3LNNA

Crystal structure of zneb from cupriavidus metallidurans
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
341
structure length
341
Chain Sequence
ALRHEGERLVVPAESPLRRTLAVAPATRETVAAPFNLPAMIEADPAKLVKVLPPLAGRIVSLNKQLGDEVKAGDVLFTIDSADLAQANSDAAKARAAMTMARRNLDRQRELDKSEIAAKRDFEQAQSDYDQAASESQRADARLAQLGAKGGGTLQAGGGHILAVRSPINGRVVDLNAATGAYWNDTTASLMTVADLSHVFVTANAQEKDLGHVYVGQSATVKFDAYDDPQPGKVRYVGQILDADTRTTKVRMVFDNPDGRLRPGMFAQATFLSQPHEGIVVPMSAIVQSGFYTRAFVEVAPWQFEPRVIKLGAQIGDRMEVKSGLSAGDRVVVKEGVLLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-induced conformational changes in ZneB suggest an active role of membrane fusion proteins in efflux resistance systems.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal transport
molecule keywords Membrane fusion protein (MFP) heavy metal cation efflux ZneB
total genus 58
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3lnnA04
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3lnnA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lnnA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3lnnA01
3VR5A 3A8JE 1OXTA 3VR4A 1Z7TA 1GHKA 5JEAH 4OO1H 4G7OC 3OOCA 1QJOA 4KHZA 4DK1A 1VF7A 2JXMB 3A8IE 3GD7A 3ND9A 1GUNA 2AWOA 1K8MA 2BE5D 2A6HC 3P20A 2K32A 4DNTB 3NE5B 4L8JA 2D62A 2DNEA 5JJNB 4KN7C 4PV1C 4G7HC 3QG1A 4GZYC 5BN4A 4KMUC 1TU2B 3HGBA 4IFDH 3VR6A 2F95B 1HPCA 4H0LC 3T51B 3BDOA 1VDZA 1H9SA 2LMCB 2O5JC 3I4LA 3IKJA 2BA0A 2F1MA 1TKWB 4BA2I 1GUSA 3A7LA 4BA1I 5C0XH 3LNNA 5D5PA 5BN3A 3M85A 2DNCA 4GYCB 2A68C 3AB9A 4I7ZC 1BDOA 2F93B 1VF5C 5C0XG 1DXMA 2AUKA 1ONLA 1Q1EA 2A69C 3PV0A 4OGQC 1LABA 1V43A 1RSOA 4H13C 1VCIA 2E75C 2QF7A 3PUXA 3VR2A 3A7AB 5KNCA 2PCFB 1Y69U 2PPBC 5JEAG 5KNBA 1OXSC 2NN6G 2R6GA 2B8GA 5JJEB 2JEBI 1GJXA 3QIAA 1SMYC 2K33A 1DCZA 2A6ED 4DNRB 2E74C 3W3AA 1HQMC 1ZYRC 3VR3A 1FR3A 1EWHA 1Y8PB 3PUWA 2A68D 3QJYA 1HCZA 1E2VA 3ND8A 2JE6I 1FYCA 4H44C 2YYZA 2KA7A 3BG3A 2O5IC 3SE0A 4IFDG 4OO1G 1YNNC 3M4YA 1CI3M 4XIGS 4TQUS 4KKTA 1K8OA 3T53B 2DN8A 2PNRC 2A6EC 4JK1C 3BRCA 3IFTA 1IW7D 1HTPA 3PUVA 3OPOA 1CFMA 2AUJD 1CTMA 1B9NA 1H9SB 1G291 4RCNA 1LACA 1Y8NB 2ZT9C 2Q8IB 2BE5C 1O7LA 5KNDA 2A69D 1T5EA 2NN6I 2V4DA 2BA1A 3FMCA 3N6RA 1H9JA 1V8QA 2NN6H 3L7ZC 3OW7A 3FPPA 1IW7C 2CW0C 5A35A 3U9SA 2D2CC 2EJFC 4IQZA 2EJGC 4KI0A 3M7NA 1YNJC 3D31A 3PUYA 3WDNA 5K36H 1Z6HA 2BDOA 1PMRA 3SDZA 1E2WA 4KKUA 2EVBA 1GUGA 1H2SB 3DXJC 1I6VC 1DD2A 3D4RA 2D5DA 3RLFA 1A6XA 3I72A 3H94A 3MXUA 2JEAI 1ZKOA 2EJMA 4LK1C 5BN5A 4LJZC 3LWUA 2A6HD 4TKOB 4DK0A 1Q12A 3WB0A 1Q1BA 4HR7B 3VA7A 5D5QA 1O78A 2B8FA 2L5TA 4KKSA 3WB1A 1Q90A 4KN4C 5JJJB 1GUOA 2IT1A 2EDGA 1B9MA 3EQLC 3TZUA 1OXXK 1E2ZA 2KCCA 3KLRA 1H9MA 4G7ZC 1IYUA 1GUTA 3CRKC 3I73A 3MFYA 1IYVA 1H9KA 3WB2A 1Y8OB 3A8KE 3T56B 1OXUA 3GQBA 1GHJA 2E76C 1H9RA 4XTCS 4JBWA 1OXVA 3PUZA 5K36G 2K7VA 3CRLC
chains in the Genus database with same CATH superfamily
