3LNNA

Crystal structure of zneb from cupriavidus metallidurans
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
341
structure length
341
Chain Sequence
b'ALRHEGERLVVPAESPLRRTLAVAPATRETVAAPFNLPAMIEADPAKLVKVLPPLAGRIVSLNKQLGDEVKAGDVLFTIDSADLAQANSDAAKARAAMTMARRNLDRQRELDKSEIAAKRDFEQAQSDYDQAASESQRADARLAQLGAKGGGTLQAGGGHILAVRSPINGRVVDLNAATGAYWNDTTASLMTVADLSHVFVTANAQEKDLGHVYVGQSATVKFDAYDDPQPGKVRYVGQILDADTRTTKVRMVFDNPDGRLRPGMFAQATFLSQPHEGIVVPMSAIVQSGFYTRAFVEVAPWQFEPRVIKLGAQIGDRMEVKSGLSAGDRVVVKEGVLLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane fusion protein (MFP) heavy metal cation efflux ZneB
molecule tags Metal transport
source organism Cupriavidus metallidurans
publication title Metal-induced conformational changes in ZneB suggest an active role of membrane fusion proteins in efflux resistance systems.
pubmed doi rcsb
total genus 58
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3lnnA04
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3lnnA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lnnA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3lnnA01
4H44C 4JBWA 2LMCB 2O5IC 2NN6I 3QJYA 1SMYC 4KHZA 4HR7B 1GUTA 3A8IE 4KI0A 5D5QA 2YYZA 3PV0A 3SDZA 3BDOA 2B8FA 4BA1I 5KNCA 1GUGA 1GUSA 2BE5D 4LJZC 3M85A 4OGQC 3QIAA 1HQMC 2JE6I 1GUNA 2BE5C 2A69C 2Q8IB 1E2ZA 1RSOA 4KMUC 2BA0A 4GZYC 1E2VA 4DK0A 2EJGC 5JEAH 4G7ZC 4IFDH 4I7ZC 2A6HC 4JK1C 3T51B 5BN3A 3VR3A 2D5DA 1Y8OB 1PMRA 3A7LA 4PV1C 1GHKA 1DD2A 2DNEA 1GJXA 4DNTB 2K32A 3IKJA 1OXXK 3T56B 2IT1A 4OO1H 4KN7C 4KN4C 3SE0A 3WB1A 1CFMA 3U9SA 3EQLC 2D2CC 3FPPA 3CRKC 3L7ZC 1K8OA 1I6VC 3ND9A 1Z7TA 1H9SB 3ND8A 3PUXA 3OW7A 2L5TA 2DNCA 4DNRB 3D4RA 1VF7A 2KA7A 1Q1EA 1H9JA 2K7VA 3A7AB 2F95B 1ZKOA 3OPOA 4IFDG 1Q1BA 1DCZA 3H94A 1VCIA 4XTCS 3GD7A 3WB2A 5A35A 3WDNA 2A68D 2E74C 4BA2I 1LABA 5K36H 1K8MA 2CW0C 1CTMA 2PCFB 5KNDA 3PUVA 1GHJA 1FR3A 2AUJD 1ZYRC 3D31A 2JEAI 2DN8A 1O7LA 1TKWB 1OXSC 2NN6G 5JJNB 2NN6H 2F1MA 2V4DA 3T53B 1GUOA 1LACA 4TKOB 1H2SB 3LWUA 1B9MA 1HTPA 5JEAG 1IYVA 1VDZA 3MXUA 3GQBA 2JEBI 3VR5A 5BN4A 1H9RA 1G291 3PUYA 4XIGS 3I72A 4H0LC 4GYCB 2R6GA 3M4YA 1O78A 3OOCA 4L8JA 3QG1A 1Q12A 3WB0A 1DXMA 3VR4A 3NE5B 1IW7D 3I4LA 4OO1G 2F93B 3RLFA 1H9MA 2ZT9C 1YNJC 2QF7A 1B9NA 2K33A 2EJFC 5C0XH 3LNNA 3I73A 1Y69U 1V8QA 3DXJC 5D5PA 2EVBA 3A8KE 1A6XA 3MFYA 3VA7A 4KKTA 2AUKA 2EDGA 3W3AA 3KLRA 4KKSA 2A68C 2BDOA 4TQUS 1T5EA 2A6HD 2JXMB 3BRCA 2BA1A 3TZUA 2O5JC 3AB9A 1BDOA 1EWHA 1HCZA 4DK1A 5JJJB 2B8GA 2E76C 1IW7C 1V43A 1H9KA 3A8JE 1E2WA 3N6RA 4H13C 4LK1C 4G7HC 4G7OC 3PUZA 1Y8PB 4IQZA 1ONLA 2EJMA 5K36G 5JJEB 1HPCA 2A6ED 1Q90A 2D62A 2PNRC 1IYUA 1VF5C 1YNNC 1QJOA 2A6EC 3BG3A 3CRLC 3FMCA 2E75C 1OXVA 3PUWA 4RCNA 4KKUA 3VR2A 1FYCA 2AWOA 1CI3M 3P20A 3IFTA 5BN5A 5KNBA 1Y8NB 1TU2B 5C0XG 3M7NA 3VR6A 2A69D 1OXTA 2KCCA 1H9SA 1OXUA 1Z6HA 2PPBC 3HGBA
chains in the Genus database with same CATH superfamily
5M5YB 2AZ0A 1S72A 3D36A 3ZMVA 1QVFU 2NN6I 1SNPA 2OXPA 2ZE6A 4X62O 4FM2A 2EYPA 1FJGB 4CGYB 2R9IA 3AG1B 3FX7A 2EQSA 1K8AC 2ITCC 1GUSA 4JYAL 4DPGA 1S0UA 4Y9UA 1Q6UA 4GX1A 1HR0O 1QUEA 1V0FA 2BTOA 4I4TA 1A3TA 3H0GH 2CF4A 2F52A 3ZN0A 4JI7O 4IUUA 3F2CA 3S2DB 1EOTA 3HKCB 1TY0A 5FLMG 3CMAA 4B3SQ 3DWAA 3RD4A 4IFDH 1JWSD 3CHBD 5HKKA 3BZKA 1ZM9A 1BCCH 1KQSA 2Q6LA 4MS2A 1J9ZA 4ZCLA 1M8AA 1TS3A 1SFOH 3GTQB 3L71H 2PQEA 5D3DA 4DGZA 3S15H 1HZCA 3HOZH 2Q6OA 4UZEA 2B2YC 1EYGA 5C4XG 3RUZA 2HCIA 4O2DA 4TOIA 1BBUA 4GLAC 4RA8A 1RQPA 3WOEA 3W2FA 1W0KA 4KJNA 4CH6A 4FLYA 3W2GA 5M5WH 2WA4A 3U9SA 4GT1A 3L7ZC 4MW3A 4JI8Q 1C8CA 1N0NA 4TN1A 1YBYA 2PZUA 4K14A 3GTGB 1FD7D 1AILA 3VYUA 5C8YA 5IY5B 4JVZA 5BZBA 1II3A 1SETA 4CC5A 1NRKA 1Y74A 1PYWD 2R61A 3DWPA 4X65Q 3JQRA 4L5RC 4B3SO 5JCOA 1Q9SA 2PUSA 4DV4L 3T1CA 2Y0SB 3TQYA 4YJ2A 2C5CA 3RMHA 4DV6Q 2XAGA 2A68D 1JCHA 2JIZG 4QE7A 2DE0X 2R7DA 1AJQA 1I6HH 3EHBB 1DDIA 5KUKA 4QE9A 4EEQA 1QCEA 5IYWA 1FR3A 3OT7A 1OO9B 2ITDC 4LBZA 2XZOA 2QDBA 2QA4A 4DR2Q 1K9MC 3AG7A 4PDLA 1U97A 3K0DA 2QWRB 4Y9RA 3A54A 4EQNA 2DUDA 1EY5A 5FO0A 1B9MA 4LW1A 2E2HH 4PMWA 4A93G 1PH8A 1M1KW 4LF5O 1PNKA 2F0EA 1H9RA 4YELA 1KQSB 5FOBB 4P12A 5AJ3Q 3M3YH 3UO3A 3ZRVA 5F2VO 3CMEB 3J80N 1I94B 5JEAJ 1NB0A 3M8AA 4J42A 3T1YQ 1KMHA 2NVQH 1TA8A 3BCCH 2ZL7A 2F0LA 3HP3A 3M9BA 1PVOA 2VUMG 1D7QA 3W5OA 1QFJA 1MZEA 1DXMA 4DV1B 3A0RA 1DZ1A 4X7FA 1XL4A 1WA8B 4A3JH 4UB8Z 4Z4UA 2VY3A 4K0KB 2F4NA 2D0OA 4LFBO 3OJWA 2CTRA 1EEFD 2UUCB 2K33A 4JI8O 5D65A 5B3SC 1XNRO 3ZZUA 3BA8A 2YI8A 3EFFK 4EQ5A 1IZ3A 4G28B 4YAFA 4B3FX 4NXNL 2EVBA 5IT9c 3H3VI 3A8KE 1NBMA 3K08A 5HY6A 4U673 1DOMA 1VQMA 3CCRB 2WB1B 1S72V 1FNWA 1KLGD 1R5OA 1W0JA 1I08A 2ZR2A 3M99B 4JI0L 3K04A 1SN8A 1X3FA 2HQEA 3BRCA 1EN6A 4JI4O 4NXMB 1X32A 1S5ED 4DAYA 4B3TO 4GOPA 4DK1A 1AR4A 4LWSA 1VQOB 3R2TA 4FXKC 5ELFA 1XNRL 2XSCA 1W59A 3JAKB 5I9PA 1AMOA 2PNRC 1IYUA 3W7XA 1GAWA 5FLMH 4F4LA 2E3CA 1D5ZC 4DKAC 1BBXC 3OTOO 1U0LA 3TXSA 3TZDA 2R9RB 4G6IA 3MZ5A 1TIID 3CE2A 4PI0A 1FNMA 2KEEA 4IYHA 2KCCA 2HDLA 3K80C 2Q67A 4QIWF 1FXHA 3TDQA 3RYIB 4JI6Q 1VMGA 3S1RB 1D2BA 4JBWA 2OBRA 1IBMB 2LSSA 4NW2A 4C1NK 4OELB 4QGUA 3OTOL 4H37A 4JV5B 1S3OA 4JI1Q 3JATB 1WOCA 3CCLA 4TV8A 4P26A 