3LNNA

Crystal structure of zneb from cupriavidus metallidurans
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
341
structure length
341
Chain Sequence
ALRHEGERLVVPAESPLRRTLAVAPATRETVAAPFNLPAMIEADPAKLVKVLPPLAGRIVSLNKQLGDEVKAGDVLFTIDSADLAQANSDAAKARAAMTMARRNLDRQRELDKSEIAAKRDFEQAQSDYDQAASESQRADARLAQLGAKGGGTLQAGGGHILAVRSPINGRVVDLNAATGAYWNDTTASLMTVADLSHVFVTANAQEKDLGHVYVGQSATVKFDAYDDPQPGKVRYVGQILDADTRTTKVRMVFDNPDGRLRPGMFAQATFLSQPHEGIVVPMSAIVQSGFYTRAFVEVAPWQFEPRVIKLGAQIGDRMEVKSGLSAGDRVVVKEGVLLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-induced conformational changes in ZneB suggest an active role of membrane fusion proteins in efflux resistance systems.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal transport
molecule keywords Membrane fusion protein (MFP) heavy metal cation efflux ZneB
total genus 58
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3lnnA04
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3lnnA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lnnA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3lnnA01
3RLFA 2A69C 2A68C 3SDZA 5K36H 1VDZA 3IKJA 3VR3A 1BDOA 1K8MA 3VA7A 3U9SA 2K7VA 1IW7C 2Q8IB 1HTPA 2PPBC 1GHJA 1FYCA 4G7ZC 4L8JA 1V8QA 5KNBA 5K36G 1TKWB 1IYVA 2A6ED 1GUNA 2EDGA 3OW7A 3FPPA 1H9MA 1Q1EA 2D5DA 1Q90A 2E75C 3CRKC 4BA1I 3W3AA 1CI3M 4H0LC 4LK1C 1IW7D 5C0XH 4KKUA 5JJJB 2PNRC 3WB1A 4JK1C 3VR5A 2AUJD 4DNRB 2CW0C 2K32A 3VR4A 2E76C 3I72A 3WB0A 4TKOB 3FMCA 3OOCA 2BE5D 1LACA 2O5IC 2AUKA 3QG1A 2QF7A 2NN6I 4DK0A 2EJMA 4LJZC 1T5EA 1VF5C 1YNNC 3PUZA 3ND9A 3TZUA 3BRCA 1QJOA 3NE5B 3M85A 2JEAI 1DXMA 3DXJC 1EWHA 1CTMA 2BDOA 3AB9A 4IFDH 3VR2A 3M7NA 3PUYA 4PV1C 3HGBA 2EVBA 1VCIA 3H94A 4KKSA 3PUVA 3SE0A 1H9JA 2V4DA 2BE5C 2A68D 1Z6HA 1FR3A 3ND8A 3T51B 1DCZA 1Y8NB 1IYUA 2A6HC 3KLRA 2F95B 5JEAH 3I4LA 2DNEA 3A8JE 4KN4C 2F1MA 1Q1BA 3MFYA 3A8IE 1H9SA 2AWOA 2B8GA 4KHZA 5BN4A 2F93B 1GHKA 3PV0A 1YNJC 1Y8OB 5D5QA 5KNCA 5JJNB 5C0XG 2NN6G 4RCNA 4GYCB 4KMUC 2KA7A 2O5JC 1HQMC 2JE6I 5BN5A 2B8FA 1HPCA 1E2ZA 1HCZA 2IT1A 3GQBA 3N6RA 1Y8PB 4OGQC 3WDNA 1Y69U 1B9MA 2DNCA 3M4YA 4IFDG 1OXSC 4OO1G 4GZYC 5D5PA 3QJYA 1K8OA 1DD2A 2A6EC 1GUOA 3GD7A 3A7LA 2YYZA 2EJFC 1RSOA 4H13C 2L5TA 5BN3A 4OO1H 4G7OC 2BA0A 5KNDA 2LMCB 1TU2B 2JEBI 1I6VC 1Q12A 3A7AB 1GUTA 2BA1A 3D31A 3QIAA 4KKTA 1H9RA 1H9KA 2R6GA 3PUWA 1V43A 2D62A 3LNNA 4DNTB 1B9NA 2K33A 3BDOA 5JJEB 4BA2I 1O78A 3D4RA 1H2SB 1ZKOA 2NN6H 2PCFB 3CRLC 2D2CC 3P20A 1E2WA 3LWUA 1ZYRC 4I7ZC 2KCCA 3OPOA 3A8KE 1LABA 2A6HD 2DN8A 3EQLC 2E74C 1GJXA 4XTCS 4XIGS 4KN7C 2EJGC 1GUGA 4TQUS 1G291 1OXTA 1GUSA 4H44C 3T56B 3I73A 4KI0A 3MXUA 1VF7A 3VR6A 5JEAG 3IFTA 1OXVA 3WB2A 1PMRA 5A35A 4HR7B 3PUXA 4IQZA 2A69D 1Z7TA 1ONLA 2JXMB 1E2VA 2ZT9C 4JBWA 1SMYC 1OXXK 3L7ZC 1OXUA 3BG3A 4G7HC 1O7LA 4DK1A 1CFMA 3T53B 1H9SB 1A6XA
chains in the Genus database with same CATH superfamily
4MS2A 3DUZA 4L5TA 3SYAA 1HNZL 5AN9A 1F4MA 3OE7G 4DV0B 4JBMA 4RD0A 1WNSA 1M4VA 4B3XA 2EINB 1OCZC 1S76D 4KV6A 5JJKA 1V8QA 2L55A 1F4NA 4PA3A 2DOGA 3F5TA 1FFXB 4WRDA 4UV9A 4JI1O 1COWG 2Z6KC 4QPKA 4FXDA 4K1XA 2QGQA 4PZ8A 4RD3A 1IL8A 1PV0A 5DECA 3MAQA 2EIJC 4D6TH 3PF5A 4JK1C 2F0MA 2CW0C 4Z4TA 4RD2A 4ZCIA 1FL0A 2C35B 2D9UA 4OXSA 5H6QA 2KEEA 3C1FA 4XQJA 4DV2O 4FVMA 4XLHA 1W2BA 2O5IC 2UXDO 1LACA 1UFIA 2AKWB 1WSRA 1X6OA 2M5SA 3FB8C 1FJGB 2ATWA 1IXBA 1NTMH 3VQWA 1XNRB 1EXMA 1N8RC 3ND9A 3E22B 4Y9UA 4A3BB 2Z8LA 3TEHB 4GOPA 4RCOA 3CE2A 1ILPA 1A32A 1SRUA 2OT2A 4HSPA 3BCFA 4BY7G 2DY1A 5EQ0A 1GM9A 3L74H 3A55A 4LF9O 2KVMA 3SE0A 2QDXA 4FLZA 1YNJD 2A74C 1MKHA 2A68D 3B8MA 1FR3A 3MEFA 3KLSX 3PIO3 2MQHA 1SSOA 3G6BA 3RZDH 2GHYA 2K50A 3HP3A 4BBSB 1G7TA 2QSAA 3I56A 1SDFA 1NJIW 3D26A 1JA1A 2B7CA 1H42A 5JQGB 1UJWB 3JASB 1LUZA 2FMLA 4NXMB 2PZWA 4FMTA 4JI8Q 3C46A 1EY8A 2N78A 4YCUA 1YNJC 5KNCA 4LF4O 2F66C 3N2KB 3K58A 1F7YA 1I4RA 2EY5A 5IGFA 3FEWX 2XZOA 5LHIA 5IYBG 1JWMD 3C3LA 3P26A 4XOPA 5D14A 1EP2B 2I07B 2UU9L 4AYBG 1VMGA 4DR6B 1ZUNB 2O5JC 1C9OA 1TWAH 4QF4A 4LF4L 3B8NA 1N36Q 4A3CH 3N6RA 4B44A 1R73A 4P12A 4RD4A 3W2GA 5LMNW 4FLTA 3CCJB 4O2BA 2O57A 5B1BB 3AG3C 4X89A 2JJ2A 4H13C 3CB2A 4LFAQ 1X59A 3RD4A 1B8AA 5JAVA 4C3JG 4RGTA 2RQ6A 1GUTA 3CCVA 1Y0RA 3APQA 2JN9A 2RDFA 1F60A 2XZPA 1EZ6A 3CQZB 3BABA 3RWRD 2PYLA 5AJ3Q 5FIUA 1K5SA 3M7MX 4J7JA 3TETA 3CCQV 4I5SA 1X56A 4JI4Q 1ZKOA 4GKJL 4PA6A 1BBUA 2PCFB 3RT3C 3BYYB 2WYRA 3RYHA 1S5ED 4KHPL 1MOFA 1YJWA 1W0KA 4Z4SA 3L9DA 3ETGA 2IW3A 2VY3A 1FPOA 1K97A 2QTLA 4G1BA 1AROP 1BCPC 1VQKV 4DAYA 3OIQA 1YJ9B 4TV8A 4WFN3 3J80E 4A3EB 3JASA 3KCYA 1EQQA 4MVMA 4X06A 1PNMA 2OCCB 3HKDA 4FLYA 2JA6G 4H02A 1K3RA 1DOMA 3S14H 5BXZA 4DQKA 5LMUQ 3ZMTA 1S5LZ 1KUQA 1OXUA 3J81E 1Q3EA 3CEIA 4MTNA 5CGKA 1GM5A 4OWWB 1N32L 2RF4A 5FJ8H 4IIJA 2B2VC 3E9HA 3M3YB 4C3IB 1SFOB 1HZEA 3AVTA 2F0WA 1HRJA 3RY8A 1ICWA 3JATB 3NXSA 4GX5A 3A8KA 1GHJA 1PRTD 2KOLA 2L1BA 1W59A 3ERSX 4B3GA 1J5EL 2JA7G 1DONA 3PO3H 1Y76B 4OX9B 5LBQA 3ETDA 1IBLB 1SLJA 3FPPA 3AK1A 3EROA 2NYZD 4QCLA 2ZIMA 2YWGA 3L3OC 4EQPA 2HCCA 2Z9HA 2PNRC 2UXBO 1VQNV 5IYDO 1EFID 2B63B 2NZHA 4YJ3B 3L71H 4ZI7B 5B6IA 2PI4A 1N32B 2IM9A 1BO0A 1TWCB 2EXZA 4QMGA 2E2JH 1TWAB 