3LNLA

Crystal structure of staphylococcus aureus protein sa1388
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
368
structure length
307
Chain Sequence
b'DPMKIADLMTLLDHHVPFSTAESWDNVGLLIGDEDVEVTGVLTALDCTLEVVNEAIEKGYNTIISHHPLIFKGVTSLKANGYGLIIRKLIQHDINLIAMHTNLDVNPHGVNMMLAKVMGLKNISIINNQQDVYYKVQKIEFMIDAYQKSRAEQLIKQYHPYETPVFDFIEIKQTSLYGLGVMAEVDNQMTLEDFAADIKSKLNIPSVRFVGESNQKIKRIAIIGGSGIGYEYQAVQQGADVFVTGDIKHHDALDAKIHGVNLIDINHYSEYVMKEGLKTLLMNWFNIEKINIDVEASTINTDPFQYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0135 protein SA1388
publication title Structure of a Conserved Hypothetical Protein Sa1388 from S. aureus Reveals a Capped Hexameric Toroid with Two Pii Domain Lids and a Dinuclear Metal Center.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 92
structure length 307
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01784 NIF3 NIF3 (NGG1p interacting factor 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.260 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3lnlA02
2NYDA 3LNLA
chains in the Genus database with same CATH superfamily
1PZXA 5K2ME 2RFKB 2NVQL 1IRNA 3SS2A 5MGNA 2NVYL 1IU5A 2Y0SP 1BFYA 3FDJA 1RWDA 3H0GL 3GTOL 5MF6A 3PO3L 4JAEA 4LHLA 4UY81 3WWLA 1R0JA 1R0IA 5C44L 3S17L 2MS3A 2PMZP 1SFOL 4Y52L 2XJQA 4A3BL 1IW7D 4AHZA 3RZDL 1YV1A 1YUZA 5GAGc 2V0FA 1B13A 2YU9L 4A3CL 1R0GA 5M3ML 1JYBA 3KYVA 2PVEA 1Z92B 1LKOA 4X6AL 3H9BA 1IROA 2PYAA 4V196 3PIP1 1QCVA 3RZ6A 3H97A 1BQ8A 5AI2A 5IY0A 1SMMA 2AYJA 2JA5L 4POGA 1S2ZA 3PWFA 2PPTA 3CQZL 3HJYB 1SMWA 4ZN3B 1BRFA 5GAHc 3LWOB 2A6HD 5IYBL 1SMUA 1T9OA 1TWCL 2AUSB 1LKMA 4XGHA 3PKIA 3QVDA 3GTML 3S1QL 4TVMA 1CADA 4TPUA 5C4XL 1RB9A 4YWMA 3MQKB 5AN9H 3I4ML 3RYGA 1VZGA 3HOUL 3S2DL 7RXNA 4GS7D 5IP7L 5M5YL 2XJPA 6RXNA 3IU3I 4AI0A 1VZIA 4QIWP 1OWBA 3LPEB 1RDGA 2O5JD 2JI1A 5GADc 1OWCA 1LKPA 2ERJA 2C6AA 2AQCA 3RZOL 4AI3A 2E2JL 4RXNA 4AR5A 1P7PA 2M6PA 3M4OL 2APOB 2EY4E 4A3KL 5FLML 2JI2A 1R0FA 1PFYA 3A44A 2XJUA 2JI3A 4JAFA 5FJ8L 1IU6A 2E2IL 2NVTL 1PFUA 1LTLA 1BE7A 3GTQL 1Y1VL 1RDVA 1WJVA 4E6YA 2Z3QB 3KYUA 3I4NL 4A3GL 2A6ED 2JA6L 1K83L 2PVXA 5MFPA 2JA7L 