3OFNA 4A3DH 5H5JA 4O2AA 4IN3A 1XPRA 1S5DD 3G6EV 1EIFA 4O1NA 4P75A 4NVPA 2RHQB 3CPFA 4GKJQ 1QJOA 3NBIA 1VQCA 5IJ0A 4F8MA 5H6QA 3ABKC 1N36L 4YWLA 1B6QA 1JJCB 4JYAO 4X62L 4DUZB 1FJGB 5J9PC 5ITZA 2ZXPA 4L63B 3QFRA 2ZJQA 4E4EA 4DUYB 3ONUA 1Q8IA 1P16A 1G4YB 4OL7A 1FFTB 1M90W 4OXSA 3G4SB 3JAKA 5DSZA 1EXMA 1K28D 3T1HL 2L12A 2QE7A 4FLWA 1NNXA 1Y1VH 3O13A 3FFQA 3ZIAG 2P22C 5B6IA 1SMXA 2WIIB 1JCHA 2VNJA 3IKJA 1SBBB 1CHPD 1IHMA 1PKVA 3P27A 3A55A 3A7LA 4GLAC 5ELEA 3DEOA 4BA1I 2WLHA 3UM7A 4ZK9B 2A5HA 3H3VC 1VQ5A 5LOVB 2GUZA 3C3TA 4I7ZC 1K28A 3VYSA 3ISXA 3A5UA 3U11A 3GWOA 1BZKA 2EY1A 5ELCA 4L5SA 2E75C 3K80C 2PPBC 3RYIA 3ZRWA 3S1MH 4JI6Q 1DDGA 2XNDA 4FLTA 2F4VL 5HZBA 3EN2A 4JI7Q 2OTJA 4B3MQ 1KBHA 1CP9A 3CXHF 2J7ZA 2EXDA 1S5ED 1HNWB 4AQYL 1GN3A 1FXVA 2WLLA 2ZXWB 2OTLA 4FF1A 4Q0FA 3RLOA 1IJFA 3GTOB 5KX5A 4OX9O 2FXQA 4ZOLA 1GM8A 1EY9A 2AKWB 5KA5A 2PI5A 1K0RA 2RDGA 3X3NA 4GOPA 2NVTB 3HKEB 4P6YA 4WWVA 2SOBA 4P2CB 3HP3A 2F0LA 4HN7A 2IH3C 3MA2B 4LF4Q 4BW5A 1K34A 3H1LH 2DQ0A 1X3GA 4DV0L 2R93G 4X66O 1VQGA 4GKKB 1TTTA 4R71A 3SJCC 1VQ6B 3LUTB 1N9WA 4N9PA 5A2QL 3H15A 2Y48A 3NR7A 3CJHB 1K73W 2FMCA 5JVH3 1LUWA 4DR4B 1D5MC 1M4UA 5LHIA 1EY6A 2KBNA 1SJHD 1FKAO 4LBVA 1O7IA 1YI2A 4UCRA 4XLCA 1SQXH 1VF5B 1IURA 3J7AV 1E1QA 3RBZA 3S1NH 1EU4A 2PYJA 4C2MB 3AEVA 3RN5A 4NXNO 3OW7A 3LSSA 2NZ1D 4YJ2A 1SQPH 1IDSA 3E8BA 5JCOC 2QWQB 1TVCA 1XL4A 1TS4A 1VS0A 3OT7A 4J6HA 1V9PA 1T6YA 2Q6IA 4UP8A 1BQEA 5JVG3 2WA3A 1NR7A 4D7SA 5IP7G 4O4HA 4JI8Q 1YJWA 2B29A 2EPBA 3GTPB 4A3MH 1ZL8A 2BF4A 2G9DA 2J0TD 1VQIA 3SLDA 1XFOA 5IY5C 3HKZG 4FIPC 4EQ5A 1BE3H 5LA6B 5CV9A 2LW7A 1IKLA 3N2KA 4DR4O 5TRDA 1F2YA 3CU7A 4BY7B 3LSUA 1S5JA 2UXXA 3OTOO 4K8XA 1WP6A 2R6HA 1N34O 2KEEA 1YSCA 2QJ1A 1YTFB 3KZIZ 4C0SA 2L55A 1G8MA 3MAQA 4OIJA 4GX0A 1EWIA 3VYUA 4P6VF 1QGZA 3CRRA 3CMMA 5C4JH 2G5DA 1MGSA 3J81i 2WSSG 2YXHA 5BR8Q 3NTIA 2ZDIA 1QGAA 4X1IB 2MHVA 1XNRB 2Z6BA 2FMLA 4LF9B 1UE5A 5KEEA 2EBOA 2B2TA 2RCVA 5CBHA 3AYHB 4RD6A 1QVCA 4NXMB 3OE7A 1EIGA 1QVGB 1E3ZA 2AWNA 3CCSA 1XMQO 2DY7A 2KOLA 1KB9F 2E2HH 1WPBA 3F5WC 5B66Z 1PXUA 1W2BB 2Z8LA 2X6WA 3MFYA 4FXKC 3ZRSA 1SKYB 3SK8A 2A79B 1LTSD 2K5QA 1XL6A 3TK1A 1QR9A 1KYOF 2ETNA 4JI2B 1Q43A 1VQOA 3JARB 4WZEA 1ORQC 2UUAB 1S5BD 3ZZ0A 1PKXA 2C77A 1Q5OA 4WCEV 4DYLA 3X2QC 1D5ZC 3OAAA 4FVMA 1BCPC 4DAMA 5D3IB 4A3EG 1T6ZA 3FDTA 4TRDA 2ZM6Q 2VQEL 4AHCA 1EUJA 4GKJB 2B2VC 2EZOA 4CJ2C 5GAHC 1EZVH 4C3JB 1I3QH 1KECA 5C3XA 2LP7A 3KLSA 1KD1C 1HFNA 3NE5B 2QM4A 1EY0A 1EQQA 1MD2D 4X1KB 2XNDG 2Z0SA 3ZMTA 3H09A 3C2PA 1IBMB 1K8AD 1DF5A 4KP4A 2PE3A 1JX9A 4KV6A 1GVPA 3HOVH 5AJ3Q 1B2TA 1KUQA 1K92A 1R9TH 4A93H 3M3YB 3RZOB 4LP8A 2WYRA 2WV6D 1AFPA 1LT3D 2G9HD 4DV6O 4PNYA 1K73D 4CBVA 2F1MA 5IGGA 2CE4A 4RWUA 4BIZA 5KHIA 3CC7V 4LFAB 4N8FA 2MW2B 4PV1B 4B7KA 3LDEA 3KDFB 4PHZA 4CS4A 1YJ9V 2EIXA 5LMNW 3A1PA 1RSOB 2H8PC 1HUNA 4PJ0Z 4QL5A 1DXMA 2CAZC 3ULLA 4DU9A 5JBQA 2N3SA 4C3IH 3SR2C 3HS0C 2WKDA 5KNDA 2JA7H 1MSGA 2XWBB 1EN6A 2WB1B 4CJ1B 3DSQA 1HNZO 1BBUA 1OXSC 4RGOS 2KG7B 4JI6B 3ZN0A 2BSAA 4LF8O 3HOWH 