3LNDA

Crystal structure of cadherin-6 ec12 w4a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
203
structure length
197
Chain Sequence
NQFFLLEEYTGSDYQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILVNRRTGRPVEPESEFIIKIHDINDNEPIFTKDVYTATVPEMADVGTFVVQVTATDADDPTYGNSAKVVYSILQGQPYFSVESETGIIKTALLNMDRREQYQVVIQAKDMGGQMGGLSGTTTVNITLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cdh6 protein
publication title Two-step adhesive binding by classical cadherins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 34
structure length 197
sequence length 203
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3lndA02
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3lndA01
1FF5A 4OY9A 4ZMNA 3K5RA 3K6FA 3MVSA 1SUHA 3K5SA 2OMTB 4AQEA 4ZMOA 2WBXA 4ZTEA 2YQGA 1NCIA 2V37A 4AXWA 4QD2E 4ZMWA 4AQAB 4NUMA 3Q2WA 4ZMLA 2OMZB 3LNDA 4APXB 3FF8A 3QRBA 1WUZA 2OMVB 3UBFA 5JYMA 4NQQA 2OMUB 2QVFB 4NUPA 5DZVA 4AQ8A 2X2UA 1O6SB 2OMXB 2WHVA 1ZVNA 4ZMQA 2WCPA 5KJ4A 3LNHA 2WD0A 4AQ8C 2A4EA 3LNEA 1WYJA 2OMYB 4AK1A 2O72A 1L3WA 4ZT1A 3Q2NA 1Q1PA 4ZMZA 3K6DA 1NCHA 4APXA 3LNIA 5CZRA 3Q2VA 5JYLA 4AQEB 4XXWA 4AXWB 2OMWB 4ZMXA 4ZMPA 3UBGA 4XXWC 4NUQA 3LNGA 3PPEA 5CO1A 4ZMVA 4ZI8A 1NCJA 1EDHA 3Q2LA 2EE0A 2YSTA 4AQAA 3UBHA 1OP4A 1ZXKA 2QVIA 2A4CA 4ZMYA 3LNFA 3K6IA 3FF7A 4ZMTA 1NCGA
chains in the Genus database with same CATH superfamily
1RZKL 3O2DH 4GG8A 2C9PA 1HOEA 5H2BB 4M56A 1YUHB 2WBJD 3KE0A 3RVTD 5I16B 3CH1A 4WI8A 3X1EA 2IBGA 4XX1E 5MEND 3BT2H 1JXDA 4EVNA 3OKOB 4X6EA 3H9ZA 1U8NB 2H7WA 1PX4A 4HW6A 4BIKA 4FQXC 3RY6A 4U1LA 1WA1X 2WLLA 3PL6D 5FYLD 1ZA6A 2BDNH 1DLHB 5DD6B 2KUTA 4AI7A 5C0RH 1KWGA 1QW8A 2NXZB 3TM6A 4P2QD 3W0WE 4FDWA 2NY6C 3BGMA 5IHZB 3FKUS 4AQ1C 4W9CC 1YNKH 3KVQA 3NN8B 1VESA 1J05B 2IXQB 3FH7A 3GSXB 5IWLA 3O4OC 1BVZA 4WNSA 2J8HA 2NW3A 3UH8A 2EAEA 2H0FA 4E5XB 3D69B 12E8L 3I6LE 2BNQE 5I9QB 4R4FH 1UA6L 4YDVA 4ZW3A 4J8QA 4EE2A 1SHSA 4JFPB 2AI0L 4PHZA 2ZKWA 4N8UA 4ELKA 2N0MA 3RKPA 4P5KA 1S7QA 3L5WA 4P5TA 2V2WB 5EDXA 5C09E 6FABH 1WG3A 3UO1L 5H2BA 1YUHA 5FXCH 3LIZH 4NCC1 5AZEH 5I16A 3UMNA 2R2HA 1CXIA 1PTZA 1XGYL 4HBQA 3RDJA 1UURA 4U1GB 5TPWL 3PWPD 4N0UB 1DLHA 4WK2B 1IEHA 4B9GA 1AHMA 1HWGB 5IV2B 1XR8B 1F4XL 1LMKA 1BEYL 4CDHA 4Z76B 2F9BT 5IHZA 1LP9E 1VEPA 3MLVH 2VQTA 3NN8A 4PS7A 3GSXA 2J5WA 4UTAH 1ASQA 5FYKD 1VJSA 1M71B 2FWOB 4UTCA 2FE0A 4UT7L 3D69A 3OLDA 2FBOJ 4M7LT 3S5YA 2ROYA 2G9KA 5CBAB 4W9ZA 2VDOH 2C3GA 5AVSB 4LGRB 4DN4L 1YCSA 5IQ9B 1G6RB 1OSPL 1XTLA 2WNGA 3CVIL 4WY7H 5D7SH 3TBSB 4UQIM 2Y7OA 5GS1C 1WIOA 4MJIB 4POYA 4LKXB 3KPRD 4Y88A 1WCBB 3LDBB 3VXMD 4P46C 2V2WA 2JF1A 5DC4B 4AV4A 1XCTB 4RWHA 3AY2A 2WQSA 1E2WA 3PAUA 1H6UA 2FH8A 2P24A 3LAFA 3MUUA 4ZMYA 1F3DJ 3B5TA 1VA9A 4GSUA 2RJMA 4RGOL 4TQ8A 1JDAA 1N59B 1D9KC 3NFPB 2A6KA 4DGVL 1ET8A 2DI7A 1AS6A 1FGVL 4Z7VB 3A3YB 3E8UL 2XC8A 5IREA 3FQRB 2RALA 1JFQL 4N0UA 4GMSL 5IV2A 1XR8A 2EYSA 3NH7L 2IFFH 4PB9L 3VFUB 2IBBA 1J0ZA 5SX4H 2IFGA 4Z76A 1JPGB 3GZPA 3NGBB 2HCZX 2BJMH 1M71A 2XXMB 3EHBD 1IC4H 1CLCA 2FWOA 2VRAA 2RD0A 3GMRB 4G71B 5JIDA 1C1EL 3FULA 4LF3B 5E5LA 2UZXB 3OJVC 3RBSA 5IQ9A 4AVIA 1G6RA 5GZNC 3BZ4B 4NWUH 1EZVX 3TBSA 4NGHL 1PF3A 4DF9A 1X6NA 2AXGB 2Z4TA 3RX8A 4MJIA 1PG7X 3MRFB 4TSCH 4LKXA 4W9LC 4BK8A 3WTWA 1NIAA 2W5PA 1G87A 1VGEH 3UJTH 1UT9A 3OX8B 1BEXA 2DQMA 3QS2A 3D18B 2VLKB 3AT8A 5IB3B 1BIIA 1T5XB 1N59A 3NFPA 4Y4FA 3QQ9C 4JR9L 1UEMA 1V3KA 1X9QA 3B9AA 5GRJH 3FQRA 5DWPA 1F3DH 4Z3HA 3Q8CA 2E6JA 4N0UE 2OR9L 3ZTJG 3FL7A 4E9LA 3BCFA 2X2YA 2NZ1A 2X6MA 1JPGA 1CDYA 4UNUA 3U0WH 2DM3A 4OGYL 3HBZA 5GJTL 3MNWB 2B5IB 1EEZB 1MVUB 3GMRA 2OK0H 3K8KA 2X1QA 4PFEA 4JM4L 4LF3A 2CUHA 1DBBH 2UZXA 3CHRA 3MACH 5CN2A 4L1LA 3JXAA 5F1KC 3SDYL 5JA9A 3BZ4A 3R4RA 1S6NA 2XWEA 2VDMB 4DKEH 3AUVA 5I75B 1Z9LA 1QLEB 3W38A 3MRFA 4OQTA 2X3AA 3WHE1 3JVGA 3AACA 2FATL 3OX8A 1I4FB 1XGRB 2Q7AA 1REIA 2AQ2A 1NBZA 3D18A 2VLKA 3E2HC 1E0OB 3VXSB 4JFHE 5IB3A 1T5XA 5F7AA 2R83A 4PMEA 1LK3L 3AXIA 5CS7A 5DS2A 4XHQA 3CMGA 1G9HA 5HY9B 1PNCA 5GGTH 5E5MB 2EH8L 3ULUE 4Z7VE 4Z3TA 5IBLD 4R7NA 3VVVA 1TDQA 2BSTB 2R15A 1IM9D 3DVIA 4YXHH 1ZSDA 4RNRB 1BXVA 2BW4A 2ARJB 2PO6D 2JKLA 1UFGA 2R1XB 5DXWA 1PVHA 2HRPH 3MNWA 1EEZA 1MVUA 1CD1B 3U48A 5I1AB 4JM0A 3FRUB 4A7SA 3CHQA 1M6OB 4R3SB 3CDYA 2EXWC 5D5MB 5DK2B 4PBDA 3FU8A 3B7YA 5CJ8A 3KLLA 2BDNL 2TSBA 3OHXB 4LKCB 3VI4B 5T5FH 3S9DB 2J7LA 4KO6A 2W07B 2YUVA 3HN3A 1NCCH 4BKLB 5T1JA 1I4FA 1R3LB 1XL6A 2HT2D 1MCEA 4L8CB 3GMPA 2K8MA 3VXSA 1WWBX 2BY2A 3LZLA 2VLKE 5HYSB 4AZUA 5IJCC 3ZE0E 3MBEC 3P11H 2K0RA 1FVEB 2RMNA 1MPAH 5HY9A 5C3LD 5E5MA 3OKEA 2I07B 3QJQB 4PIBA 4AQ8C 2WSKA 1OE3A 5FA3B 4RNRA 2ARJA 2QMJA 3Q1EA 5AL8A 2FQGA 2R1XA 3PJLA 2KZ1B 4JRYB 1DQVA 6FABL 2KKQA 2C9RA 4BFIA 3Q2NA 1CD1A 1JZHA 1DEDA 3BSGA 5AZEL 5I1AA 5FYJH 3H3BC 2VSCA 4U7SA 5E0QA 4DIXA 3FRUA 2IAND 1M6OA 4R3SA 5I75C 1CICD 4PRAB 2YEZB 3H4FA 5D5MA 4J3SA 1DQIA 1LGVA 2KYIA 1MFBH 5FW8A 4LKCA 3VI4A 4YVNA 3GRWH 2AHIA 5KSBF 2DQIH 1U3NA 2W07A 1UT2A 4NNYA 3U9WA 2RR3A 4BKLA 4IBQA 1T6VN 2DF3A 3MLVL 4N28A 4HS6B 2JJSC 1R3LA 4K94C 4HULB 4L8CA 2C4XA 4JFQB 1GMEA 2GJ6D 2ZCHH 3N41F 4MA8L 4U6YB 1C16B 