5DNFA 3S1NB 1FX0A 1SLJA 3R6JA 3MC0B 5C0XI 4B47A 4P9SA 1EY9A 1JWUD 1JX9A 2YTXA 3E9IA 4OWXB 3UO2A 2BE5C 1IBML 5KHIA 3GO5A 3S17B 3ZHUA 2UXCB 3JAWA 2JJ2A 1RSOA 2YSUB 2FKXA 4A3GB 1F51A 4XKVA 1NE3A 4X88A 1KMIZ 5IE8A 4FFKA 1E62A 4B3RQ 3FHWA 1LTSD 1SSOA 3JALA 2O4XA 4C3JG 4KHPL 1VQ7B 1NVPD 3CF5A 1V1PB 4XLAA 3G05A 3CCVA 3SEBA 5CV6A 4LWSB 2NR5A 4UUJC 1A8PA 1Y8OB 3M4QA 2R92G 3P3PA 4H13B 3W7TA 1GHKA 1F20A 1YLOA 2ICIA 4YCUA 4MTOA 5CA1A 4JI1O 5A89A 4JYCA 1UWVA 2HHHO 2L1BA 1XPUA 3QFTA 5E6TA 2OTLB 3FB7C 5KA5A 4JI2B 4I0XA 1W3SA 2X6LA 2YEVA 1BXTA 3EQLC 2Q8TA 4UCVA 3WWVA 1VQ4A 4AQYO 1CKMA 4LUOA 4NXML 2XNJA 5CORA 2Y69B 3FKSG 1E22A 2C35B 5GW7A 1CKNB 1VF7A 3MEHA 1UE1A 2D3OW 3HS0C 5L37A 1JJ2B 3HOWG 3JSNA 4B3GA 3DC6A 4DV5B 1EFWA 3ZHTA 2VB2X 3W5HA 5HURA 1D1KA 3NUCA 1HNWL 1UE7A 4JGSA 3H09A 4KHVA 1U2RA 2QTLA 1BQEA 1AJNA 4YY3O 3J81j 4J15A 5KNDA 1PL0A 1N33L 1N32O 2X69A 3CP2A 4F87A 3SYAA 1O7LA 4JAAA 4LF4L 4DR5B 4P6YA 2EY5A 2EIKC 3N2KB 3LWUA 1NJIW 4JI7B 2ATWA 2CH4A 4DR3O 4LF7B 4ASUA 1YITV 1TVKA 5FPRA 2QTSA 2KVOA 4WBNA 3F2DA 2UXXA 1X55A 1O78A 1IYJB 1N36O 2HDNB 2Z4IA 4A3MG 1XJVA 1HZ9A 1WN7A 3JQPA 4J41A 1FJGO 1M90W 3KLSA 2XAHA 5IODA 1L1OB 4D7SA 2LZJA 1Q82D 4O4LB 1FXVA 5EBWC 1S72B 4AYBG 4PDVA 2N8NA 1TS4A 1NTMH 3CRZA 2EPBA 4RO2A 2XVSA 4UVBA 4FLWA 2F4VQ 1EXMA 1HR0B 2ENBA 4NDXA 4ZYSA 4AQYQ 1VQ7V 5IYDH 4DUZB 2JGUA 2XRQD 1N36L 2GJRA 4CS2A 3K8AA 5BR8B 4B44A 2J0TD 1EQRA 4QY7A 1R3LC 3ZIAA 1EZVH 2UUAL 4IN3A 1SQQH 2JA7G 4X62Q 3EVKA 3ERSX 3VYTA 1GUWA 1Q81C 2AHZA 2QKSA 4JZ2A 4K8XA 3I4NB 2EJRA 1T6YA 3A2FA 1UUPA 3TRZA 5IYDG 1Y8PB 4X7DA 1BCPB 2ILMA 3ZRSA 1VF5C 3C3TA 3UQ8A 2B7BA 3LO8A 5IYCH 2PW5A 4H02A 3CRLC 3SJPA 4RCNA 4P3IA 1B6QA 1GVHA 4LBWA 3E1YE 2QSAA 3ABMB 3RBZA 5IJ9A 4GNXB 1M56B 2JGDB 2Y0PA 2WAQB 1SAPA 5CV7A 4DU9A 1AR1B 2ZIOA 3CS5A 2A3QA 2QE7G 2I1LA 1SC5B 1SROA 2Q2HA 3ONYA 4FFBB 2ZTCA 4A3LH 1IXMA 2DETA 1NNXA 2CTPA 4X06A 5B1OA 4BWGB 4RCOA 4HAMA 2RKSA 5GAGC 3OAAG 1QVGA 2E2IH 4AILC 4MYUA 3T16A 3OD4A 4A3JB 1QVCA 4X1YA 4R8IA 2ICEC 1PH5A 4II2A 2D3LA 3LDEA 2SOBA 1LTID 1XB2A 5L3EA 4B3XA 1OCRB 2KECA 4CDFC 5C44H 2C4UA 1JCKB 3C3LA 3GVLA 4HIZA 5KMGB 5CDFA 4KMUC 3G71A 2VUMH 3CCRV 1IL8A 3W7UA 4N3GA 4OX9Q 5KX5B 3SPGA 1NS1A 2L35A 4CKBA 2DJVA 2VWJA 4O2AA 1J5EL 2KHIA 2R7FA 3E0JA 4HEDA 3H1LH 1JJ2U 4I50B 3LDDA 1COWG 2K5DA 3CB4A 3GV3A 4MVMA 4DV1O 4O2BA 1D1NA 2Q6KA 2UUBL 1S40A 1MA1A 4K0KO 1KAAA 3CCUA 5JH7A 1K8AD 1Y1VG 1LTRD 4X7CA 4JI8B 1HUNA 4X1IB 3GB7C 3VBBA 1MMMA 3OMIB 1ZAUA 4DV4B 1MI2A 1EP2B 2OIGA 3BEHA 2UXDB 3D0FA 2RSOA 2XN9C 5A88A 4N3NA 3GVJA 4TMVA 4LBYA 3GTMH 2Z6KC 2NVXB 2GK6A 3HFZB 3I90A 1S5HC 2E76B 3MDSA 3AVXA 2VBSA 2IJIA 3I56A 1SFOB 1M90C 4IFDG 2EYFA 2ZXHA 3R6KA 1R6TA 3WB2A 3HKEA 2B2WC 5LGTA 4EVOA 5A35A 3JAME 3NK9A 1STHA 2NTSA 1AP6A 1NKDA 1W0KG 3KJOA 1Z47A 3O9OA 1CTMA 4NMZA 1H8EG 5B1AC 1GVPA 4DR4O 4HMIA 5M5WB 1IVSA 3CMEA 1V0EA 1KTKA 1LTLA 1QE6A 4FF3A 3F8TA 3KUPA 1AE2A 3SEJA 2EILB 2NN6G 2N88A 2CDYA 3QFRA 3CMMA 3FKIH 2YWHA 4POFA 4QCLA 2UXCO 2IJJA 1QNKA 3KCYA 3JC66 4GKKB 4M2LA 3I72A 2VQFO 2B1IA 3F2UA 4DR5L 2K4KA 4RD4A 3FP9A 1CQXA 4K3AA 4Z4VA 4X89A 4IPCA 4J9YB 3S1QH 4ROXA 2P4VA 1Q12A 5CC4A 3NSWA 1I4HA 3ICXA 3MA2B 1PD3A 4R8CA 1Z2GA 1N06A 3NE5B 4B9XA 3I4MG 1S3JA 4JI1B 3CHXA 5ELBA 3CRQA 2F0IA 1QR8A 2CRVA 3AQQA 3G6EA 4B3ML 4DR7O 4X64O 2L4NA 3H3VC 1NTZH 3DXJC 4BWAA 1EFCA 4X66Q 3J80i 1KRSA 3UDIA 2JA5B 1FXKB 2EIKB 3A0BZ 1B3QA 2YXYA 1RPOA 2Q7GA 2C78A 3ZBTA 2JN4A 3SJQC 4JG2A 1KC8W 4DR3Q 3K58A 2HMAA 3U6BA 4YIPA 2B39A 2F0FA 5J2UB 4TVAB 4K8ZA 1QB5D 1Y1VH 4KL1A 1RF2D 4DV3Q 1K73C 2JA5H 3ZZ0A 4AF7A 2XTIA 3Q6QA 3RY8A 4YY3B 1OHHA 1Q90A 4RDKA 2J7KA 5IYCO 1N32B 2ZTGA 2CH4W 3L9AX 5AFWA 3ULLA 1L8DA 5F4OA 2IW3A 1BS3A 4LFAO 2NVTH 4JI2Q 3PSIA 5CA0A 4C2MB 1UE6A 3GTOH 1H95A 3LVBA 1NBMG 3E8GA 4HNAB 4LBEC 5FL7G 4DV2B 1PTOD 1QOHA 1V1OA 4DK6C 3HOYH 3VYRA 2EFGA 3K0YA 5KHHA 1GTOA 3MCAA 1PH9A 2PPBC 5EBCA 1Q6IA 2ZDIA 3DDYA 3T4DA 4J8QA 4PNYA 1XNQL 3CCJA 3J7AF 4TMXA 3ZZTA 2ZTNA 4GX2A 1HFGA 5COYA 5BSXA 2ZCEA 2XIWA 1XMOO 5TISZ 1UPGA 2WSSG 2B1GA 5IYZB 4MYTA 4WZTA 2YV5A 3PV0A 1S4MA 3CCVB 4JI5O 1QLNA 2JK5C 4JAVA 4TRDA 1SXTA 4QIWB 3J80E 4LNQA 3E0EA 1VQ8A 1PTOB 5KYIA 4YXWA 1SKQA 4WFAV 1E2ZA 1LV9A 2UXDQ 4P25A 1FXKA 5CA1B 3K57A 1QUQA 3T2MA 1EZ8A 3ITPA 3GTLB 1YJ9V 4MTXA 1N34B 3J81i 5EGTA 3GTQH 2A6HC 2ZJRA 1AB3A 5J9PC 2NVXH 1G2TA 3F2BA 3ES9A 3DMUA 5FPOA 4EB6A 2CGOA 1PKVA 2V1CC 2WKCA 4KJOA 1MJCA 2GN5A 4UXNA 4S3SA 2V7QG 1G1XB 4MVSA 3CXCU 1J5EB 1K3RA 1VARA 1ET9A 4PA9A 2EIMC 4A3FG 2QEXV 2HQLA 1G6ZA 5BR8O 1WTVA 3LWEA 1M57B 2F0SA 2X6XA 2TSSA 3W5UA 3SJAC 3I91A 5IYNA 3HOUB 3LSUA 5ELDA 3OMCA 1YHBA 2X6CA 4DR1B 2R3ZA 1WTHD 2F0UA 4EX5A 2NVTB 2F0MA 4GLVB 3ZMUA 2HKOA 4EQPA 5IYZA 1E24A 2LXJA 1G7SA 2FMMA 4WJWA 2TMPA 2R7ZH 5FLXN 2K01A 3BVOA 2JA6G 1FPOA 1DK1A 4WFN3 4DR1L 2CKZB 2CAZC 5H6RA 2EULA 3KKYA 3F7YC 3RN4A 4TKOB 2VNUD 4Z1VA 1IYVA 1Q3EA 4O4LA 3B8NA 1DM0B 2ZIMA 3SKBA 5IYQA 3ER0A 3OW2U 4CBCA 5M9OA 2Q4PA 5K1PA 2Y4UA 4BBSH 2YWFA 2HLDA 2VBTA 2WINB 2R6HA 1Y1WB 4JI7L 1EL0A 1BVSA 1COWA 2WAQG 3EBEA 2QE7A 3BVMA 3VR4A 3A0HZ 2H4OA 4LF8Q 5KAFZ 4K2LA 4OOSA 4DV7L 5IP7H 1EM1A 5C4XH 5C5MA 1HHVA 4UZUA 2IBZH 2WLIB 3FFQA 2PZTA 1XTCD 