K92 A;  1F80 D;  2FVE A;  4HKG A;  2FQ2 A;  1X3O A;  4R0M A;  2QNW A;  2MR7 A;  4BPF A;  5HVC A;  2KOO A;  3EJE A;  2N5I A;  2KOP A;  2FHS C;  2MR8 A;  4NEO A;  2CQ8 A;  2LTE A;  2KWL A;  2KR5 A;  1DNY A;  2MY5 A;  3CE7 A;  2K2Q A;  2ROQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...