1WCMG 2X6LA 4TSFG 1F23A 3ONYA 1SE8A 1EFRG 4HIOA 4LNQA 1RQPA 4C1NI 1Y1WG 4X1IA 2A0LA 1F9SA 2JE6I 3PF5A 3M4OB 1M4VA 2JJ1A 4DV2B 4YWKA 1YIJV 2OCHA 1C7YA 4Y52H 3JYCA 1KD1W 3QOLA 2F1LA 1SESA 2LGWA 4YCVA 3TRZA 1I94B 3IFTA 4DK6C 1W2BA 5FLXN 1IW7D 5CR3A 2X8KA 1COWA 1QVGU 2AUJD 1J5EO 2X3UA 2N55A 3LX0A 1KP3A 1NT2B 5A2QE 2K5VA 4LNUB 4RDKA 1XNRO 1UMKA 3W1GA 3K5OA 1S5LZ 3C1FA 1H9JA 2GUZB 1WTPA 2XAHA 4A3BG 4PI2A 1DYQA 4O4HB 4IYIA 4X64O 1RM1B 2V31A 3CMEB 5M3MH 4XQJA 3K0DA 3R93A 1PFNA 1PH2A 5J2UA 3OHXC 3SDZA 4LH6A 3OW2A 2K1EA 4LBZA 1RCVD 1YTFD 2CBXA 1HJPA 2EVBA 1JOQA 3FX7A 3D6WA 3K7AB 3E9IA 3K3WA 2KUMA 1A6XA 2HQEA 4MTNA 1GM9A 3EROA 3S1RH 2JEAI 3I4NG 3ZN1A 2RCNA 2ZIMA 2OT2A 2A6HD 1L1FA 5K1XA 3HR0A 2LY7A 1VQ9V 4I55B 2BCOA 4FP5D 4NMZA 1Q8KA 1S4ZA 1LTTD 3G05A 3HOUG 5F4MA 2ZKOA 3SJZA 3GTJB 4KY5A 2JN4A 4A3LH 2BOCC 2H1EA 2L5TA 3UE0A 3CCEV 3RGBA 5FLXc 5IYQA 2AW9A 1WSVA 2ZTGA 4JGSA 5JJJB 3K5NA 3OZWA 3KLSX 4DV5Q 3MHBA 3SEBA 3SYCA 2QW7A 3OGIB 3TZUA 1G7SA 5KRUA 4G7ZC 1VQ6V 5CA3A 4A3JB 4GN4B 2LKVA 4IFDI 3URYA 3I73A 4E6IA 3CMAA 2VUMB 1H9KA 3STBC 1N0NA 4QUZA 4IALA 3K57A 2XAGA 2XTAA 1YJWV 4X8AA 2PF4E 2YWEA 1FNWA 1H9RA 4TUYA 4DV7B 3B82A 1ZUNB 4N8X1 4DR3Q 3S1QH 4JC0A 4AILC 4R7CA 5LGTA 1VHOA 3ABLB 3KL9A 2QKCA 5HZAA 1KK3A 2FHTA 2WB1E 4KJNA 4PG3A 5H59A 3WOFA 5KSWB 5DLQE 4WJ3M 1H2LA 1S40A 2B39A 1U96A 4GX2A 2JGUA 4DK1A 1HXYD 2EXZA 2ZM6B 4HZ3A 4OGQB 2AWOA 4DNIA 2F03A 3E1YE 1O7ZA 2K32A 3W1BA 4PELA 4DV6Q 4K5VA 1TQOA 5JJNB 3IAYA 2R9RB 2PUSA 2P90A 4UVCA 4DAYA 1WCMB 2BVNA 3S15B 5BN4A 5C44G 4R4OA 2HT1A 2CTWA 5LXTA 3VR6A 1SNCA 1XHXA 4P22A 4LF8B 1Y0RA 4TMVA 1Y74A 3Q24A 1CT1D 2ILMA 1EOTA 2RMKB 1EN4A 1N05A 4RCZA 1SKVA 4YAWA 1WD1A 4N9TA 5BY1A 5D5PA 3VO1A 4PI0A 2A68C 4KTAA 3CCUV 5BMVB 1NJID 1J5EL 3QTCA 1RTOA 2FMMA 3PO2B 1MIUA 3NHHA 1Y76A 1YJ9A 1AJQA 1RSOA 4DR7Q 4BW9A 1B8AA 4I7AA 4RG1A 1G2TA 4MW3A 1NU1H 4I9QA 1ZM4A 4DPGA 4DR1L 2R6GA 1RPRA 2EQSA 5G3LD 2HJFC 4MTXA 3VQWA 1JWUD 2J4XA 4A3MB 2K33A 5CC4A 1S5CD 3OTOL 1JJ2U 2RBMA 2PI2E 1NAPA 2OIGA 2MFIA 3A8JA 1W6KA 1UE1A 1BCCH 4P3YA 2UU9L 4K2KA 3SVMA 4GQNA 3W7SA 1CI3M 3SPIA 1VQDA 2X6XA 3KFUA 4FXGC 1AH9A 3ZUGA 1CZWA 4XQNA 4I5SA 2GVBA 4WJWA 3ICXA 4S3SA 3IC7A 4HSVA 3WWVA 5CV5A 4F6EA 2JJ1G 4RQFA 5LL6X 4H9GA 5LGUA 1H8HA 1EFUA 1SRUA 3BCCH 4B9WA 4A3KG 3TJTA 4DF7A 2XASA 1O7LA 2BE5C 2BCCH 4JTDB 3D8CA 4UPAA 1QE6A 1N06A 3E0EA 4C3HB 3ONAB 4CJ0B 3RN2A 3CD6A 5CB4A 3KDFA 4CKCA 3HOUB 4RCOA 1NMGA 1U4MA 2CW0C 1SFOH 4R8IA 2Q68A 3ASOB 3CEIA 5LYJB 1N33L 4QVJA 3ML0A 4RM0A 2BDNA 1HZ9A 1AI6A 1M57C 1WP7A 5ITZB 2EJFC 2EJGC 4H02A 1ZSPA 1TY0A 4IQZA 1KMIZ 3RYIB 3ZRWB 1Z6HA 3CPWA 2HCJB 1A3UA 5FPRA 4AQYB 1HNWL 5CV4A 2EIJB 4JI4B 4H13B 4O2DA 4IGGA 4UP9A 4X3TA 5IE8A 2ZTCA 1KK2A 3HOWG 2F4VB 4DV2O 1MMMA 2JS3A 1M56C 3ZZTA 4IPHA 5FA6A 1TR5A 2FINB 2RHSB 3V05A 1NQTA 2EJRA 1XPOA 4AQYO 3ERQA 3E8GA 3W7UA 1HR0O 4EFBA 1U9RA 3LWUA 1ET9A 1EY4A 4MW8A 4MHEA 4C3IB 3NUCA 3R2IA 5TR9A 4L5QA 4NDXA 3VA7A 1UE6A 1A0IA 4RD2A 3W2IA 2JYOA 