5LGNA 1HWYA 1PRTB 1O9HA 3ABUA 4X3TA 3STBD 5JWPA 1PM9A 3OM3B 1KD1W 2VNKA 1B23P 4RCZA 4LF6L 4FYDA 2UXCQ 3K7AH 3I4NH 4KKSA 1OCRC 4C7UA 1XQBA 3KLSX 4NP5A 5K1XA 3CCQB 1HH2P 5E1FA 3UDGA 4PV1B 2UU9O 3A74A 3JD1A 2LFRA 3JASB 1V43A 4OO1G 2I5MX 1VQKA 1N0VC 4IUNA 3V05A 4P2ZA 3ZCCA 4LF6B 1WTRA 1F2MA 4N8X1 3UT5B 3F7VC 5DS0A 1I94L 4I5SA 3U6KA 2A6EC 2ID0A 1LUWA 3PUWA 4DXFA 5LBQA 4DV4O 4A76A 2Q7HA 2VZAA 2I5LX 4WZKA 1AFPA 2ALYB 2UU9L 3IFTA 3ICEA 1S76D 1YJNV 2CGNA 3QVNA 5IY0A 4ZI7B 1IJFA 3CCSA 1KIXA 1PNMA 5I4DA 2CH7B 2QEXA 4PDRA 1RSOB 3AK2A 5C93A 1VF6C 2VQEB 5F4JA 1R4QB 1RL2A 4YHHB 5FNVA 4XOPA 5FO1A 3G80A 2L0CA 4K5WA 2YXHA 1OCZC 3J7AU 1DG1G 1B4OA 3OWEB 1TY2A 3U0ZA 1G8ZD 1TWHH 3NEMA 4P71A 4DV3O 1Q82C 4LF5L 4DRXB 4KK7A 1X9NA 1OB2A 1ASYA 4ASUG 4LJZC 5JQGB 2KCTA 3P30A 4YHHL 1HQMC 2ZXOA 1CA5A 3ZBHA 5IJ0A 1G91A 4R7CA 4X64B 3ZIAG 4P3YA 4OP7A 4DR6O 4Q5VA 5L3BA 5JVG3 3Q39A 3TN2A 4LFCL 3NQIA 1KKCA 2XNDG 1BCPD 2PMDA 3PQIA 4CDEC 4LF7Q 2AHOA 3W2HA 4X1IA 4ZIBA 3C1EA 4B3TQ 2R7ZG 5ITZB 1RTNA 3A7LA 3A8JA 4UPAA 1PFBA 1AJPA 3ZYYX 1SS3A 3VDYA 2UUCQ 4HIKA 4LFCB 1Z9FA 1SERA 3FKSA 1UEBA 4QVAA 1YTFD 1DDGA 4OPHA 1KRHA 1CHQD 2HIVA 1XMOQ 3L72H 4L87A 2EY6A 4O0AA 4B7KA 4LFAB 3X2QC 4TSSA 1EBOA 2AW9A 3RLOA 4DUYO 5IOCA 4DV0O 3OIQA 2DYSC 4DV2O 3S1MB 2VNHA 3CC4A 2WAQE 3R2IA 4NKLA 4Y7NB 1Q1BA 4FF2A 1B1ZA 1X4TA 2DERA 4RFBA 2ZM6B 5H59A 2EYJA 3I70A 3Q8DA 1TWGH 3Q38A 3OWFA 2ADPA 3B82A 1NH2D 1EIYB 4OX9L 3MHPA 2PCFB 5EZYA 3TREA 2F4IA 2RA4A 3CRRA 1TGOA 4I4TB 3CYOA 1ZYRC 4X66B 2GPJA 2WA3A 1YEWA 1Q46A 1KLUD 4DV0Q 1EIFA 4GNXC 1OCOC 2WPDA 4PA4A 1GUOA 1XTDA 3MEFA 5JEAG 5C44G 1BF4A 4L5QA 4A3EG 2JA6B 3MXUA 4YHBA 4I55A 2JEBI 3CJHA 4OX9O 4AH6A 5M3FH 4RD0A 1MIUA 2N49A 4JI4Q 2QGGA 4FLXA 4H0LC 3ETEA 5CMUA 5B6IA 2QW7A 3PCOB 4A3GH 1VLYA 3OOCA 2RMKB 4XLFA 4L8JA 2KEDA 2JA7H 4PELA 2DYRC 4PC1A 3OW2B 1W2BU 3S17H 4Y52H 4GQNA 1L0XB 2FVGA 4IIJB 1LUZA 1ZYRD 4PABA 1WSVA 2E8GA 1Q7YC 1S5FD 3HOUG 1YEZA 3BY2A 1FGBD 5EPLA 3H01A 4DV5L 2K5NA 3WQZA 2P3MA 4N21A 2VRZA 3KLWA 4WFGA 1WTPA 3K06A 1LUVA 3BDLA 1PH7A 4XQNA 1EFUA 3UM7A 5TR9A 4LR3A 1L2FA 4OOVA 1E0BA 2ZL6A 1JOOA 3TGUH 3J7AV 1PXUA 2OYQA 4BW5A 1FFXB 2WWWA 2A7WA 4KUMA 1N34O 4ZCMA 3HRZC 2DWDC 3IC7A 5J39A 3BZCA 2JGDA 1MGSA 2NVYB 4JYAQ 4RD3A 2ZE7A 2KBNA 2YU9H 3SK5A 1AR5A 4GUNA 4K35A 1MABG 1K0SA 1U96A 1VMCA 5FIUA 1PH3A 4IQZA 4A3CH 3D26A 4FLZA 1NAPA 2JRIA 1I4XA 2EIFA 4P1VA 3OSOA 4XT1B 4B3SL 4XYOA 4TUYA 4ME5A 2XNCA 3RVYA 4GLXA 1B3AA 2F0QA 2E75C 1OXVA 2VJJA 4IPHA 4HJ5A 4Z2WA 4IUTA 1N34Q 1AI6A 2EIXA 1TWGB 4M1KA 2WKDA 2ZTEA 3SDLA 4RPBA 5EYPB 4J0QA 3P75A 3P20A 5J35A 1Y1WG 5TV2A 1H42A 4A5UB 1J95A 3BY6A 2ETNA 3JD0A 4QNHB 4XL9A 4ACBA 5GQOA 4LF4O 2F43A 1VQMV 2SEBD 4QVJA 4HSPA 3QJYA 4R1JA 4X66L 3W5VA 1FGUA 5LMUL 3OEHG 1GN4A 2B9ZA 4IIJA 1MABA 3CCMB 4HR7B 1YHQA 2E2HB 1GD7A 3EA6A 1BJKA 4APVA 1E43A 5KNCA 2CHBD 2JSOA 5LHGA 1DF4A 3SYCA 2Z3YA 4CS3A 3OZUA 1W2BB 1MSHA 1CUKA 5LOVA 4OGQC 2OIEA 1JICA 3OMNB 3G71V 1GUNA 2D0PA 2GJPA 3S15B 1FJGL 1IBKB 2SNMA 2EY2A 1WCMG 5H6QA 4UCSA 1WORA 4OPSA 3WXMA 1FFXA 2JYOA 3E3XA 1HNXB 3R3OA 3CCRA 2DW4A 4O4HA 1D5MC 4BY7B 1AH9A 4I7ZC 4JI3O 1Q8IA 1VLOA 3FRPB 4EH1A 1QX4A 5B1AB 3K59A 2N55A 1GAXA 2A1AA 1ZEQX 4DR2L 1R73A 4MN3A 4F88A 2UXBQ 1K28D 2K32A 4GKJL 1HR0Q 2HIXA 1G7TA 3DUZA 4LFBB 1XQ8A 3S1NH 5AJ3L 3JCZA 2GSMB 1XNRB 2X53S 1M1KD 2L55A 4FM1A 3G6BA 2F0OA 1JA8A 1JA1A 2DNCA 2OQ0A 5LHY1 4JTCB 1O7ZA 2HD3A 2KA7A 1HP8A 2V7WA 1XDCA 1E1TA 2K7VA 2OQKA 1KDAA 3DEPA 3DHQA 1RQRA 3HOZB 4A3GG 2VQEO 4JI4B 4CBVA 1Q7YW 2OCEA 4OL7A 1NDHA 3C90A 1Q5OA 2CTQA 2Q0AA 4POGA 2KHSA 2ZJQA 3CCLB 3P27A 1X3PA 3AVVA 1ORQC 4B7EA 2VW9A 1STYA 3CTAA 3D31A 1YDXA 4JI0Q 2XAFA 2Q8RE 5LOVB 4RGTA 1HNWB 1V55B 1ENFA 2VQEL 4RM0A 2WLNA 5JJNB 1MHWC 4ZKIA 3HOVB 4KLKA 2QDLA 1V1PA 1I5YA 1RD9D 4DR7Q 4UCTA 3OFNG 3X2QB 2VB3X 2BCCH 1G291 1K92A 2B63B 4TT3A 4IPDA 1EQTA 1VJSA 4Z4WA 1K83H 3Q4HA 2K5HA 3CMAV 4IUVA 4A75A 1YNXA 1IBMO 1P4MA 2BV3A 2XNAC 3RZDB 1YJ9A 3GTPH 1JB9A 3D8GA 2GUZA 5DSZA 1NY4A 2AQ2B 1LR1A 1Y0RA 5GAHC 1XHXA 1KXLA 4WCEV 4KHPO 2NZ1D 1M1KC 2G9DA 5J2UA 3E5SA 4M0LA 3CPWB 2RCNA 4PA3A 1K28A 3K9SA 3CWBH 2WZPP 4CDDC 2IX3A 1Y6XA 1SE4A 1VP7A 5IGDA 3T1HQ 3V96A 1SMXA 1GN3A 3U2QA 4DR6B 5JOBA 2RNBA 4A3EB 4BW9A 2VZLA 3PVDA 4M4SA 2B2TA 2NVQB 4JI1L 2P4KA 4KY7A 3ZUGA 4X9QA 1Y76A 1U4RA 3J80c 4K0KL 2H1EA 4Z4RA 1E1QG 1GN6A 3RYFB 1BLIA 1D1IA 3JU4A 2JS5A 1EWHA 1F2YA 2DY7A 2HDMA 1E2WA 1STEA 1NTKH 4X20A 1PTOH 3SPIA 1XL6A 3GSIA 1H85A 3CCSB 4EFEA 5L3FA 1XHZA 1HNZB 3CC2A 1QR9A 5EJWA 1MRZA 1QJOA 2QM4A 4BAYA 3GDEA 3AEVA 2BGJA 3KCXA 5H5JA 3BG3A 1E1RG 4KHPQ 3FDTA 2MW2B 4PHZA 4AQYB 1F9RA 1K0RA 4G4KA 5I6YA 2G5DA 2CW5A 4WBNB 2Q68A 1STAA 2K5VA 4HJAA 4LF8L 3I4MB 2R9VA 1PDQA 3VR6A 4OX9B 1H2MA 3ETGA 1PKXA 4DR4L 1H9SA 3CP8A 1ET6A 2YI9A 2GBOA 2QKIC 3HOUH 3Q4HB 2K50A 1VQ4V 1G6UA 5EC1C 5G3LF 4BXXG 3SYOA 2LO1A 2KKWA 1EOVA 3J7YW 2CW0D 1BPLA 1N8RC 4CJ1B 1L1OA 2IY5B 3H9VA 4LF8O 2P5ZX 3CMAB 3W2DA 5GTIZ 4KI0A 3AK3A 1Q81W 2DJFC 1ROPA 2OF1A 3B09A 2IH3C 1IHMA 3G4SB 2ZXPA 1URFA 2R92H 3BU2A 4DR5O 2VQFL 4BS9A 2OCCC 1AEXA 2F0KA 1Y1VB 3JD4A 5JPNC 4NVPA 4TSFA 1FVIA 1VQJA 3A56A 4Z1MA 1F9QA 3UE1A 4XQJA 3U11A 1PV0A 5FJ8G 4DUZQ 3J7A5 