3MSUA 1YUXA 3HKZP 4AR3A 4WFN1 1NXGA 2WB1P 4AR4A 3S1RL 4A3JL 5IYCL 3GTLL 4C3HL 3LWVB 3HOVL 3HAXC 4C3JL 1TWHL 3LNLA 2B63L 3GTKL 3B0AB 1VCXA 5M5XL 3PO2L 1DVBA 2ERSA 2WAQP 1E8JA 2HR5A 2A69D 4XXBB 4AI2A 3PL5A 4AI1A 3FKIL 2VL6A 2B5ID 4A3EL 3LWQB 4AYBP 2GMGA 2PSMC 1H7VA 2K2DA 5IP9L 4BY1L 3RZTA 3GTGL 4A3IL 3PKJA 1YK4A 1I3QL 3P8BA 2R7ZL 1WCML 1ZRPA 2V3BB 5JVH1 1NNQA 2CKAA 1B2OA 5EINC 4JADA 2A68D 1RYQA 3HOYL 2NVXL 3LWRB 3NFPI 3LWPB 1B71A 3HOXL 1VZHA 2H12A 4LHNA 2C6BA 5C3EL 5AI3A 4U671 2R92L 1DX8A 3HOWL 2KKDA 3H3VM 1FHHA 3GTJL 2V0EA 5M3FL 4G6BA 1FHMA 2M6OA 5GAEc 5IYDL 5EIOC 4BBRL 4C3IL 1B2JA 1T9QA 4BXXL 2RDVA 1R9TL 4BBSL 4AHXA 3PZAA 3HJWB 1T9PA 2BE5D 1R0HA 2XJSA 3K35A 3HOZL 3WWNB 1NXEA 4B8CD 5DM61 4A3ML 2R93L 1TWAL 1BQ9A 3S15L 1YK5A 2M4VA 3GTPL 3JR7A 2LCQA 3MPSA 4A3FL 5M5WL 1PFVA 3KYYA 4AR6A 2HVYC 4BY7L 8RXNA 3S2HL 4ZN1B 2XJVA 3KYXA 3S14L 3J7Y1 3H99A 4A3DL 2CR8A 5JVG1 3B08B 5DM71 2VUML 3ZG6A 1I50L 3PIO1 1Y1WL 1PFWA 5C4JL 5MLC3 2QL0A 3QQCE 2E2HL 4A93L 1CAAA 3S1ML 2Z3RB 1I6HL 5RXNA 2XJRA 3M3YL 2KN9A 4C2M1 1TWFL 1QYBA 4AHWA 4JAGA 2DSXA 2CKCA 1TWGL 3H9CA 3P2AA 4Y7NL 3J7Z1 2JA8L 2NYDA 2L0ZA 1ODHA 2XJTA 1S30A 4YWLA 3S16L 3K7AL 5MFZA 2J9UB 1RYTA 2M4YA 4POFA 3KYWA 3VPBE 4ME3A 1F4LA 2ZIXA 1S24A 4AHYA 4K9FA 4A3LL 5H1Sc 1C09A 3S1NL 1QQTA
chains in the Genus database with same CATH topology
1CADA 2LCQA 4TPUA 5K2ME 1RB9A 1IRNA 2A69D 4XXBB 4YWMA 3MPSA 4AI2A 3SS2A 5AN9H 5MGNA 4AI1A 2VL6A 2B5ID 3RYGA 1VZGA 7RXNA 3KYYA 1IU5A 4GS7D 4AR6A 2GMGA 1BFYA 2PSMC 1H7VA 2XJPA 2K2DA 6RXNA 8RXNA 1RWDA 4ZN1B 2XJVA 3RZTA 3IU3I 4AI0A 5MF6A 3KYXA 4JAEA 1VZIA 1OWBA 3LPEB 1RDGA 3PKJA 1YK4A 2O5JD 2JI1A 4LHLA 5GADc 3J7Y1 1OWCA 1LKPA 2ERJA 4UY81 2C6AA 3WWLA 3P8BA 1R0JA 2CR8A 5JVG1 3B08B 1R0IA 4AI3A 5DM71 3ZG6A 1ZRPA 2V3BB 3PIO1 5JVH1 2MS3A 1NNQA 4RXNA 4AR5A 2XJQA 2CKAA 1B2OA 2M6PA 2QL0A 3QQCE 2A68D 1IW7D 4JADA 5EINC 5MLC3 1RYQA 4AHZA 1CAAA 2Z3RB 1YV1A 1YUZA 5GAGc 2V0FA 3NFPI 1B13A 5RXNA 2XJRA 1R0GA 1B71A 1VZHA 2JI2A 2KN9A 1JYBA 3KYVA 2PVEA 2H12A 1Z92B 4LHNA 1R0FA 2C6BA 3A44A 2XJUA 1LKOA 2JI3A 1QYBA 5AI3A 4AHWA 4JAFA 4U671 4JAGA 2DSXA 1DX8A 2CKCA 