5HYSA 5JHBA 2XXCB 3TH2T 3VXSE 2VDOL 1HL5A 5I18L 3LXUX 2ZYRA 4XMKL 3UDWC 4WY7L 3VYPA 2I07A 5D7SL 4D9RD 4I1PA 1TT6A 2BSDA 3HNVH 3FQTA 1QA9B 4OCRH 1OAQL 3INUL 5HYSG 2GT9B 5FA3A 1QBBA 1MZZA 5DFVD 3WN5C 1YEHH 5CEXB 4JRYA 1CFMA 2COQA 2EC9T 3S5LB 3BSZH 4B27A 4MQTB 4MA7H 1UWGH 3OHXC 2V9TA 1DQJA 3NDYE 4KC3B 3Q6GH 1RXLA 1TKWB 4PRAA 2YEZA 3NSJA 3U7AA 1AZUA 3EGDB 5D5ME 5FUCC 1ZTXL 2E27H 4WO4A 3IRCA 2VOTA 1EWHA 3VI4E 5I8OL 2AAVA 1YNTF 3K91A 2AQTA 4KJYB 4LEOB 5FV2A 4S11A 1MFNA 1OTUD 4MYPA 4HS6A 4WHTB 3V0DA 2IAAC 1BECA 1ZY9A 5CINH 3IPFA 5GGVH 2VJ8A 4JFQA 1KJ2H 4U6YA 3VD5A 1C16A 4P2YA 1HWWA 2NY2B 3BI9X 3QH3B 4YMPA 3Q06A 4ONOA 1RUQL 4FNPA 5T1DH 1SVZA 3FT0A 2DV6A 4LPTA 5I15L 5H37G 5BV7C 3W5NA 1QA9A 3OC8A 3IYLW 5B8CB 1M53A 3S35L 2F5BL 3H9SA 2YQBA 3EJSA 2BSED 1HOCA 4KK6D 4TSCL 3SKJH 3EBAA 1IE5A 3HR6A 1JNLH 4CU7A 4BCYA 1NMCB 1JRHH 3N1PC 2A1WH 3HFFA 3OKMB 3GSNA 5LGKA 4HZLB 3S5LA 4FYSA 4NPJA 1YECH 5DZPA 4L2YA 2WXJA 4JDEA 3O6FD 4BFKA 2WVSA 5GSVB 3QIBD 3TLRA 4BK4A 5F3BB 1TKWA 2WKLA 3NABL 1WEJH 4K7FB 4BK5A 1L9SA 2WLIB 3S5LG 1JN6B 1BZEA 1WZLA 5GRJL 3P0GB 3EGDA 1AZVA 1B90A 1NC4D 1QSFD 4AYDC 5IJKC 4GS7C 1QKZL 2QFPA 4BUQA 1M7UA 2Q10A 2IPUG 1BF2A 4KJYA 1V8HA 3GMOB 4LEOA 1GOGA 3MODL 5BW7A 4OQ1A 3U0WL 1F3RB 1W8NA 3L4VA 3QPXH 4KK8C 2JI2A 3CFEB 4PLKD 4HSQA 4WHTA 5C71A 4H26B 3J27A 2FK9A 4JO4L 5HJGA 5LBGA 3WIAA 3QH3A 4HISA 3S0PA 1JPSH 1NOAA 3MN8A 3WFZA 3N85L 3DSNA 5KBKA 1PZ5B 5DZAA 5B8CA 5DQJB 4ZUTB 3PDOB 2H45A 1Y6MR 1T20A 1EH9A 3HNTH 1CT8B 5I19L 1CTOA 5JUEH 3L4UA 2DB8A 3OKMA 5K59E 4EO5A 4HZLA 2OJ1A 2YRPA 4PJ7F 4YFLI 1FDLH 4EIUA 4LCWB 2GC7C 2PCPB 4LARH 4M1DH 5C07B 1CJYA 2I5YH 3CFKB 1GW0A 5GSVA 1RULH 5F3BA 5LNDA 4DERA 2KZKA 3W2DH 3L1FA 3QZMA 3R4DA 4K7FA 4N90E 4RFNC 4W9IC 2WLIA 2YR3A 5IGXL 2QQKH 3UG5A 5CEZH 4HX1B 2HKFH 5EZJB 2ZKXA 4HFUH 4YXHL 1MNNA 3TV8A 4P2OB 1U4EA 1AVAA 4JANA 4JCWA 3HZMB 3CFEA 5KJRL 4Q6IB 4W4OC 1L9PA 2VN6A 4XBPB 4WVRA 4IBZA 2DMKA 5MP6H 1MFCL 1R47A 1H8OA 2YZ8A 4PGDB 1QWUA 4JN1H 2E9BA 4ODWA 3FT4B 1UOVA 2B2XH 2IPTH 1HS6A 1QFPA 4GQZA 3L3OC 1KBKA 1PZ5A 1M4KA 3CZUB 5DQJA 3PDOA 4ZUTA 1GYWA 3HN8A 3HRPA 2HG0A 4M4PA 4MS8D 1KBPA 1NCCL 1RSYA 1CT8A 3NSYA 5E2TH 4JPVH 1DN2A 3VD0A 2CBQA 2YD8A 1Z2KA 5DGRA 4LCWA 3TN0B 3WTSA 2PCPA 3K6SB 1UM4H 5C07A 1CBVH 3CFKA 1D6VH 1JHKH 3P11L 3DX4A 3CVBA 3BN9D 4Z6AT 3T3PB 2AQPA 2Q0ZX 5FIEA 5I6XC 4LRIA 4HX1A 4Y8AA 5EZJA 2YKLL 4W6YB 3QWOB 5JXED 4P2OA 4F7TB 1I8LA 3HZMA 3LH9A 4KROD 1O5DT 4Q6IA 3QXTA 1TCMA 4NBXB 3GEWB 2OCJA 3NCYP 3TF7C 4FFVC 3KJ4B 2PPDA 1S7RB 2ESVB 2BP3A 3FUMA 4PGDA 1ZLWH 3C5SA 4NAMA 5I73C 1DE4B 2BOBB 3DV6B 3GM0A 3S4SG 4KK5D 4NUGL 1BLNA 5AOMA 3OJMB 2VC2B 2WO3B 3CFMA 4G7SB 3GRWL 3A47A 1B0IA 5DRNA 5FCUH 3RE0A 5KYWB 4XOAA 2C4FU 2E86A 4E9WA 2EKJA 1ZTMA 1YMMD 5SX4I 3K2IA 3TN0A 1JL8A 3K6SA 3BLPX 3L5JA 1JIBA 3KJ6L 4LCWE 1T0OA 1DLFH 1BGXH 5C07E 3MRKB 7TAAA 3CTTA 2G3MA 3AGWA 4AEHH 5T1LD 2DWTA 1Q0XL 1VACA 5EC2B 4TUJB 2FO1A 3PJSB 2F7IA 3HNVL 2XPYA 1LO5B 4JHBA 4MKMA 4QXUL 4RIRB 1M05B 5DSCB 4K0OA 3UXFA 3QWOA 1W6WA 4F7TA 3L54A 1DDTA 3HZYB 4I0KA 1FP5A 3TBTB 3BSZL 4ZO6A 4ZMTA 1RZQA 1UOWA 2X9XA 3LS4H 3CXDL 1S7RA 4JM2C 2ESVA 4U31A 1ZD6A 4CN6A 4MXVE 1JDDA 2BOBA 4GSXA 3ERXA 3DV6A 4G8EB 5D7IF 2EDRA 2AJVH 3PWNB 2P8PB 5FGRA 4KXCA 3NIDE 5EU7C 3VG0H 4HWBA 2JKRM 1NGPL 2I25N 2P26A 3FO2B 3GC3A 5KYWA 4K8RL 2PPAA 3X3GH 3SGDI 1TFPA 1UM6H 2EDQA 5A3IC 3OJDB 3KM2A 1ZS8B 1HHHB 2W81C 5JPNC 2E9JA 5EU7E 5GGVL 4IMKC 4CKVX 1HCZA 1BXAA 4HUKB 3MRKA 4IU2B 1ZHBB 5T1DL 4Q58C 1QSEE 3D85D 5F7BA 5EC2A 3T3PE 4TUJA 3U1SL 3GTNA 3PJSA 4J3OF 1DQTA 4RIRA 4BZ1H 1M05A 1KDJA 5DSCA 3ROLB 2WCPA 3QAZB 1KSRA 3HZYA 2HWZH 3IN0A 1JRHL 2IO5A 3V52H 4D7BA 1NFIA 2EQDA 3TBTA 2FLBT 2E6QA 1YECL 4FOMA 5LGHL 3FUDA 4FULA 1PX3A 3FTZA 1KBVA 2DICA 2VAAB 3L81A 4PCKA 2ESVE 2YUXA 4WENB 4G8EA 5DD3H 1K3ZA 2X4TB 2WXKA 1UM5H 1VSCA 2P8PA 3JUYA 3TA3D 5DJ2B 3KL3A 3NPSC 3TYGL 5E5RB 3STLB 3FO2A 4M5TA 4NHUB 3B9VA 4TUUA 5F89B 1K2DB 3KVPA 3QPXL 3C9NB 3OJDA 1ZS8A 1HHHA 1PD1A 2H3XC 3EH4B 3EYQD 1L4IA 2RQEA 5JHLL 1FLRH 4YOKA 1Z9NA 3PWUA 4J39A 4IU2A 1JPSL 2LE9A 3C6LC 1EHAA 4HVBA 3FYEB 5DR5H 1KB3A 2NY7H 2O5ZH 1F8TH 3F7QA 4KFZC 3ROLA 4D0BB 4DK6A 1GOFA 3BKJH 3QNZB 5CCJA 5GRVL 4JFUA 5I0VA 5JUEL 1JSYA 2RACA 2VN3A 5GGRY 2MIZA 2IPUK 3Q8AA 4FXLA 4M1DL 2WZPA 1OP4A 1RIUH 3CIAA 3IU3B 2X89D 3VVWA 1OD7A 4FF9A 2JQAA 3KLSA 4X8XA 1X5JA 4UT6A 2X4TA 3FB7B 2NMSA 5DJ2A 3Q5OA 2HKFL 4H2AA 3VXNB 3CBKB 3X13B 3STLA 3QA3A 4LRNL 3OB8A 4NHUA 1GC1H 2HFEB 1K2DA 1YO4A 5DS1A 4PV9B 2ORBH 2BWIA 3C9NA 4KY1H 3BDXA 3KPNB 1NCIA 4M5ZH 4QD2E 5DC9B 3NACH 5KUMA 3I84A 3K7UA 4HMDA 1H5BC 5JIPA 2VDLB 3ZIYA 4V1DB 1H6FA 4K71C 4JN1L 2VDQH 3QHZL 4WFFD 3T0BA 1QUNB 4Z7NF 4FHKA 5D1QD 2IV8A 1VFUA 5DCCA 1E4WH 4NQQA 1XZWA 4EF3A 4D0BA 3ARBB 3CCHB 3HN5A 3QNZA 3WDIA 4TQEH 5E2TL 5HI5C 1I1CA 3ZKNC 1YMHA 1DQML 1DVFD 2BNRB 2OTPA 3EYVB 5EB9A 3FFCB 3MZGB 5ESQA 4Y16B 3IU3A 1FFOB 1EJ6A 1D6VL 4BBWA 1AR2A 2GCYB 3J8F7 3V4VH 2GB2A 4XP9L 3VB9A 1TVDA 3FB7A 5BZWB 1NQBA 3VTTA 2VJXA 3ZGHA 3VXNA 4W70A 2V17L 5ANHA 3X13A 1MFEH 3OAYH 2HFEA 5DT1H 1LK2B 1DVXA 1EGJL 3JWOL 4PV9A 2CR3A 5C0JB 3KPNA 5EZIL 3DIDA 