2ASBA 4R71A 4WFFA 3W7SA 1A2UA 2OBSA 2JA5H 3FKIH 1EFCA 2L11A 2NN6I 1VARA 2DQ0A 2X6CA 1SXTA 1Q3LA 2EJMA 2RVLA 5A2QE 5EBDA 4UZFA 4ZBMA 1FXVA 1F9RA 1RF2D 3B6YA 3TN2A 3D36A 3Q6SA 4X66B 4I4TA 3CMAV 1IKLA 1KTVA 4X1IA 3BZDB 3W1GA 2UXCL 2ZZQA 1GO3E 4BS9A 1FXHA 3ZMZA 3A35A 3LGJA 4A3MG 4UVBA 1WTHD 3QB3A 2J7KA 3VA5A 1MABA 5IT9c 3R6JA 1SNQA 4A93B 2VNUD 1Z6HA 1AI6A 2Q73A 2QM4A 4IL6Z 5GV7A 3PA2A 3CP1A 3AVXA 2AGAA 2WV6D 3RFRA 2CH4W 4B7EA 4TMXA 3GV6A 4M4SA 4XMYA 2WZNA 2JEXA 2LFNA 3R2IA 4LFAL 1ZM4A 3IJ4A 4AQYL 3U58A 3KYHC 4M0LA 3G7LA 2QEXA 3VYSA 4JI5L 2GN5A 2HD3A 2ILMA 2JK8A 4X1YA 3OFNA 3AEVA 2CBXA 2YWFA 3MXGA 2DOSA 1HP8A 1IBMB 4DV2L 3JSLA 2IW5A 1XWEA 4B3TO 2P7TC 1SZTA 2B2TC 5LYJA 4DGZA 1VQIA 4LUZA 1KK2A 2P5OA 2MO0A 2E5LB 3L0OA 3E8BA 2WKCA 4M1UB 4LFCQ 2GQFA 4OGQC 1WJJA 1QZGA 3FYIB 1HDJA 4IYHA 5EBMC 1X54A 2C9OA 2ZJPA 4KUMA 3QE2A 3ZZTA 1KD1D 1K8OA 3ZN0A 3JD2A 3CC2B 3HOWB 3B8HA 1XTDA 5KX5A 3ULPA 1KC8C 4FF1A 5LMNO 2W6JA 2L5TA 1VQ7B 2OTJA 1CP9A 3F7YC 4C43A 3H09A 3A7AB 2UXDB 1Z5VA 4DR3B 1Y67A 1YNND 4LNUB 4DV2B 1L2FA 3V76A 2XNAC 3ASPA 5BR8L 2N04A 3EVKA 1HVXA 3HOVH 3HKZB 2BN4A 3T1YQ 2OCCC 3FJOA 4QUZA 4LF7L 4TV9B 4BA2I 4X62Q 5HFLA 1WCMH 3CB4A 2D0OA 3GTGH 2D2CC 4CS4A 4BY7B 1GJXA 2P6JA 2ZTEA 4ACBA 4G57A 1GO2A 1AJNA 1BCPF 4LFCL 4AI8A 3I56B 1GKHA 4J10A 1TVCA 2BM0A 1UD3A 1E64A 4RAUC 1FGUA 1HTLD 3NPPA 4CH4A 3IFXA 1PH2A 4DFAA 1OXVA 4IUPA 1VQLA 5C4ZA 2CKZB 4HR7B 3WNBA 3RN2A 5EKLA 3ABKB 3D6CA 4LF9B 3HOUB 2DY8A 1NR2A 2Z5UA 2R6HA 1F51A 1FNCA 3L7ZC 3OE7A 1AJQA 5KAIZ 1B1ZA 4P71A 3C3SA 4MVSA 4ASUA 2F4VQ 2A68C 1ESFA 3DLLA 4JI8O 2L15A 4F6RA 2A69C 5K36H 2E1RA 2LW7A 4LBEC 5E79Z 1IJEA 3CCRB 2PQAB 1P84F 4ILWA 5J2UA 4JAAA 5LGUA 3SLNA 5IY5B 5THXA 1U2RA 4JYAB 3H0GB 3AVYA 1DDGA 3T1YL 4WCEV 4CH5A 2VNHA 1XBLA 3BVGA 4JYAQ 3LDCA 3HOWG 2KECA 4BIZA 1DK1A 1HNZB 2VJJA 3DDYA 4AH6A 3J81i 4LF8L 5G3LD 3AVWA 3H15A 2D3LA 1VQ4B 4U3JB 2PI5A 4X64L 4DYLA 2I0QA 1A3VA 3CXCU 5DS0A 2GBOA 2WA4A 1R4PB 1IX9A 1QUQB 4A3JB 3KF8B 1KABA 3RYHB 3T4DA 5FO7B 4DF7A 4J15A 1C0AA 4ZKBB 1PH5A 2EOTA 1T5XD 4X64O 3E89A 1JJCB 2B2UA 4X3TA 2ZBVA 5H59A 1EOVA 1L0LH 2JJ1G 1QCEA 2E1BA 2EZVA 5GW7A 1TY0A 2R9VA 3A3BA 1H8EG 2XAQA 4XONA 2PQEA 2SOBA 3CD6V 2L4NA 2G38A 3ONAB 4C3JH 4ZUJA 3RLOA 3MWYW 4JG2A 4GKKQ 3HKDB 1L1OA 3S24A 3MXNA 4A5UB 3M3YH 4O4IB 2VBUA 1DCZA 5LOVA 1TUIA 1Q86C 3JU4A 1CKMA 1J5EO 4DAVA 2K5WA 5KYIA 1OB2A 4O4LA 5HURA 4MTXA 1U96A 2F1MA 2PMDA 2ZJRA 4G1VA 4X07A 2RCNA 5LMZA 3ABMC 5FNZA 4F6RB 4F7XA 3HKZE 1GAWA 1B3AA 3JD4A 1VQLV 3GTMB 1HZ9A 3BCDA 1PNLA 3BY2A 2XOKG 4Z4UA 5JCOA 3WNCA 3PQIA 1ENVA 3T1HL 5B1AC 2BH2A 3PO3B 4MVRA 1HA6A 1YIJA 3MCAA 3OZUA 1J9ZA 2A79B 4B3SB 4RMFA 5KMGA 1VIBA 1XHXA 2BV3A 3UDXA 4DV5B 2E2HB 1BNZA 2D74A 1SE4A 3CPWU 1CKNB 2ZINA 2ZL7A 2UXCO 3M4YA 2OF1A 2YS8A 3T1CA 4IUQA 3FB6C 3F2BA 4GKJQ 4NTXA 3AK3A 4GZYC 3SYOA 4YY3O 4IGGA 4FF2A 4W4KA 3WWVA 3HOYB 2VWKA 1TR5A 3GD7A 1GN2A 4A3FG 3CJHA 1FKAO 3ZMUA 2UU9B 3H3VI 2YI9A 3RW0A 5LHY1 4OO1H 4KHVA 2NVQB 4OL7A 2L0CA 2WKDA 4O2DA 3OMCA 5ELDA 3QR8A 3Q23A 3CCMA 3S9WA 4I4TB 4DNTB 4NPSA 1XMQO 4X9QA 4AQYO 1CA5A 1RPOA 3ZRVA 4FJCC 3SYQA 1B9NA 2K33A 3U0ZA 1O78A 3UE0A 2Q0AA 1J8IA 2X53S 4YWLA 1BF4A 1K7DA 4X3UA 1IZ3A 3ZBUA 1ZYRC 4CDEC 3AGPA 2KCCA 4DW0A 2XSCA 4RAIA 1U4LA 2CCZA 4GOPC 2CC2A 4RO2A 4WFBV 4B3TB 1W34A 1JB7A 3A8JA 2VB2X 1YHQV 2V7QG 2GV9A 3W2IA 5KIXA 5KHJA 1FVIA 4O4HB 1BR9A 3J7A5 4DR7Q 1SNMA 3RYFB 5KSWB 4X65O 3ZIAA 1SYDA 4WZKA 2A69D 3T13A 3HOXG 2V7QA 1Y0YA 2QWRB 3G05A 3WBJA 1SE2A 1Z47A 1SYGA 1WTHA 2M9VA 2OXPA 3E9IA 4JBWA 5M3MB 3D4WA 4H44B 5LMNL 2F4NA 1BQEA 4DV6O 2JA8B 2HDNB 1TIID 1AP6A 5H5JA 2OEOA 4UZUA 3RLFA 3DMUA 5E4XA 1E3PA 1GM8A 3LO8A 1W2BU 4FFKA 1II3A 1K8MA 3VA7A 4HBNA 3ONUA 1I4QA 2K7VA 2WJVA 1MGSA 1BMFG 3ZHRA 3QFCA 4OOVA 2SEBD 2UUCQ 2MPMA 5CR3A 2YEVA 5IYBH 4UZEA 3CRKC 1XPUA 4LFCB 3ZRXA 4DQLA 1EUJA 3HEJA 4H0LC 2E5LQ 4BAYA 3K5LA 4X3SA 4ASUG 3JYCA 3HOVB 3UDFA 3GTOH 4LBYA 1CSQA 3GTLB 4PELA 1OB5A 3FPKA 3BVZA 1LR1A 3C3TA 4II3A 4JV5O 4J0QA 4KK7A 4ID6A 4JI2L 4YHHQ 3BY6A 4A3MH 4B3MQ 3ZC3A 4PD4F 3ZRWA 2PYJA 4OGQB 3BEHA 3CCUA 3AG1C 2E2DC 3CC7A 2W6IA 3ONYA 4U9UA 1SMYD 1ZM3A 1HWYA 1MSDA 1T5EA 4MTFA 1K73W 4F4LA 4FM2A 1VQJA 2VZAA 5D3DA 2Q2HA 2FTKA 3IL8A 1TQOA 3CKIB 3M85A 4A3BH 1QNUA 4CC5A 3QFSA 3FKIG 1VHOA 4JVZA 2VL6A 2HHHO 2UU9Q 3NXWA 1BQ0A 1YI2V 3N2GA 5IDJA 1NH2B 3QO7A 2EIMB 1F2LA 1S5BD 1OV9A 2V4DA 1H9JA 1SESA 3RYFA 1PYBA 1EY7A 2ZR3A 3JAWA 5T1IA 4HIZA 4JGSA 4TT3A 5FO1A 1PFSA 3JAKB 4RD1A 2UUBB 4MVOA 5EC1C 5I6YA 2RHQB 1I7FA 1GN3A 3JSNA 4KL1A 2EIMC 1V54C 1UMKA 3CSXA 3BVOA 4DV0O 3SLDA 1U0LA 2B8GA 2R93G 5HFMA 2F93B 1G8MA 1MZEA 1H8EA 1HXYD 2Q8RE 4POFA 1BHBA 1N34Q 3A5ZB 1MG1A 4PDMA 1CM9A 3K80C 1EU3A 3PV0A 3VDYA 3SJPA 5JPNC 4GQNA 1K0RA 1R9TH 1P4RA 5JJNB 4AHCA 3ZJZA 3T2MA 4JW0A 3OAAA 1VQMA 4GYCB 1D6EC 3HG9A 3G71A 2C2AA 3CC7V 4JI0Q 2HQLA 3MA2B 2KA7A 1US6A 1Y14B 3RBZA 1Q81W 1EY0A 1NU1H 5DAUA 2W6JG 2R7ZB 4Z1VA 2JA8H 1PTOD 5FNVA 4BWGB 3B78A 3CRZA 4F6EA 1PXUA 4DXFA 2EZOA 3LSSA 2KG7B 3BA9A 4NNJA 1FNVA 1OO9B 5TRDA 4K8IA 1G6ZA 3SK8A 3LX0A 1IBMQ 3S15B 3OKXA 4L87A 4KKTA 1EYDA 5LHGA 2R6GA 3J80i 2ZDIA 1LTRD 4Z1MA 2D62A 5LHHA 4G5GA 2F0DA 1LUWA 4MN3A 4LF5O 1VQ6A 