4RWUA 2I07B 5DLQE 3GWOA 1KNEA 5GTHZ 4JK1C 5ELNA 1YXBA 4LWCA 1O80A 3EXAA 3L74H 2PQAA 5CGKA 1TS2A 3ZMZA 1PMRA 1PFNA 1RDPD 3LUTB 2KSDA 2ZE5A 1N4CA 2HLDG 4I7ZB 2H8PC 4MTFA 1BBWA 2AQ1B 5IE9A 5IJ9B 3DXRA 1YX2A 2C5BA 3ONUA 3U4VA 3OTOQ 5IWAO 5J3BA 4MVUA 4LFAQ 5KAIZ 4DUZO 2AXTZ 4PMCA 1NJIC 4GS3A 2K28A 4LF5Q 1QUFA 2IX1A 2F66C 1MSDA 3VQYA 2GTSA 1EZJA 1I50B 1DJRD 1NMFA 1GOZA 3MXNA 4BIOA 1XMQL 3ERQA 1S77D 5IYBG 4FWTA 2ZQMA 2XHBA 4K1XA 2B2TC 3HZXA 3B77A 1JE4A 1LABA 2A5HA 1QVGB 2OT5A 1M93A 3K0GA 1ZM4A 2ZITA 1J6QA 4CKCA 4LF7L 3S16H 2X85A 2DQ0A 1I4RA 3CKIB 4Q6GA 4OWTB 4QJFB 1VQAA 1XNQO 1TLLA 3AG4B 1SNOA 3CX5F 1H2SB 3CCUV 3VQXA 1JOQA 4O4IA 4PC3A 1AW7A 2ZR3A 2ZXRA 5M3MG 2DQ3A 1XMOL 2Y48A 1HNXO 5IK2A 3KG2A 2JJ1A 4O2AB 4LF4B 2R92B 2RCVA 2OK7A 3CCMV 2ZTDA 4KD3A 1IDSA 3QO8A 4JI5L 1IBLQ 2SDFA 5TY0A 1ESFA 4JTAB 4EKWA 1IW7D 2BOBC 4HBNA 5KIXA 3RLFA 4P9PA 1OCOB 1Q3LA 2E1RA 1NR2A 2EJFC 4DAYB 2RBMA 1A15A 2FHTA 4L63B 3RZDH 3IAYA 2JN9A 1N33Q 1G2SA 3BJUA 1WLEA 2QA4V 4KKTA 1U9RA 2VBUA 1V55C 2Y0IA 4DV7B 2A68C 4LF4Q 3I4NG 4UAJA 1GO3F 2Z6KA 4LC1A 1FNVA 2JA5G 1RODA 5CR3A 4Y7CA 3P26A 2B8GA 2OTJB 2LP7A 1IW7C 4WFHA 4P74A 3K3WA 5BMVA 3P1HA 3HOVH 1WNSA 3L70H 3CQZB 4DA2A 5BR8L 4YJ3B 4A3EH 3CU7A 2GDSA 3T1YB 1HPCA 1R3IC 2CQAA 1FDRA 5KW9A 1XI1A 1R4PB 5C0XJ 1MKHA 1B2TA 1PPJH 2CK3A 1OV9A 4PC2A 2JJQA 2X6AA 1CSPA 1FYCA 4IPGA 3JATA 3UE0A 4YWKA 1QZGA 1YVCA 4FO2A 3ZJYC 2A69D 5E4WC 3E8BA 2C2AA 3M7NA 2M5SA 2F0JA 3NP8A 2F0TA 2MHVA 4IW3B 2PE3A 1WP7A 1PTOF 4H33A 2K05A 1K83B 3HGBA 1Y4MA 2F0NA 5IGEA 1VQCA 2ARHA 4P9OA 2YWGA 4RKBA 5IP9H 3HOXH 4JBMA 2BM1A 2ZM6Q 4MVZA 4ZGQB 5D5QA 3JALB 1GN2A 1D8LA 3QG5A 1HDJA 2OT2A 3G6EB 4ABMA 2DEUA 1PHJA 4XDLA 2A69C 3AGQA 3B8HA 2F3IA 2MO1A 4OWWB 5IYPA 4FVMA 1U5KA 2NYZD 3HKBA 5G3LD 2P5OA 1FNUA 4G7ZC 3EROA 1GH6A 2G9HD 4UCUA 4YEJA 5HGTA 2P7TC 5ELEA 1HZBA 4B3RB 2NZOA 4BY7H 2KQXA 2OEOA 3HOWB 2RDGA 1Y67A 1TWFH 1G8MA 2UXBB 2VWKA 1CPYA 2K14A 4JI0B 2CC2A 3SK6A 3U50C 1P7BA 5EBLC 1HNZO 5JCOC 2WV6D 5C44B 3H3VH 4YJ2B 1QH0A 4QFMA 1X3GA 3WY9A 4QL5A 3B78A 3WB1A 4JOIA 4A3DH 3D8CA 2K03A 3KK7A 1OCCB 2D2CC 4DN4M 4DR7B 4HNAA 2E5LQ 1AZPA 1V5VA 4P75A 3FAVA 1PRTD 1Z7TA 5C4HA 4JAUA 4AHCA 3U4ZA 2WLLB 3SJCC 1PJ6A 3D4RA 1SZXA 1WOOA 3HAGA 5C3WA 3E35A 2XOKA 4CC6A 2B63H 1HNZL 2F95B 5FK9C 4FIPC 2OCCB 2Y4TA 5THXA 5KHJA 3A35A 3OEHA 1HQRD 4I7AA 4UZFA 5DN6G 2ZDIC 2XZLA 1QWYA 3BFRA 3PIO3 1U4LA 2KB1A 4YAOA 2LXKA 2F43G 4FDBA 5I2XA 1X56A 1KP3A 4UB6Z 3BHPA 4LF8B 1XEQA 1N8RD 2CW0C 4A3IH 3RZOB 5EK0A 3LNMB 3PUVA 1VQ8B 1TUBA 4I9WA 5CBGA 4ZQ3A 1YHQV 1DONA 1R1BA 2KG7A 4NTXA 4F7DA 1OB5A 3J81k 2FMLA 1TVXA 2UXBL 2QJ1A 1F4NA 4G1BA 1EWYA 1SDFA 4DV3L 4JV5L 3TK1A 1QBZA 3CPWA 4XLHA 4EGVA 2X6WA 1DYQA 2VS1A 1P84F 2PMZB 4LBVA 1R6NA 1CP9A 1MBYA 2J7ZA 5L3DA 2LFSA 1BCPF 1STBA 5JJKA 3AK1A 4R50A 1JWMD 2EZVA 4DR6L 2YTYA 1K7DA 3HR0A 3CD6B 5GONB 3F5TA 2GV9A 2QKAA 4RH6A 4ZAIA 1IJEA 5FLXc 1ZSPA 1WOSA 4MT8A 2WAMA 1SNMA 2QMUA 1Y69U 2IX0A 3OYYA 5DAUA 3OR7C 1SE3A 4UP9A 1EN5A 1MZFA 3SYQA 2FX3A 5M3FG 1KU9A 2EBOA 2EX3A 4UP7A 2JA7B 3BY1A 4K5XA 2A79B 3B8MA 2YU9B 1ZM2A 3NTHA 1VQPB 5M5XB 1K73D 3AVTA 1XOUA 2X0LA 3SPHA 1N08A 1BDOA 1HCZA 4ZK9B 3WG7B 4FMTA 5H1SE 1W6JA 1JR9A 4FXGC 2K75A 2F1LA 3T13A 2IM9A 1HZEA 1IBLO 3JCUZ 1NSNS 3N2GB 3CCQV 2KUMA 4V190 1C48A 3QFSA 3H1HH 2NUCA 2QCPX 1SKYB 4DR5Q 4OXPA 2E2JB 2VBVA 4FFBA 3PO3H 4NPSA 1CEZA 5JAVA 1XNQB 2AWOA 4PZ7A 4A3MB 1U4MA 2FB5A 1GXDC 3JAMN 1EQVA 1I3QB 1MSGA 4U3JB 4JBJA 1JQ0A 3E6ZX 1JB7A 2ZNJA 1VQLB 5C3EG 3LQ6A 4B3SB 3BC9A 1KJZA 3D6CA 3S1MH 2B2WA 2DY1A 4DR1O 4QV2A 1WTHA 2HT1A 4A3DG 2EE1A 4LF9B 3WBKA 2JA6H 1EIGA 3P3NA 1EY6A 1S5CD 3CD6A 4BBRB 3BDOA 5J3OA 4J80A 5DEDA 4W4LA 5B1BB 1V9PA 2H5XA 1BL8A 2HVKC 3T4ZA 5JVDA 1EP1B 2Q7EA 2BN4A 1YITB 1ILQA 1TQOA 4GX5A 2AKWB 3D6WA 3HKZE 5IDJA 4LF9L 2W6JA 1KD1C 4A3IB 4I0XB 2KJXA 4ICGA 2EJGC 2Q2UA 2EZPA 4OEMB 3AFQA 5A2QN 3LDCA 5B3SB 3AG3C 2PI2E 4NTWA 4Y7NH 1HA6A 4W4KA 2F3WA 4JI2L 4FPPA 2X7RB 3CC2V 5NUCA 1M90D 3S24A 4YY3Q 1IBKL 4X1KA 4LMQD 4DNTB 4DR4Q 4F7XA 1OXXK 1E64A 2ATKC 3T56B 3KBXA 4PMBA 5ELOA 1ELOA 4FN5A 3ZC3A 3OZWA 3RZOH 1RIPA 4M8AA 1I6VC 2WYRA 5LP6C 3CXCB 1JVMA 1EU4A 2R93H 2CH7A 2QEXB 2XOKG 4X64Q 2HG5C 2W6IA 1US6A 3ND8A 4HIMA 3T1YL 4IFDJ 4ZI7A 4DNRB 4U3JA 4O1NA 4A4IA 3G7LA 2OBSA 4Z9CB 4RMFA 1HRJA 1R3JC 1OCCC 2D2CB 2IJKA 3KL9A 1SF9A 3H15A 5EIBD 4EFBA 2B5OA 4QJFA 3OUSA 3SYPA 4B3TB 4HJ9A 3BYYB 3LX0A 1W87A 3SK4A 5K5PA 4MVOA 5E7NA 3H6MA 4JI4L 5T1GA 3ASRA 3MTSA 3T1YO 3EFXD 2JEXA 5CV4A 2PF4E 1EFID 1QGYA 3FPUB 5A2QL 4DV1Q 3SJBC 1KYOF 1XFOA 1SNQA 3WOFA 5JQGA 5E79Z 5JVDB 4U7OA 2ZE8A 4K5VA 5IJ0B 4PAAA 3STBC 3ZBUA 1TWFB 3ABTA 5A8AA 2QM8A 2AHOB 2I46A 4U68A 2C5HA 3CCVV 3CEIA 1YJWB 2MO0A 3NTIA 4XIGS 4JI3Q 4JI8L 2N04A 4JYYA 4YHHO 1GM9A 1EFRA 3PO2H 1VEWA 4X8AA 4WFBV 2KVMA 4OIJA 2YXLA 2QILA 4AYBE 4JI0O 3PIPA 3PN1A 2JA8G 2ZZFA 2UU9Q 2BSKB 4XDXA 4FJCC 4GZRB 5LXTA 2XWBB 3I2ZA 2ZT9C 4NB5A 1KC8D 2NBFA 2B7CA 2HFEC 3ASSA 3B2EE 2A19A 4E2LA 1FRNA 1SQBH 1NB9A 2FJ2A 1K34A 4DR2O 1GR1A 5LMZA 5EIBC 1STGA 3TJTA 1FXKC 2D9UA 2IHFA 2JVDA 2Q2IA 1VQFA 3CQZH 1DGSA 3E8FA 1AI7A 4IHJA 5LMNL 1I4QA 1P4RA 2WLKA 4CS4A 2EOTA 4PA7A 3S3XA 2WB1G 4TQUS 5CV5A 4DR1Q 1RCVD 