5F7DB 1BBDH 3QFJD 2Z0BA 4NJ9H 4V1DA 4UB0L 3CZLA 1X3DA 1DHKA 3VDAA 4GQRA 1NAMB 4PHXA 1QUNA 5FFOA 4TVPE 1KT2B 1G94A 3TF4A 3ASNB 3QEQD 5EF3A 4JDVA 4LZKA 1ORQB 3ARBA 3CCHA 4TLTA 5FCUL 4YHOL 5KVFE 2C9VA 4J4PA 1WZ1L 2YHGA 5CFHA 2BNRA 3JWNC 3P54A 3EYVA 4HUMB 3CSBA 3FFCA 5DVKA 3O3EB 3D07A 4XX5A 3PHAA 5CMAB 2K3HA 4Y16A 4ZNEA 2KHAA 3DHMA 4HD5A 4BXVA 3KHQA 5BRZB 1T83C 1DZ0A 3KDMA 2GK2A 2DBLH 4LESA 5BZWA 3FBKA 4DEWA 3BMWA 3ARGA 5F7EL 1MCBA 4ZQKB 3U1QA 1J9SA 1HHJA 2WXIA 3K6NA 4HJ0C 4JVPA 5MENB 3IKKA 4J2QA 4NN5B 4I3SH 5DK3A 3WI9A 1LK2A 5L8KB 2Y1ZA 5IFHH 3FUHA 2Z31D 1XF3B 4IRSD 3ZKMD 3PL6B 1DFBH 3MRBB 5C0JA 1E7VA 3LS4L 5F7DA 1RUPH 4Q9RH 2NZIA 5CJQL 2G3XA 4P2QB 1WAPA 1NAMA 4V1DE 1SUHA 1PBYA 1KT2A 1BSIA 5DEZA 3ZR6A 6TAAA 1ILSA 4FI7A 3BT0A 3VG0L 4X5RA 3WV0A 3BQUB 2JJTA 4ABQA 3PHQB 1ORQA 2Z9TA 4WAFA 3Q7JA 5CILH 2FWSA 3X3GL 1I7UB 5IEKB 4NRYA 1TQBB 4Z3GA 2AMUA 2EDEA 1H3GA 4ZD3H 4KMTH 1S8DB 3MXVH 4AY0A 3O3EA 1OXYA 1V7NH 4KKAC 1MZYA 5CMAA 3U46B 3FFCE 4FMVA 3UOAB 3GQFA 1SDDB 5BRZA 1IGCH 1XIWC 2O30A 4OCYH 3O2VH 1KGXA 4H20H 4FFZA 1JI2A 1KN2L 3COOA 3CX2A 2PXYD 3MGAA 1HTYA 1RUKH 2OMXB 4R5VA 4N2EA 2EIMB 2ICWI 5HVHC 4ZQKA 4I3GA 4BZ1L 2XWBA 5FYJD 5K9JH 2R69L 2WD0A 4NWTL 2YIHA 3KWXA 2HWZL 3V52L 3ZLQC 3EH3B 1XF3A 2E7DA 3UTTB 4N5UA 3MRBA 4HIPA 4LQFL 3DJSA 1B3JA 1ZSHA 1RAMA 5I5RA 3LD8C 4ERSH 5HDQH 2DQTH 3K1KC 3MA7B 5DD3L 5DMGC 2IBZX 3X14B 5DA0B 4ABVA 2UY6B 1NCHA 1T80A 3BQUA 1ZLSL 2D7TL 4GG6F 3PHQA 2FT8A 1T21B 3WSQH 4WGKA 5IEKA 3EH2A 4HPHA 1NCBH 3QW9A 1S7VB 1S8DA 3QIWB 4XXCC 3U46A 3IK2A 2CE6A 5AVWB 3P9WB 1EJOH 2VSMB 2FZ3B 3FQUB 1TZGL 5DGQA 3S7GA 5LGYA 5F9JB 2WBJC 3RVTC 1SDDA 5L9DH 1A7OH 1S46A 3KPRB 4RMVA 5F1SA 2GUYA 2Z35B 5BRZE 4ZUSB 4C4KT 2OMXA 5K9OB 5DR5L 1BWWA 1WBZB 2XWJA 3IN2A 4JFED 2WWKO 3G5VB 1T5KA 3PL6C 4H8QA 5B38A 2WW8A 1B88A 2AJ3B 2MRYA 3W9EB 4M6OH 2R7EB 4HWEH 1SEQL 3ZQWA 5BUPA 4DKTA 5MENE 1VRSA 3UTTA 4BCZA 3EJQA 2YOAA 1QRKA 2Y7NA 4KVCL 5B38G 4MASA 1PEWA 1VDGA 4HXBH 4K7PH 4IKIA 1BVKB 4P2QE 3MA7A 1TQBC 1E50A 2VXSH 2NQCA 2JQMA 2OTWB 2WM0A 3C8HA 4RA0C 1KCRL 4OH2A 3VQ1C 4F93B 1Z32X 2XCMC 1A0QL 3PHSA 1GC1L 2HLEB 4FP8L 2OSYA 1Q94A 2Y1VA 3M88A 4PQXA 2P9RA 1S7VA 1KELH 3QIWA 4KY1L 3BIKB 3B1UA 3W81A 2FZ3A 3FQUA 5F9JA 1WITA 3SDAB 2QKSA 4DOHB 3NZHH 1E9OB 1NDMA 3BFWA 1OZUA 3MV9D 2VO8A 2F68X 1YJDH 3CK0L 4Y5VC 3RGVB 2Z35A 4FL4B 4ZUSA 5FO7B 4YPGB 3VXRD 5K9OA 5J11C 4RMTA 1WBZA 1E4WL 3QDJA 4HDIB 3G5VA 1I8MA 1OGTA 2CK0L 2AJ3A 1L9QA 3EBHA 4HHWA 2WXGA 4N3TA 4J8RB 5TF0A 4MVBC 3FTGB 3LHPH 1XT5A 5HHVH 2GJJA 3ZRSA 3EYSH 2GYSA 1CD0A 3CC1A 1ZPLA 4TUOB 4XVTH 3RUGF 1O9ZA 4MMYA 3SY6A 3UTTE 4XZUA 3RDTB 1LDPH 3I6KB 3UCQA 3V4VL 2NLJB 1BVKA 2IVFC 4M1GL 2OTWA 4A68A 3WKPA 1IAIH 5L2KD 1NDGB 2CR0A 1DJYA 2CPCA 3RIKA 1MFEL 2AGJL 1DJZA 4DK3A 1D2OA 2A5UA 1IC7L 1TO5A 2GBTA 1GOHA 5TE7L 1FNSH 3GBNH 3F65A 4NS0A 2AEWA 3SJVD 4EAEA 3GO1H 3QSKB 1BBDL 1JPTL 3FTUA 3FRPB 1AD0A 1OOWA 3BPNC 4U4BA 2W91A 3SDAA 5JORA 4EZMA 1E9OA 1A6WH 3RGVA 1EFXD 3RL1A 3HLKA 3TASA 3V0EA 3ZL1A 1U58B 2DD8H 3DURB 3KPRE 4XO5A 5FO7A 3ZL4H 4DKDC 3ZY7A 2DM4A 3HZ3A 3X3FL 1Q4NX 3HMWL 4PS4H 4HDIA 4JFWA 1FFPB 2LLNA 1HWHB 1RUAH 3VXOB 4EDWL 4QHKJ 1MW3A 4J8RA 4LASH 1BQSA 3PGFH 1T4KB 3FTGA 3GMMB 2QVTA 3QO1B 1JGUH 4HU2A 3APFA 2KZWA 4TUOA 1Z0NA 1E4KC 4N2FA 4NT6B 1NCAL 5CEZD 2HT4D 2QQNL 2QZQA 3EHBC 3RDTA 2PWGA 1X5AA 1SJEB 4X42A 3I6KA 2PO6B 1KWKA 2NLJA 2GEQA 2VUOA 4LVOB 2V3FA 4EN3D 4IQHA 4XC3H 1WTLA 1TQCB 1Y1UA 3CAFA 4LCCB 5DQ9B 1NDGA 3FOMA 4M62H 4XB3A 3W39B 5KYYB 4PG2C 1TNNA 3QDAA 4H13C 4NCC2 3KWVA 4ODVH 4IBWA 2ARJQ 3IGAB 2FD6H 3OKDB 5JXAH 3FRPA 3P30H 4Q9RL 5DJXB 4LP8A 5C7XH 1A5FL 5IBTH 2Y07H 4OJYA 3NCWA 1Q1JL 4Y19D 4ZUUB 4DOHE 1U58A 2JKSA 3DURA 3IE4A 3M8OH 4ALAH 4JKWA 4NN6C 2DLHA 1R3HB 3FRPG 2XU9A 1FFPA 5IT2H 3VXOA 2YXWA 1QR1B 5T33H 1HT6A 1EZVY 3F00A 1T4KA 1A6PA 2F61A 1JAEA 3GMMA 4ZD3L 3QO1A 3NJNA 1NGWB 2YUZA 3MXVL 3IXAB 4UAOB 1V7NL 4NT6A 2XA3A 1CLVA 3FJTA 5TQ0L 3TVMA 4LCIH 1CLOL 3A6CL 3V5DB 1AC0A 1SJEA 2VMJA 3RZCD 4OCYL 3RVWD 3QORD 3O2VL 2YPVA 4WGWB 4NC2B 3OG6B 4AQOA 2BNUB 3O9WD 3A67L 1BQRA 5IMLB 2IOIA 2TSAA 3LPWA 1NA8A 2CDGA 3HS0C 4LCCA 5DQ9A 1DQQB 3D39D 1BM3L 1P9MA 5KYYA 4RMWA 1P7QD 2IANB 3H2PA 1VZGA 3WXVH 2HMID 4L0PB 4PJFF 4WEEA 2AK4D 2JH2A 3FAWA 3IGAA 2XG4B 4R2GB 3OKDA 3NQIA 4BFGA 2ADFH 5DJXA 4HK3N 1NBVL 5F6IB 2V9RA 3EIFA 4ZUUA 4JDZB 1WD9A 5HDQL 1PZSA 3PP4L 1PZBA 4W9FC 3BYTA 2H32B 1R3HA 4YHZL 2AK1L 5IK3B 1IKNA 1E2ZA 2FIRT 3EJJX 3V6BR 1QR1A 1ANUA 3WSQL 3VGFA 3O0RH 1VPOH 4DFHA 2FEEI 2MQCA 5BOJA 5I6OA 1J5IA 1NCBL 3CHXA 3CVHB 5DHVH 4U49A 2PO6C 1NGWA 2NXYB 5ICZB 3IXAA 3BW9B 2DPKA 3KGUA 4AGNA 1TTAA 5CUSH 5GGQH 4JN2B 4MZ3A 4XOCA 4M02A 1D7FA 2YMXH 4WFED 4PCTA 1QPXA 1SXBA 1PZ3A 2PPFA 3RGHA 1JXJA 4J3TA 5E99H 2BNUA 5IMLA 1TSRA 4RAVB 3BAJA 1FG9C 1DQQA 2PCXA 2D31B 3C8KB 4KQ4H 5GSRB 4AC4A 2V2TA 4M6OL 4XNYH 4H8WC 4HWEL 4Z1PA 1J8KA 4WW2B 1YYCA 3EXJA 2XG4A 4NP4H 4N87A 1XV8A 1Y1DA 2GJZB 2IGFH 2HT2C 2Y7QB 3DX6B 1RIVL 5EU6B 1IZJA 4JDZA 4NZUH 1L5GB 3P4MB 3FU7B 2HX8A 4CGUB 2H32A 3GHPA 5D4QA 5F3HB 3CDZB 4G5ZL 4ES9A 2F18A 4QWWD 5FW7A 3T0VA 3DX9B 4WCYH 1FAIH 4RFEB 3J7HA 4FLHA 4MAYD 