3M4OB 1XPRA 1JB9A 1RKNA 3PIPA 3D4RA 1Q7YW 2VNJA 5KW9A 1VQKA 1GKFA 3ZMSA 1LTLA 3CRLC 3I90A 1WTRA 4JBKA 1TS2A 4KJOA 2K75A 1QVFA 2XGTA 1G91A 2R92H 3BFRA 1VQOB 1LABA 1ENFA 4IFDI 4K5XA 3B82A 3TXSA 2JVDA 2ADPA 4PDVA 1M90C 3I7FA 3MHPA 4K2KA 4EFBA 3CU7A 4DUYB 3I73A 4LBVA 3G71V 4RWSC 1AR4A 1HNWQ 4P22A 2B2YA 1DLBA 5C4JB 5EPKA 4LUVA 2WAQG 1VQPB 3U4VA 1G2TA 3W7TA 1ENAA 3NTHA 5CV5A 2YSUB 4L5SA 3GVMA 2XASA 1JMKC 5B66Z 1PFBA 4XQNA 1M9NA 1LUVA 1SMYC 4NYKA 4WBNB 1D5MC 5C44G 5H9CA 3J80c 4G7HC 4J9YB 5B5EZ 5KX5B 1YTFB 1SJED 1CFMA 3ES9A 1JWUD 2JRIA 3G4SA 1HZCA 4LF9Q 1CKNA 1I3QH 1G7SA 1BDOA 5BN3A 4DV1B 4X1YB 2GK7A 3CCEA 2K01A 2UUBQ 4H33A 2QTZA 4QUFA 5M5XB 1Y1WH 4R9WA 4P30A 1SA0B 3IC9A 4L8JA 3QOJA 1IBLQ 2ZXPA 4B3ML 4JI8L 1VQNA 5LL6X 3ZS8C 3K0YA 3OW7A 2B2YC 2C77A 1Q6IA 2E75C 2HMAA 3OMAB 1P8LA 1BQZA 1N06A 1NDHA 2QEJC 2F52A 3KFUA 4G6IA 2ZTCA 2BSKA 3ASNC 3FB5C 4L5RC 2H1EA 3IAYA 1X3GA 1XDCA 4RKLA 2K32A 3VR4A 1XPOA 3L2PA 3HPLC 1RM1B 1KK0A 4X20B 2BE5D 5DM63 4HYOA 1V9PA 4A3LG 4LP8A 1N4CA 4AILC 1KKDA 1I4HA 3NTIA 4LF8O 1VQLB 1RQPA 3CCLB 3Q38A 1SROA 2K5QA 3PUZA 2FYUH 4DV7B 1QILA 1NB9A 3BRCA 4YIOA 3A3GA 4YHBA 4DV2Q 2ZDIC 3AB9A 4A3CG 1A63A 1WA8B 4I7AA 5J22A 3I2ZA 4XYOA 4OPSA 3FAVA 4BIOA 4RKBA 3CPWA 1SKQA 4KKSA 3ASRA 3M99B 4G28B 1MSWD 1FNWA 3AFPA 3J81L 2BE5C 1GN6A 2YIDA 3HS0C 2SNSA 5IYPA 2QM7A 1IBKB 1QE6A 5IY0A 5IJ0B 2F43G 2PMZE 5KLVH 4A3JH 4KXRA 2UUAL 2QA4A 4KN4C 5CMDA 3A8IE 4DR1L 1GH6A 1SM4A 3AVUA 2AHOB 5IYNA 2NTTA 1ZWIC 2A5HA 4O2AB 5K1PA 1FJGQ 3JD0A 4A3GB 1WTOA 1XOUA 3CHBD 2UXCB 3GVJA 4IHJA 2CTWA 1QB5D 2XNDG 3FX7A 1PFMA 1HNWL 1Q82D 4KJNA 1GXDC 1WB7A 1D8LA 3ZUGA 4LF7B 4UAIA 4C3IG 3ZHSA 1HFGA 4L5QA 5C3WA 5ELOA 2JA6H 2HG5C 3UKMA 4PA4A 3T1HO 2B8FA 4PAAA 1STGA 4JMQA 4KY5A 5I2XA 1OGJA 2O4XA 3MVVA 5CBAE 1GR1A 1DD2A 2YXHA 1KP2A 2EJ7A 3HOVG 1AB3A 2CQOA 1DGSA 3ZBTA 2DW4A 3OWFA 4PC3A 5DNFA 2CVRA 3GTJB 2MGSA 5KAFZ 1KZLA 1Q8KA 2IJ0A 1BBXC 2GK6A 5CV6A 5IGCA 5JVDA 2VNIA 1QNMA 3ICXA 1QG0A 4OX9L 2LY7A 3K0DA 4LFAO 4ZAIA 2P3MA 5I6WA 3CXCA 2C4UA 3RZDB 3ZEDA 3ZCCA 4Q5VA 2CUGA 2Y0IA 1Q90D 4YHHB 2XAFA 4B3MB 1BJKA 4YAFA 3LVBA 4Z4VA 3ZPNA 1PH9A 4Y7NH 3ABMB 2WLMA 4J1MA 1E2WA 5IOCA 4MW3A 3J7AV 3GTKB 3D3RA 2F0TA 3TS0A 3CRAA 3TQYA 3F1ZA 2OIGA 2E74C 4I9QA 4PABA 2L12A 1JOKA 3JAML 4HNAA 1QOHA 1UD6A 1EN5A 4TQUS 4CDFC 2QKSA 1GUSA 1S4ZA 2RNBA 4RFBA 4AYBE 1V55B 2WLIA 3FFQA 5KEEA 5JEAG 3IFTA 1NJIC 4X66L 2UXDL 3QTCA 3U50C 1AP0A 1L1OB 2QWQB 1TWFB 3OZWA 3CPXA 4ZCMA 1NCVA 1Z7TA 3KJOA 3ZZ0A 5CBEE 1E2VA 3FB7C 4CDCC 1K34A 1PKXA 1B7YB 1SQQH 1SC5B 3BG3A 2F0PA 5LMUB 1WPCA 1ZTEA 1OCOB 2DYSB 3AVVA 2CFMA 2IJKA 1S72V 2NZ1D 4G4KA 1O9HA 5C3EG 1PRTC 1CZWA 4C2MH 1N33B 3F2DA 1WP6A 3CCMB 3D4DA 3I4MG 1ENCA 4WFAV 1I8DA 2BF4A 4G7ZC 2VUMG 4TSFG 5AJ3L 4JI0O 4GLXA 3ZHTA 1GUNA 3OUFA 1AJPA 2Q6IA 2MO1A 2CK3G 4C3HH 3ABLB 5K1XA 1YI2A 1QUFA 5LGNA 3W2EA 1AIPA 2PZUA 1D2BA 4UXNA 4YJ2B 2A73B 2KCTA 1WTPA 2ZXHA 4OEMB 4DV7Q 1NBWA 4P75A 3H1IH 1QGAA 4A3GG 1ICFB 3WFVA 1K83B 2K1BA 1YEWA 1JR9A 5GAGC 4JYYA 2BGJA 1VF5C 2G9HD 1N33L 4FFBB 3NE5B 1K73C 5EYPB 4X88A 1D2DA 1N08A 2HR3A 4XDXA 3LWEA 4XQFA 1TWHH 3OSOA 4JI1Q 3M7GA 4DAYB 5IJ9B 1EN4A 1MJCA 1YJNA 2WLIB 4CKEA 1GUWA 3KEWA 1N33O 1H95A 3D8GA 1M5IA 2A8VA 3G6JB 3E20A 2F0JA 5LMNQ 1O80A 2X0KA 4NXML 4FF4A 1FNUA 3MFGA 1KRTA 3GTOB 4OOXA 1PRTB 2CTRA 3RYCA 2Y0SE 2YIBD 4Q20A 1YJWV 3P75A 1ZX3A 1X4TA 2WP8J 2CWPA 1XYIA 2DNEA 4OPHA 1VHEA 1SAPA 1CNFA 3AK2A 2B63H 3AEIA 1CQVA 1K28D 3HZXA 2FVGA 1WI5A 2QDOA 3PUMA 2SDFA 3NSWA 3TJTA 1PTOB 3K9SA 3JARB 3L72H 4KHPO 2ADQB 4O4HA 2VRZA 4WJWA 2VQEQ 4LAAA 1DG1G 1I6HB 1N8RD 1VQ8A 3OJWA 3K06A 4Y7NB 3J80L 2KCMA 4KHPQ 1WP8A 1Y76A 4PDLA 1C4QA 4DXGA 1JX9A 2YWHA 4JI7Q 4KMUC 2RC5A 4DV7L 3CHXA 1E22A 1VLOA 4ZHQB 1KL9A 4CJ0B 3J81c 2OYNA 2FINB 4B3TQ 3ASTA 2KB1A 2I1LA 2NVYB 2YTXA 2L6LA 2HLDA 2F0QA 3GTKH 3AG2C 4GOPB 3X2QC 1HR0L 4QIWE 1N36B 2QEXV 2OQ0A 4N21A 4PZ7A 4B3RL 1IBLO 4E2LA 1TY2A 3SYCA 1CQFA 3JD1A 1QCBD 3NK9A 1JJOA 4LWSB 2JA7B 2EJFC 5ELCA 4G7OC 1WFQA 3VO2A 3EN2A 5IK2A 2QTOA 3LDDA 2JQOA 2ZM6L 1I18A 1E79G 4YXWA 4LMQD 4HE6A 2MW2B 1SE8A 3T1YB 1EYCA 3LNNA 4ZLTF 1H2GA 3SVMA 5C4JH 4CKCA 4N3GA 5GADC 1KK1A 1W87A 3BDOA 3D6WA 3JAME 5IT9N 2FXQA 2R70A 3CPWB 2GUZB 3A56A 1OCRB 3L75H 4FXUA 4HJ5A 4Z4YA 1PH1A 4JI7L 1HNZQ 3PUNA 2AW9A 1EM1A 1I94B 1RM1C 3RYCB 2CNDA 3BC9A 3CMMA 1PP9H 1ROPA 1P4MA 1RQRA 2A6HD 1YVWA 1BBWA 3H3VC 4DR5Q 2NVXB 3K7UC 2VQEL 2CRVA 3S3XA 3UQ8A 5IWAO 1XREA 2R61A 5F4JA 1JJ2B 4MT8A 4CJ1B 2PY5A 4OHJA 1Q86W 3NHHA 5KUKA 2A7WA 5AG2A 4X7DA 2ZTGA 4YAOA 3GP7A 4KLKA 4O2AA 2CE4A 1SKYB 3JALA 1XQ8A 4P2ZA 1O7ZA 1UEBA 1CA6A 1OTCA 2ZT9C 1LYLA 2Q2IA 1RCVD 2XN9C 1DOLA 3D3IA 1KAWA 3STBC 3S1QB 3DWAA 3KJPA 4GUNA 3WBKA 5J3BA 3T53B 5C0XH 1KC8D 4F87A 1KBHA 1F9PA 4FNFA 4OX9O 3VMFA 4IPGA 4IZ8A 5H1SE 1MZFA 1VEWA 5LP6B 1NT2B 4BWAA 2D2CB 1CHPD 1DYQA 1G2SA 1PZKD 2WAQE 2Z4HA 3IKJA 3KLSA 1WPXA 4G2KA 4II2A 3OTOQ 3I4NH 3B09A 1EL0A 2GDSA 3GTPB 3A8TA 4Q0FA 2F0KA 1VQ6V 3I3CA 3NBHA 3HKSA 1I94O 2KHSA 2YTYA 4I0XA 1WP7A 2C4TA 5CV4A 1FD9A 2B1GA 2WLKA 4J7KA 1IW7D 3APOA 3F2UA 1AVMA 3CQZH 4OXPA 4LH7A 3WB1A 3CXCB 4FWTA 1F2YA 2X6BA 1LT6D 3VR5A 1I94Q 1E1QG 3OW2U 2LO1A 4DV4L 3E35A 4QNHB 2OCEA 