1IROA 1IU6A 2PYAA 2KKDA 4V196 1FHHA 2V0EA 3PIP1 1QCVA 1LTLA 1BE7A 4G6BA 3P2AA 1FHMA 2M6OA 3J7Z1 3RZ6A 1RDVA 5GAEc 1WJVA 4E6YA 2Z3QB 3KYUA 2NYDA 5EIOC 1BQ8A 2L0ZA 5AI2A 2A6ED 5IY0A 2PVXA 1B2JA 5MFPA 1ODHA 2XJTA 1T9QA 1SMMA 2AYJA 2RDVA 1S30A 4POGA 3MSUA 4YWLA 1YUXA 1S2ZA 3PWFA 4AHXA 2PPTA 3PZAA 1SMWA 4AR3A 4WFN1 5MFZA 1NXGA 1T9PA 2BE5D 4AR4A 2J9UB 1RYTA 2M4YA 1BRFA 1R0HA 2XJSA 4POFA 5GAHc 4ZN3B 3K35A 3KYWA 3VPBE 4ME3A 2A6HD 3WWNB 1NXEA 4B8CD 2ZIXA 5DM61 3LNLA 1S24A 1SMUA 4K9FA 4AHYA 1T9OA 1BQ9A 3B0AB 1YK5A 1LKMA 2M4VA 5H1Sc 1C09A 1VCXA 3PKIA 3QVDA 4XGHA 1DVBA 2ERSA 1E8JA 4TVMA 2HR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYD A;  3LNL A; 
#chains in the Genus database with same CATH topology
 1PZX A;  5K2M E;  2RFK B;  2NVQ L;  1IRN A;  3SS2 A;  5MGN A;  2NVY L;  1IU5 A;  2Y0S P;  1BFY A;  3FDJ A;  1RWD A;  3H0G L;  3GTO L;  5MF6 A;  3PO3 L;  4JAE A;  4LHL A;  4UY8 1;  3WWL A;  1R0J A;  1R0I A;  5C44 L;  3S17 L;  2MS3 A;  2PMZ P;  1SFO L;  4Y52 L;  2XJQ A;  4A3B L;  1IW7 D;  4AHZ A;  3RZD L;  1YV1 A;  1YUZ A;  5GAG c;  2V0F A;  1B13 A;  2YU9 L;  4A3C L;  1R0G A;  5M3M L;  1JYB A;  3KYV A;  2PVE A;  1Z92 B;  1LKO A;  4X6A L;  3H9B A;  1IRO A;  2PYA A;  4V19 6;  3PIP 1;  1QCV A;  3RZ6 A;  3H97 A;  1BQ8 A;  5AI2 A;  5IY0 A;  1SMM A;  2AYJ A;  2JA5 L;  4POG A;  1S2Z A;  3PWF A;  2PPT A;  3CQZ L;  3HJY B;  1SMW A;  4ZN3 B;  1BRF A;  5GAH c;  3LWO B;  2A6H D;  5IYB L;  1SMU A;  1T9O A;  1TWC L;  2AUS B;  1LKM A;  4XGH A;  3PKI A;  3QVD A;  3GTM L;  3S1Q L;  4TVM A;  1CAD A;  4TPU A;  5C4X L;  1RB9 A;  4YWM A;  3MQK B;  5AN9 H;  3I4M L;  3RYG A;  1VZG A;  3HOU L;  3S2D L;  7RXN A;  4GS7 D;  5IP7 L;  5M5Y L;  2XJP A;  6RXN A;  3IU3 I;  4AI0 A;  1VZI A;  4QIW P;  1OWB A;  3LPE B;  1RDG A;  2O5J D;  2JI1 A;  5GAD c;  1OWC A;  1LKP A;  2ERJ A;  2C6A A;  2AQC A;  3RZO L;  4AI3 A;  2E2J L;  4RXN A;  4AR5 A;  1P7P A;  2M6P A;  3M4O L;  2APO B;  2EY4 E;  4A3K L;  5FLM L;  2JI2 A;  1R0F A;  1PFY A;  3A44 A;  2XJU A;  2JI3 A;  4JAF A;  5FJ8 L;  1IU6 A;  2E2I L;  2NVT L;  1PFU A;  1LTL A;  1BE7 A;  3GTQ L;  1Y1V L;  