2OMTB 4X7EC 2GSIB 4ANWA 4A1RA 3CVHA 2ITFA 1MEXH 5FUOH 4NUMA 5ICZA 3V55A 3BW9A 1S9WB 2L0DA 1KACB 3KPOB 5IROD 4JN2A 5FO9B 4GIOA 1FH5H 2Q3XA 3RPIB 4WU7A 5KSUA 2J4WL 4AX3A 3LKNB 2EYRB 1YJDL 3AROA 1BXXA 4ADJA 3MRQB 1CICC 3KPPB 4UWQB 4BRJA 1IT9H 1CXEA 5JO5B 1LEGB 3TIEB 2D31A 5GSRA 5HI4D 3GBDA 2OW7A 3FT1A 5HHVL 1JD7A 3NJVA 4WW2A 2IANE 4CAGA 1N5YH 1J8SA 1OP9A 4D8PA 1W16A 4XVTL 3ETTA 3EZ8A 4XNZC 3WS3B 2GJZA 3RGBA 1KJVA 3VUAA 2Y7QA 1CFNB 3DX6A 5F7HA 5EU6A 4JGNA 3DXAB 3NSDA 1L5GA 3P4MA 1HCVA 1SHMA 4JQIL 4NO3B 3WDJA 3P3YA 3IT8D 1ZK9A 5F3HA 3JTSB 5BS0B 1IAIL 2DIAA 2ZYSA 4FEMA 3DX9A 3V9CA 4F37K 3OSKA 5KZCB 4RFEA 1BD2A 2GSIA 2ZUVA 3OAUL 1N64H 2Y4SA 2O6PA 1FNSL 2IV9A 1FORH 2PTVA 5DFVC 3OB0H 1S9WA 4TUKH 2CBMA 3GO1L 3KPOA 3R8QA 2UUDH 3GHEH 5K1JA 4ECNA 3HS8A 3B2MA 1AI1H 4U1SB 5FO9A 2NCEA 5I8KH 3RPIA 3L3HB 3LKNA 2EYRA 3JBG7 2DD8L 2H2PD 3ZL4L 3MRQA 4I3RH 1YEJH 4YBLC 1YYMH 1IEBB 5JO5A 1AHWC 1LEGA 1AC6A 2K45A 4JRXB 2O6EA 3TIEA 5IJBC 3NDZE 4N2KA 4A7GA 3F12B 3PGFL 4L5FL 1NLBH 1JGUL 3HUJB 5LAPA 3OXRA 2VLRB 1EHKB 1OTUC 3FTVA 3MNZB 3WS3A 1IFHL 4LO9A 4FG2A 1CFNA 3B2PA 4UOW1 3DXAA 4HT1H 3T0XA 4NO3A 1FIEA 5EU6E 3GXMA 1YG9A 3JTTB 1CS6A 2IWKA 4XC3L 1YYLH 4W6XB 5BS0A 1A66A 3IAGC 4M62L 4GSRA 4OGXL 4ABUA 3WY3A 4OFVA 1RLWA 2E75C 2JLLA 2AQSA 3EJPA 4KK6C 4ODVL 3FUIA 2ZUTA 3EKCA 4RGMB 1AKJD 4BXSV 15C8H 5C6WH 2FD6L 4PV8B 1HCYA 5C86A 4N0YH 5A40E 4GO6B 2Y07L 2YQGA 3L3HA 3OR6B 5KSVB 3O6FC 2M2DA 4ALAL 4FQIH 3QIBC 3H3PL 3S3DB 1VFBB 1IEBA 5TE4H 2ZZUT 4MLIA 4JRXA 4JCMA 5T33L 1G7LB 4QTIH 3OMIB 3F12A 4R84A 3B9EA 3E0GA 4KJQD 2OTUB 1KIQB 4F24A 1ERNA 5KSAD 3HUJA 3WOVA 2VLRA 3MNZA 2IDSA 3HLAB 4LCIL 4PLKC 2L4OA 1O9WA 1I8AA 5JOPD 3GBMH 1II4E 3DXAE 4KROB 3JTTA 3CUPB 3UTZB 1OTSD 3DHJA 1MY7A 1I9IH 1Y0LB 3FB6B 1CL7I 2IH3B 5BS0E 1MFVA 2NTSP 2HH0H 3QUXC 5LAXB 4I4WB 4BD4A 2AJYH 2V8LA 4CSSA 3WXVL 3QRGL 2O61B 1B4TA 4KNTA 2QMKA 4J2XA 4PV8A 1FPTH 2D8KA 4EJ1C 4FHBD 4ZFOB 2VB5A 3F64A 3OR6A 3E38A 5KSVA 1NEUA 3BGAA 1G9NH 2WLHA 3EO0B 3HA0A 3BQVA 4GRLB 5BZDB 1HU8A 5AVZB 1VFBA 2E59A 2QTEA 1E8ZA 3SO3C 4BZ2A 4MNQA 1G7LA 2J1YA 4GEIA 4IRJB 4AXWB 1VPOL 4JRXE 3WHXB 5CJXA 2OJZH 2OTUA 1KIQA 2AJXL 3KL0A 4W1TA 3BGFB 3HFML 3QXDB 4FQHB 5T1LB 2P5EB 4I5BA 1DCLA 3SEPA 5I17B 3LZOA 2X3BA 3W11D 2VLRE 1UACH 2XVBA 3WJLA 5EIIB 1BF8A 4Z9KB 2PABA 3RKDD 3WS6C 2IALB 3NZUA 2MTPA 2EDJA 3VFMB 5E1GA 1Y0LA 5GRWA 3FB6A 1T5WB 1ZEAH 2IH3A 3B8YA 4KQ4L 4PJHF 4XWGL 1E2VA 4K9EL 3QCTH 4YHPB 4CC0A 2E8ZA 3WIIH 3VH8G 5LAXA 2ZE0A 4I4WA 1K3IA 4FNTA 4MS8C 1RD6A 4YHLH 4AMWA 1FYHB 1W2KT 4GW4B 5A7BA 4NP4L 1MCLA 2MMXA 4AGMA 4OLEA 3D48R 1UWYA 2IGFL 2NUPB 3UGXA 4ZFOA 2ETWA 3F84A 3HKZA 3VQLA 3X1NA 4NPYB 1N0LB 3EO0A 5I5MA 2QV2A 4GRLA 3B4NA 5TK2A 3TJEH 2MHAB 5MEQB 3BN9C 4UU9B 3TPKA 2YRZA 3G9VA 4C56D 5BCAA 1MW2A 2XV0A 4WCYL 3AY4C 4ZTEA 4AXWA 4IRJA 4FG6D 2HFTA 3K4DA 4FFYH 3E1ZA 4PJ9D 4GY4A 3BWUF 5FUOL 5JXEC 3QXDA 4FQHA 1KCWA 5T1LA 2P5EA 3H8NA 4MDIB 5I17A 2EO9A 3FYIB 2J43A 4NC0B 3BMVA 1FH5L 5CN1A 5CZKA 5EIIA 1GTFA 5DEJA 1HSBB 1VFMA 1RCYA 4QRUB 4PVBA 4NUPA 3P9LB 2IALA 4JZNB 5DI8B 5E8NB 3AS1A 2DTSA 1OL0A 3RWCB 3HC3L 4KKQA 1T5WA 3ARED 5EIIG 4OZGF 2EDLA 4X9GA 2YARA 4W9GC 5GRYA 4GW4A 4WV1B 1BCIA 1GGCH 3HB3D 3LOWA 1TJIH 2NUPA 2IEPA 3LSOB 5B3JE 3T6ZA 4DPCX 2XZAH 1N0LA 1TENA 1Q38A 3JT2A 5MEOB 2AMGA 5AALA 2MHAA 5MEQA 4UU9A 2D4DA 2YSSB 5BMFH 1QNZL 1W6LA 3DX0A 1MJ7H 3D25B 1QD0A 1QFOA 1JGIA 4HCRA 4WJG3 2VM9A 2JV6A 1FORL 5EBMB 3VI3F 4MDIA 5J13C 2WQWA 3G08B 3GHEL 4CSZA 2P5EE 1IVTA 4NX0A 1C5CH 1NEZB 1HSBA 3GJFB 4OCLC 4QRUA 3P9LA 1KXTB 4JZNA 5DI8A 5E8NA 3BZDA 2FHFA 2BWDA 4MXQC 3RWCA 3S5ZA 1YYML 4F9PC 4YDLB 4PPTA 3SKMB 3PPEA 4KV5E 5CJ5A 3EUUA 4IRZH 3HR5B 4NSKB 3PHOB 4V11A 5DURD 2R4RH 1RFDL 2VLJB 1JZ2A 4WV1A 4X7DC 4G7VH 1MUJA 4FQJL 5K33A 3ZYZA 4DO5A 1UKTA 4CMHC 3LSOA 4NO2B 4KVNL 4HT1L 3L08A 3RZWA 4AUJA 4R90H 2HG5B 3FB5B 5MEOA 4MQ7B 2BVEA 3UDWA 1AQMA 2YSSA 5I2IB 3SCMB 5GS0L 3L5IA 3VWJD 5FWRA 3D25A 2HB0A 3D2UD 4HHGA 5CBEA 2GKIA 1E27B 4LL4A 2FTAA 4XVSH 5EBMA 2B16A 3H7BA 2C9SA 15C8L 4IGBD 3SE3A 3G08A 4L4TD 3KW8A 2ZXWB 2AJSH 4N0YL 5C08D 4ZMWA 3T6WA 1NEZA 3GJFA 4X2UA 2A73B 1CF1A 1KXTA 3DOHA 5DRWB 4FQIL 4M1CD 4LMQI 1BFSA 2ZOWA 3DYOA 4ACTA 3JV0A 3K0WA 3U25A 3SKMA 3TA3C 1NEZG 1U8OB 2N7SA 3HR5A 4NSKA 2JIXD 3PHOA 2VLJA 32C2B 1KTDB 1YEWA 1U8JB 5K9QG 4NENB 1IAOA 4LEBA 4NO2A 3EYQC 1U91B 1I31A 2FT7A 2HG5A 3FB5A 4Y7OC 1HSAB 4MQ7A 1M7IB 4LVEA 1RIHL 1P84K 3II1A 2F8IA 1LO0L 4R97C 4JZJC 5I6PA 1I9IL 2N59A 5I2IA 1CU4L 3ABZA 3O2WH 3SCMA 4HKBB 5AB1A 4DW2L 2IF7A 3QFJB 1AY1H 5I1KL 1MRDL 2HH0L 4PRID 2WINB 4IOFD 2AJYL 4UAHA 5KBNC 5B3SB 3S3PA 1E27A 4FFTA 3MJ7B 5IHUL 2Y23A 3WXWL 2BVYA 4IJ3C 4QRRB 1JS4A 1WSST 1RZJL 2Y1YA 4LLWB 5D72L 4MZIA 1U3HC 3VB8A 2A73A 4BZYA 1JZ3A 1G9NL 1CDIA 4EKJA 3CFBB 1RZPA 5JYLA 2OXGB 3M1OA 1LP9F 2DIEA 2P47B 4LIQH 2MWCA 1MAMH 1FNGB 1JWSB 2FQEA 3H55A 4PR5A 1U8OA 4YSTA 2O5YH 1L9NA 1XO8A 2OJZL 1SVCP 3GGWB 1N67A 4IS6B 5EEUA 32C2A 3UPCA 4HBCL 2ATKA 3R7QA 1T2QH 1KTDA 5AKTA 1RKRA 2VLJE 5EF0A 2XX1A 1OT2A 2CSPA 1NCJA 2NOYA 1UACL 4IIQC 5CIPH 3CFCH 4NENA 1LEKB 1JK8B 4LHQB 1U91A 3KYOB 1ID5I 4K7PX 4IK7A 4LPYA 