2B2VA 4C3JB 2VUMH 4NR1A 2Q9LA 4K5WA 1JQYD 2AUKA 2N05A 3WQZA 1PD3A 4K6DA 5B3SB 1YNNC 2VQFL 3QVNA 4OELB 3SK6A 4TUYB 4MW8A 5JWPA 2BM1A 4CC6A 4G7WA 4MTKA 2NN4A 3H01A 4DV6L 3CD6B 2WIIB 4JV5B 4LFAB 3M4QA 4V190 3TZDA 2R92G 4GKKB 2RCVA 3OFNG 1A8PA 3P30A 3AG3B 2VQFO 3R6KA 1EWCA 1XTCD 4LFBL 1P16A 5DN6G 1PH4A 3WG7C 3WXMA 1IJFA 3GTLH 3X2QB 4DR4L 3S1MH 5M3FB 4DU9A 3Q39A 1IXRA 1R4QB 1LO5D 4F8MA 3UCSC 5JEAH 3RYIB 3ZZUA 1XMQQ 4IPCA 4DR6Q 5GTIZ 4RD6A 2E76B 4X05A 1Q1BA 3ABUA 4PNYA 1KRHA 4CKBA 4GNXC 1X3QA 1HHVA 1FGBD 1H2NA 1EFUA 2B2TA 4KHZA 5BN4A 4A3KG 1QGYA 1LT3D 5D5QA 2VJIA 3W7WA 4DR1O 4E0FA 1THZA 4MNOA 4TVAB 4DXWA 1Q5OA 3SYPA 1A0IA 4R6ZA 5I4DA 4H13B 5KHIA 1ILQA 2BGIA 3NR7A 4DR3O 2ZITA 1VQ5A 5JBQA 1PTOF 3D0FA 5IGBA 4CS2A 1F9QA 1QVGA 2DIEA 5CV9A 4YAUA 3QG5A 4K8JA 4HJ8A 2XAHA 2ZQMA 2B1IA 4DUZO 2LFSA 4N23A 1R6KA 4NXMO 4RDLA 4DAMA 4BR6A 1RSOA 2EZPA 4GX2A 4GKJO 5HXBA 4HCEA 4IN3A 4J6HA 3WG7B 1SQFA 1S77D 4FFBA 1EP1B 1EIHA 1YIJV 5J2TB 3PN1A 4UCSA 3CMAA 1MA1A 1VP7A 1N34L 3S1MB 3I4NB 4X6AH 1N32Q 1UD2A 2K14A 4BY1H 4UB8Z 3QFRA 4H9GA 2XAJA 4C0SA 3UDIA 5BSXA 4DR6L 2JK5C 2B5OA 3FKIB 3LWUA 3I70A 5IYQA 4NXNQ 1WD0A 2IHFA 1GK9A 3S17B 2A3QA 1B50A 3H1LH 2QWNB 4GCZA 1SS3A 4GN4B 1A15A 2TMPA 3I8ZA 4A93G 3KKYA 4NKGB 2XGJA 2YV5A 4DR5O 5EIBD 1BPLA 5KA6A 2GJPA 3WNDA 2PZTA 3DM3A 4EQ5A 3EIVA 5DEHA 2ZZGA 2LGWA 2HJFC 1B06A 3U10A 1IB0A 2XNCA 3CRQA 2RHSB 3PSIA 4R8NA 4DK3C 1I0HA 3RR5A 2IU0A 4DKAC 5F2VO 4EB6A 4WORA 1XJVA 2Y4TA 2Z0SA 2P90A 1HQRD 2IJJA 2ODMA 1G6PA 4L6TB 2O2LD 4IJLA 1O7LA 2Q68A 1SF9A 2EYFA 2N8NA 2C5BA 1PZJD 1FXKA 2ZIOA 4ZHQA 2EIXA 3ITPA 1A6XA 1NH2D 1VQ7A 2WSSA 4TSFA 1PL4A 1I50H 2HCIA 3ICEA 1H8HG 1Q82W 2EPBA 2X85A 1PJ6A 3P3NA 4ZRZA 5M5XH 3ZBHA 5JCOC 1IW7C 4AYBB 4DV3Q 3MD0A 3UO3A 1S5JA 1DTOA 2WPDA 1VQ6B 5KUMA 2KQ3A 1TKWB 3CJHB 1ASYA 3PENA 2KHIA 2JJ1A 4DV0Q 3GO5A 2QR4A 3TS2A 1SJHD 4BXXH 2VNKA 5IP7H 3HOYG 1YJWB 4QV2A 5JJLA 1QFYA 2UXXA 4AVZA 2IU3A 3BU2A 5I2YA 4DR2Q 2Q7EA 4QVJA 5IWAB 1FXKC 4JI0L 2ZL5A 5K5PA 3M8AA 3FYEB 2GUZA 3WB0A 3BAAA 1D5AA 3UO2A 1E3ZA 2AHZA 3QWNA 4QGUA 3H1HH 2JDIG 4QL5A 2DEUA 4HMIA 3GSIA 1R6NA 2N88A 4DUYL 4ZYSA 4KY7A 4PA9A 4C1NK 2N74A 1CTMA 4GN3B 4QVAA 4DR7B 5NUCA 5IODA 1Q7YC 4YELA 5JJIA 1XI1A 1NJID 2B2UC 4PV1C 1XMOL 2QN6A 2XTAA 3BNWA 3KK7A 3U6BA 1VCIA 2F0GA 3KUPA 1DARA 1E1QA 2BMWA 2LXKA 5J39A 2EYOA 1L8DA 1FRNA 1ZM9A 3ND8A 4FK5C 1IYUA 3CCUV 5J2UB 2LKVA 4CDDC 5E4WC 2GTSA 1NRKA 2QTSA 1MSHA 2MUYA 3K6OA 1GTOA 1VQPV 1N36O 1S5FD 2B3GA 4X64Q 4NXNB 3Q22A 3QSYA 2EJRA 2IL8A 2AQ1B 5M3MG 2FB5A 1HR0Q 2FX3A 1SFOH 1GOZA 1GHKA 3LQ6A 2B2WA 5JVG3 1K9MW 1S72B 4ZOLB 1E1RA 1VQ4A 2V7TA 4JZGA 5C3EB 4X62B 2NN6G 3TGUH 2NVYH 4KY6A 4HJ9A 1SQXH 2YEVB 4O1NA 3KF8A 4DR2O 2Z3YA 1SERA 4B4DA 2EYPA 3E0EA 5IP9H 1E1RG 4PC2A 1PTOC 3JQRA 5BN5A 3OMIB 1HNXB 2Z6BD 3CWBH 2PNHA 4QFMA 4NDXA 4GNXB 4DNIA 2F23A 2LW1A 2F4VL 3ZHQA 3PF4A 5D5PA 4AQYB 5E7NA 4OPOA 1I5YA 5AFWA 2WFWA 4OPVA 2KJXA 1YJNB 5C44H 4HJ7A 4JI6L 3S15H 4P9SA 2LZJA 3RVZA 4IIJB 1WOSA 2WB1E 3SEBA 5KNDA 1EY4A 5IYCH 1KJZA 2BA1A 5LOVB 1IBLL 1JPXA 3TP6A 4JI6O 1SKVA 4YJ2A 2E75B 4K6LA 1SQVH 2VBVA 1VQDA 2ZKOA 5B1OA 3CCLV 1ZL8B 4PJ0Z 2ZTNA 3J7AF 2ZZFA 1BOSA 1KDBA 2EFGA 4DV4O 4JYCA 4JI1L 1CXZB 3PGZA 3HKEB 2FKXA 1EWYA 2R72A 1O9GA 1PJ5A 1BUVT 2CGNA 5E1FA 5HY6A 3R93A 4QIWF 4YJ3A 2F0NA 3OEHG 1BVSA 2OK7A 1RDPD 3BA8A 2V1CC 5E3FA 1HNXQ 2HDMA 4WF9V 2LQTA 1IZ6A 2BOSA 3DSQA 1OB0A 1BT8A 3VR6A 2F0OA 1L0NH 2VXWA 5LYJB 2OTLA 1KQSA 4RDKA 2CTQA 3ETEA 2HP8A 4QPJA 3K5MA 1WOOA 1WSVA 4C7UA 3FD9A 2JGDA 1HJPA 2KENA 1HNWO 1URFA 4DR2B 3QNEA 4OIKA 2GTAA 4ZOLA 4HTHA 4UUJC 4CGYB 4A3KB 3KF6A 4I50B 2YDEA 4NTYA 1VF6C 4X1IB 1VQMB 5IYRA 5FO8B 1S0UA 1Q8IA 3C90A 1VQEA 4JI4L 4IFDH 4B08A 2QCPX 2NLJC 4FLUA 1N34B 4HIMA 4GNXA 3VR3A 5GAHC 4LNUA 2PZSA 1FRQA 2PPBC 5IP9G 4IUUA 1Y1VH 2XTIA 3STLC 5DM6V 4YEJA 2F0UA 3H91A 1V55C 1IURA 2EDGA 2PO4A 1RSOB 4PC6A 4X65Q 2KHJA 1FJGL 2Q8VA 3W3AA 1QU7A 4CJ2C 1B44D 5B1NA 1M4UA 4FZ0A 1SQBH 3E3XA 5LL6S 2DYIA 2Q6KA 4P2CB 3GVLA 3Q6QA 4TKOB 4FYDA 3OOCA 1A8VA 2WA3A 1VS0A 3F8TA 4GT1A 2QE7G 4QGPA 3QG1A 3ASOB 4XN0A 1GJRA 3HKZG 4ULLA 1EYAA 4EQOA 5JVH3 3QO5A 1ZYRD 4FP5D 4RPBA 1LV9A 3KG2A 4MTOA 1XB2A 2EIKC 1S5HC 2EIJB 3SPCA 4NCNA 1DXMA 3DXJC 3T1HQ 4YALA 1K92A 2HT1A 5FOBB 1KK3A 4KFMA 1PNKA 4P9OA 2EVBA 1EIFA 1YZBA 2KBNA 4UVAA 1VQPA 1KTKA 1XNQO 2JGDB 3IFDA 1CEZA 3T51B 2K28A 3K81C 5KRUA 1AZPA 3OTFA 5C4XG 4EB6B 2PQAA 4R4QA 1J95A 3AG2B 1K4CC 3KLRA 4HAEA 4WBNA 2WAQB 3G80A 5FLMH 4GLAC 4OWXB 1WU8A 1Y1VB 4K2LA 3PIOA 1GO3F 3HOYH 1UE5A 3F5WC 5FPRA 4LBZA 4U7NA 1Y8OB 4JYAL 1SA0A 3Q6RA 2KSDA 3PVDA 1U9RA 4FLVA 5M5YB 4DA2A 1KLUD 2MK3A 1A62A 1QUQA 3MHHC 4D7TA 1UE1A 2JYOA 3KDFA 3RUZA 2DWDC 2XOKA 4A3IG 2IX3A 1VQ9V 1R3IC 3I56V 4LC1A 2NPFA 3C1EA 1QUEA 1KYOF 3G4SV 5IYCO 1YZ6A 1EZ8A 3A54A 4ZCKA 3WDNA 4E6IA 4DR4Q 4OO1G 4WJ4A 1B2TA 5I9PA 1XL4A 3F2CA 1JOQA 1W35A 3CD6A 2ID0A 4FXKC 2RMKB 1PTOH 1XMQL 5IYZA 5EPLA 1AMOA 1IHMA 4U68A 2B63G 4R4IA 4JPRA 1XFOA 1TU2B 2JEBI 3JAWB 1CUKA 3Q24A 3CCRA 4P3IA 3T4ZA 3PUWA 4MZ9A 1CSPA 3RN4A 3ASQA 3GTQB 3JAKA 2J0TD 4MHEA 4X8IA 2X3UA 2H3OA 2XRSD 1NS1A 4F88A 5EMNA 3OUSA 5B1BC 3SPIA 3MTSA 3AU7A 3W7UA 3JCUZ 1R3JC 1JOYA 5CC4A 