1RDV A;  1WJV A;  4E6Y A;  2Z3Q B;  3KYU A;  3I4N L;  4A3G L;  2A6E D;  2JA6 L;  1K83 L;  2PVX A;  5MFP A;  2JA7 L;  3MSU A;  1YUX A;  3HKZ P;  4AR3 A;  4WFN 1;  1NXG A;  2WB1 P;  4AR4 A;  3S1R L;  4A3J L;  5IYC L;  3GTL L;  4C3H L;  3LWV B;  3HOV L;  3HAX C;  4C3J L;  1TWH L;  3LNL A;  2B63 L;  3GTK L;  3B0A B;  1VCX A;  5M5X L;  3PO2 L;  1DVB A;  2ERS A;  2WAQ P;  1E8J A;  2HR5 A;  2A69 D;  4XXB B;  4AI2 A;  3PL5 A;  4AI1 A;  3FKI L;  2VL6 A;  2B5I D;  4A3E L;  3LWQ B;  4AYB P;  2GMG A;  2PSM C;  1H7V A;  2K2D A;  5IP9 L;  4BY1 L;  3RZT A;  3GTG L;  4A3I L;  3PKJ A;  1YK4 A;  1I3Q L;  3P8B A;  2R7Z L;  1WCM L;  1ZRP A;  2V3B B;  5JVH 1;  1NNQ A;  2CKA A;  1B2O A;  5EIN C;  4JAD A;  2A68 D;  1RYQ A;  3HOY L;  2NVX L;  3LWR B;  3NFP I;  3LWP B;  1B71 A;  3HOX L;  1VZH A;  2H12 A;  4LHN A;  2C6B A;  5C3E L;  5AI3 A;  4U67 1;  2R92 L;  1DX8 A;  3HOW L;  2KKD A;  3H3V M;  1FHH A;  3GTJ L;  2V0E A;  5M3F L;  4G6B A;  1FHM A;  2M6O A;  5GAE c;  5IYD L;  5EIO C;  4BBR L;  4C3I L;  1B2J A;  1T9Q A;  4BXX L;  2RDV A;  1R9T L;  4BBS L;  4AHX A;  3PZA A;  3HJW B;  1T9P A;  2BE5 D;  1R0H A;  2XJS A;  3K35 A;  3HOZ L;  3WWN B;  1NXE A;  4B8C D;  5DM6 1;  4A3M L;  2R93 L;  1TWA L;  1BQ9 A;  3S15 L;  1YK5 A;  2M4V A;  3GTP L;  3JR7 A;  2LCQ A;  3MPS A;  4A3F L;  5M5W L;  1PFV A;  3KYY A;  4AR6 A;  2HVY C;  4BY7 L;  8RXN A;  3S2H L;  4ZN1 B;  2XJV A;  3KYX A;  3S14 L;  3J7Y 1;  3H99 A;  4A3D L;  2CR8 A;  5JVG 1;  3B08 B;  5DM7 1;  2VUM L;  3ZG6 A;  1I50 L;  3PIO 1;  1Y1W L;  1PFW A;  5C4J L;  5MLC 3;  2QL0 A;  3QQC E;  2E2H L;  4A93 L;  1CAA A;  3S1M L;  2Z3R B;  1I6H L;  5RXN A;  2XJR A;  3M3Y L;  2KN9 A;  4C2M 1;  1TWF L;  1QYB A;  4AHW A;  4JAG A;  2DSX A;  2CKC A;  1TWG L;  3H9C A;  3P2A A;  4Y7N L;  3J7Z 1;  2JA8 L;  2NYD A;  2L0Z A;  1ODH A;  2XJT A;  1S30 A;  4YWL A;  3S16 L;  3K7A L;  5MFZ A;  2J9U B;  1RYT A;  2M4Y A;  4POF A;  3KYW A;  3VPB E;  4ME3 A;  1F4L A;  2ZIX A;  1S24 A;  4AHY A;  4K9F A;  4A3L L;  5H1S c;  1C09 A;  3S1N L;  1QQT A; 
#chains in the Genus database with same CATH homology