1YEEL 1HSAA 3B3IB 1M7IA 5DO8A 5FYKU 4IRSB 5CP3A 2PLTA 3L3GB 2MTAA 5D1QC 3MOQA 3QFJA 4G6JL 4MBOA 1OAUL 3WIIL 3Q8FA 5HYJB 1CUOA 4YHLL 3MJ7A 4A7TA 2VZUA 4TTDD 2G60H 1WAAA 4QRRA 2D7QA 1DVFC 2CKBH 4LLWA 2HKAA 2IAMD 2UZPA 2BFVH 4P5SA 4AKQA 3QJFB 1JYNA 3CFBA 2H2SD 3BPOB 2I85A 2OXGA 3CE1A 4UV4L 4PJCB 4Y5YB 3LRSB 1FNGA 2VRKA 1ZANH 2ZYIA 5KOMC 1JWSA 4NC1C 4YHYB 5FFGA 1MCRA 2XZQH 3UO8B 4OZHE 4OFDA 4IS6A 3QDGD 4GINA 4B9KC 3ATEA 3T0DA 1MI5D 3WKNA 3ARPA 1LEKA 1H3UA 1SMAA 1SN0A 2CA4A 2F15A 3KYOA 5C3TA 3UGUA 4DPBX 2XETA 3PAYA 4WW1B 2VGLM 2LU7A 3B3IA 5DRXB 1WFTA 2Y5EA 1N10A 2PYEB 4DVRL 3RQ3A 3Q01A 3L3GA 4OW6A 2GIMA 4OFQA 2E7LC 2AKRB 5AYTA 4LLAA 5HYJA 5DMIL 3QFJE 3F3HA 5G55A 2VZVA 1ACZA 1GGCL 3MLTB 3FHEA 2NYKA 1TJIL 4OJAA 4URTB 1WAAE 3LZFH 3BAYA 5HTSA 2A38A 4LSUH 3QJFA 5GQBA 2XVKA 5G5DB 5F70A 2Z8WC 3T2NH 5BMFL 4WK0B 4Y5YA 3LRSA 3L7FB 1D7BA 1MJ7L 4X7CC 1QQDB 4ZOAA 2ERJC 2BM3A 2VDNH 2VE6B 4BSVB 3FN9A 3EFDH 3C08H 1J7VR 2Z31C 3GIVB 4Y2DB 3ZKMC 2PUQT 4ABWA 3WNIA 4KDTA 1GHFL 2YAEA 4Z7UB 4Y4HB 5F0JB 3MKKA 3UTPE 4A7UA 4WW1A 1E5AA 5DRXA 5TQ2L 1M9WA 2PYEA 1D3CA 4U1JB 2CRZA 2C3VB 4I48B 1IAKA 3D52A 2ZP9A 2AKRA 4IRZL 3FB8B 3F85A 3NUKA 5HDRA 2N0KA 3NEOA 4PD4K 5HYJE 1QYGH 2NR6A 3JZYA 4BE5A 3MLTA 2I60L 4EZLA 1BJ1H 1YNLL 4Z7VF 3WFCL 4BCXA 1MN4A 1QRNA 2P52A 3H56A 1VGKB 5A2CA 5KS9B 4KHXH 4ZMNA 5FGBC 4PUBH 4JL2A 2PXYC 3KHOA 3L7FA 4PJCE 9CGTA 2I7SA 3CU1A 4YHNB 4LK4A 1S9KC 4Q97A 1QQDA 4PJAB 2VE6A 2FBJH 4BKTC 1HH9B 5DZ9A 4AEFA 1EO7A 3GIVA 4Y2DA 2C34A 2KLRA 4TNEA 4Z7UA 4Y4HA 2OMBA 5EO0B 5FYJE 4YR6B 2F8VA 4OSUL 1F42A 2AQQA 4I2XB 5DZJA 2E4FA 3U30C 2VZSA 5H35A 4U1JA 1RERA 1HQ4B 2H0EA 2DQGH 2ZWYA 2C3VA 2PYEE 4I48A 5HYFA 1OCCB 4F7PB 3MCYA 2JB5L 3FB8A 3VD7A 4NZJA 3RTQB 1Q8MA 3T65B 2F7OA 1M7DB 3ZE0F 2J1KA 4XO4A 4LFHG 5L2KB 1JZ6A 4XTRD 2HJKB 3BDBA 3ARSA 2WTRB 5FKPB 5HVFB 3RFZC 2R51A 1UADC 1VGKA 4I1RA 4LDCA 3SDXB 3SJVB 3O2WL 5CCKH 1AY1L 4GSQA 4YHNA 4XBGA 1UXLA 4OCNC 3ZQ9A 4RX4A 3QNYB 4H40A 2PR4L 4OJFH 4PJAA 3S98A 2Q8AH 3SQOL 1R4XA 1BFVH 1HH9A 3D2TA 2CO3A 3GJFK 3QEUB 2D03H 4PH8A 2J72A 3JYCA 4JHVA 2HVKB 3AW5A 5F9OL 3TCXA 3BWSA 4JFEE 2EECA 4NQEB 4NJAL 5EO0A 4YR6A 4XXWA 4Z7UE 2ILLA 4I2XA 3MA9H 3GS4A 4QRQB 1HQ4A 4ANXA 1CFVL 3G6DH 3QIUD 2Q9OA 4N8VB 5CEYB 4F7PA 1FVDB 4PJ6A 1TJGH 3AG2B 3BUTA 2E5EA 3U2IA 2OFQA 3RTQA 5L0QC 4F15C 2ZJSH 3GXPA 4M48L 1G6RH 3U4AA 1KEGL 1M7DA 1T2QL 3Q1SH 1QR4A 5E6IC 5DD0H 1J8HA 1NM4A 3GT6A 4JG5A 2HJKA 4Q9BA 2B39A 2WTRA 3AXHA 5FKPA 4N2DA 1XD1A 2FNBA 3I74A 4FNLH 4YHMH 5D6DC 4K5MA 4G80B 4NXKA 2BX5A 3SDXA 2WKGA 3V95A 5FW6A 2IDTA 1O7DE 2A4CA 1UZGA 3A22A 3VGAB 5KS9E 2FECI 3ZTJH 4E9VA 3MLZL 3ULUH 3QNYA 3S34H 4MCZB 5I1GL 4ICWA 1DSYA 1O6VA 3VRLE 1A47A 1NKRA 2G60L 4HAKA 3QEUA 4LU5H 4PJAE 3FDWA 2CKBL 1HILB 4CVWA 1GKEA 4YQXL 3CZNA 4ORZC 2XTJD 4GT7A 4UM9D 4NQEA 4PJXB 2ZX5A 4X5PA 3QWRA 5CLYA 4AOFA 2EICA 4QRQA 2QPUA 2NY3C 4I2XE 3MRMB 2AXWA 2CJTA 4G59C 4N8VA 5CEYA 4ZW7A 4X6BA 4LOEA 4FNSA 1FVDA 4IU3B 2XZQL 2ZXQA 2V5TA 1ZE3H 2LU3A 4TNWK 3GM8A 5ACLA 4JRLA 4N8VG 3S3SA 5JW4M 3HI5H 4OQTH 4XT1C 5IF0B 5IHHA 5L2KE 2X2UA 1DJIA 3DMMB 4L1HA 1XBDA 5C9JB 4G80A 2AK4B 2BY0A 2DQDL 1Q90A 1RVFH 1JD9A 3R18A 5KJ4A 1IZKA 3SDXE 2HX7A 3SJVE 4A38A 5BZXA 3D3VB 4WEUD 2C26A 4PI2A 4MCZA 3P0VH 3EUDA 2F54B 5EIQA 1JZJA 2XY2A 2ZXDA 1EJ8A 2BP0B 1XH3B 5I66B 1Q1PA 1P1VA 2GFBB 5CU9A 2WYIA 5CNHA 4PJXA 4LGPB 2HT4C 1N26A 4AT6B 3DJ9A 4UYQA 2F53B 3T2NL 2YO3A 3NSFA 3MRMA 2VDKL 5G4NA 1U42A 4ZODA 3HNSH 4EN3C 2CNYA 5FLVA 4YHKH 2Z34A 2E76C 4IU3A 5L4IA 5CEZE 4APQD 3ARUA 3V0VB 1TMQA 5I1HL 2VDNL 3DNKA 4K07A 2UXFA 2VDMH 2X0VA 1J1XL 1IL1B 1QLEH 1HQRB 2JTYA 3WNLA 1GSMA 4FYRA 5BUAA 5EDSA 2BS8A 3DMMA 3N44B 1CDUA 5B21A 1Q9KB 1NBQA 5C9JA 1HKFA 3AITA 5EZOL 3ZHFA 3B34A 4ZAKB 3VXUB 4YC2C 3D3VA 1QFHA 2JNZA 3ESUF 3UBXI 5I30H 5D7LB 1KLFB 1QYGL 2F54A 5IQ7H 5I66A 1XH3A 1OAXH 1CG9B 1AP2B 2GFBA 2CGYA 2JCCA 5DD5H 3WLBB 4MAYB 3TEUA 5C0DB 4AT6A 3VACA 2ZCKH 4CBZA 3BRDA 1XL4A 5T3XE 3RZCC 4PJXE 5SX5K 2F53A 1UGKA 1XB6A 3QORC 3VDCA 3ZKXC 4PUBL 3UZEC 4Z8FH 2DWDB 4QXGH 2WXLA 3O9WC 1Z9OA 2R2CA 1MCQA 1RURH 3FU9A 1QLRB 1RK1B 3CVDA 4BFOA 3UPRB 2FRGP 4PTTB 1AZBA 5HGGS 3Q2WA 2FNWA 2A9AA 2HMIC 1QI4A 1IL1A 1HQRA 5D7JB 1QSVA 4TN9A 2J1ZA 2R1WB 3WFBH 5J0BA 1N8OE 1VFAB 1Q9KA 4OFPA 2EKSA 3U1PA 2DQJH 2XIIA 5F8RC 2AK4E 4V2BA 4ZAKA 3VXUA 5B1KA 4I18B 4XP1H 2P43B 3ZE2B 1XSKA 1U2HA 3D3VE 4WTZA 3BDYH 5D7LA 1KLFA 1CCZA 3MJWA 3ZHNA 2ITEA 3BP5B 2YXVA 4JKPH 5D1XD 4BWUA 4DUWA 1CG9A 1AP2A 1IBGH 2NQ3A 3HC4H 5C0DA 3WLBA 5DJ8B 2EYTB 4G1MB 3SDDD 3ECWA 1HH6B 4WTZG 2G9HB 1U8KB 5FHAH 3N42F 2ZWNA 2ZWZA 4QOKB 2G75B 2I27N 3NJFA 3HE6B 2F53E 2DWDA 2ZYHA 3G6JF 3H54A 3NCMA 5IROA 3M86A 3V4PB 4EI5D 3VMPA 4LP4A 1EZLA 1QLRA 1RK1A 2LVCA 3UPRA 4GRWB 1AZCA 4PTTA 3C2SA 4YUEL 5B4MC 3N0AA 3MLXH 3A4FA 1MG2C 1YQVH 1BFVL 3FU3A 4WGVB 3WIHA 4ZMAT 2D03L 4M93C 1DUZB 2C9QA 2B08A 5D7JA 4BKSC 4F8TA 2R1WA 5I0DA 4JK0D 5JQHC 1VFAA 2WLYA 3O6LH 3QQDB 5I6KA 3MA9L 4ELMB 1WT5A 4JG9A 2IQAA 2YGQA 1KBWA 4GIAA 5F0PB 2QEJA 3G6DL 4BQ9A 1ESOA 1TITA 2BZCA 4I9WD 1TJGL 5B7MA 1TJXA 2F7PA 4G8FB 4MAYC 4YWGH 2ZJSL 2NDGA 3AUWB 3B37A 1FNFA 2ODIA 5D7LE 