4B9XA 4EVOA 3KBXA 3I5DA 1HZAA 3QO2A 4MSWC 3EQLC 3TRZA 2BPOA 1GVPA 4QUCA 1TS5A 1JE4A 2ALYB 4MVZA 2J7ZA 2K03A 2UXBQ 2EJGC 4X65L 5TY0A 4DV7O 4H44C 5EBLC 2JIZG 1E79A 1TUBB 3CCVV 2GA4B 3CCJV 1G1XB 2NB0A 2DCUA 3CW2C 1XEQA 4R50A 3HKBB 4X1KA 4KHPB 1A2TA 3T1HB 1IBKL 2ZM6B 1OCZB 3C2PA 5IY5C 1V1OA 3A1PA 4DV5Q 1TWGB 4KTAA 2JXMB 4JI6B 4IHJB 3A8IA 5CB4B 4XLAA 3C2QA 3Q3AA 1AILA 3KCXA 1STNA 1AEXA 5M5WH 4DK1A 1FNDA 2SNMA 2KG7A 5FKAC 4C3HG 1H9SB 4A3EH 3A0JA 3CP8A 1LNQA 1EFWA 5IT9E 3L73H 2K5VA 3PCOB 3CC4V 2CGOA 3GV3A 3CMAB 3QF7A 3U9SA 2C2WA 1HA3A 3SPGA 2OBRA 4XKWA 1XMOQ 1FYCA 1Q82C 1B6QA 5DLQE 2ZBUA 2ZNJA 1OZ0A 1WAZA 3OGIB 5IYZB 4JV5L 1R3KC 2QKAA 3ZHVA 1EIGA 1Q1EA 1Z9FA 2R7ZG 2PTMA 3OEEG 3P27A 4DUYQ 3OTOB 2XHBA 2PLFA 1T9HA 2F0FA 1PYSB 4IUNA 3SGIA 2K4KA 5EPJA 4DV5L 3CCSV 2E76C 1YIJB 3OEEA 3AG4B 3RGBA 1MNGA 4N3NA 4R4TA 3NQIA 5J35A 1H2MA 4QHYA 1IBMO 2I5MX 1NKDA 5GV8A 2IH3C 1KKCA 4IYIA 2QF7A 2XVSA 2DN9A 3NBIA 3T16A 4K8ZA 1W0JG 1AH9A 3HOZG 3BJUA 5CA0B 5HZAA 4OWTB 4B47A 2YC0A 4B7KA 1FFTB 1MABG 2XZLA 4HNAB 1XQBA 2K5DA 2ZXIA 2QMUA 3I4OA 4JBJA 5BZBA 4X3KA 4UFZA 2DYRC 2X7RB 2ZCEA 5IGGA 4DV4B 3HKBA 4X1KB 5CA3A 1ML0D 4GZRB 3S14B 3TMEA 4DV4Q 2EINC 2KUMA 5LMNB 3S16B 1SNPA 5CB4A 2R7DA 2FL4A 4M53A 3KF6B 3MMPA 4JI2B 4A3EG 4BBSH 4LF5L 2EBOA 1V5VA 2CAZC 1D5XC 1I94L 4P6VF 2X6LA 3S1NB 2UXCQ 3HR0A 5L3EA 1E1OA 1H9SA 1M93A 2Z6KA 2KKWA 4NKLA 5GTHZ 1Z2GA 1SNOA 2F0HA 1HH2P 1XUQA 4BPRA 2BSKB 4C3HB 4MIUA 3HB3B 3MHSC 3G48A 1K9MC 4KP4A 4XKVA 5FA6A 1B04A 3OW2A 2EX3A 4JI5O 1FDRA 1IBKQ 1XNQB 1YI2B 3HKCA 4JI5B 4OIJA 1K83H 1YCIA 3IC7A 1EFRA 5TSSA 3CCLA 1MI2A 1K8AD 5CBHA 1D5ZC 1HCZA 5C8YA 3AGQA 2OT5A 5C6AA 2X0LA 5L3FA 4DR2L 5M3FH 1FS0G 2IH1C 3E8FA 4LF9L 4LW1A 1QWYA 4K0KB 1E43A 2YYZA 2X6YA 3PIP3 3S1NH 4JI3B 4XDLA 3B77A 3JCZA 3KZIZ 1V1PA 4MVUA 1KP3A 1I6VC 3VYRA 4A3JG 2MP1A 4JI3Q 2OTLV 4FIPC 1V43A 2AMCB 2ENBA 3R2TA 5IJ0A 1OCCB 4U3FH 1EWIA 1WCMB 2DY7A 2GVBA 3HOZH 2G5DA 3SR1A 5H6RA 5IE9A 2R7FA 2Z4IA 4Z1MG 1YX2A 5BR8O 2BTOA 4JYAO 2RSNA 1NVPD 4K5VA 4BY7H 4UCOA 4P74A 1NAPA 4LF7O 1YITV 4A3GH 4FM0A 2ZM6Q 2IBZH 1AE3A 1TS4A 1MIUA 3ZRWB 3T56B 4F7DA 1NTGA 2Y48A 3H6MA 4UDUC 1EQRA 3OMNB 4FXGC 1KU9A 2A9HA 5D65A 5TR9A 2Q7GA 4LFCO 3BS1A 2EXDA 3GDEA 4IQZA 5FLXL 5IYDH 2AQ3B 3STBD 3HOUH 3SEJA 2R93B 1VQ8B 2EYMA 4XR6A 4JPBW 1MMMA 4EGVA 1M8AA 3OW2B 1W0KG 2WZPP 1OXXK 3MEHA 4A3DB 1UD5A 3PO2G 5B3SC 4P25A 1BSMA 1XX8A 4RUFA 1Z5WA 3DGEA 1FYJA 4YAWA 3SDZA 2GREA 3CC4B 3VQXA 1SR3A 3AG4C 4X7FA 2PMZB 1SEBD 3CP0A 4J8QA 2Q8TA 4XYQA 1XNRL 4LF8B 2FMMA 1TS3A 3STZC 3K08A 1VF6A 2ZE7A 2BDNA 3QOLA 3VBBA 4R4CA 4DR6O 4P73A 2A6ED 1YEZA 1VQKB 4BA1I 2D5DA 5ELBA 4CBVA 1XNRO 2WLJA 4TN1A 4CQJA 1SN8A 3FDTA 1CI3M 4DRXA 1WTVA 4LF6L 4LNQA 2VBSA 1HFNA 2Y4UA 1ORQC 1VQOA 2QDBA 3DWPA 4LF6B 2QE7A 4A3FB 1P7BA 2HCJB 2F03A 5GAEC 1BE3H 2WSSG 2WJYA 5EC2C 2IJHA 4LBWA 1TWCH 3I72A 2E2JB 3OR6C 1B2RA 4TV8B 2JA7H 1SZXA 2NVTH 4R7CA 2YIAA 2MNAA 1KQSB 4QE7A 3I55V 4DV1O 4DR5B 1JVMA 1M90W 1KLGD 2XWBB 4LJZC 4DR3Q 1NE3A 1KQSU 2CF4A 1AP5A 5BY1A 4FLXA 2WACA 4I55B 1ASZA 2OTJV 4I50A 2YUAA 4J9ZB 1R3LC 5FLXc 2YWEA 1BKBA 2CW0D 4B3RO 2KVOA 2QILA 3R3OA 3S1QH 4B3RB 5FLXN 3WY9A 4OO1I 3K0XA 3G4SB 1MRZA 4GKJB 1P7GA 1LM0A 5FO9B 1Y74A 4LCUC 4JI0B 2V7UA 1DJRD 4RA8A 3GWOA 1BZKA 3HRZC 1OJHA 3U4ZA 3HAGA 1VQNB 1WORA 3TSSA 1EY6A 2BTQB 2WLHA 1JWSD 1LTID 1VQMV 3K3WA 2V7VA 3RMHA 2UXBL 2A19A 4DV5O 4PI2A 1WPBA 3A2FA 5JJZA 1RP3B 2B29A 2JA8G 4XN3A 1B4OA 1QG7A 2H5XA 4QJFB 5CBGA 2NNUA 5EKKA 4RCNA 2PE3A 2Q0OC 1IVSA 4PMWA 5C0XG 4O4JA 5H5NA 1YJ9A 2FJ2A 2ZXRA 4UCRA 4YXWG 4X65B 1VJSA 4DRXB 2XRQD 2C5CA 2XIWA 1I3QB 1NI8A 1GAXA 4V0BA 2PF4E 2VUMB 1N0NA 1E2ZA 1HUMA 4XD7A 3DHQA 4RGNA 5IGDA 3H0GG 5C93A 3CCSA 3GTJH 1XMOO 3O13A 3W2FA 5F2DA 3QJYA 1WA8A 3LUTB 1BCCH 1Q46A 1SYBA 3TBIB 4DV6Q 2FHTA 2M2LA 4DV1Q 4LF7Q 2R93H 4E4EA 4J41A 3HFZB 3OP1A 3D31A 4POGA 3CMEV 1NUCA 4HAMA 5LA6A 1H9KA 3E6ZX 1J5EQ 1XL6A 4XORA 1G7RA 5C3XA 1N36L 1L1FA 2VQEB 2F0IA 1EFRG 1ZAUA 2HVJC 5CN0A 1K5QA 1PPJH 1I08A 5JJEB 1XMQB 1VQ5V 1LTSD 1NTKH 3ABTA 3PJSK 2I5HA 1KXLA 1VQHA 3P20A 2Z0AA 3EFXD 1JCHA 3A0HZ 5KA5A 3JARA 4EEQA 3A8KE 4LUOA 4QB4A 5ELNA 5M5WB 4HEDA 4FO2A 2DJGC 1IKMA 1FD7D 4NXNO 3FP9A 4JV5Q 2JS3A 4KI0A 2BTQA 1N33Q 5M3FG 4TQFA 5IT9L 1R5NA 4A75A 1YVCA 2ZTDA 2UUAQ 3WB2A 1NMGA 4DR7L 1K3EA 3W1BA 5A35A 2YXYA 2CTPA 4JI1B 5LGTA 4TWKA 5A2QN 1SQPH 1Y1VG 1GRJA 2IY5B 1Y1WG 3SJCC 2QGNA 1QBZA 5ISRA 4B3FX 1DM0B 1QQCA 2VZLA 3KOJA 4RLZA 1SNDA 1JA8A 3P1HA 4Q7JB 3HKCB 4Z2WA 3ASSA 1M57C 2BE3A 2LP7A 3CRMA 4LFBO 2AWNA 2X69A 4A3IB 3H3VH 1TAEA 1ET9A 1VDZA 1NMFA 3THOA 5FJ8G 4IPHA 4JTAB 1JICA 4R8IA 5JH7B 1QVGU 1CT1D 1RHPA 1EYGA 1GD7A 4EH1A 3UT5A 1K4DC 2HFEC 3U9OA 3ETQA 1EY5A 2P4KA 4BY1B 4XLFA 5IE8A 4LK1C 2OCHA 4Z4WA 5JJJB 2VS1A 3QO8A 2JJQA 3EJIA 1UE6A 1R5OA 3CYOA 4O42A 3X3MA 4LH6A 1LTBD 3VYUA 1JOOA 4XDKA 3V7AA 2EYJA 3S17H 1JJ2A 4JI4B 4P9PA 1TA8A 3OYYA 1E62A 1TWHB 4U7OA 1SRYA 1JJ2U 3E86A 2GVAA 4DK0A 2F43A 1S5DD 4BXXG 4RPDA 4W4LA 2MJ8A 4HIOA 4JI2O 1V0FA 2JEAI 2LXJA 1EWHA 3CMEA 4KD3A 2JP1A 4NP5A 2NTSA 1PRTF 1YXBA 2F0VA 4O2BB 3PUYA 2VWJA 1IBML 3K57A 1K73D 4JI2Q 4M1KA 3CCQA 4IT5A 4LF6Q 4YIPA 1K8AW 1ZM2A 2QA4V 1HNZO 1I4GA 