2QDBA 1WA8B 1Y76B 2B7CA 3RUZA 1II3A 4NBSA 4GN3B 2C2WA 4FXUA 4UZEA 1KDCA 2UXDO 3AVTA 2E5LQ 1SKQA 2CH7A 4BBSB 1I5XA 4NTWA 3CB2A 1KDAA 2XNAC 5C0XJ 2NR5A 4BBSG 3E0JA 4I50B 1WOOA 4RUEA 1N32O 3MCAA 3QO7A 5EPJA 1RFYA 2EX3A 4CH4A 1OZ0A 3CCLV 3L74H 4X65O 4JYYA 1YIJB 5CMDA 1VQ6A 3ER0A 3RFRA 1XI1A 2N74A 5E4WC 5M5XB 4LF6O 4IJHA 4DAYB 3RVZA 3G4SA 3OEHG 4XTCS 1DF4A 4I0XA 4DV0Q 4FF3A 3CRLC 2R9IA 4MTFA 3KJPA 2R7ZB 3CCEB 5CBEE 3W2DA 2VXWA 3IRBA 4Y7CA 4RDJA 2K5DA 4DR5Q 1GM5A 3OOCA 4DR6B 5T1IA 2V1CC 3GD7A 4LF9L 1QUQA 3GTMH 3TETA 4YEJA 4B48A 2LSSA 1KD1D 4XORA 1PNLA 2P5ZX 3BQJA 5JAVA 1VIBA 4XNFA 4DAPA 2BH2A 1W3SA 2NBFA 1YJ9B 1E3XA 3GTGH 4FK8A 4OPOA 2DJGC 2QDXA 1A3TA 5EKIA 4HYOA 1ZEQX 5JEAJ 2ZZEA 3A35A 1U4LA 4N3GA 1YJWB 4XT3B 1Q86W 4QIWB 3J81L 4TV9B 4KL1A 1BQQT 2SNMA 3ZRVA 3Q6RA 4BIUA 3AG1C 1D1IA 1ZAUA 2Z0AA 1N0JA 4UDUC 3CKIB 3MXGA 3U4ZA 2CC2A 4ZYSA 2KKWA 1SETA 3CQZH 1P7BA 3LDDA 2UXBB 1F2ZA 5IYCG 2L0CA 3PV0A 2LGQA 2QWOB 1SM4A 2R93H 1VCIA 1JQ0A 3ASNC 2DQ3A 4A3EB 3HKCB 1I0HA 2NVYH 3ULJA 1H2KA 3DXRA 3FYIB 3NBHB 3R2TA 3D6CA 4CDFC 2XOKA 1CKNA 2XGJA 4JI5Q 2WAMA 1I18A 5FO7B 3APOA 1F9QA 1AMOA 4B3TQ 3J7YW 1W59A 5B1BC 4RAIA 1LYLA 1AZQA 3ABLC 5CDFA 4ILWA 1PH8A 1P84F 3OEHA 4X7CA 1HVXA 3NQIA 4J41A 4DUZO 1FJGO 2O5IC 3A3GA 4DV7O 3SJPA 4FM2A 4A93G 1VF6A 1VQNB 4UVBA 4LF9O 3JD4A 1XB2A 1PTOF 3PA1A 2B2UC 3CCJV 3SPJA 4X7EA 1GTOA 1GKHA 2M9VA 1YHQV 1LT6D 2QCPX 4RD0A 1RTNA 2HD3A 4JI2Q 3RZDH 2JA6B 2UUAQ 5ELNA 3SJAC 4QNHB 1IL2A 3HKZB 4RCNA 1LACA 3AK3A 2Q8IB 4DUYQ 3I2ZA 2PY5A 2OK7A 2LQTA 1AI4A 3IFDA 1OB5A 4I4TA 4DUZQ 1FJGQ 1L2FA 4C7UA 1XREA 4FFBB 5B3SB 1K3BC 1EY5A 1O7YA 4NB5A 1EFCA 3AVXA 1WCMH 3S3XA 4RPDA 5IT9E 4UCVA 3NQTA 4UAIA 2QDOA 4YY3Q 5CN0A 3B8HA 5IYBG 4QJFA 4QGUA 2YS8A 1XX8A 1SA0A 3BVMA 1KC8C 2AXTZ 3SYAA 2B1GA 1GAQA 3OKXA 3DXJC 3J7AF 4PA7A 4A3BB 5KYIA 4UZUA 2MUYA 4TMTA 5AJ3L 4OIKA 1A8PA 4J15A 3M8AA 1KKDA 1JNYA 1PFBA 5IYZB 5HKKA 4TQFA 4X20B 1C9OA 4LFAQ 1FS0G 4XYQA 2XTIA 4A3GG 3S2HB 2AHYA 1X6OA 1SNOA 3I5DA 1P8LA 1HWYA 3EHBB 1CKOA 1QX4A 2K4KA 4L5RC 4RD1A 3OMNB 4H37A 5LBQA 1SQBH 2M2LA 1UNSA 2B8FA 3W7XA 4K5WA 1N32Q 4QMGA 2K5HA 1PLFA 4QCLA 3T1CA 4QIWF 2EDGA 1B9MA 3ZMVA 3HOYB 2BE3A 4QIWE 4TV8B 1PNMA 1BLIA 2YV5A 2SNSA 3CP0A 2HLDG 4HJ9A 2IY5B 2GJKA 2Q0OC 4X1YA 4IL6Z 2E5LO 5J35A 1SYGA 1JC7A 3AG4C 4YCWA 4DRXB 1A62A 2MK3A 1PP9H 2VB2X 2QKAA 2L4NA 1KRHA 1TVKB 3BA8A 3OAAG 1VQ8V 1GN4A 3MD0A 1ESRA 1PPJH 3BCFA 3E22B 1Q86C 3CCQV 2RC5A 5FOBB 1R5OA 4EKWA 1BJKA 1F9RA 2Q2UA 4DW1A 2CTRA 3BY6A 4OPAA 4GX5A 4JZGA 3C1EA 4DV4Q 3HOUH 1Q82C 3BH4A 3K5MA 2NZOA 5IT9c 1DM0B 4Y7NB 4M53A 2BE5D 3I55V 1KMHA 4X64Q 3B77A 1SQGA 5CORA 1FXKC 3RYCA 4LR3A 4FO2A 4A3IH 2BV3A 2NWGA 1L1OC 4ZUJA 4DAVA 3PO2G 4MS2A 3C3SA 4JYAB 3P3NA 3KOJA 1ZXTA 3E2EA 1PJ6A 2C2AA 3PVDA 1RP3B 1SA0B 3Q39A 2CH7B 4M2LA 4Z4TA 1OB0A 4RWSC 4JI3L 4AIMA 4QUFA 1PTOC 2NLJC 3LNNA 4UAJA 2Y0SG 2Y4TA 3L73H 2Q7EA 2ZZFA 1PZJD 4BBSH 5FIUA 2AQ2B 1VF5C 1L8DA 5LL6S 4XXEA 4O4JB 2EILB 4G2KA 4TMXA 