3BP5A 5HPMB 4OVUA 2YBRB 1A1MB 4PY8J 5DJ8A 2EYTA 4G1MA 4GXUM 4OV6F 2XN9D 4L3CB 1HH6A 2ZXGA 2NUTB 3HIZA 1KB5A 2EIDA 2G9HA 4RAHA 3UJJH 1U8KA 4F91B 3S36H 4FNLL 1A6ZA 4Q52A 4YHML 1YEFH 4HCIA 4QOKA 1AKJB 2G75A 3HE6A 4U1NB 1HC1A 2EXYD 2BY3A 3V4PA 5A2AA 1S9XB 5EO9B 5JLZB 3C75A 1MIEH 3ZE1F 3V5KB 3ULUL 5HI4C 3LJ3A 4FTVD 3O3BB 4MXVF 1S7UB 3N50A 3NA9L 5SWZB 2NY4D 3MRIB 2XQYG 2IOMA 4EOWH 2OL3L 3AQYA 3NIDF 4CC1A 1CURA 2XRAH 3QQDA 1OV8A 1UUSA 4JM2F 4ELMA 1XAKA 4PGEB 5EPMB 2NPLX 3TPUB 5KSAB 2X5PA 1KN4L 2FO4B 4JEGB 5DHMC 4X4YB 1NSNL 2QKIB 5BUGA 3TZVD 3SPVB 1CE6B 1D5MB 1G7JB 1Z5YD 4G8FA 4TOYH 2BMKA 3ZE2E 3IDYB 3B8SA 4WWKD 2KC0A 1OAKL 2CGZA 4JFFD 1K6QH 2DYPD 4NHCL 5HPMA 3VWKB 2YBRA 4GAYA 5DEFB 5DMYA 3HI5L 1A1MA 3QZPA 4JRFA 2FX7L 5GHWL 3T3PF 1SQMA 4L3CA 3WTXA 4X9YA 4K3GA 2NUTA 3SY0B 3CSGA 3CX5K 3OLEA 3POHA 4XNQB 2QLVB 2QFRA 1RVFL 3LNEA 2H2PC 4GAGL 4QOKE 4PM1A 5A1AA 1EO8H 3SE4C 4WHYG 1S9XA 4IEFB 4XOEA 5EO9A 2CK2A 3ZJAA 4ZW6A 4BQ8A 5JLZA 3US1A 2A6IB 3V5KA 3DVGB 3AADB 3N43F 4PJ8D 2XN1A 3ATDA 3PY9A 1E42A 3O3BA 5D2NB 4GRWE 2KS0A 1UH3A 1WBXB 1EUUA 3GHBL 1S7UA 1TEYA 1I1AB 2Z93B 5SWZA 3MRIA 5MERB 3OLGA 5M95B 1RP9A 5K69A 3SGKC 1BX2B 4Y9BA 1MY5A 1FZJB 3IMUA 3GUTB 1JNNL 3B5GA 4DPRA 2EEFA 4PGEA 5EPMA 3TPUA 2XHNA 4LOUD 1U3ZA 2FO4A 1GC1C 2ENQA 5GRUL 4AJYV 4ELME 4X4YA 3HNSL 2QKIA 1XF1A 3OC5A 3SPVA 3ZK0A 1CE6A 3S88L 1G7JA 4BJLA 1HJBC 25C8H 1IMHC 4WWNA 3GLAA 3VWKA 1CFTB 5DEFA 5AW2B 2R0ZH 5GIRB 4TS6A 3GSVB 3BE1H 3LNGA 4R7VA 3QXUA 4S1QH 3SY0A 3F5WB 5I0ZA 5HJ3B 4NKDB 4XNQA 4NM4H 4KZCA 2OPCA 4U6VL 2BFGA 5ID1B 2AC0A 1VLXA 1J18A 1O6TA 5C0BD 4IEFA 1DQLH 3PYCA 2A6IA 2V9QA 4NN7B 3DVGA 4GBXD 1UXMA 1B0GB 4K94L 1EBAA 1E40A 2QVIA 2P42B 5D2NA 5E2VH 5E6YA 5AWNL 3UAJD 3C09B 4JKMA 4KJQC 3DJTA 1WBXA 1I1AA 2DEYX 2Z93A 3K1DA 5MERA 5DD5L 4HCGA 2C9AA 1BX2A 3L17A 1FZJA 3GZOA 5IQNA 3GUTA 3B2XA 1ADQA 1T7XA 4N8CH 1J1PH 5H4ZA 2ZIDA 1BZDA 2CUIA 2EIJB 5ADOL 4Z8FL 3D0AA 5F1IB 1OTSC 1RURL 4E0RB 2P5PA 2P49B 4MQXD 4AWJC 4UQEA 1BQKA 5E2UL 5KANG 5JOPE 3REVB 1SBSH 1H6EA 4KZEH 1CFTA 1R0AL 4PS8A 5GIRA 3ASWA 4FXKC 2IDFA 3GSVA 2BNQD 3I6LD 3AREB 2XBDA 4OIIL 1U2YA 3VD9A 1OB1B 4X6CB 1MFMA 1EMTH 1NIBA 4E42B 5HJ3A 1MVYA 4NKDA 3VGGA 4XMZA 1B0RB 1F45A 2EIZB 4H1LG 5E9DB 4AVHA 5KYUB 5E9NA 3HB3B 4DAGL 5ID1A 2R8SH 1R3KB 2E9GA 2E6PA 3H6JA 4Y5XB 1EXUA 4B9ZA 2XN0A 5C09D 2UXTA 1B0GA 3MSPA 3BDYL 4JDTL 1D5IH 2DEWX 3ZN6A 2H5UA 5D2NE 3MHZA 4JKPL 1EVUA 5F7LB 1N4XL 3HC4L 4K3JH 1OAYH 1UWFA 3W11C 5BV7L 3IGKA 5FHAL 3QRFM 3IVKA 2X1WL 3FQ4A 4YSQA 2DQEH 1P4LB 1P53A 1WA0X 3RKDC 1BYNA 5IB2B 4P57B 4XC1L 3QFGA 2X7LB 3HBPA 4KXAA 3BZEB 4E0RA 3TBWB 3BAKA 2NNAB 3TT3H 4JG1L 4GIPD 4EXPX 1G1KA 2WOBA 4UV7H 4HUXA 3REVA 3IBEA 4CL7A 4WFHD 1DCEA 2VC2H 5DUMH 1QBMH 2CHXA 3CIQA 4PJEB 2B1HH 4HWBH 1CD8A 3KS0J 3AREA 4U0QB 2WYZA 4X6CA 1B3IA 5DURB 4E42A 2EILB 2FJHB 1B0RA 2EIZA 5E9DA 5KYUA 4M5SA 3IF1B 2JB6B 5LO7A 3FMGL 5AAWC 4F1ZA 3DGCR 1G9MH 1R3KA 2K70A 5SV4A 4Y5XA 2XLLA 1J88A 4P5TD 1N6UA 4FG6C 4DHLA 2LTQB 1J5HA 1PAMA 1AQ8A 4XN8A 3QUMB 4PJ9C 4DP7X 3DC0A 2E8YA 3EF4A 1AOZA 4LLQB 4CW1B 4Z5RB 2O6DA 5DLLA 3JYBA 3UJJL 1IGTB 4MD0B 3VWJB 2Q76B 4HP5A 3RAJL 4UQCA 1F58H 2OCCB 1P4LA 5I1JL 5IB2A 4H0IA 4IGBB 4P57A 2LLGA 3U6XA 4B96A 1GY1A 2W9EH 2X7LA 5D70L 3BZEA 2NXZD 2NNAA 2RIKA 1MIEL 1DVYA 3HI1B 4FXGC 5EN3A 4FZ8H 3TBVB 1OCRB 3CN1A 2PWFA 1V05A 1CVSC 4JB9H 1DO6A 3WIFB 4JPKL 4PJEA 2LR4A 4AGQA 3BKMH 1Z7JA 3BFQG 1AZZC 1AYRA 3MROB 4M7ZB 2AJUH 4EOWL 5I71B 1GXEA 2X4RB 4CDGC 2XRAL 1UG9A 3KLHD 2FJHA 4X6CE 3V6OA 1XD0A 1EEUA 2JB6A 1WUZA 3IF1A 3KS0H 2Z7WA 1LHZA 4G3YL 4O58L 4M8RA 5E9DE 5F7WC 4F58L 5CSZA 4PTUB 1JWUB 1KENH 5DQDH 4H2CA 1YC7A 2HT3D 3K2MC 4LDLB 3FU0A 3QUMA 1IBHA 1AYOA 5DDHB 5ALBL 5DJDB 4YSSA 4MA3B 1GMIA 5A2KH 1KPVB 1FIGL 4LLQA 4CW1A 3HMXL 5EUKB 4EI0A 1IGTA 3VWJA 5HI3D 1CGSL 3QUZC 4A2GA 2OI9B 3FUKA 5AOLA 3WGUB 1OGAA 4IGBA 5LBSA 1PNDA 3GFUA 4KO9A 5D1ZA 4OF0A 2A99A 3VSVA 4K9JA 1INEH 3HI1A 5IW6A 2ZPKH 3TBVA 5AW8B 4XWOD 4N0RA 3NAAH 5EG6C 3WIFA 4BQBA 4YSOA 4U7MA 1IIKA 4WUUA 3HCVB 1OARL 3LPGA 1BQLH 2IH9A 2X3CA 4HC1A 4NFCA 4GEJA 3IXTB 5CZRA 1KGWA 4YEFA 4JHUA 2HKHH 3MNVB 1DQDH 3V6OE 1OHQA 4MJID 4U6HB 4PTUA 4ZMXA 5TDOB 4TVPH 3I50H 5E23A 25C8L 1SYSB 2EADA 3CC5B 4FJ6A 3I3EA 3F7PC 5CJOH 3JVFC 5DDHA 1KGCD 1YJDC 3L5XL 4JFHD 1A2YB 4M7KH 4MA3A 5DJDA 4JREC 1KPVA 4LE8A 4RMBA 3MKGA 2KDGA 5EUKA 3BE1L 5KVFH 4X5LA 1HESA 3BH4A 2A74C 4S1QL 3VD4A 2Q5BA 1CGWA 3T04D 4Y4FD 3GLEA 2OKMA 3ULUD 3IAPA 1QFWH 3A5VA 1CXLA 4M1CC 1RZIB 1T0NB 3TNNB 2YRBA 4HUWA 4M7JL 4E9RA 4MAUL 1DQLL 4R6UA 4L4TE 2IAMB 4IBTA 5TDNB 2XQBL 4HLJA 4UINL 3KR3H 2VITB 4ZZFA 2WKOF 4G43B 5C08E 5E2VL 4WI4A 4PJDB 4EN2A 2WIIA 5T3ZE 3BUPA 4KKZA 1FFRA 1S3RA 4HFWB 4RAUB 2F74B 2ZX6A 4JO3H 5ILTL 1JF6A 3HCVA 5ICUA 3MTXA 4KKRA 5E9AA 3QI9B 4NKMA 4XP4L 4HCFA 1U4FA 3IXTA 1J1PL 1IKOP 3MNVA 2WBXA 3D9AH 2VDLH 1H3TA 2CLZB 4U6HA 4K3DL 3C60C 5TDOA 1Y6NR 1S7XB 5K9KB 1CI5A 2H47C 2FH6A 1SYSA 3GXUB 4F2FA 2I69A 3CC5A 3S96A 5IB1B 4IOFC 4B9JA 3H85A 1GGIL 1A2YA 4KTEH 1H8NA 4JMNA 2YS4A 3FO0H 5C2BH 2MNWA 35C8H 4PG9B 4F80A 1RZIA 5FCSH 1T0NA 3TNNA 4L8SC 3WKQA 4XVUD 3BISA 1USZA 3ETBJ 