4ILWA 4IO9A 3QSYA 3M3YB 1ZX3A 3DM1A 4EQOA 4BY1G 3K7AB 1H9KA 2X6BA 3OJXA 5EQ0A 4DUYL 1IBMQ 1UFIA 4G7OC 2Y0SE 1VMPA 2DCUA 4WZEA 4IOAA 1VQOV 2D62A 2HHHB 3D3RA 2H3OA 3SK8A 3A8TA 3SGIA 1GKHA 3QB3A 3I3CA 1R9TH 2GVBA 4K8IA 3S14H 4B3TL 1IKLA 1SR3A 2FMCA 4DV0B 4HAEA 1BCPC 2V31A 1SYBA 3CJHB 5TSSA 4PDMA 1MOFA 3VMFA 4BY1H 4BIZA 4X0CA 4A3JG 2PI2A 5M3MH 1E3ZA 1SZTA 3DC5A 5LP6A 4XDKA 2SNSA 3OR6C 4LNUB 1WPBA 1XE1A 2PIAA 3FB5C 3GTOB 3CCEA 1GK9A 1OB0A 3K6OA 4KHZA 4TT3G 1AP5A 1AVMA 2WR8A 2BSKA 3RT3C 5GV8A 5LXTB 4NCNA 1UD3A 4P2CB 2XAQA 3T4AC 5IGBA 4I50A 4LFBQ 2P6JA 3CMEV 4ZLTF 1N0UA 1KDBA 1JB3A 1SE2A 3ISXA 3M4OB 2UXCL 1SQVH 2EXZA 4ZBMA 1QG0A 3TP6A 1WB7A 4IHJB 4BBRG 1VQOA 5IGGA 4QIWE 1TAEA 3JAKA 1SMYD 1JE5A 4QF4A 1AZQA 1ENAA 1N36B 1HUMA 3R65A 4NXMO 3MWYW 2Z9HA 3VR3A 2R9AA 2JDIA 3CAMA 5IT9L 4JW0A 5IYBO 2FYUH 1IBLB 1N32Q 5BSYA 3DTUB 3AVWA 3IKJA 5B1NA 2I0QA 4JI6L 1SRYA 3HKEB 1WSRA 1YI2V 4QHYA 1XMQB 1R5BA 1N0JA 2N74A 3HKCA 2W6IG 1ENVA 1LT5D 3AG2C 1PTOC 2K9PA 1Q86C 1PH4A 5I9OA 2Q0OC 2PI4A 4F8MA 4YCVA 2AHYA 2CE4A 3ZMTA 1YSCA 4FLUA 3MHSC 3OW7A 1I4GA 3Q6SA 4O4JB 3R93A 1N33O 1G6PA 1I50H 4DO2A 5KSWB 1ESRA 3A7AB 3F5WC 4XN3A 3GP7A 5H2FZ 4YHHQ 3ABLB 4BXXH 5L3CA 1NR7A 1SESA 1LNQA 1Q81D 1VQ5B 1DCZA 1ICFB 2MP1A 2PNHA 3MD0A 4DAPA 4IOCA 3PO2G 2KOLA 4ME3A 3X3MA 4BA2I 4R4IA 2IJ0A 4AQYL 3V7AA 3A5ZB 3K03A 2B2VA 3PMFA 3VNUA 2UUAQ 5CBHA 2JEAI 3TS0A 5C8YB 1W2BA 1VQ5V 3OTFA 1IZ6A 3OHXC 1Y74B 2RN9A 5LMUO 1GM7A 5FJ8H 3EIVA 1VQNA 1VQ7A 4FLTA 1VDZA 3VNVA 1HXYD 2EJ7A 2WLMA 3H9NA 3E83A 1DOLA 2E5LO 4RDLA 1SE8A 3PUYA 2LW7A 4ZCKA 2IWHA 5LYJB 5CYUA 5EAYA 3MXPA 4WRDA 3J81E 1LT3D 1XYIA 4WFEA 1T9HA 4RD6A 1YI2B 1QG7A 2EYMA 4ZHQA 3I7FA 3H91A 5FLXE 4IFDI 2LY7A 1SRUA 5BXZA 3K79A 1K3BC 1E1QA 1G51A 4KY5A 2MJ8A 3D3IA 1H9MA 3WNBA 2DGYA 1Q7YD 3K0XA 3LNNA 3QF7A 1QVFB 1TWCH 1JPXA 1L0NH 1BHBA 1N05A 1LT6D 5FKAC 3URYA 4UVCA 3S9WA 4GX0A 1JJ2A 4RWSC 1A6XA 1UE5A 4AF6A 1JR0D 2O2LD 2XWJB 1IURA 5EPJA 5GV7A 1S5LZ 5IY5C 1QVGU 1CNEA 4MTGA 5J2TB 4XNFA 1BO0A 2BDOA 5CA0B 1RKNA 2F3VA 2RHSB 3KDFA 1VQ5A 3AB9A 1VS0A 5I6WA 1VIBA 4JZGA 1ZUQA 4MSWC 1Q82W 1KBHA 4H13C 3A8JE 3ABKB 1EEID 3STLC 2K52A 4K6DA 3A8IA 2CVRA 3J81c 3PUZA 3VOUA 1KB9F 2JEUA 1THZA 2Y69C 5JJEB 1X3QA 1VQLA 4QUFA 1EYAA 2UUAO 3N2KA 1QFYA 4UCOA 1D2EA 2MGSA 2AGAA 3VR2A 3IFDA 4B9WA 3PJSK 2UXDO 5FL7A 5LL6X 3DM3A 2IU0A 1ZUNB 1KHIA 3A8KA 4DR3B 4LF7O 4NNJA 4JF3A 3GV6A 1PA6A 3S1QB 1GAQA 1SYCA 3HKDA 2CWAA 4GKJQ 2CTWA 4NKGB 3GTMB 1M9NA 3QFCA 2LMCB 3OIPA 4H44C 3NXSA 1I3QH 3MXGA 4IJHA 3NENA 1YI2A 2GJKA 1I8DA 4XXEA 1PZJD 1EYDA 4F6RB 3QWNA 5JPMC 1AROP 3JAMi 1SA0B 4WFFA 1SNDA 3JQQA 3HKSA 3KFUA 3KOJA 5IT9E 1HNXL 3U58A 4E6IA 2X6GA 1JQYD 4ACAA 1YZBA 1QNUA 4J7KA 2WPDG 1A62A 1L0WA 1AN8A 2K6AA 3PO3G 4DR2B 2EYLA 1E2VA 4DK0A 2CQOA 3Q0AA 4GKKO 4C1NI 4NBSA 3M4PA 1CQFA 4WJ4A 1JMKC 1VQKV 4TV8B 2V7XA 1QCBD 3WBJA 3CC2B 1SJED 3GTJH 1S5BD 5KRUA 4K8JA 1EQQA 2VQEQ 3ETQA 2DN9A 1U4PA 2YIBA 1B04A 3Q23A 3CXHF 1EY4A 1FD9A 1NI8A 3O65A 4GKKL 1L0LH 1OJHA 4KP4A 4A3LG 3ND9A 4D6TH 4L5TA 5JJZA 5HXBA 2FL4A 3K9AA 1A2TA 1H9SB 3C46A 3QNEA 3FB8C 3OUFA 1YJWV 3HOZG 1AE3A 4QPKA 3ZEDA 2F0DA 1TWAH 1VQ9V 2OTLV 4CDCC 3RN5A 4XYQA 2BH8A 4ZRZA 2NV4A 4LUVA 4FP5D 3A3BA 3CPFA 1VCIA 1J9OA 3NBHB 4XTCS 3IC9A 1H8EA 5HZBA 3D36C 1W9XA 3A5UA 4B3MQ 1BMFA 1AI5A 3GIRA 3SLNA 1PLFA 3E9HA 4ALPA 3RN2A 2A8VA 5K36H 1CK1A 1RM1B 1YJWA 2Q8VA 1EIHA 2WLHA 4XLEA 1PJ7A 4IURA 4PQXA 1K9MD 1VQ6A 4AVZA 2EYHA 1R5NA 2VL6A 1TKWB 2BGIA 2HHHQ 1BKBA 4CKEA 4ODGA 2DYSB 1ICWA 3NWTA 2F0PA 2RDHA 5CB4B 3CPWU 3ZPNA 5E4XA 3VR5A 2W6JG 2NTTA 3D4DA 4C3IB 4B48A 3HPLC 2K04A 4HCEA 1X59A 3A1PA 1ZLZA 4B3MO 2D9RA 4LH7A 1CA6A 5FO7B 4C3JB 4X64L 2Q69A 3GTKH 3QG1A 2OCHA 1PJ5A 2R93G 2RHQB 2PI5A 2XGJA 4C0SA 1VQPV 4NYKA 4RGMA 2ASBA 4TV9B 1QLEC 3ZN1A 1XMOB 3Q3AA 3SR1A 1XPOA 2ZKOA 1R3KC 3JASA 1MD2D 2YIBD 1ZXTA 4XMYA 1YNJC 1B9NA 2WB1E 2ADQB 2DMXA 1BQQT 3W1BA 1PZKD 1V8QA 5D5PA 3PA2A 1TR5A 1ENCA 2EDGA 4N9PA 1MJEA 4DQKA 4QQBX 2XGTA 2O5JC 2A6HD 5IWAL 5C5LA 2Q6AA 2BTQB 5CN0A 3AVYA 4HE6A 3NBHA 5JJJB 4G7HC 2IJHA 4DR7L 2VYQA 1SEBD 4MTNA 4BIUA 3T1HO 2YIAA 2W0XA 3CP1A 5LMNB 1TTTA 1LYLA 3SPJA 3G67A 2F0VA 4DR4B 4UY8C 1XMQO 2Z6BD 3AMUA 5LP6B 3O13A 2PY5A 1NR4A 2NZHA 4DRXA 4J10A 4RLZA 1CI3M 1LO5D 1VQLV 1YHQB 1VQIA 2F0GA 5C0XG 4O4IB 1VQ8V 1KUQA 1N33B 3IGAC 3T1HL 1YITA 3G6JB 1QGAA 2X8KA 1RFYA 1BGYH 1KZLA 3BA9A 1Y66A 1B06A 3BCFA 4RD1A 4OO1H 1M4VA 1JORA 3E89A 2L11A 3CCJV 2PGGA 4Q7JB 1YHAA 1V54C 2D74A 2ZBVA 1E79A 4ZCIA 1RJTA 2Z5UA 1PH6A 1PV4A 4LFAL 1KQSU 1M4UA 4CH3A 4TV9A 3OGCC 1LTAD 1D5AA 3QO5A 1Q90D 1STNA 1HJPA 4AYBB 1D5NA 1NU1H 2L15A 2BE5D 4G7WA 3QIAA 2JE6I 5D3IB 4CHTB 3RFRA 3PF4A 5LMUB 1K33A 1H8HG 3K5MA 1D8TA 4DV4Q 4GNXA 3HG9A 2VNIA 3THOA 2BDNA 1KTVA 3JARB 5JEAH 4JYAB 3DWQA 4KY6A 3UDFA 4V0BA 2GTAA 4FZ1A 1N07A 2ZZEA 1JC7A 1V54B 2IHEA 1XUQA 4F6EA 5B5EZ 4DV1L 1L0YB 1DLBA 2BSAA 4TQDA 2LJ2A 3VO1A 2WZNA 1PYSB 1CHPD 3CD6V 2PLFA 2DNEA 3QE2A 5JVH3 3BZDB 1JA0A 4E4EA 5IP7G 4PGOA 4H44B 2XNDA 1X54A 3JAML 2PW7A 1PH2A 4Z4YA 1SBBB 1I4PA 3HB3B 1JFFB 2XRSD 3WU2Z 2PYKA 3CRKC 1JJGA 1K8OA 4DK3C 2B2UC 2Z6BA 3B4SA 3ZHSA 1A3UA 3CRMA 3G6EV 1CSQA 1IBLL 5KGUA 2J4XA 1DF5A 3KZIZ 