 1CAD A;  2LCQ A;  4TPU A;  5K2M E;  1RB9 A;  1IRN A;  2A69 D;  4XXB B;  4YWM A;  3MPS A;  4AI2 A;  3SS2 A;  5AN9 H;  5MGN A;  4AI1 A;  2VL6 A;  2B5I D;  3RYG A;  1VZG A;  7RXN A;  3KYY A;  1IU5 A;  4GS7 D;  4AR6 A;  2GMG A;  1BFY A;  2PSM C;  1H7V A;  2XJP A;  2K2D A;  6RXN A;  8RXN A;  1RWD A;  4ZN1 B;  2XJV A;  3RZT A;  3IU3 I;  4AI0 A;  5MF6 A;  3KYX A;  4JAE A;  1VZI A;  1OWB A;  3LPE B;  1RDG A;  3PKJ A;  1YK4 A;  2O5J D;  2JI1 A;  4LHL A;  5GAD c;  3J7Y 1;  1OWC A;  1LKP A;  2ERJ A;  4UY8 1;  2C6A A;  3WWL A;  3P8B A;  1R0J A;  2CR8 A;  5JVG 1;  3B08 B;  1R0I A;  4AI3 A;  5DM7 1;  3ZG6 A;  1ZRP A;  2V3B B;  3PIO 1;  5JVH 1;  2MS3 A;  1NNQ A;  4RXN A;  4AR5 A;  2XJQ A;  2CKA A;  1B2O A;  2M6P A;  2QL0 A;  3QQC E;  2A68 D;  1IW7 D;  4JAD A;  5EIN C;  5MLC 3;  1RYQ A;  4AHZ A;  1CAA A;  2Z3R B;  1YV1 A;  1YUZ A;  5GAG c;  2V0F A;  3NFP I;  1B13 A;  5RXN A;  2XJR A;  1R0G A;  1B71 A;  1VZH A;  2JI2 A;  2KN9 A;  1JYB A;  3KYV A;  2PVE A;  2H12 A;  1Z92 B;  4LHN A;  1R0F A;  2C6B A;  3A44 A;  2XJU A;  1LKO A;  2JI3 A;  1QYB A;  5AI3 A;  4AHW A;  4JAF A;  4U67 1;  4JAG A;  2DSX A;  1DX8 A;  2CKC A;  1IRO A;  1IU6 A;  2PYA A;  2KKD A;  4V19 6;  1FHH A;  2V0E A;  3PIP 1;  1QCV A;  1LTL A;  1BE7 A;  4G6B A;  3P2A A;  1FHM A;  2M6O A;  3J7Z 1;  3RZ6 A;  1RDV A;  5GAE c;  1WJV A;  4E6Y A;  2Z3Q B;  3KYU A;  2NYD A;  5EIO C;  1BQ8 A;  2L0Z A;  5AI2 A;  2A6E D;  5IY0 A;  2PVX A;  1B2J A;  5MFP A;  1ODH A;  2XJT A;  1T9Q A;  1SMM A;  2AYJ A;  2RDV A;  1S30 A;  4POG A;  3MSU A;  4YWL A;  1YUX A;  1S2Z A;  3PWF A;  4AHX A;  2PPT A;  3PZA A;  1SMW A;  4AR3 A;  4WFN 1;  5MFZ A;  1NXG A;  1T9P A;  2BE5 D;  4AR4 A;  2J9U B;  1RYT A;  2M4Y A;  1BRF A;  1R0H A;  2XJS A;  4POF A;  5GAH c;  4ZN3 B;  3K35 A;  3KYW A;  3VPB E;  4ME3 A;  2A6H D;  3WWN B;  1NXE A;  4B8C D;  2ZIX A;  5DM6 1;  3LNL A;  1S24 A;  1SMU A;  4K9F A;  4AHY A;  1T9O A;  1BQ9 A;  3B0A B;  1YK5 A;  1LKM A;  2M4V A;  5H1S c;  1C09 A;  1VCX A;  3PKI A;  3QVD A;  4XGH A;  1DVB A;  2ERS A;  1E8J A;  4TVM A;  2HR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...