3SJBC 5A2QL 4C56C 4FK8A 3CCVB 1UPGA 2F1LA 4DO2A 2E5LL 2GPJA 2XWJB 3DEPA 2ZD9A 1PH8A 2HHHL 2PYKA 4LC0A 2JA5B 2F95B 2B5UA 2XUMA 2P5ZX 4GKKL 1TGOA 4A4IA 1BX1A 2FFKB 4RM0A 3S2HB 1FXKB 2DE0X 2AWOA 5HZBA 5FPOA 1Y6XA 1ZSPA 2CH7B 2ETNA 2H8PC 4PA7A 2UXNA 2E5LO 2QGGA 4JZ2A 2ZE5A 1A3TA 1TWFH 4CHTB 4A3DG 3DC6A 2EIKB 4C2MB 4C1NI 3W5HA 1C48A 1UE7A 4RDJA 5IYWA 4YWKA 1KIXA 3PO2B 3ZX6A 2X6AA 1Y4MA 5C3EH 3S2DH 3PA1A 2Q4PA 1EOTA 1HR0O 3E1YE 2CHBD 4A93H 3VNUA 1SYEA 4QQBX 3I91A 3A74A 4J80A 4WZTA 4PG3A 1YLOA 1HR0W 2YXLA 1EU4A 1HQMC 3HOUG 4B43A 1BGYH 3V05A 3ZYYX 3OAAG 1ET6A 3GQBA 3CTAA 4IFDG 1IXMA 3SK4A 4BBRB 3CESA 1OXSC 2RDCA 4BY1G 1C7YA 2ZZEA 1L0XB 1STHA 1NVPB 4UP9A 2ATKC 2HLDG 3K04A 3P3PA 3H9NA 1S3JA 1KC8W 1NR4A 1TT2A 1WLEA 2C78A 1I5XA 4L63B 2LMCB 4DR1Q 3ZRSA 3MHBA 1PJ7A 3CP2A 2KQXA 3SDLA 1P49A 5L3CA 1N9WA 2JEUA 2H94A 4FM1A 1ZLZA 3L9AX 4RHRA 5EKIA 4LF5B 3SHLA 2Q5ZA 1H2SB 1S40A 4A3BG 4A3IH 4G27B 2AZ0A 3SK5A 2NVXH 4JI6Q 4K0KL 1YNXA 3MZ5A 4YIJA 5GROA 4B9WA 1EQVA 1JORA 3H1KH 3OPOA 3NP8A 1OHHG 4IW3B 4HSVA 5EZYB 4MVQA 5JOBA 1M56B 2F0EA 1Q7YD 1EEFD 2JJ2G 3I4MH 4WFHA 2K05A 5GQOA 2D3OW 3SXHA 3K0GA 4XOTA 4QY7A 3TK1A 1H2KA 1J9OA 3MXUA 3SKBA 4B3RQ 5C4XB 1LT4D 1U4RA 3CAMA 5F4OA 3DWQA 3AQQA 3RLNA 1HNXO 1E7ZA 2Y0PA 2LGQA 5L3DA 3MC0B 5FO0A 1BX0A 3SPJA 4Z9CB 3OTOL 1K9MD 5D3IB 4UVCA 2NV4A 1F77A 2WINB 4A3KH 4QJFA 4HIDA 1YHQA 1YTFD 2DMXA 2CK3A 1UNSA 4RCZA 3VQYA 1J5EB 2DQ3A 4GN5A 2EY1A 3EBEA 2CWAA 3BDCA 2YIBA 5JQGA 1EFTA 4O4IA 3MXPA 4HZ3A 4P72A 3GTMH 5C5MA 5J2TA 1IYJB 2OTJB 2R9AA 4I65A 4WZLA 4HJAA 5KHGA 4X0CA 1N0UA 3ZIAG 2QM8A 3G67A 4GX0A 1S4MA 4RWUA 2RC6A 4FN5A 5FLMG 5K36G 2P22C 4BBRG 1R6TA 2ICIA 4B3SO 2IHEA 2EYLA 2RN9A 3UI2A 1EBOA 5B1AB 1BCPB 1VQCA 4XQQA 2Y69C 3URYA 3GVKA 1W6KA 4GX1A 1XXGA 3SR2C 5C8YB 3JC66 3K7AB 4B3SQ 3BH4A 3T1YO 1ZL8A 4NW2A 4TMWA 4DR7O 4DUZQ 1I4PA 2C5HA 4Y7CA 4EFEA 5EBWC 2Q2TA 4DV3O 2N49A 3J81j 1V1PB 2WB1G 2UUCO 3VYTA 2AQ2B 4YWMA 2EULA 2BDOA 5KHHA 1E3XA 1D7QA 4DR4O 1G51A 1NQTA 1N32O 1EN6A 1T6YA 2R9IA 4DV3L 4HCSA 3OT7A 5EIBC 3DXRA 3H94A 2DERA 4GLVB 3GTGB 1PDQA 2B9ZA 4AIMA 3K03A 5BMVB 4YHHO 4B3MO 5CA1B 2R3ZA 1X9NA 5FL7A 2ZNIA 1STBA 3BY1A 2VB3X 2DJFC 1XNQQ 2DWEC 3VQVA 5DN6A 5G3LF 5C0XJ 1XMOB 5ITZA 3JAMN 2F0SA 4Y52H 1M1KC 3H1JH 3HOXB 1SBBB 2XNDA 2WLNA 5FL7G 1FX0A 1HZBA 1NZ6A 4YHHL 4I9WA 4DUZB 1Y1WB 1K0SA 4PC1A 3TP7A 3OGCC 3FVQA 3FKSG 2V31A 4IALA 1KECA 4DV6B 1X32A 1G8ZD 3NQTA 4WQMA 5C4XH 4NTWA 1WTXA 1R9TB 3KBGA 2A0LA 5GONA 1D1NA 2UXDQ 3I4MB 1VQ9B 1WOCA 5JEAJ 1M90D 1MHWC 1EY9A 4JOIC 2E3CA 4QIWB 2Q67A 1Y8PB 5ELEA 3G6EB 1HA5A 3TP5A 4R8CA 4ZGNB 2ZXWC 1N34O 3NTKA 1JJGA 4X66Q 2W0FC 4RQEA 1D1KA 2CQAA 3AFQA 3J7ZC 5J9PC 2RQXA 4XBFA 1CZGA 3IGAC 4BW5A 3H0GH 4S3SA 4JI4O 1I5FA 2MFIA 4P3YA 1RFYA 1IHZA 1STAA 3OD4A 3TREA 1KDAA 4YY3L 2F4VB 4H7BA 1D1IA 2OIEA 2HVKC 3RYIA 4FPPA 5L3GA 3NBHB 4N9PA 1YITA 2YICA 4ABMA 1MJEA 1JMCA 3HOZB 4I0XB 3VO1A 1QVCA 1FNBA 4N8X1 3A0RA 4G7XA 2ZT9B 4GKKO 3ULLA 4MYTA 2UUBL 1HNWB 5CA1A 3B2EE 1FJGO 1E1TA 1KHIA 1AI4A 3B4SA 1TLLA 3JAMc 1X55A 4OX9Q 1NNXA 5C0XI 2CW5A 1C8CA 1JT8A 5DSZA 3CCUB 4LF6O 2CH7A 4UY8C 1CNEA 3LQEA 2PGGA 1E0BA 2JA5G 1AFPA 1JQ0A 1PH3A 1JNYA 4PMCA 4XT3B 2HEPA 4TUYA 1CQXA 2BVNA 3W5OA 4LF5Q 4JTDB 3ASOC 1B3QA 4P6YA 1Y74B 3OZVA 2MHVA 1COWA 1KMHA 4Z4RA 5FNVB 5GONB 3N2GB 1J6QA 2NBFA 2Z6BA 3E0JA 3GTPH 4PGOA 3D8CA 1SYFA 4DW1A 5A89A 4YCVA 1SYCA 4ZV4A 1F2ZA 1BMFA 2YTVA 3O9OA 2D9RA 4GS3A 2ZXOA 3PO3G 4K0KQ 1S5CD 2PW5A 3AYHB 2Z1CA 5LA6B 4PV1B 1W9XA 4PZ6A 2Q8IB 4K3AA 4APVA 1VQOV 2EIFA 4K0KO 3TP8A 1RODA 5I9OA 4J11A 3OIPA 1UWVA 2CH4A 4O4JB 4XLCA 1I4XA 3B40A 1H8HA 1E24A 4P2NA 2QWPB 3H9VA 3R65A 3BVMA 3P32A 5C4HA 2WPDG 3CS5A 1YJNV 1QVFU 3HKEA 1QLEB 1S0VA 5LL6Y 1MBYA 1PLFA 5F4MA 3CCSB 5KYLA 4WJ3M 4DUYO 2IX0A 2LJ2A 1TWGH 4RGMA 5IYCG 5IYBO 5CBFA 2LS01 2JGUA 1L0YB 2DETA 1F23A 2BOCC 5KMGB 1ELOA 4P1VA 3SJQC 2OTLB 1UD8A 1VQ5B 3S16H 1WCMG 3WOFA 1BS3A 1VQBA 5BSYA 3NEMA 1QVGB 3Q4HA 3CCRV 1MD2D 3CCMV 1ZEQX 3OWEB 5LMUO 4HE5A 3SPHA 3M9BA 3PO2H 2Y0SG 4TT3G 3CPFA 3I55A 3LSUA 1OGIA 1QGZA 3AG1B 3DEOA 5TV2A 3AG7A 1M57B 2EE1A 3NWTA 2XNJA 2HQEA 5IYDG 1VF5B 1PKVA 1WYDA 5CV7A 2IWHA 5IP7G 5EGTA 1YHQB 1B70B 2A6HC 4RCYA 4JF3A 2PIAA 4XL9A 2XAGA 1YDXA 5M3MH 3RNUA 4LF8Q 3W5VA 2CDYA 5CMUA 2WLLA 4B3SL 1WJZA 3ASNB 3OJXA 3EA6A 4ZK9B 1RTNA 2VS0A 2E2IH 4YY3Q 5C44B 2BCOA 3TXQA 2AZ2A 2GJRA 4JI8B 2F3IA 1OCCC 4NXMQ 4FF3A 4KD4A 1IL2A 4N9TA 3U11A 1DF5A 1WTWA 1Y66A 3JQQA 2N3SA 3IRBA 2P67A 1FNMA 1EZJA 4NMZA 1CPYA 3E83A 4RHSA 5HGQA 2EY2A 5IWAQ 4IUTA 1O7IA 2OK8A 2LSSA 5KHKA 4X7CA 5E6TA 2F3WA 3CRCA 4AQYQ 4TOIA 2K04A 3OMGA 1KNAA 5CV8A 3DTUB 4JI5Q 1Q81C 3NWSA 1Y69U 2DNCA 2AXTZ 1GMGA 1NR1A 1QH0A 3JQPA 4IOCA 3S1RB 3AMUA 1YSCA 1N0JA 3K79A 1KD1C 1G7CA 3ABKC 1VQ8V 1WOPA 4UCVA 1WN7A 3FPUB 2K1EA 3E22A 1KAAA 1B23P 1Q12A 4JYBA 3QIAA 3QFTA 4JC0A 4DN4M 4ZKCB 3CCEB 1H9RA 5IIFA 3Q4HB 2ES2A 3A0BZ 4BIUA 1U97A 4XXEA 2QWOB 3J80N 3VNVA 3DC5A 3I55B 2QKCA 1LTGD 2Q2UA 1FFXA 4UV8A 5L3BA 4PMBA 5IWAL 4LF4B 2B39A 4I7ZC 5EJWA 1KDCA 3KLWA 2M6YA 2L35A 1E63A 3GIRA 1PZID 2DN8A 1TVKA 1ZUQA 3CXHF 4XIGS 1Q86D 4XTCS 4X8AA 4UCUA 1U5KA 3N52A 3O65A 2NR5A 4C3IH 2Q69A 1I50B 5BR8Q 1WVLA 3BZCA 