1W6JA 2MQHA 4OGQC 5IGDA 1LABA 3VR2A 3H3VI 1AIPA 2QF7A 3CB4A 1MZFA 3ULPA 2E2JB 4WJ4A 1H85A 4UY8C 3NELA 1QUEA 2YUAA 3G6EB 2OTLB 3W5UA 1Q82W 3SLNA 3J80L 4PD4F 4JOIA 1PTOB 3UDXA 3K7UC 5IYBO 1FGBD 3QJYA 3VYRA 1SNPA 4A3FB 1KXLA 4ZIBA 2DCUA 4WFFA 3CPWU 4H44C 2OYQA 3N27A 4C3HG 5IP9G 1N8RC 1K7DA 4K0KO 4A3CH 3O9OA 1R4QB 1SE4A 1WTXA 4OX9B 3J80i 4ZCMA 2GPJA 2UUBQ 3QO5A 2WLNA 4O4LB 1SYBA 3HKSA 4UP7A 3UI2A 4XQFA 2Q7GA 1ZL8B 4DR3B 4NTXA 4GKJO 4Q7JB 3L3OC 3E86A 2AZ2A 1GM7A 4Y9RA 1CQFA 2JK5C 2LO1A 3VNVA 3VQXA 2HHHB 3KLWA 1XNRL 1Q90D 1P4RA 1I6HH 2V4DA 3DC5A 3OP1A 1SNDA 4X20A 1YEZA 4LFCL 5M3FH 1WTWA 1I5FA 5LMNQ 3B4SA 2VJJA 1EFID 1A2TA 2QKIC 1E1RG 1XHZA 1HNZB 2LZJA 3EVQA 1YNJC 1BCPF 3F8TA 5IT9L 3SPHA 5C0XI 4O4IB 3O65A 2WFWA 2JA5G 2ZZGA 3OTOB 3MMPA 1AJPA 1GUGA 4PZ6A 3N2KB 3DM1A 3A0BZ 2G38A 2A19A 4PMCA 4NXMO 4TSSA 3RLFA 1TAEA 4PDRA 1S76D 1JA8A 3MXUA 1S72V 3CQZB 5EKKA 1DTOA 2Q9LA 1BCPB 2Q67A 3PA2A 2F0JA 3FP9A 3FRPB 1BBXC 3KKYA 2EIKB 3CC4B 2DWEC 2EZPA 1F2LA 1G8ZD 3V2TA 2VZAA 3JQPA 4DRXA 1WOPA 1ENAA 1SXTA 2NVYB 3VDYA 3K59A 4J8QA 3ES9A 2X69A 1QU7A 1O78A 4NKLA 4JI5L 3STBD 5IGCA 1OCOB 4G7HC 1GO2A 3WBKA 1BNZA 1G7RA 1N0VC 4KD4A 4ME3A 4XLHA 1B7YB 1LT5D 2IX3A 4DR1Q 2EINC 4GLVB 2B2YA 3I70A 5C4HA 1WTRA 1Y1VB 3G71A 2ZINA 4DV3L 4NXNQ 4JV5L 3L0OA 2B63H 2PZUA 1FNBA 4O4JA 3AG3B 3AVVA 2K04A 4X9QA 4XOPA 3VOUA 2K75A 1VQMV 4RHRA 1F60A 2F0FA 1DOLA 4JI1O 3JAMN 2VNHA 1GHJA 4HSPA 1KIXA 4P9OA 1SE2A 3TQYA 3CE2A 3VR5A 4X88A 4V0BA 3D4DA 3H0GB 2JEUA 2ZXWC 2LS01 3CCRA 1WORA 1NH2D 1AE2A 1NTKH 3G67A 3ZMZA 3KBGA 4KXRA 1KZLA 1NE3A 3GTQB 4K0KL 2JGDB 2R7ZG 1M5IA 3QG5A 3CCRV 4PQXA 3I56A 1IBKB 3FAVB 3T16A 3GTOH 3FB8C 4CKBA 2W6IG 2MP1A 4LF7B 1Q3LA 2BTQA 3AGQA 4JTAB 1EP2B 4DV3B 4JV5B 4KHPQ 1SDFA 4MIUA 2JJ2A 4JBJA 1H9SA 1M1KC 1P49A 4A3KB 2JA9A 3UT5A 3NK9A 1E79A 1OJHA 2B2WA 2EY2A 4JF3A 4ME5A 2QA4A 1M93A 3CRQA 1F77A 1IZ3A 4K0KB 2Z1CA 4X65Q 1SEBD 1IL8A 5DAUA 2AUKA 1NKDA 3S1NB 4H13C 2IM9A 4PA3A 5JJZA 1K4CC 4DV2L 5J2UB 1JA1A 3A7AB 1L0LH 4L87A 4ID6A 2K01A 2WZNA 4J9ZB 2ARHA 2CNDA 3CSXA 4A76A 4B3GA 1NJIC 4CS2A 2IX1A 5EIBD 2BM1A 3L9AX 3SXHA 4XQQA 3VR3A 3SR1A 2HIVA 1C0AA 1HZBA 3OR6C 1N33O 2B7BA 1X56A 4C1NK 2XEXA 4XBFA 2E76B 3JAMi 4OOSA 2XNCA 1DOMA 1NBWA 5DN6G 3BAAA 3T1YB 1ZYRD 2AHZA 2GDSA 3Q6SA 4QHYA 2IH1C 4UB8Z 4YY3O 5EZYB 1NTMH 1HTPA 1QWYA 3ASNB 2XNJA 2KECA 4R9WA 5COYA 2VQFQ 2F3WA 4A3GB 1WLEA 5H6RA 1HR0Q 3I4OA 2D0PA 1MOFA 5C4JB 1UUPA 1VQNV 4QB4A 5JH7A 4WRDA 2F0NA 2UXBL 4HE5A 2DE0X 1O9HA 4K3AA 3PJSK 2SEBD 3L7ZC 4CHTB 1UPGA 3FKSA 4YAOA 1MJCA 3U0ZA 1YDXA 4Z2WA 1TLLA 3FYEB 1VQKB 1TWGB 4LF8Q 3HOZB 3F2CA 2FTKA 5IT9N 2HDMA 3EXAA 1XDCA 4LWCA 4JI8B 4B3RQ 2QTLA 1I6VC 5HY6A 2JK8A 3RZOH 3UCSC 2KENA 1YI2B 1VQJA 2IX0A 4K5XA 1ZKOA 2K52A 2VB3X 2Z4IA 4MYUA 4L5TA 2Q2HA 3HOZG 1N34L 4LFCO 3WU2Z 2ZE8A 3L72H 5GV7A 1X3QA 2RSOA 4H7BA 3HOVB 1VP7A 3BY1A 1M90C 1NS1A 3PCOB 5LMZA 2Q5ZA 1EZJA 1CM9A 2F43G 4GUNA 4LFCB 3AVYA 3OUFA 1PTOH 3RY8A 2IT1A 5KX5B 4PZ8A 3VQYA 