2LGWA 4JI5Q 4NTYA 2HCCA 1NTGA 3ASTA 1UD2A 3TXQA 2GVAA 1EUJA 2Y0SG 3A0JA 2YICA 3V76A 3HOXG 1GM8A 1K9MW 1BHAA 2VQFQ 4O2BB 1WTOA 1UNSA 3ZRXA 3WDNA 3IJ4A 4X62B 2HUGA 5C6AA 3UCSC 1T6ZA 4JPRA 1BMFG 1BOSA 1I0HA 1SYGA 5C4ZA 1CKNA 1HR0W 3PO3B 3M7MX 2UUAB 2ZBUA 4YIJA 4A3KB 1XILA 4TSFG 5LYJA 3ZRWA 1HA3A 2DN8A 3SXHA 3KJPA 3RYCA 3Q22A 5IGCA 4L5SA 1RP3B 2YDEA 4JI5B 3BNWA 2NN6H 2OBTA 1LACA 4HMJA 2JA9A 1Q86W 4MIUA 2N05A 4XDJA 1WFQA 5L3GA 3STZC 1TWHB 5IYBH 2ODMA 1XNRQ 2C4TA 2ZJPA 2QKCA 3DSQA 2RC5A 4YAUA 3L2PA 5IYRA 5M5XH 4XT3B 3H1KH 1GO3E 4JCVE 4EB6B 1Y14B 4GYCB 2R6GA 3S1RH 3KYHC 3ZHRA 2CUGA 4KV6A 1R6KA 2ZZGA 2EY1A 4RAUC 3ETDA 4RGOS 4UDUC 4DAMA 2MUYA 1L1OC 2X3UA 1C4QA 1M5IA 1TUIA 4DV3B 3CP0A 4Q0FA 4X65L 3I4LA 3L73H 3SJZA 4ZUJA 3I56V 2A9HA 3BABA 2JS3A 3TMEA 2OK8A 3E2EA 1T6XA 2B3GA 2HVJC 4DV6L 3HOVG 4C43A 3HOXB 1TS5A 3K7UC 2N78A 3F1ZA 1WTQA 4B08A 4PD4F 3TSSA 3VA7A 3CCEV 2EYOA 1LLRD 3IFXA 1ZL8B 1E3XA 1GJRA 1KK0A 3BYTB 4RG1A 4FF1A 4A3BH 1F4MA 1WJJA 2V7VA 2E76C 1B8AA 5H5NA 1BX0A 5CV8A 1TUBB 3PF5A 2YS8A 5KHKA 1S0VA 3VQVA 1QZHA 3RGBA 3KF6A 4C3HG 2DWEC 1WTXA 1BQZA 1FL0A 1UEAB 3N27A 1HZAA 3SHLA 3D3QA 4CJ0B 2XAJA 4KKUA 2LFNA 4HCSA 5DEHA 3APQA 2EILC 4WQMA 5EC2C 4ID6A 3W1GA 1M56C 4FNFA 4J7JA 2XUMA 2I5HA 2LQTA 4GKJB 1C9OA 4M1UB 5CBEE 5IIFA 3Q24A 4BBSB 1MSWD 1WU8A 4DXWA 1I94O 4NXNQ 3BAAA 2E74B 3BH4A 4MNOA 2QR4A 2X6YA 2NPFA 1NH2B 3RYHB 3CC4B 3I4MH 4A93H 2DYRB 1WOPA 1PFMA 4KXRA 4HJ8A 1QQCA 5GONA 4H0LB 5HFLA 3E86A 3W2IA 1GUGA 1M57C 2OTJV 1WCMB 3M85A 2B29A 3AYHB 1HNZQ 2A06H 1KAWA 3ABLC 3R66A 3DGEA 3V2TA 4RCYA 2QA4B 1N9WA 2BA0A 4TMZA 3GTJB 2UUBB 5KEEA 1OTCA 4NR1A 2BPOA 5F4MA 1CT1D 1F23A 4B3MB 4OGQB 3U10A 1PYBA 4QPJA 3I55A 4QMGA 3ZS8C 2KHJA 5FO9B 3TP8A 2Z0AA 3T51B 5BN3A 4A93B 3ML0A 2UU9B 1YVWA 1A8VA 3AG1C 4HTHA 4X3UA 4DV0L 2GA4B 1TUEB 2EINB 3ASOC 4DV2L 3QO2A 4P2NA 2IT1A 4KN7C 4KN4C 5LMNO 5KX5A 1H38A 1JJOA 3G48A 5T1IA 1CFMA 4C3IH 4WF9V 1OGJA 4DF7A 5IYDO 4XLCA 1HA5A 2ZXWC 1VQEA 4N8FA 4LAAA 3VYSA 3OTOB 3CRAA 1WA8A 2QWNB 4YXWG 3RVZA 4FXUA 1YIJB 1K3EA 1XXGA 2KCNA 3KF8A 2ZM6L 4AI8A 1HW7A 3KEWA 3JSLA 3GTPB 3G4SV 2L5TA 3FEWX 4RHSA 4OO1I 1ZWIC 3CCUB 1MNGA 2WSSA 1VQNB 2E75B 1ZKOA 2PO4A 4N9TA 1IKMA 1S5JA 2QM7A 4TWKA 3GD7A 2HJDA 2EINC 2JDIG 2K1EA 2V7QA 2YTVA 1WI5A 1BNZA 4FXDA 1SJHD 4KD4A 5CB4A 5DM73 4CJ2C 5CBAE 3E8HA 1BR9A 2EXDA 4LFCQ 1KL9A 3C3SA 2IL8A 4Q20A 2M9VA 1SQXH 4Z1MG 4X7EA 4ZHQB 1GHJA 2A0LA 2GUZB 3ZMSA 2PYLA 3ASQA 4OOXA 1IHZA 1WAZA 4XORA 5AN9A 2K5WA 3C2QA 2KQ3A 1NUCA 4X62L 2F1MA 2QWQB 1Z5WA 3J81N 3GWKC 4RAIA 1F60A 1E3PA 4G27B 5CA3A 1GRJA 2LGQA 1L1FA 1UJWB 3GQBA 2RSNA 5BN4A 4GKKQ 4DYLA 1JOKA 3GTLH 4JYAO 1OHHG 3LGJA 3CCSV 2HEPA 3OAAA 4GOPC 1YJNA 2QGQA 5EYPA 3OEEA 4LF9O 3I55V 1FFTB 4X8IA 1Y0YA 2NB0A 4X1KB 3KDFB 1OGIA 1N34L 4MVQA 3AFPA 4O42A 3CXCA 1DTOA 3TEHB 1G4YB 3CCMA 1S5DD 1HNWQ 1UD4A 4OXSA 4JI2O 1ML0D 1WD1A 2BTQA 1SM4A 4JPBW 4QGPA 1AI4A 1B70B 2BCOA 1YIJA 2OTJA 4UCRA 3I8ZA 1HFNA 1IBKO 1CM9A 2RQXA 2H94A 1NBWA 4X3SA 1A0IA 4H9GA 1PZID 3MFYA 4Z4SA 5IYCG 5LMUQ 4QUZA 4B43A 3HOYB 4JI6O 4ULLA 3CW2C 3KLRA 4JI3B 3JAWB 5LL6S 2HHHL 2JXMB 1F77A 4ZOLA 1HVXA 4DV5O 1GO2A 1FNCA 2ZZQA 4WWVA 1CQVA 1NR1A 3VA5A 1R9TB 2IPKD 3S14B 1GKFA 1VQ6V 4JV5Q 2DIEA 4MHEA 3S2HB 2RVLA 2DOGA 2AWNA 3TP7A 1ONLA 5LHHA 5K36G 1KK3A 1VQGA 3WNCA 1KNAA 3FD9A 1YNNC 1I7FA 3PIOA 4X66O 5JBQA 1NT2B 4LUZA 2YEVB 4PA6A 2BM0A 1VQ4B 4R4OA 1SQFA 1I7PA 3HEJA 5E1AC 2Q73A 5KNLA 4DFAA 5BN5A 4KFMA 1G7CA 1J5EQ 2WP8J 4G2KA 2P22C 1TU2B 2JA8B 1BZKA 1VF5B 3LSQA 4DV5Q 3FPKA 1QFZA 3C2PA 4YY3L 1IBKQ 1FNDA 3OW2A 1RM1C 2UUBQ 3CCLV 1K4DC 1Z6HA 1WVLA 1XBLA 1K5SA 3TBIB 1N36Q 5LHIA 4XOTA 5J22A 3H1JH 2YC0A 4DW1A 1BUVT 1VQDA 1IX9A 3B6YA 3JARA 3ABKC 5C4XB 2YYZA 1F7YA 4RHRA 1I5XA 4P30A 3OFNA 2B8FA 1F2LA 2PQAB 3NTKA 2E5LL 2FXQA 2RC6A 2A73B 2B2UA 4L6TB 2AMCB 2F03A 4IZ8A 3K5LA 1EY0A 4A3KG 3PO2B 3OMGA 2IH1C 3B40A 1PH1A 1O7IA 1JOYA 4X3KA 2HP8A 2K5QA 2NVYH 1KP2A 1QLEB 1TVKB 2B5UA 3WFVA 2PZSA 2OWOA 2Z1CA 1K8AW 4X05A 1JFFA 1KDCA 3A3GA 4G1VA 2D5DA 4ZGNB 4NXNO 2C2WA 3FKIB 4PV1C 4TUYB 4J1MA 2P90A 5EKKA 1EN4A 3DEOA 5LA6B 4FF4A 1LM0A 3J80L 1EFRG 2XTAA 1WPCA 2XZPA 1Z5VA 4IJLA 5GROA 4A3KH 3JYCA 4IT5A 3ULPA 1BSMA 1DARA 3FPPA 5FA6A 2NWGA 4JI3L 1VF6A 4U7NA 1H8HA 2GREA 4RJLA 2XASA 2R72A 2QN6A 2QTOA 4XN0A 2EIMB 1XWEA 4IALA 4R71A 1UD5A 1E1OA 1YIJV 1Q1EA 2DJGC 5ITZA 5KA6A 4GKJO 3Q6RA 1H9JA 2RF4A 1P16A 5ELCA 4XD7A 2KG7B 2XT9A 5EBMC 5D14A 3TP5A 4LNUA 1B50A 4J9ZB 1FJGQ 4WZLA 4AIMA 2R93B 5EPKA 2C77A 2QTZA 2YWEA 4FM0A 5C3XA 5TRDA 1HTLD 1KK1A 3OP1A 5EKLA 3ZJZA 4R4TA 3PIP3 1EY7A 2Z8LA 5LMNQ 4P6VF 3OZVA 1GMGA 1P7GA 2JJ2G 3H1IH 3ULJA 3T53B 4BBRH 3P7JA 4U3FH 3UDXA 2E2IB 1KKDA 1WJZA 3OGIB 1EWCA 4OPVA 1CZGA 1UAPA 2NLJC 2WFWA 2QEJC 5CMDA 2WLJA 3CC7A 4G7XA 3WYAA 5EKIA 3C1FA 4A3BB 4PZ8A 1WPXA 3M4YA 1QU7A 2ES2A 1NVPB 3NELA 2VUMB 1PL4A 5EZYB 4RUFA 2L9HA 1D6EC 5C3EB 2HCJB 1KRTA 2BE3A 2ZL5A 5DM63 2GK7A 3CC4V 2V7UA 2PMZE 5J1ZA 2Q6IA 1H2KA 1A32A 2F93B 3L0OA 3CC7V 2B2VC 2MNAA 2QF7A 2DOSA 2AZ2A 4C56C 4U9UA 1PNLA 3QO7A 4X65B 3LSSA 1Q8KA 1I5FA 2UUBO 2X0KA 3FYEB 4YCWA 3AG4C 2ZT9B 3SPCA 2AUKA 3KF6B 3RR5A 1PRTF 4OPOA 5KMGA 4G57A 4R6ZA 4CH4A 2M7WA 1G7RA 3NR7A 