1W2BB 4JI7O 1OXTA 3LSQA 1EP3B 1VF7A 4YCWA 4UP7A 1I6HH 3GB7C 2F3VA 3KL9A 3ULJA 4BBSG 5J3OA 3RN5A 4X62L 4QE9A 3ISXA 3NENA 3PUXA 3MXNB 4OONA 3E8GA 4ZCLA 1ONLA 1RIPA 1VQ7V 5KNLA 4BW9A 2VQFB 2M00A 1N07A 1B53A 2LFRA 3W2DA 1HNXL 1IDSA 2A06H 4WZEA 3CRRA 1VQ9A 3E8HA 4ABNA 1NY4A 3LNMB 1PA6A 2JS5A 5CDFA 4YY3B 1NTZH 1QX4A 3ZMVA 5CYUA 3BCCH 3NELA 3R66A 4FZ1A 3ZJYC 3G6EA 4LWCA 1PYWD 4TMVA 4ODGA 4UHVA 1F20A 4CS3A 1T6ZA 1HTPA 1X65A 1O7YA 2WWWA 4DR4B 1DDIA 2JDIA 3BQJA 1NSNS 2HIXA 2K9PA 4IJHA 1BXTA 4XT1B 5M5YH 2DYRB 2NVTB 2YI8A 1IYVA 5LXTB 2HUGA 4H37A 1H9MA 5BR8B 2AHOA 2V7XA 1Q90A 1SE3A 2PUSA 4AF6A 2KCNA 3P7JA 1XHZA 2EY6A 3CX5F 1JE5A 1AR5A 3ML0A 2NWGA 1XNRQ 4A3LH 1QHTA 1PVOA 3TDQA 2R7ZH 3BPZA 3BZKA 1VLYA 4X66O 2OBTA 2HKOA 3E2EA 4U673 1N8RW 3CF5A 1HW7A 4IPDA 4DR1B 4PI0A 3R8BA 1WD1A 3S1RH 2XT9A 2Y69B 2NZOA 1JFFB 1PL0A 3EVQA 1UUPA 3ER0A 1XNQL 3Q8DA 1SNCA 4HMJA 4MTGA 3M4OH 4XDJA 1R1BA 3OHXC 3N27A 3CCJA 2W0XA 2F4VO 1CHQD 2DUDA 4IO9A 4A3DH 2EYHA 3PUVA 4LR3A 3RZOH 1RTOA 2UUCL 4PQXA 2ZE8A 5JVDB 3G6EV 1HUNA 1K3BC 4JASA 1Y8NB 5EZYA 4AF7A 2OYQA 3HOWH 2W6IG 4DAPA 1H85A 2K52A 3JAMi 4TQDA 4ZUIA 3FKSA 3M4PA 4ZKIA 1D8TA 1DOKA 4DV3B 4OOSA 1EQTA 4ME3A 1VQ4V 1BQQT 2HDLA 4RH6A 2EILB 3EXAA 4A76A 5T1GA 3K59A 1VQAA 5M9OA 2E8GA 4JTCB 4XM3A 1AE2A 1V1QA 1W6JA 3V2TA 4JAVA 3U6KA 1Q6UA 4PDRA 4TMTA 1NBMA 4DR3L 3S2DB 1X3FA 1N05A 2M7WA 3S3WA 2YU9H 2RCFA 3D3QA 1Q9SA 3U2QA 4R1JA 2G9DA 3K9AA 4J7ZA 2UUAB 4M2LA 2PI2A 2A1AA 1NBMG 2UUAO 4DUZL 1M56C 1G4YB 2JE6I 3NUCA 2IJIA 2BSAA 4RJLA 2X8KA 3BDLA 4EQNA 5LMUL 2QJ1A 1B9MA 4CH6A 2WR8A 5EAYA 4ALPA 2L9HA 1QZHA 4I7ZB 1A3UA 3MDSA 3WU2Z 2V1DA 2A6EC 5IJ9A 1GUOA 2FMCA 2IX1A 1DZ1A 3DXRB 2EQSA 1PV4A 2BA0A 1AR1B 4TSSA 4LFBQ 1JFFA 1AZQA 1N0VC 1W3SA 5BMVA 2JSOA 1BLIA 1JB3A 4P26A 2I5LX 4RG1A 2N55A 1T6XA 4J42A 4UB6Z 1UEAB 2ZXWB 4DV0L 5ITZB 2QDLA 4HIKA 1K8GA 2YU9B 1NR7A 4X64B 4RUEA 5LP6C 3CC7B 3ERQA 2ARHA 1K33A 1KMIZ 5KGUA 2ZE6A 2PI2E 2Y0SB 3WOEA 3K8AA 4KN7C 1GN4A 1MSGA 1TUEB 1R5BA 1M1KD 1JR0D 1LT5D 4HN7A 3UE1A 1K8AC 4X20A 1Q6HA 2UUBO 2QEXB 2ITDC 3SJAC 2RDGA 5FLXE 1X3PA 1D2EA 2X6WA 4M8AA 1PMRA 1U4MA 2RKSA 1FAFA 2P4VA 3ZHUA 2E74B 1XE1A 4NB5A 1XILA 5EYPA 4JAUA 2F0LA 2F4IA 1L0WA 3T4AC 4DV1L 2IPKD 4DR5L 4LF4Q 1OHHA 2VW9A 4ICGA 4D7SA 2RA4A 1WDTA 3W7XA 2AHYA 2HHHB 5HGTA 4LWSA 3WYAA 1QLNA 3RVYA 2ZM6O 4R4OA 3OR7C 1YHAA 3FHWA 5CORA 4ZIBA 4IOAA 3SJZA 2OQKA 5COYA 5TISZ 1I7PA 1YHBA 2D0PA 1OCRC 4AC9A 3J7AU 3E5SA 3N2KA 1GAQA 2VYQA 2BOBC 4K8XA 2QA4B 1K28A 5JPMC 5KNBA 4UCTA 1YBYA 1YJ9V 1EZVH 1IBKO 3CW2A 3G71B 3DM1A 1AI7A 1QNKA 2B7BA 1AI5A 3TCUA 1WB8A 4CBCA 3I1FA 4KKUA 5J1ZA 3EHBB 3LDEA 4FLWA 1SETA 4B48A 1UD4A 4JI7B 4DNRB 1V54B 1AW7A 2AUJD 2H4OA 4TV9A 3K5OA 4TMZA 1F9SA 2HIVA 1EIYB 1BCPD 3FMCA 5FK9C 2I46A 3KDFB 1HR0B 4X62O 1H38A 3ZN1A 3J81k 3OTOO 2V7WA 2TSSA 3ABLC 1Q81D 2UU9O 1STYA 4UAJA 1TVKB 3BYTB 3TZUA 2HHHQ 1QJOA 1TVXA 1QR9A 1QLEC 2WAMA 5L46A 3UDGA 2RBMA 4ACAA 3X3NA 3W5UA 4PC7A 4Y9RA 2BH8A 3VR2A 4EX5A 1RPRA 3CC2A 2RJZA 1QR8A 3M7NA 3HGBA 1YITB 4XLEA 1W0JA 4TRDA 4RGOS 1CK1A 3S2HH 3K7AH 3OM3B 1QVFB 4NB3A 2ZJQA 1RD9D 3CC4A 1SMXA 5IGEA 4RQFA 4FDBA 2E2IB 1RJTA 1S72A 1PFNA 3GWKC 1LTAD 3I4LA 3A8JE 4UP8A 2JA6B 1PHJA 3MFYA 1F2MA 2Q6AA 2B2WC 1YF2A 3F7VC 3HOXH 4B3TL 2OWOA 1GM7A 4CH3A 2BCCH 3D36C 1PM9A 1BHAA 4IURA 1AN8A 3FRPB 2D3NA 5JH7A 4BBRH 3Q0AA 1WTQA 2J4XA 2VQFQ 5DEDA 3EFFK 2GJKA 4H0LB 1GVHA 1KNEA 4X7EA 2Q7HA 2ICEC 2K6AA 1TUBA 2KEDA 4ZQ3A 5LXTA 4JOIA 2HJDA 3UT5B 4NXNL 4DK6C 3GTQH 1VMCA 1QFZA 1D5NA 1VQFA 2UXBB 1G6UA 1JC7A 3JALB 5A8AA 1HPCA 2P06A 2IT1A 4K14A 3JD3A 1STEA 5E1AC 2Q6OA 4O0AA 4I55A 4UPAA 4ROXA 1KB9F 2ZR2A 3JATA 4PHZA 4ZGQB 2UUCB 1LLRD 3BHPA 3A7LA 1CKOA 1BL8A 2GSMB 2VBTA 4N8FA 1L1OC 1Q43A 4NBSA 1SQGA 4WFEA 5EK0A 2JN4A 5LP6A 4JCVE 1KD1W 5L37A 2NVQH 2ITCC 1S3OA 2ZL6A 2K5NA 1NB0A 2JIZA 1KRSA 4IFDJ 2RDHA 3CMEB 4LFBB 1JCKB 3CCEV 2JA9A 3K5NA 2PW7A 1TTTA 2EILC 2X6GA 4A3FH 1EEID 2E2HH 4MYUA 3I4NG 2RSOA 3L70H 4ZI7A 3CCQB 1H2LA 2QW7A 2WB1B 4IUVA 4NVPA 3V96A 4XNFA 2WLLB 1TXYA 2NN6H 3RZOB 2DJVA 1V0EA 1JA0A 3J81N 2Q6LA 1UAPA 3UM7A 1OCOC 2DYSC 4JI3O 3A5UA 1QFJA 2R92B 4A3MB 5DM73 2X6XA 4U3JA 4O4LB 2NUCA 4OPAA 1GUGA 1G291 1VMPA 3CC2V 5ELFA 5C5LA 5HKKA 4JI3L 2R9RB 3FAVB 3J7YW 5A9GA 5A88A 5H2FZ 1X3EA 1VQGA 2XEXA 3OEHA 2QKIC 4WFGA 5CA0A 4K35A 2VQEO 4OP7A 4CZZA 4WWVA 3PMFA 4DPGA 1PH6A 4EKWA 1U4PA 3W2HA 4ME5A 1M1KW 3VOUA 1LTTD 5EBCA 4Z4ZA 2K5HA 1RL2A 1DF4A 1ESRA 4Q6GA 1ZXTA 1PH7A 2DGYA
chains in the Genus database with same CATH topology