3RVXD 4PLNC 2R8SL 5LN8A 1JGEB 5TDNA 1X4YA 4B9PA 1KCSL 2VITA 3WJJC 4YDMA 4PJDA 1D5IL 1OEZW 3INOA 2GBVA 4LAQL 2F5AH 1P6FA 1GSKA 4FKEA 4HFWA 2BK8A 3MJ9L 4RAUA 2EUVA 4K3JL 2F74A 5E00B 2CRIA 3I85A 2DS4A 2EEXA 3QI9A 4ATTA 2HX9A 4ZMZA 3L4YA 2NW2B 4X6DB 2GHZA 1E4HA 3QUKA 4MXWL 1QWNA 2CO4A 2RAMA 1YPZF 2Q1EA 4U0RC 3ZBMA 2AV7B 1NAMH 1S7XA 3X12A 4KX7A 3QUXA 1L7TH 3KBEA 3L2LA 4JKNA 4UV7L 1C5DB 2OJEB 3B9DA 4G6ML 5IB1A 3SGJC 2WVTA 5BQDA 1I1YB 5DUML 1QBML 4ZZKA 5CSBA 2B1HL 4HWBL 2B1OA 2WLJA 3QHTC 4N2CA 4PJGB 2IMNA 4ZBJA 4ALAC 1A7NL 3DX3A 1FUNA 2Y36H 1IKFH 2H4EA 4N5ED 2IAMC 3BUYB 3KEHA 1CGTA 2DI9A 3GSWB 4PG9A 4XO3A 2H2SC 3WDHA 4K7PY 2M8XA 4IHOB 1JUFB 1E5ZA 2SEBB 1ETB1 2HA1A 3F6LA 5CHNA 3TESA 3FQ2A 4FFZH 4AM0Q 1H9VA 3NP3A 1CDGA 2H41A 4HIQA 4PJDE 4U4IA 2OBGA 3P02A 3O3UN 3F2LA 1HYSD 4QJ3B 4QMEA 5DTFB 5E00A 4R96B 4J6RL 4QXTB 2YAQA 4PRPB 1IU1A 3PP3K 4FZEH 2CKNA 4GI6A 3HC0B 3SPHA 5INDB 4X6DA 1F58L 4XMXA 2AITA 1E4JA 3O8XC 4X8GA 2AFNA 3OPZH 2FWUA 5DUPL 2W9EL 3QDGE 4HZAA 1GGBH 2ZP8A 2AV7A 4FZ8L 4PY8I 4WSGA 2ZKHL 3RI5K 5CJBA 1QNIA 1C5DA 2OJEA 3BOVA 3FT9A 4HLZH 4AV0A 1I1YA 2VXQL 1I85A 2X10A 4PJGA 2CM5A 2LOEA 3BKML 4KHTL 2FHCA 2EIKB 3OQRA 3T8MA 2Y7LA 3BUYA 3N40P 2Z7YA 2VH5H 3GSWA 1XMWA 4LMQE 4YBHA 4GUPA 1FCGA 4YAQB 2Y0SA 3QP3A 4IHOA 2VM3A 4Z3FA 1JUFA 3VX0A 2SEBA 3O6KH 5DQDL 1OO2A 2WUCL 3DO3A 2E56A 3V7AG 4JRYD 1WFJA 3KPMA 2YMOA 4P4KB 3GDCA 4B7IA 3ES6B 4R7DB 5DTFA 4OFKA 4XPHH 4R96A 4KNQA 2ZXAA 1UCBL 4DTGL 4QXTA 4PRPA 4OLZH 3HC0A 5INDA 4DVBB 1MDTA 2NNCA 4M9PA 2ZOKB 4NNPH 4X6DE 2E4TA 4O51B 4WO4D 1R5VA 5BO0D 4UNVA 5LCVL 3P4OB 1Z9PA 2ZG2A 1AMXA 4J3WA 4FKHA 4PEEA 2YXFA 1INEL 1LILA 5EV7A 1BZ9B 2ZPKL 1HZLA 3HEIB 4UQ2B 3O6ML 2E7MA 2MCG1 2VSKB 5DZOA 3CFJA 4GP4B 1AKPA 3LQAH 4L4VA 4PJGE 3RI5F 1G84A 1I9JH 4EZJA 1ZRUA 4G1EB 4NO5B 5D2LF 1O9VA 5I74B 5JDJA 4YDZA 1RI8A 2GEEA 4PGZA 3V7AE 4FE9A 2XOTA 4J3UA 4ODUB 4YAQA 4G8GB 1OTTD 1DBML 3H9SD 4TVPL 3V5HB 1MOEA 3I50L 2AXFB 5CJOL 4IDJH 4P4KA 3TC9A 3M7OA 3ES6A 4M7KL 3N91A 1P7KB 4AG4L 3LS5H 4URKA 4NZTH 3ARDC 2EVHA 4EBQL 1MCDA 5E6SB 3QJTB 3RBGA 3EDEA 3V4UH 1PU0A 4PRPE 3V8CA 1OPGH 4ZXBD 5AVVB 2ZOKA 1QFWL 3TEXA 4NLAA 2CR6A 3O41B 4LVNB 3BFOA 3P4OA 3QCUH 3UYPB 4MAZA 3ZTEA 3HHMA 2EDFA 1BZ9A 3FFOA 4UQ2A 3F83A 2EEBA 2DYRB 3NCJH 4HSCX 2IJ0C 3VG9C 1ETZB 4FKKA 2RA1A 4NKIH 4JBSA 1TU2B 1TTRA 3SB3A 3ECBA 4POZC 4K15A 3OF6A 2NY2D 4G1EA 4X0NA 4NO5A 4XTRC 3VA6A 1N6QH 3WYRA 1ITCA 2GK0B 3BAEH 3DX1A 1IV8A 3D9AL 2YUWA 1LTXA 4ODUA 4G8GA 3WJMB 1KB9K 4PBXA 1CXKA 2B9BA 3DBXA 3V5HA 4OFIA 5T5NG 1JV2B 1CTNA 4M5YH 4P9MH 1P7KA 4KTEL 3RU8H 2ZTBA 3FO0L 5C2BL 4HJEA 2DJMA 3FTSA 1T2JA 2N01B 2B7DT 3AS3A 3W1ZA 2LAAA 3FTYA 3O41A 5FV1L 5HDWA 3UYPA 3O81A 3QIUC 3V0AC 2F5AL 3CLEH 5E1AB 1ETZA 1IGML 1TU2A 1ITBB 4JRWA 1AIZA 1F4YH 4YZWA 2DH3A 3DVNA 3ZXAC 1JF1B 4F3FB 1UYWH 3K0YA 4UUJA 5EOCH 5GJSH 5IMOB 1P2CB 1CDHA 2GK0A 2ZICA 3WO4B 4Z7QE 5IKCB 2WAHA 4JY5H 4HUCA 3WJMA 4Y2NA 3VGEA 3MV7B 4G8GE 3ZMRA 1JV2A 3K71B 1PSKH 4NI6A 3CZGA 2Z0UA 4KOCA 3OQ3B 3UEQA 3TV3H 4LCWD 4P9HH 5K5YA 4KNSA 3MGTB 4UZSA 1U3HA 1E43A 1IKFL 2RBLA 2Z7ZA 2CRMA 5BOPA 2XTJC 4WWID 2V6HA 1Q9LA 2NYYD 4IOIB 1NFKA 1EDHA 3TFKD 2WO4A 1PLGH 5KAQF 4FMFA 1P7BA 4ZUVB 4OF5A 1LWHA 4AQAA 5TGBB 2ROXA 2BC4B 2YPVH 3LPOA 3IMTA 4FFZL 4P2OD 1LMIA 2BY1A 1AS8A 1AQKH 3GSRB 4HIEA 3UC0H 2IDUA 3KPLB 3SBWA 1TCRB 4JQVA 1QMUA 2FX9H 4N0FB 2B0SH 5E1AA 3T3MB 1SZNA 3VW3H 2Y5QA 3FF7A 3DO4A 3SE8L 1JF1A 4FZEL 5IMOA 1P2CA 3BJLA 4G6FB 5IKCA 5F97E 2W65A 1SBBA 1XWVA 4U05A 4JAMB 4ONGH 2X9YA 3MV7A 2ZG1A 3OM3B 3K71A 1J86A 3SHSA 2ZAHA 3KVDD 2ZP0T 4K5NA 4IDLA 3TJHD 4AEEA 5B1JA 1SGKA 2YPKB 3TN0D 2X40A 1G9NC 1PG7L 5HDOA 2YWZA 3MGTA 1FGNH 4JFYB 2X42A 4MSWB 3STBA 4WRLA 2Y06H 2AEQH 2VH5L 1SXAA 4IOIA 3GB7B 2VR6A 2R4SH 2WQAA 5D1XB 4MQSB 4HJ1A 4LSTH 4ZUVA 4B3EA 5FDWB 1Q9WB 5I26A 5TGBA 3SDDB 2BC4A 1NC2B 4HHAB 1RJYB 3GSRA 1JGLH 1XCQB 4EEEA 3UAFA 4APQC 3KPLA 4HOXA 1GYUA 1TCRA 1ND0B 5B1BB 1KXVA 1XSOA 4XPHL 2DWSA 4X83A 4LT7A 1NKOA 3ZYJA 4GQ9L 4TF4A 2H6PB 5HJDA 4PRHB 1V3JA 4OLZL 3R1GL 1KLGB 1UB5B 2APBA 1MWAB 2W92A 3H2QA 4HIJB 3P2TA 4JAMA 2WQXA 2OAAA 2EDHA 1WRFA 5F1NB 1AFVH 2KMWA 1C08B 4KI5D 3MV7E 2H32H 4EQ2A 1GGUA 4D2NA 2CWRA 2YPKA 4ZW8A 3U9UB 3RJDA 1UTDA 2EEAA 5MHSD 2DQCL 3LQAL 4O9HH 2AEPH 1MQKL 1PZUB 5GS2H 3CVHH 2YK1H 3VXTB 4MSWA 2YAOA 3IFPB 5CD5D 6CGTA 5KN5B 3GB7A 2BHFA 3BWZA 2A9NH 3VO0A 5FDWA 1OOAA 2ZXBA 1V7ML 1N70A 1NC2A 1E6OH 2DLIA 4HHAA 5CO1A 1RJYA 3ZRFC 2P8MB 1XCQA 2IPKA 3KGTA 1FHNA 4IDJL 2MOGA 1ND0A 4QNPF 1JTTA 3QXWA 5EOTB 1F13A 4HH9B 2BHZA 3T3ME 2H6PA 3FSZA 4PRHA 1FWXA 1JZDC 2O5XH 3QEGL 3EJYD 1KLGA 1UB5A 3I75B 1FLTX 1OPGL 1MWAA 5FUZH 4HIJA 5DJCB 2K6ZA 5ICYB 1H0DB 2B77A 3QCUL 3L2MA 3UBXB 1P84J 2WCSA 5F1NA 4CKQA 2GJPA 1JZFA 4ONFH 1G7IB 1C08A 4QKTA 5E4IA 2J56A 1BAWA 3NCJL 3RL2B 4RFOH 1KJMB 4LAJH 4MMXA 2APXA 3U9UA 5LXGH 2OM5A 3MRCB 5IVXF 5D1XC 2C8NA 2ED8A 3ESNA 5F0MB 4GH7B 2VLLB 3VXTA 1TG8A 3IFPA 5DA4A 1N6QL 3B3BA 3SDDC 2IDQA 3BAEL 4RSYA 4WWKB 1DL7H 3CFDB 4JFFB 2DYPB 4OTXL 5L7XL 1ZOXA 5D1XE 3UBFA 5C0AD 4EI5C 1D6EB 1FH2A 3MV8B 4A39A 1JNJA 2P8MA 4CC4A 4TPRH 1A25A 2C3HA 3BVWA 4PYHA 3QJUB 