4HYOA 3CESA 4DV6B 4M53A 3G71B 5FNZA 5HZAA 1SYFA 2BA1A 3ONAB 2F23A 4LH6A 2VNJA 3AG2B 3WNDA 1B7YB 3AU7A 1SYEA 3H0GG 3N6RA 4UV8A 4FK5C 2PTMA 2FINB 3BDCA 5CV9A 1WTWA 2EJMA 1OCZB 3PA1A 3U9OA 5C4JH 2A6ED 4K6LA 4IUPA 3UKMA 4XKWA 1VQMB 5LL6Y 2JQOA 2L12A 3FMCA 2F4VB 4ZKCB 1EZ6A 2MQHA 4A3FB 1HNWO 5JH7B 1NJID 2YUAA 4LC0A 4A3CG 1Y8NB 3QOJA 4IUQA 3IRBA 2P67A 3CC7B 2QWOB 2ZXWB 1N32L 1X3EA 2FTKA 4RQFA 5LMNW 3W7SA 2WJYA 2VQFB 1CNFA 3I56B 5IP9G 4Z4TA 1GM5A 2JK8A 3EJIA 4WORA 4RD2A 3MXNB 4DAVA 1LTTD 4R4CA 1WB8A 1GUTA 1LT4D 4DR3L 4K0KQ 4PC7A 4LFBL 3VO2A 2IW5A 4KHPB 4BA1I 3NQTA 1C0AA 2Q5ZA 2HR3A 5HFMA 3KBGA 1E7ZA 1YNND 1TVCA 1F9SA 5C4JB 5FNVB 4PJ0Z 2Q8IB 3ZX6A 5HGQA 3NPPA 4DUYQ 1QVFA 5J2TA 2CWPA 1F2ZA 1DOKA 4JOIC 4GZYC 1WP8A 4GCZA 2E5LB 2OYNA 1W35A 2E1BA 4RPDA 3I5DA 3ASNB 5A9GA 4II3A 1VQBA 1X65A 1AP0A 4RUEA 3PUMA 2Z4HA 3OE7A 5DN6A 1X6OA 2V7TA 2NNUA 2VXWA 2RDFA 4PI2A 5KUMA 1W34A 2XEXA 1SYDA 3UI2A 1DD2A 2C9OA 1J8IA 4IGGA 4KTAA 3CSXA 1VQHA 2R70A 4FK8A 3SE0A 1BT8A 1K5QA 2UXNA 4DW0A 4YAWA 1XNQQ 3ZHVA 1EU3A 1FNBA 1S4ZA 1RTOA 2BOCC 4O4HB 2WACA 1Q86D 5A2QE 3J81L 3PUXA 1K4CC 4BR6A 4JASA 3ZRWB 3ASPA 1Y1WH 1V1QA 3GTKB 2DYIA 4JI6B 4C3JH 3HKDB 5EBDA 4LP8A 3OPOA 3WG7C 4F6RA 2AQ3B 4YIOA 3FJOA 3S3WA 3BCDA 3IL8A 4ABNA 2G38A 4AC9A 2UXDL 1K8GA 1IXBA 4UV9A 4DUZL 2QDXA 3VQWA 2B2YA 2OTLA 1K73W 4RGNA 1SA0A 4A3FH 1D2DA 3MVVA 5BMVB 2E2JH 1YJNB 1KD1D 4LF6Q 2MK3A 5F2DA 5LGUA 4YJ3A 1MG1A 1ZM3A 2ZXIA 1PP9H 4DV2Q 2B63G 2V4DA 1KC8C 1TT2A 2ZINA 1PFSA 2LKVA 4D7TA 4PC6A 2K1BA 2IU3A 2W0FC 1KK2A 1F9PA 1QILA 1KABA 3ASOB 2D3NA 4DQLA 4XR6A 4IL6Z 2QGNA 2PYJA 2CNDA 1EY8A 1SQGA 1I94Q 1TWAB 3RW0A 1JMCA 4TMTA 4NXNB 3EN2A 4CQJA 1ZL8A 5GAEC 3DXRB 1JT8A 4RQEA 4BPRA 3TCUA 4I55B 4FZ0A 2RQ6A 5KYLA 4ZUIA 5I2YA 3OE7G 3CCJB 3K5NA 1XMQQ 2FFKB 4GN3B 2NN4A 3NWSA 3N2GA 4P73A 4ZOLB 1J5EO 5IWAB 3N52A 5C0XH 3NBIA 1EFTA 2V1DA 3QOLA 4UVAA 1O9GA 2BF4A 4TMWA 1TXYA 4OIKA 1UMKA 5DM6V 1Q6HA 4B3RO 4PG3A 3NHHA 1T5EA 3QR8A 1N8RW 5KHGA 1VHEA 3TZUA 5M3FB 1HNXQ 1NCVA 2GHYA 1QUQB 4BY7G 3GVKA 2QDOA 3OEEG 1VQ6B 1BQ0A 1EP3B 1Q43A 3E20A 1O7YA 2E2DC 1YF2A 1E79G 5IGFA 2MPMA 4QUCA 2BOSA 2EIJB 4JYBA 3RYHA 1WP6A 2VJIA 4XONA 1B53A 1LTGD 4P72A 4B3RL 3ZHQA 4UP8A 1H2GA 3R8BA 3LQEA 4JI7Q 4GOPB 1A63A 1W0JG 3A55A 2RDCA 3RYFA 3GVMA 2QWPB 1UD8A 3D4WA 2WIIB 5ISRA 4DV7Q 2YIDA 4A3IG 2BVNA 4JC0A 1KECA 1YCIA 3SR2C 4QB4A 5C3EH 2UUCL 4X20B 1EYCA 1VHOA 4XQFA 1QHTA 1OXUA 4C3IG 1XPRA 3OKXA 3BVZA 2O5IC 3RNUA 3BPZA 1SMYC 3BS1A 1RHPA 3I55B 4C2MH 4MVRA 4Z4ZA 1D5XC 4HSVA 4ZKBB 2JJ1G 4XM3A 3A8IE 4NXMQ 2BH2A 2F0WA 3SDZA 5KLVH 4BBSG 1YZ6A 1CKOA 3RLNA 4A3DB 3I1FA 3RYIA 5H9CA 3CPXA 3HKZG 2UUCO 3NXWA 4DNIA 1OZ0A 4TQFA 5B66Z 4GN4B 5BR8Q 4OPAA 3S16B 5FO8B 1QNMA 3AEIA 4R9WA 1WDTA 4X07A 4LF5B 4X65O 3APOA 4ZV4A 5LA6A 4A3BG 4HJ7A 1CXZB 1IXRA 3PGZA 5FLXL 3KF8B 4DV7O 1UD6A 3MHBA 2P06A 4DV6O 4FLVA 4I9QA 3BQJA 1A3VA 3TETA 1RPRA 4X1YB 3G4SA 1GJXA 2DY8A 3E22B 4X6AH 2A74C 4O4JA 2JIZA 4RDJA 2M6YA 4LF6O 1VQNV 4YALA 1IL2A 4YWLA 4JTDB 2LW1A 2CBXA 3GTGH 1I6HB 1B2RA 4A3MH 3JD3A 2WLIA 2F4VO 2Q9LA 1VQ9B 1EWIA 3PENA 2HJFC 1XREA 5AG2A 1BE3H 3ABMC 2JP1A 4MW8A 4N23A 2GQFA 4G5GA 1ASZA 4DR6Q 5JJLA 4JMQA 3K81C 2F0HA 3I4OA 5L46A 4CZZA 2N3SA 3H94A 1ILPA 3CB2A 4I65A 3OMAB 1K97A 2Q2TA 2E74C 4JV5O 1VQPA 3T1HB 2F4VL 1K8MA 1P49A 3CCQA 4MTKA 1WYDA 3ASNC 2KCMA 1NQTA 2RCFA 3H0GB 1C7YA 3UT5A 4P22A 3SLDA 1VQKB 2AUJD 1NMGA 5E3FA 1IB0A 2CCZA 2O57A 3HKBB 3MMPA 1YTFB 1SNCA 3FVQA 1SKVA 3K5OA 2ZNIA 1OXSC 3FKIG 5IWAQ 3JD2A 2PZWA 3S2HH 4HIDA 5JJIA 1JJCB 4MZ9A 1HTPA 5CBFA 3MFGA 1FS0G 5DECA 5B1BC 1FYJA 3BVGA 4XQQA 3X3NA 4J7ZA 5M5YH 4J6HA 3S2DH 3MAQA 4NB3A 1B44D 3M7GA 3CRCA 5GADC 2UXBO 4UAIA 5IT9N 4OONA 3E22A 3WB0A 4E0FA 4R8NA 1TWCB 3MHHC 1A2UA 1YNJD 2JA8H 4K2KA 1AIPA 3FAVB 4XBFA 4HZ3A 3L75H 4LFCO 1E63A 2WJVA 3PUNA 2M00A 3HKZB 2EZOA 4HN7A 2WLLA 1LTBD 4RKLA 1FAFA 3I73A 2L6LA 1PRTC 4IYIA 2ZD9A 3EVQA 1WD0A 1YJ9B 1VQ9A 4H7BA 1E1RA 1BX1A 4DUYB 1NZ6A 3J7ZC 3W3AA 1JNYA 5EMNA 4YWMA 3JAMc 4BY1B 4LCUC 3SVMA 4R4QA 4PZ6A 4B4DA 1H2NA 5BY1A 4UHVA 1T5XD 1W6KA 2CK3G 3W7WA 3QTCA 3W2EA 2MFIA 4WJ3M 4LK1C 4C3HH 3L9DA 4CH5A 3FYIB 2ZM6O 3AGPA 3AVUA 1FKAO 1I18A 1ZTEA 3L3OC 3M4OH 3RWRD 3RYCB 4LF9Q 4UFZA 4GN5A 3AG3B 4OHJA 2LS01 1Y76B 4JBKA 1WCMH 3CCEB 2R7ZB 1QGZA 4HE5A 1P8LA 1SQPH 2M2LA 2BMWA 3CW2A 4C3HB 2CFMA 1CZWA 5KNBA 3FB6C 4J11A 3DLLA 1H2LA 2EIJC 1XX8A 1OXTA 2VS0A 3TS2A 3HOYG 2KENA 2Z0SA 4HIOA 2RJZA 3HOWH 5M3MB 3P32A 1FRQA 4DXGA 1HR0L
chains in the Genus database with same CATH topology