3DUZA 4DV0B 1WNSA 1M4VA 4KV6A 1V8QA 2L55A 4WRDA 1FFXB 1IL8A 3MAQA 4JK1C 2F0MA 2CW0C 2D9UA 2KEEA 3C1FA 4XQJA 4FVMA 4XLHA 2O5IC 1LACA 2M5SA 1FJGB 3VQWA 1XNRB 3ND9A 3E22B 4A3BB 2Z8LA 4RCOA 1ILPA 2OT2A 4HSPA 3BCFA 5EQ0A 3A55A 2KVMA 3SE0A 1YNJD 4FLZA 2A74C 2A68D 1FR3A 3KLSX 3PIO3 1SSOA 3HP3A 4BBSB 1SDFA 5JQGB 3JASB 2PZWA 3C46A 4NXMB 1EY8A 1YNJC 5KNCA 2F66C 3N2KB 3K58A 1I4RA 2EY5A 5IGFA 3FEWX 2XZOA 3C3LA 1JWMD 4XOPA 5D14A 2I07B 4DR6B 2O5JC 4QF4A 3N6RA 4FLTA 4O2BA 2JJ2A 4H13C 3CB2A 3RD4A 5JAVA 4C3JG 4RGTA 2RQ6A 1GUTA 2RDFA 2XZPA 1EZ6A 3CQZB 3BABA 3RWRD 2PYLA 3M7MX 1ZKOA 2PCFB 3BYYB 3RYHA 1S5ED 1W0KA 2IW3A 1BCPC 4DAYA 3OIQA 4TV8A 4WFN3 3J80E 4A3EB 3JASA 3HKDA 4FLYA 1DOMA 1OXUA 3J81E 1Q3EA 5CGKA 4IIJA 2B2VC 4C3IB 1SFOB 1HZEA 2F0WA 1HRJA 1ICWA 3JATB 1GHJA 2KOLA 1PRTD 2L1BA 1DONA 4B3GA 4OX9B 3EROA 1IBLB 3FPPA 2NYZD 4QCLA 2ZIMA 3L3OC 4EQPA 2HCCA 2PNRC 1EFID 2B63B 4YJ3B 4ZI7B 2EXZA 4QMGA 1TWCB 1N32B 2IM9A 1BO0A 3C2PA 1TWAB 1A2UA 2L11A 2NN6I 1SXTA 2EJMA 1Q3LA 2RVLA 5A2QE 5EBDA 1F9RA 1RF2D 3TN2A 3Q6SA 4X66B 4I4TA 1IKLA 4X1IA 3BZDB 2ZZQA 4BS9A 3A35A 1WTHD 3QB3A 3VA5A 1MABA 1SNQA 2VNUD 4A93B 1Z6HA 2QM4A 2WV6D 3RFRA 3GV6A 4XMYA 2LFNA 3R2IA 3G7LA 3VYSA 4X1YA 3OFNA 3MXGA 1IBMB 3JSLA 1XWEA 2B2TC 5LYJA 4DGZA 2P5OA 2E5LB 4M1UB 2WKCA 4OGQC 2C9OA 1K8OA 3HOWB 5KX5A 4FF1A 2W6JA 2L5TA 3H09A 3A7AB 2UXDB 1Z5VA 4DR3B 1YNND 4A3GB 4LNUB 4DV2B 2XNAC 1HVXA 3HKZB 4BA2I 4TV9B 2D2CC 4CS4A 4BY7B 1GJXA 4G57A 1BCPF 1UD3A 4RAUC 1HTLD 3NPPA 4CH4A 4DFAA 1OXVA 4IUPA 5C4ZA 4HR7B 5EKLA 3D6CA 4LF9B 3HOUB 2DY8A 1NR2A 3L7ZC 3OE7A 1B1ZA 4ASUA 2A68C 1ESFA 4F6RA 2A69C 5K36H 4ILWA 5J2UA 4JYAB 3H0GB 4CH5A 3BVGA 2KECA 3DDYA 1HNZB 2VJJA 5G3LD 2D3LA 4U3JB 1A3VA 1R4PB 4A3JB 1KABA 3RYHB 5FO7B 4DF7A 4ZKBB 2EOTA 1T5XD 2B2UA 4X3TA 2E1BA 2EZVA 1TY0A 2R9VA 3A3BA 4XONA 2PQEA 2SOBA 2L4NA 3ONAB 4ZUJA 3MWYW 3HKDB 3MXNA 4O4IB 1DCZA 5LOVA 3JU4A 4DAVA 2K5WA 5KYIA 4O4LA 5HURA 2F1MA 4F6RB 4F7XA 1B3AA 3GTMB 3BCDA 5JCOA 3PO3B 1HA6A 4B3SB 5KMGA 1XHXA 2E2HB 4DV5B 1BNZA 1SE4A 2ZINA 3M4YA 2OF1A 4GZYC 4IUQA 4FF2A 3HOYB 2VWKA 1TR5A 3GD7A 2UU9B 2YI9A 4OO1H 5LHY1 4KHVA 2NVQB 4OL7A 2L0CA 2WKDA 5ELDA 3OMCA 3Q23A 3S9WA 4I4TB 4DNTB 1CA5A 1B9NA 2K33A 3U0ZA 1O78A 2Q0AA 1J8IA 2X53S 1BF4A 4X3UA 1ZYRC 2KCCA 2XSCA 1U4LA 4B3TB 2VB2X 2GV9A 5KIXA 5KHJA 4O4HB 1BR9A 1SNMA 3RYFB 3ZIAA 1SYDA 2A69D 3T13A 2V7QA 3G05A 1SE2A 1Z47A 1SYGA 2M9VA 4JBWA 2OXPA 5M3MB 3D4WA 2JA8B 1TIID 2OEOA 4UZUA 3RLFA 3DMUA 1II3A 1K8MA 3VA7A 4HBNA 1I4QA 2K7VA 2WJVA 1MGSA 2SEBD 2MPMA 5CR3A 3CRKC 4LFCB 3HEJA 4H0LC 3K5LA 4X3SA 3HOVB 3GTLB 3BVZA 4KK7A 4II3A 4ID6A 2PYJA 2E2DC 2W6IA 1SMYD 1T5EA 4FM2A 5D3DA 3IL8A 1TQOA 3CKIB 3M85A 1QNUA 4CC5A 3NXWA 1S5BD 3N2GA 1F2LA 1H9JA 2V4DA 3RYFA 1EY7A 3JAWA 5T1IA 4HIZA 4TT3A 3JAKB 2UUBB 5I6YA 1I7FA 3JSNA 4KL1A 4U673 3CSXA 2B8GA 2F93B 1H8EA 1HXYD 2Q8RE 1CM9A 1EU3A 3PV0A 5JPNC 4GQNA 5JJNB 4AHCA 3OAAA 4GYCB 1D6EC 3HG9A 3MA2B 2KA7A 1EY0A 5DAUA 2R7ZB 1PTOD 5FNVA 4BWGB 1PXUA 4DXFA 3BA9A 1FNVA 4NNJA 1OO9B 4K8IA 1G6ZA 3SK8A 3LX0A 3S15B 2R6GA 4KKTA 1EYDA 1LTRD 4Z1MA 2D62A 4MN3A 2F0DA 3M4OB 1RKNA 3D4RA 3CRLC 3I90A 1WTRA 1TS2A 4KJOA 1G91A 1LABA 1ENFA 4IFDI 4K5XA 2JVDA 4K2KA 4EFBA 3CU7A 4DUYB 3I73A 4RWSC 4P22A 2B2YA 5C4JB 5EPKA 1G2TA 1ENAA 3NTHA 5CV5A 1PFBA 1JMKC 4XQNA 1SMYC 4WBNB 1D5MC 4G7HC 5KX5B 1SJED 1CFMA 1JWUD 1BDOA 4DV1B 4X1YB 2GK7A 2K01A 5M5XB 4QUFA 4R9WA 1SA0B 4L8JA 3QOJA 2ZXPA 5LL6X 3ZS8C 3K0YA 3OW7A 2B2YC 2E75C 2QEJC 4G6IA 2H1EA 3IAYA 4RKLA 3VR4A 2K32A 4X20B 2BE5D 5DM63 1V9PA 4AILC 1I4HA 3NTIA 3I4NB 3PUZA 2K5QA 4DV7B 1QILA 3A3GA 3BRCA 3AB9A 5J22A 4XYOA 4RKBA 4KKSA 3J81L 1FNWA 2BE5C 3HS0C 2SNSA 1IBKB 1QE6A 5IJ0B 4KN4C 5CMDA 3A8IE 2NTTA 2A5HA 4O2AB 5K1PA 1WTOA 2UXCB 3GVJA 4IHJA 1QB5D 1PFMA 1GXDC 4C3IG 4LF7B 4UAIA 1HFGA 5C3WA 2B8FA 1STGA 4JMQA 4KY5A 5I2XA 5CBAE 2O4XA 3MVVA 1DD2A 1DGSA 3OWFA 5DNFA 2CVRA 3GTJB 2MGSA 1KZLA 2IJ0A 1BBXC 2GK6A 5CV6A 5IGCA 5JVDA 3ICXA 2LY7A 4ZAIA 5I6WA 3RZDB 3ZEDA 4Q5VA 4YHHB 4B3MB 3ZPNA 4J1MA 1E2WA 5IOCA 3GTKB 3J7AV 3D3RA 2F0TA 2E74C 4I9QA 2L12A 1JOKA 3JAML 4HNAA 1QOHA 1UD6A 4TQUS 1GUSA 1S4ZA 4RFBA 3FFQA 5KEEA 5JEAG 3IFTA 3QTCA 1AP0A 1TWFB 1NCVA 1Z7TA 5CBEE 1E2VA 3BG3A 2F0PA 5LMUB 1WPCA 2NZ1D 4G4KA 1O9HA 1PRTC 1CZWA 1N33B 1WP6A 3D4DA 1ENCA 1I8DA 4G7ZC 4GLXA 1GUNA 5K1XA 2PZUA 1D2BA 4YJ2B 2A73B 1WTPA 2ZXHA 1K83B 2K1BA 1YEWA 1VF5C 2G9HD 4FFBB 3NE5B 5EYPB 4IFDH 4XDXA 3LWEA 4XQFA 3OSOA 3M7GA 5IJ9B 4CKEA 1GUWA 3KEWA 3D8GA 1M5IA 3G6JB 2F0JA 4FF4A 1O80A 1FNUA 3MFGA 3GTOB 1PRTB 3RYCA 2YIBD 3P75A 1X4TA 2WP8J 1XYIA 2DNEA 1SAPA 1CQVA 1K28D 3HZXA 2SDFA 3NSWA 1PTOB 3JARB 4WJWA 4O4HA 4LAAA 1I6HB 4Y7NB 3J80L 4DXGA 1C4QA 4KMUC 3CHXA 4ZHQB 4CJ0B 2NVYB 2HLDA 2F0QA 1N36B 1TY2A 1CQFA 3NK9A 1QCBD 1JJOA 2EJFC 5ELCA 4G7OC 5IK2A 1I18A 4ZLTF 4YXWA 4LMQD 3T1YB 1EYCA 3LNNA 3SVMA 4CKCA 3BDOA 3D6WA 3JAME 2R70A 3A56A 4FXUA 1I94B 3CMMA 3BC9A 3RYCB 2A6HD 3H3VC 2NVXB 3UQ8A 2R61A 4CJ1B 2PY5A 4OHJA 3NHHA 3GP7A 2ZTGA 4O2AA 1SKYB 3JALA 1XQ8A 1CA6A 1O7ZA 2ZT9C 1RCVD 2XN9C 1DOLA 3S1QB 3DWAA 3T53B 5C0XH 4F87A 1F9PA 4FNFA 4IZ8A 1G2SA 5LP6B 1DYQA 1NT2B 4BWAA 1CHPD 1PZKD 2Z4HA 3IKJA 3KLSA 4II2A 1EL0A 3GTPB 4Q0FA 2F0KA 3NBHA 3I3CA 2KHSA 5CV4A 1IW7D 3F2UA 4LH7A 3WB1A 1LT6D 3VR5A 1F2YA 4C3JB 2B2VA 4K5WA 1JQYD 2AUKA 3WQZA 4K6DA 1YNNC 3SK6A 4TUYB 4CC6A 4G7WA 2WIIB 4JV5B 4LFAB 4V190 3TZDA 4GKKB 1EWCA 1XTCD 5M3FB 4DU9A 4F8MA 1R4QB 1LO5D 5JEAH 3RYIB 1Q1BA 4CKBA 4PNYA 1HHVA 1X3QA 1FGBD 2B2TA 4KHZA 5BN4A 1LT3D 5D5QA 2VJIA 4E0FA 1Q5OA 5I4DA 5KHIA 1ILQA 1PTOF 5IGBA 4CS2A 1F9QA 2DIEA 5CV9A 3QG5A 4K8JA 4J6HA 1RSOA 4IN3A 5BN3A 4HCEA 1SQFA 4FFBA 1EIHA 5J2TB 3PN1A 4UCSA 3S1MB 1UD2A 3FKIB 3LWUA 3I70A 1WD0A 3S17B 1B50A 1A15A 2TMPA 3I8ZA 2XGJA 5EIBD 1BPLA 2GJPA 2PZTA 5DEHA 2ZZGA 4R8NA 3U10A 4EB6A 4WORA 1HQRD 4L6TB 2O2LD 1O7LA 2EYFA