4MMZC 2V7NB 5EOTA 4P8QA 3LZNA 4AL8H 2WZPD 4P0DA 1XSJA 4HH9A 3HVNA 5LJYH 2HTKD 4NZ8A 5KVMC 4UQAA 3UROR 3ULVD 3JV6B 3RX9A 1DQKA 3I75A 4PRHE 4XPAH 5DJCA 5ICYA 1JV5A 1THAA 1T03H 1H0DA 1NAKL 4OT1L 5EOQH 1Z9SB 4RGNC 2WXOA 5DLMH 1OQOA 3BPLC 1I7ZB 1G7IA 2R56H 3MGOB 5C0EB 4QAMB 3BVDB 5DHYB 3RL2A 1FYTB 1KJMA 3CLEL 4OIBA 4QLWA 3MRCA 3KXFB 3P3UA 4LSRL 4K3HA 4LPVA 1XCXA 2VLLA 1J9CT 5SV3A 3RHWK 3HBGA 2PW2B 4TVPD 5AD0B 4I9WE 3U7WH 1S5IH 2XZCL 1TXKA 4WWKA 1W0WB 2YAPA 1VIWA 3CFDA 4JFFA 3ZZLA 4DEUA 2YAHA 4D9QE 4JY5L 3LB6D 5FA4B 3EBIA 5ABDE 1KULA 1ASOA 2EXYC 1ZLUK 3JT0A 1D6EA 4ZOBA 3MV8A 5EUOF 1PSKL 2FB4L 3WMPA 2WZ0A 4PLOB 3TV3L 4ZFGH 1AHKA 3IJEB 1G43A 2BSRB 3GKWH 2ZAIA 2ZONA 3JV5A 4ZMVA 2WMPB 3JV6A 1JGVH 2NY4C 1NGQH 4J3BA 3WEBA 4YSEA 3BD3A 3CJJA 4KV5F 1LWRA 4RMUA 3T0AA 3X1BA 4JFXB 1I7TB 4NNXB 1J0KA 1BW8A 5K39A 3NEXA 1I7ZA 4YFLF 2YPVL 2IMMA 4LOVA 3MGOA 3FUFA 3TZVC 5C0EA 3US9A 1VF5C 1QSZA 3AU0A 3UC0L 1TJMA 5DHYA 5KSBB 1FYTA 2B0SL 2MCPH 3VW3L 1OM3H 3C5ZB 3QWQB 3KXFA 3UEZA 5CGTA 3U83A 5GGSB 2PW2A 2LLLA 3VNZA 3MO1B 5AD0A 3ULAB 5F7YC 5H8DA 3N41B 3FK3A 2CH8A 1W0WA 2FUTA 4HOMA 1YN6B 4HG4K 4O02L 3PWJB 5FA4A 4JFFE 3UCRA 4ZMOA 3GKZA 4D3CL 3ARBD 3DPBB 4I7ZC 3SKNB 1D2PA 4J4PD 4F5CA 5J1TC 1AGFB 1P5UB 4PJ8C 2BNRD 3GXFA 2Z65C 5INCB 2F1AA 2X1XR 3FFCD 4I0PB 2GSGB 2UWEF 4BZ2H 2BSRA 4Y16D 5D7KD 1Z3RA 4F57L 3DUUB 2XUWA 3B9KB 5FO8A 2WMPA 3ESVF 3LEVL 1E65A 2Y06L 5BO1H 2AEQL 3S8WA 3QVAA 3BAXA 1IFRA 2J20A 4M03A 1FL3B 3E8VA 1N12A 4JFXA 1I7TA 4NNXA 1OE2A 3ARGD 4HQQH 5F9WC 1KYUA 3WD5H 4LOUC 1CMOA 3W57A 2ZOUA 4GQQA 3T2PA 1RY7B 3QUYB 4X6EB 1JGLL 4OB5L 5JHLA 1Z9MA 3LYRA 1DBKL 1UKQA 2FX8L 3APMA 3GZKA 2WLLB 3B56A 5KSBA 1KNOB 3CNKA 1YNTB 3EJUA 4P2AA 4WI6A 2ADYA 1L6ZA 3C5ZA 1BAFH 1FYTE 2W0KA 1JZ4A 3MLSL 1JXKA 3KXFE 5GGSA 4JPWL 3BGMB 3MO1A 1A6VL 3QR2A 4X5WA 2DYSB 1X7SA 3WTUA 1JYWA 1YN6A 1MHPH 3GUFA 3PWJA 3CHSA 5KBMA 1AH1A 3NP4A 4XP6H 4FABL 3U9PH 2WNXA 4N2BA 3ESPA 1DSFH 3ARFB 3GLDA 1AGFA 1P5UA 1ZA3B 2XV2A 4GBXC 4XCFH 5INCA 3R0NA 4I0PA 3UAJC 3ZYIA 4F5CE 5KYNA 2GSGA 3MCKB 1GS6X 4O9HL 1TTBA 3DUUA 3B9KA 3CVHL 2YK1L 1KDIA 1PPIA 1S7QB 4OCXH 1KYAA 3VCLB 1FG2A 3V0GA 1FL3A 3ZO0A 4GQPH 3N1MC 4LNVA 2R2HB 2Y9RT 3E3QE 1QX1A 3QUYA 4ZS6D 2ED7A 4AUYA 1EFQA 3NIGF 3L16A 4R83A 4LHJB 1A3RL 4MQXC 3BP4B 4KWUA 5D96C 4B7LA 1KNOA 4P2RB 1YNTA 3BPCB 1SFHA 4JHWH 1S78D 5KSBE 1DSWA 1BHGA 3QZWB 1XMEB 4WDIB 3T4AC 3W82A 2BPBA 2Y2TA 5LXVA 3BQUD 4JQXA 4B9CA 3SDCB 4P49A 2WZ6A 4F7EB 4X7SH 3I6SA 4DEPB 4DZBB 2YRLA 4OKDA 5IZ7A 2XKNA 3ARFA 4YZFF 1ZA3A 4RLDA 3MVSA 2ED9A 3K5SA 2YFOA 3MCKA 5LXGL 2LW3A 4WEMB 4UF7C 4XMPH 4AZ8B 1BQHA 4H8VA 3NJJA 4R4ND 1YA5A 2DAVA 2E3VA 2AEIT 2J6EA 3DDGA 3MJGX 4HCRH 5KOVC 3VCLA 3KPQB 4AEIH 3CQQA 4CUCA 1DL7L 3SE6A 2ZD0A 4OZHF 3RY6C 2EUXA 2P24B 1EGJA 2DTMH 4P23B 1BQHG 4JPIB 4S1DD 1OHZA 2A6KB 4FRWA 4TPRL 2YN5A 5AW1B 4TQHA 3BP4A 4FQCL 3UTTD 4HPOL 4P2RA 3BPCA 5IWLC 2H3NB 3HPJB 3ALPA 3S3JA 3E6FB 5AAMC 4AL8L 2EYSB 1F6AB 3QZWA 4ZMQA 2PKDA 4ADGA 1OPOA 4WDIA 4M00A 1J5OH 4XPAL 2P44B 2ZUQC 3AG1B 1CXFA 2FDBP 2Y6SD 4WFHE 5DLML 4QT5B 1S3KH 3S3CB 3SDCA 5HYEA 3QZWG 4F7EA 3I9GL 3ILQD 4WI5A 1E6JH 4DZBA 1XH0A 1KCVL 2J88L 2IADB 4P5TC 3QIWD 5HGHB 5DYOB 4FA8A 5I0WA 3VFSB 4YGAB 2XYBA 1MIMH 2FR4A 1KV7A 1UXWB 1E9PB 4AZ8A 5B1CA 3A6BL 3HG1B 4AENA 4PJ7A 3KPQA 3U7WL 1S5IL 1S9VB 3JTBA 3KYKH 3CDFA 3WNKA 3V79C 3EFFB 2Z92B 5I8EB 1RMFH 3FSVA 3QDJD 4LSSL 1WWWX 1X4XA 2CDFB 4GAJL 3GJFH 4P23A 3QYCA 1BIIB 4JPIA 4JO2L 5F72S 3GI9L 4XODA 1RU9H 1UZ8B 5DFTA 4E36A 2NXZC 4JKKA 4Y4FB 3DTXB 4FJYA 3P3TA 4HOWA 4ZFGL 4H25B 1MVFA 2H3NA 3HPJA 5FO8B 2GY5A 3E6FA 3GKWL 3HHSB 4UZUA 1F6AA 4P2RE 5DJAB 1NGQL 2D9CA 2AABL 2EO1A 4MJ2A 3QJHB 3CDGA 3RIAF 2DQUH 2DMCA 1I3GL 4OD1H 4LCUB 5I9QC 1EZSA 3KLHC 5TDPB 3ZT5A 4D9LH 4QT5A 3U0TB 3AJ7A 1IARB 2IADA 2EH7L 4ODSL 3CLFL 4QF1B 5JHMA 1NCGA 5HGHA 5DYOA 2HT3C 4WWPA 4F8QA 3H42L 3VFSA 4XPBH 2MCPL 2Q8BH 1UXWA 3TYFB 1E9PA 1PDKB 3SDAD 5AZ2H 2WQRA 2YPLD 2I26N 3HG1A 1JERA 1ES0A 1FE8H 5J6SA 3RGVD 3SYCA 4DN3H 1FC1A 3B2VL 2B1AL 4PJCF 1S9VA 2DLFL 2R69A 3EFFA 2Z92A 3F01A 5GGSY 5I8EA 4OR1A 1VENA 3CZFB 1NBZB 3AFLA 4U1GC 2CDFA 3DGDA 3QC5X 1SJVA 4POUB 3CWGA 3AG3B 1UZ8A 2NY1B 4DPAX 3DTXA 2ENPA 3IJ9A 3BN3B 1WWAX 4XWOC 4H25A 4I13B 4BZ2L 4R7NB 4W4NA 3HHSA 5DJAA 5ERWB 3RDTD 3SGDH 1JYVA 2M83A 3T0EB 4PJIF 1MF2L 1ZSDB 3BSHA 1IGIH 4U6XB 1T4WA 4KPHH 3QJHA 1J11A 3TL5A 1W8OA 4LCUA 3IFNL 2Y69B 2WLMA 5TDPA 3AT9A 1E8WA 3TO4B 2EEDA 4ZTOL 1GZPB 4JO1H 1KF9B 5D7IB 3ZZSA 2Z8SA 4U2YA 3NRPA 1RZFH 1U6AH 3U0TA 4XMUA 1WV7T 1WYJA 4BINA 5CP3H 4QF1A 4H4NA 2BHUA 4MD4B 3LDBC 3Q48A 1ZIAA 4MNGB 2BOLA 3X11B 1BAFL 1GYAA 5E4EB 3TYFA 1PDKA 1MLCA 1TSHA 3AVEA 2E7BA 4H7VA 4MJIE 4OBSA 4J27A 3HG1E 4PRNA 3GIZH 3FXIC 4PW4A 2DKSA 3LVTA 4Y4FC 1OAZH 3ULUC 1MHPL 3CZFA 3QBTB 3GMPB 1KGCE 4Z7AA 1ECYA 3U9PL 2X4SA 1TZOA 3QCVH 3UTOA 1DSFL 2IIJA 2C1PB 1ORSB 1INDL 2R2EA 2VO5A 4XCFL 2CIIB 2EDNA 3ZO9A 3OKEB 3NGBC 4HJJH 3TVMD 1J1OL 5ERWA 3D6GA 4ZUWB 4L23A 3T0EA 1D7CA 5DFWH 4U6XA 4WJ5B 4FG0A 4R9HA 4J5VA 4OCXL 1HIMH 4AIEA 4W81A 1PLAA 1J9RA 3O2DL 4FC3E 4DCQB 1WHOA 3P69A 4GO9A 4BFIB 3TO4A 1ZE3C 1GZPA 2F7RA </