5BSYA 1EFTA 4Z4SA 1RKNA 2CWAA 2Q2IA 4LNUA 2BOBC 3D3RA 5IYCH 2P6JA 3CCJA 1FNVA 5FO9B 4G57A 4IURA 5CA1A 1P7GA 3FKIG 5LHY1 2XWJB 2HP8A 1GO3E 3GTPH 4XMYA 4AF7A 1PRTB 1C48A 1PH5A 2OK8A 3MXPA 2QDLA 3A8KE 1SROA 5M3FG 4DR7L 1VQNA 1JCKB 5ELOA 3LDCA 3M4PA 1VQ7B 1M1KW 5DM73 3HKDA 1AVMA 4MNOA 3K0GA 3QVNA 1FD9A 4LC1A 1VLOA 3J81j 3HOXB 4FN5A 5TY0A 1N4CA 4LFAO 4Z4WA 1VQHA 2F0TA 3BU2A 2WLMA 2UUAL 1S72A 3D0FA 1BX0A 2YTXA 4KHZA 1GD7A 3J81E 2UXCQ 2BSKA 3A0JA 3P20A 2ZNJA 4F87A 4OO1I 2VNUD 4H33A 1GVHA 4AVZA 3PGZA 5B1OA 4DNTB 2M00A 4RGTA 4ABMA 4J42A 5LHHA 4RQEA 5H9CA 4RD4A 2LXJA 2OCEA 2JSOA 3QG1A 1T5XD 5M3MB 1SC5B 2PZWA 5JVDB 3HGBA 2NVQB 4LF7Q 1US6A 2KQXA 5L3GA 3TZDA 1VDZA 1JJGA 4Z1MG 4JI0Q 5DS0A 1PH1A 3V76A 1VQLB 1BOSA 1K8GA 3TS0A 1VARA 4IO9A 1Z5VA 2QE7G 1TWCB 3AG4B 4ACAA 5LA6A 5H2FZ 1KTVA 4KJOA 3TMEA 1Q6HA 1QOHA 5KMGB 4JI2O 1PHJA 1V43A 1MZEA 3A8KA 4XN3A 4ZGQB 5M5YB 4YAFA 2UXDB 2JIZA 1OCZB 2XZOA 1VQOV 2L35A 1ICFB 3W5OA 3GTJH 1R73A 3E22A 2B8GA 4BA2I 4OPVA 4NNJA 4JYBA 2WKCA 5GONA 1SMYC 2MGSA 5L3BA 2K05A 4RA8A 1SQFA 2DYRB 1XNQB 1QUFA 1D5NA 4TSFA 4FLZA 1AN8A 2GA4B 4P73A 3VA5A 4A3IG 3K7AH 1ASYA 1BL8A 1FXKA 5JH7B 2VWJA 3E8FA 2ZL5A 2VBVA 2BH8A 4XLFA 4C43A 3S1RB 2BTOA 3MDSA 2ZXIA 4XYOA 4ZAIA 2PMZB 1GKFA 5ISRA 2DN8A 3P75A 4HIDA 4YHHL 1UEAB 1R9TB 1AJNA 2HG5C 2P5OA 3M3YH 3B40A 1Y6XA 3HAGA 4A93B 2B2TC 3CHBD 3G6JB 4B43A 1STHA 2JDIG 4I65A 1ZLZA 4HEDA 4IUPA 1B50A 4LBYA 1F4MA 5I6WA 4DR2Q 4LF6Q 2OCCB 3ABKB 4HNAA 4J7JA 1E63A 5EJWA 4JBKA 1OCCB 4EH1A 3JCUZ 2E1BA 2F0UA 1M9NA 2A69D 3KUPA 3K8AA 4G27B 4YJ2B 4DV4B 4GNXB 2GJPA 1ENCA 4B3RO 3T4ZA 2F0DA 4K2LA 2V7VA 5CB4B 2XUMA 1YX2A 1Z2GA 3DMUA 4AYBG 4KHPL 2QKSA 3WDNA 1KLGD 2ZE5A 2DJVA 1SRYA 1QCBD 1RF2D 4NB3A 1O9GA 3M4OH 3E8HA 4X0CA 1EOVA 1FFXB 2WAQB 4QY7A 2EZVA 3S1QB 5JPMC 2WPDG 3LVBA 1F51A 4R8NA 2ZXHA 2JA5B 1EN5A 1M8AA 2PI2A 4JI3Q 3ZHVA 3K03A 4II3A 2L15A 1Q12A 2RNBA 4HR7B 1XMOB 1IBLQ 5H1SE 4B3RL 3PO2H 1CZGA 2WSSA 2W6JG 1LLRD 1NJIW 4IPCA 3T4AC 1CSQA 2A7WA 5C4XH 4A3MG 3NWSA 3K58A 1VQPV 4AC9A 4J0QA 1LT4D 3UDFA 4PC6A 4DV6L 2H94A 2GHYA 4I9WA 1TA8A 3OE7G 4MT8A 1VMGA 1PV0A 1PRTF 4YCUA 4U3JB 1WOCA 3KBXA 2XOKG 4A75A 3JATB 2I07B 3C3LA 5LP6C 2PQAA 1JPXA 2RVLA 5ELFA 3QNEA 4B08A 2XAJA 2WPDA 4XD7A 1JJ2A 3PIP3 3RR5A 2ZZQA 2LW1A 4A4IA 4QE7A 4ZUIA 4DV5L 2BMWA 3NP8A 4DV7Q 2VQFL 1ZUQA 3U4VA 3BNWA 1ILPA 1G7TA 1CKNB 4HNAB 1AE3A 3DHQA 3GDEA 4DA2A 5HURA 3OUSA 1Q46A 2XZLA 3I90A 2KSDA 1PM9A 1OXTA 3VR4A 1FL0A 1KQSB 5EGTA 1I7FA 4MTKA 1I4RA 1GN6A 1HFGA 5C3EH 5EK0A 2RJZA 3DC6A 1KKCA 4P3IA 1I4GA 4C3HH 5IP9H 1YHQA 1WAZA 1V55B 2DYSB 5F4OA 4B3XA 1B53A 5IJ0B 5E79Z 2KJXA 1DDIA 1SFOB 3HOZH 2DGYA 1QUQB 2HHHO 2A3QA 1WTQA 5LP6A 3GTKB 4GZYC 3BVZA 3SDLA 4OPSA 4L6TB 4IFDH 1NCVA 2F95B 3IL8A 3R6JA 1E1QG 2WLKA 3HKBA 3X2QB 1B06A 2E74B 2O4XA 5FKAC 2E2IH 3BYTB 2HDLA 1VQ5B 2QEJC 4OHJA 1EP1B 4A3JH 2IHEA 1SF9A 4I4TB 5JQGB 4DKAC 1GJRA 1I50H 4BY1G 3AB9A 4JI7O 3I56B 1KDBA 4A3DB 5IJ9B 4X62Q 4DR6O 2D3NA 1AR1B 1PNKA 4B3MO 