5M5YB 2NN6I 1SNPA 2OXPA 4FM2A 2EYPA 1FJGB 4CGYB 1GUSA 1V0FA 2BTOA 4I4TA 1A3TA 4IUUA 3S2DB 1EOTA 3HKCB 1TY0A 3DWAA 3RD4A 4IFDH 1JWSD 3CHBD 5HKKA 3GTQB 1M8AA 1TS3A 5D3DA 2PQEA 4DGZA 2B2YC 3RUZA 2HCIA 4TOIA 4RA8A 3WOEA 1W0KA 4KJNA 4CH6A 4FLYA 3U9SA 3L7ZC 1C8CA 2PZUA 3GTGB 4K14A 1FD7D 3VYUA 5C8YA 1II3A 1PYWD 4CC5A 1NRKA 3DWPA 2R61A 5JCOA 2PUSA 2Y0SB 4YJ2A 2C5CA 3RMHA 2A68D 4EEQA 1FR3A 1OO9B 2QDBA 2XZOA 3A54A 4EQNA 1EY5A 1B9MA 4PMWA 2F0EA 1H9RA 4YELA 5FOBB 5JEAJ 1I94B 1KMHA 1TA8A 2F0LA 3HP3A 1DXMA 4DV1B 1DZ1A 4K0KB 1EEFD 2UUCB 2K33A 5D65A 3BA8A 2YI8A 4B3FX 2EVBA 3A8KE 1NBMA 4U673 1DOMA 2WB1B 1FNWA 1KLGD 1W0JA 2HQEA 3BRCA 4NXMB 1X32A 1S5ED 4DAYA 4DK1A 3R2TA 4FXKC 5ELFA 2XSCA 3JAKB 5I9PA 2PNRC 1IYUA 1BBXC 2E3CA 1D5ZC 3TZDA 4G6IA 3MZ5A 1TIID 4PI0A 2KEEA 2KCCA 2HDLA 3TDQA 3RYIB 3S1RB 1D2BA 4JBWA 1IBMB 4C1NK 4NW2A 4JV5B 3JATB 4TV8A 5DNFA 3S1NB 1FX0A 3MC0B 5C0XI 1JWUD 1EY9A 2BE5C 3S17B 5KHIA 3GO5A 2UXCB 3JAWA 2JJ2A 1RSOA 4A3GB 4XKVA 1KMIZ 2O4XA 1LTSD 3JALA 1SSOA 4C3JG 1V1PB 4XLAA 3G05A 3SEBA 5CV6A 1Y8OB 1GHKA 2ICIA 5CA1A 2L1BA 2X6LA 4JI2B 3EQLC 1BXTA 2Q8TA 4UCVA 5CORA 1VF7A 3MEHA 3HS0C 3JSNA 4B3GA 4DV5B 2VB2X 5HURA 1D1KA 3NUCA 3H09A 4KHVA 5KNDA 2X69A 3CP2A 4F87A 1O7LA 4DR5B 2EY5A 3LWUA 3N2KB 4JI7B 4LF7B 4ASUA 1TVKA 5FPRA 2KVOA 4WBNA 1O78A 2Z4IA 1WN7A 5IODA 3KLSA 4D7SA 2LZJA 4O4LB 1TS4A 2EPBA 2XVSA 4FLWA 2ENBA 1HR0B 4ZYSA 4NDXA 4DUZB 2JGUA 2XRQD 2GJRA 4CS2A 5BR8B 2J0TD 3ZIAA 4IN3A 1GUWA 3VYTA 3I4NB 4K8XA 3A2FA 1UUPA 1Y8PB 1BCPB 1VF5C 3UQ8A 2PW5A 3CRLC 4RCNA 5IJ9A 2WAQB 1SAPA 5CV7A 4DU9A 2ZIOA 4FFBB 4BWGB 4RCOA 2RKSA 4AILC 3T16A 4A3JB 4R8IA 4X1YA 2ICEC 4II2A 2D3LA 2SOBA 1LTID 3C3LA 2KECA 1JCKB 3GVLA 4HIZA 5KMGB 5CDFA 4KMUC 1IL8A 5KX5B 4CKBA 2VWJA 4O2AA 3E0JA 4HEDA 4I50B 2K5DA 3GV3A 4O2BA 1KAAA 5JH7A 1LTRD 4JI8B 1HUNA 4X1IB 1ZAUA 4DV4B 1MI2A 2UXDB 2RSOA 2XN9C 3GVJA 2NVXB 2GK6A 3I90A 4IFDG 1SFOB 2EYFA 2ZXHA 2B2WC 3WB2A 3HKEA 4EVOA 5A35A 3JAME 3NK9A 1STHA 2NTSA 1Z47A 1CTMA 4NMZA 5M5WB 4FF3A 1V0EA 1KTKA 1QE6A 3KUPA 2NN6G 2N88A 4QCLA 3CMMA 1QNKA 4GKKB 3I72A 3F2UA 5CC4A 1Q12A 3NSWA 1I4HA 3ICXA 3MA2B 4B9XA 3NE5B 4JI1B 3CHXA 5ELBA 2F0IA 2L4NA 3H3VC 3DXJC 4BWAA 2JA5B 2Q7GA 3K58A 2B39A 2F0FA 5J2UB 4K8ZA 1QB5D 4KL1A 1RF2D 4YY3B 1OHHA 1Q90A 1N32B 2ZTGA 3L9AX 5AFWA 1L8DA 2IW3A 4C2MB 5CA0A 4HNAB 1PTOD 4DV2B 1QOHA 1V1OA 3VYRA 3K0YA 5KHHA 2PPBC 5EBCA 3DDYA 4J8QA 4PNYA 3J7AF 2ZTNA 5COYA 1HFGA 2ZCEA 2XIWA 3PV0A 5IYZB 4TRDA 1SXTA 4QIWB 3J80E 1PTOB 5KYIA 4YXWA 1E2ZA 1LV9A 5CA1B 3K57A 3GTLB 1EZ8A 3ITPA 1N34B 5EGTA 2A6HC 1G2TA 3DMUA 5FPOA 4EB6A 1PKVA 2WKCA 4KJOA 4S3SA 1J5EB 1ET9A 1G6ZA 1WTVA 3LWEA 2F0SA 2X6XA 2TSSA 3I91A 3SJAC 3HOUB 5ELDA 3OMCA 4DR1B 2R3ZA 1WTHD 2F0UA 2NVTB 2F0MA 4EQPA 5IYZA 2FMMA 4WJWA 2TMPA 2K01A 4WFN3 2CAZC 2VNUD 4TKOB 1IYVA 1Q3EA 4O4LA 1DM0B 2ZIMA 5M9OA 5K1PA 2HLDA 2WINB 1Y1WB 1EL0A 1COWA 3VR4A 2QE7A 3BVMA 2H4OA 4K2LA 5C5MA 1HHVA 4UZUA 3FFQA 2PZTA 1XTCD 1PRTB 1O9HA 4X3TA 4FYDA 4KKSA 3KLSX 4NP5A 5K1XA 5E1FA 3JASB 1V43A 4IUNA 3V05A 4LF6B 1WTRA 1F2MA 3UT5B 2A6EC 2ID0A 3PUWA 4DXFA 2Q7HA 1AFPA 3IFTA 4ZI7B 5I4DA 2VQEB 1R4QB 4YHHB 5FNVA 4XOPA 2L0CA 4K5WA 3OWEB 5C5LA 1B4OA 1TY2A 3U0ZA 1G8ZD 4DRXB 4KK7A 4LJZC 5JQGB 1HQMC 2ZXOA 1CA5A 5IJ0A 1G91A 4X64B 4Q5VA 5JVG3 3TN2A 3NQIA 1BCPD 4X1IA 4ZIBA 3C1EA 5ITZB 1RTNA 3A7LA 1PFBA 3ZYYX 4LFCB 3FKSA 1CHQD 2EY6A 4LFAB 4TSSA 5IOCA 3OIQA 3S1MB 3R2IA 4NKLA 4Y7NB 1Q1BA 4FF2A 1B1ZA 1X4TA 4RFBA 2ZM6B 2EYJA 3I70A 3OWFA 2PCFB 5EZYA 2F4IA 2RA4A 1TGOA 4I4TB 1ZYRC 4X66B 1YEWA 1KLUD 2WPDA 1GUOA 5JEAG 1BF4A 2JA6B 3MXUA 4I55A 2JEBI 4FLXA 4H0LC 1VLYA 3OOCA 4XLFA 2KEDA 4L8JA 4GQNA 1L0XB 1ZYRD 4IIJB 1S5FD 1FGBD 5EPLA 3WQZA 1WTPA 3BDLA 4XQNA 4LR3A 3J7AV 1E0BA 1JOOA 1PXUA 2OYQA 1FFXB 3HRZC 5J39A 1MGSA 2NVYB 3SK5A 1VMCA 4IQZA 4FLZA 1NAPA 4XT1B 1I4XA 3OSOA 4XYOA 4TUYA 4ME5A 1B3AA 4GLXA 2F0QA 2E75C 1OXVA 2VJJA 4IUTA 2WKDA 1TWGB 3P20A 5EYPB 3P75A 4XL9A 2F43A 2SEBD 4HSPA 3QJYA 4HR7B 4IIJA 1MABA 2E2HB 3EA6A 5KNCA 1E43A 2CHBD 2JSOA 4CS3A 1MSHA 5LOVA 4OGQC 1JICA 1GUNA 2GJPA 1IBKB 2SNMA 2EY2A 5DEHA 4UCSA 2JYOA 3R3OA 1FFXA 1HNXB 4BY7B 4O4HA 1D5MC 4I7ZC 1Q8IA 3FRPB 3K59A 2N55A 1ZEQX 4MN3A 4F88A 1K28D 2K32A 3DUZA 4LFBB 1XQ8A 1XNRB 2X53S 2L55A 4FM1A 2F0OA 2DNCA 5LHY1 1O7ZA 2KA7A 3DHQA 2K7VA 1KDAA 3DEPA 3HOZB 3S15B 4JI4B 4CBVA 4OL7A 1Q5OA 2Q0AA 2KHSA 1X3PA 1STYA 3D31A 2Q8RE 5LOVB 4RGTA 1HNWB 1ENFA 5JJNB 3HOVB 1V1PA 1RD9D 4UCTA 2VB3X 1G291 2B63B 4TT3A 1EQTA 1VJSA 4IUVA 2XNAC 3RZDB 3D8GA 2AQ2B 1XHXA 2NZ1D 2G9DA 5J2UA 3E5SA 5C4XB 3J81E 2WZPP 2IX3A 1SE4A 5IGDA 3V96A 4DR6B 5JOBA 4A3EB 4BW9A 2B2TA 2NVQB 4KY7A 1U4RA 2H1EA 3RYFB 1BLIA 1D1IA 3JU4A 2JS5A 1EWHA 1F2YA 2DY7A 2HDMA 1E2WA 1STEA 4X20A 1PTOH 4EFEA 1XHZA 1HNZB 5EJWA 1QJOA 2QM4A 2R92B 3BG3A 3FDTA 4PHZA 1F9RA 4AQYB 4G4KA 5I6YA 4WBNB 1STAA 3I4MB 2R9VA 1PDQA 3VR6A 4OX9B 1H9SA 3CP8A 1ET6A 2YI9A 2QKIC 5G3LF 1G6UA 2KKWA 3J7YW 2CW0D 1BPLA 4CJ1B 3W2DA 4KI0A 2OF1A 2ZXPA 4BS9A 2F0KA 1AEXA 1Y1VB 5JPNC 4NVPA 4TSFA 3A56A 4Z1MA 1F9QA 4XQJA 3U11A 2I07B 1KNEA 4JK1C 1O80A 5CGKA 1TS2A 1PMRA 1PFNA 1RDPD 2AQ1B 5IJ9B 4PMCA 2K28A 2IX1A 2F66C 3VQYA 1I50B 1DJRD 1GOZA 3MXNA 2XHBA 2B2TC 3HZXA 1JE4A 1LABA 2A5HA 1M93A 4CKCA 2X85A 1I4RA 3CKIB 4Q6GA 1SNOA 1H2SB 1JOQA 3VQXA 4O4IA 1AW7A 2ZXRA 5IK2A 2JJ1A 4O2AB 4LF4B 4KD3A 2SDFA 1ESFA 1IW7D 5KIXA 4HBNA 3RLFA 1Q3LA 1NR2A 2EJFC 2RBMA 1A15A 2FHTA 4L63B 3IAYA 1G2SA 4KKTA 1U9RA 4DV7B 2A68C 1FNVA 1RODA 5CR3A 2B8GA 1IW7C 5BMVA 3P1HA 1WNSA 3CQZB 4DA2A 4YJ3B 3CU7A 1HPCA 3T1YB 2CQAA 1R4PB 5C0XJ 1XI1A 1B2TA 2CK3A 1FYCA 3JATA 3M7NA 4FO2A 2A69D 5E4WC 2M5SA 2F0JA 3NP8A 2F0TA 2MHVA 1PTOF 2K05A 3HGBA 1K83B 2F0NA 5IGEA 4RKBA 5D5QA 3JALB 3QG5A 2OT2A 2A69C 4FVMA 2NYZD 3HKBA 5G3LD 2P5OA 1FNUA 4G7ZC 3EROA 2G9HD 4UCUA 4YEJA 5HGTA 5ELEA 4B3RB 2OEOA 3HOWB 2RDGA 2UXBB 2VWKA