1EY7A 4EX5A 3TN2A 3Q23A 3NWTA 2Z3YA 4EB6B 2OIEA 4PDMA 2LXKA 5IYDH 2UXDQ 5J2TA 2EIJC 3H9VA 3JATA 1NVPD 4RPBA 3VNUA 1TS5A 2YC0A 1GAXA 5FO1A 2A6ED 3C2QA 2IJIA 4XLAA 5FNZA 3W3AA 2YDEA 3APQA 4CH6A 1IB0A 4IIJB 2QTZA 3OEEA 1E3PA 1EWHA 3PUWA 2NVXH 5LL6Y 4X62O 4LWSB 1FAFA 2YWFA 4NXNL 3SE0A 3ASSA 2CFMA 1FRNA 1DK1A 3FEWX 4UUJC 1W0KA 3CC4V 1Y67A 1SLJA 3HOXH 4JK1C 3BRCA 1I5YA 1WDTA 4ZV4A 2YEVA 1I4QA 5M5XH 1XMQB 2D0OA 4OEMB 1YHBA 5FJ8H 3MEHA 1YITA 2UU9Q 4RFBA 5AG2A 3P32A 1NB9A 3JQRA 1V0FA 1YZ6A 4IUNA 5K5PA 1UEBA 4X3SA 3CCVB 1JB9A 4DUYL 2B63G 2O57A 4UCOA 3ASOC 3JASA 2FB5A 2NV4A 3TP8A 3QB3A 2JA7G 2Q7HA 4CDDC 3WG7B 3CMAB 1HZCA 4YHHB 1NB0A 1EEID 3MC0B 2A74C 4YIJA 1IW7C 1TXYA 3TP7A 3H1KH 5LMUL 2HQLA 4H0LB 3B8NA 3QO8A 4JI7L 2NVQH 1DLBA 2L6LA 1B3AA 2JIZG 2BGJA 3P1HA 1SMYD 4B7EA 1KRSA 4G28B 4JI3O 3D31A 2X6CA 2JA5H 5LMUO 2FYUH 4KFMA 5JJIA 1XNQO 1QNUA 4N21A 3CXCU 4K1XA 1HNWO 2OBRA 2NUCA 1X54A 1K8AW 4DO2A 2OXPA 3PQIA 1W0JA 4BIOA 4DR3O 4YJ3B 3SK4A 1N33Q 3ZBHA 1Z47A 2F0PA 2R7ZH 1BQZA 3OMGA 3Q3AA 1R6KA 3LO8A 1J9OA 2M7WA 4J1MA 4OELB 1IXMA 4UFZA 3RYCB 1WSRA 1QVFB 1MA1A 2ENBA 4MVZA 1XMOQ 3THOA 5C3WA 2UXBO 4OP7A 1S77D 3BA9A 1IBLO 3ICEA 3GTGB 1LNQA 3RW0A 1W9XA 1W87A 2I5MX 4IHJA 3IGAC 1GUOA 2QEXB 4IOCA 1BUVT 1EZ6A 5JOBA 4GCZA 4KY6A 1HP8A 3TDQA 5FLXE 1CQVA 4KUMA 1QILA 3DWPA 5M3MG 1W35A 1KAAA 5B1NA 1YLOA 2FVGA 2YXYA 4JZ2A 3OSOA 3SYPA 2P7TC 2Y69C 2E5LL 1CEZA 4IW3B 1E1OA 2HUGA 4MZ9A 3T56B 2X6YA 1F4NA 3GQBA 2YXLA 3I4NH 4BPRA 1ESFA 2BOSA 4PDVA 2VNKA 1TIID 4HE6A 5IODA 1R3LC 1CUKA 3ZMSA 1K0SA 4B3SL 2D3LA 1MSWD 1GR1A 5ELBA 1PTOD 2JXMB 1HQRD 3LGJA 1J5EB 3ND9A 3GTLB 4A3LG 2A6HC 1X65A 5IY5B 5LMNB 1GAWA 2KHJA 5IWAQ 4LF4L 3BZDB 1KABA 3MVVA 1LTRD 4BBRB 1QLEC 3MHSC 1ET6A 1Y74B 2VW9A 1PJ7A 3V7AA 1U0LA 4CKEA 5TISZ 1HNXB 4LBWA 3KCXA 1QH0A 2CCZA 2C5BA 4DV1L 2CGOA 1SERA 3PIPA 4LF8L 2F3VA 1NSNS 1PD3A 1K5QA 1FPOA 2AQ3B 3ITPA 1VF6C 1EWYA 3A2FA 3OMIB 3ZJYC 2IWHA 2I46A 2JA6H 4KHPO 2CUGA 5CV8A 2R70A 4GYCB 4HJ5A 1VQ8B 1YJNA 5IGBA 5IK2A 4X1YB 3CMEA 1ONLA 4F6RA 1HA5A 1X3FA 1URFA 2PCFB 1LR1A 4DV5O 2OBTA 4ZBMA 1Z9FA 2QEXA 2M6YA 3W5HA 4DR1B 2VBSA 2N78A 4RH6A 2K50A 1NY4A 2DETA 3RT3C 2N49A 1VQ7A 1HNXO 3NSWA 2NYZD 5C8YA 5J3OA 3BZKA 5LGNA 1GRJA 1OCOC 2XHBA 2VQEB 4DV5B 2R9VA 1AW7A 1U4PA 3CCQB 1Y8PB 4P26A 4FWTA 3EJIA 4JW0A 5GTHZ 1AI7A 1HNXL 3DWAA 3HG9A 1YHQB 3AK1A 2C35B 3X3MA 4LFBQ 3AK2A 2EJ7A 4DV7L 4U673 2ZT9B 3RMHA 3T53B 2XIWA 3KF6A 3WYAA 1ZX3A 2R72A 4NP5A 1LTGD 3OGCC 3AG3C 1A2UA 4GX1A 1AEXA 5FLXL 3W2HA 1W0JG 5DM63 1QZGA 4QQBX 2WP8J 1STBA 1MG1A 1E79G 3JARA 2ZL6A 2UU9B 2OT5A 1G291 4RGNA 2E2DC 4PDLA 3KF8B 5EPLA 3CC7A 4E2LA 4JI5O 3J7AU 1PYWD 2Q6AA 1Q3EA 4U7OA 3UE1A 1L0WA 3FMCA 4JAUA 2EOTA 4TN1A 3N6RA 2UU9O 3TGUH 3K5LA 2VBTA 4ODGA 1WNSA 3P3PA 4RGMA 3U9SA 3PN1A 4YHBA 2NZHA 2E3CA 5EIBC 2Q6LA 2A1AA 1OB2A 5K36H 5C6AA 2I1LA 2F0KA 5CV7A 4YY3B 4K14A 2Y0SB 2ZE6A 5IYDG 3Q8DA 4R6ZA 4Q20A 4LF7L 1COWG 4JYCA 5JWPA 3SEJA 1LV9A 2CWPA 3TREA 4K6DA 4QE9A 3HB3B 4JI0L 1G1XB 1N33B 4J7ZA 3JAWA 1CQXA 3H01A 4K0KQ 4M1UB 4RMFA 1B3QA 1YZBA 3SYQA 4DK0A 2AHOA 1NRKA 3R65A 4LWSA 2P3MA 1Q1BA 5F2DA 4Y7NH 1GMGA 4CBCA 2R7FA 1CA5A 1NR1A 4X66Q 2N8NA 1OO9B 1JOOA 1VQ9A 4G6IA 2F4IA 2ZBUA 3S9WA 3CPXA 1LUVA 3ZJZA 1KHIA 2PNHA 3E6ZX 1SZTA 1E24A 2E2JH 2ITDC 4LFAL 4KD3A 4NW2A 1Y4MA 4II2A 3J81k 1JB7A 4PC1A 2F0SA 5FK9C 2V7QG 3NBHA 1XUQA 1HW7A 1M56B 3OJXA 1EBOA 1LTBD 2F0MA 1AZPA 3D3IA 4P74A 3AG7A 3KLRA 1OCZC 2ATKC 2VRZA 4CH5A 3MWYW 4F7XA 4X65L 2PQAB 1R3KC 4LF7O 2HKOA 3C90A 4JTCB 4U3FH 2KCNA 3GV3A 2Q2TA 3S2DH 3WBJA 3S17H 1GH6A 4P71A 5IWAL 1OXUA 2E76C 3W2EA 4M4SA 3PUZA 1MJEA 3IFXA 2M5SA 3CP2A 4Z4YA 5E7NA 5CBFA 1XILA 1BO0A 1Q7YC 1GUWA 3RVYA 1Y14B 2WLLB 4DR4Q 1H2NA 5K1PA 2F0VA 4BWAA 3E3XA 1KK0A 5DECA 1K33A 2CK3G 5I4DA 4P2ZA 1E1RA 1ZM3A 3EA6A 2WLIB 4DV6B 1SZXA 3R8BA 3FB5C 2J7KA 1YHAA 1ASZA 2KCTA 1EFWA 3HOYH 4DN4M 2OBSA 3BDOA 4JYAQ 1PV4A 2O5JC 3I4LA 3OTFA 5FLMH 2UUBL 2PTMA 1GUSA 4YXWG 4ZCIA 1WI5A 3NXSA 4LF5Q 1QLNA 1PL0A 5KUKA 1W34A 1NTZH 1WPCA 3BZCA 3LQEA 1VJSA 1VQPA 2XN9C 1U2RA 3QFSA 1X59A 3MHPA 1JJ2B 3UO3A 2B2YC 4JAVA 1QZHA 1Q1EA 5G3LF 2BTQB 1I6HB 3DEPA 4GKKO 1RHPA 1YVCA 4LAAA 1AP5A 4HIZA 1YVWA 2A06H 4OWTB 4LFCQ 4B3MB 2EYHA 3ZPNA 5IDJA 3RD4A 5C3EG 5LMNL 2K28A 2JEBI 1GJXA 2B5UA 1S0VA 3SKBA 3J7ZC 1HA3A 1FNDA 5KHGA 4XR6A 1STYA 4IPDA 2HVKC 2E74C 2Y0SE 4ASUA 4JI8L 3UDGA 4W4KA 5KW9A 1H2GA 2D9RA 3E20A 5KLVH 5IJ9A 4IFDG 4D7TA 1ILQA 2YYZA 2D9UA 4JI1Q 2MPMA 4MVRA 3M4YA 3S16B 4WZKA 1H42A 1KP2A 4CC5A 2YSUB 2UUBB 1UE7A 4P1VA 2RA4A 4A3JG 1AB3A 1X4TA 4Z4ZA 4NYKA 4X3KA 3UKMA 1R1BA 1K9MW 3I55B 3PO3G 4DR6L 1R3IC 1IBML 1D5AA 5IYNA 4YIOA 2OWOA 2RCFA 5L37A 3I4MG 4ZHQA 3KG2A 2ZT9C 2HMAA 5KHJA 5CA1B 1N34B 5LYJA 1M90D 1EQVA 2D2CB 3CCSV 2TMPA 4ZCKA 5BR8L 2JA6G 2UXCO 2LJ2A 3FPPA 4K8IA 2B63B 4ACBA 2RN9A 1X3EA 4M1KA 4KY7A 3ZCCA 1K83H 1U4RA 2ZITA 3RWRD 2WWWA 4DW0A 3M7NA 1WTOA 3S2DB 3H9NA 1PL4A 2ZDIC 4DQKA 1EEFD 1SNMA 1IZ6A 2CGNA 4DGZA 3OTOQ 5C4XG 2ZR2A 2OYNA 1SNQA 3HEJA 2CH4W 1R5BA 3NPPA 1NR4A 2D5DA 1HNZL 2JDIA 1K3RA 1THZA 1ICWA 2L11A 5BMVA 2O2LD 5EKLA 4FLYA 3H0GH 2BSKB 1S4MA 1D1KA 4JI8O 3HOXG 1A8VA 1K3EA 2DJFC 1BMFG 2JVDA 4JOIC 3PUNA 3WXMA 3HKEA 2Q8VA 1Q81W 2VQFO 2YI8A 1EIYB 4XDJA 5DM6V 4OPHA 4JI7B 3I91A 1L0NH 2FJ2A 2HLDA 1JR0D 4TV9A 2ZJRA 1SR3A 1KK1A 2NVTH 4WZLA 4JI5B 4YJ3A 2L1BA 1E22A 1OCRB 4BY1H 1BKBA 5A89A 3CCSB 3OWEB 3E35A 3TCUA 2VY3A 5D14A 4X66L 2F4NA 4DV0O 1Y1VG 5IYBH 1K97A 4MVSA 2EINB 4OOXA 3BEHA 3LQ6A 1IYUA 3G71V 4N3NA 1Q82D 1JA0A 2PO4A 1G6ZA 5F2VO 4R8CA 1N36B 2F0GA 2PW7A 5E1FA 2JS5A 3DWQA 2YICA 1BX1A 3G6EA 1QR8A 5CA0B 2PGGA 1J6QA 4ZHQB 2QM7A 1UJWB 3CPWB 2K7VA 4A3GH 5K36G 2UXCL 2GQFA 4FYDA 4X7FA 2YU9H 3MFGA 4G7OC 4RLZA 1VF7A 3A8IE 1GUNA 3HKZE 4G7XA 2VWKA 3AEIA 1YIJA 1JMCA 5GTIZ 3CD6B 4LBEC 4K35A 4MYTA 1FNCA 2DWDC 4P2NA 5HXBA 1YNJD 2RC6A 4P30A 1NMFA 4PV1C 4D6TH 4DR5O 3D3QA 3ZRXA 2EYJA 2OQ0A 1TWFB 2ZM6O 5FJ8G 1TWGH 1VQ9B 2CW5A 1XXGA 2EYFA 3ZX6A 3QWNA 3JAKB 3A8IA 4PABA 4KHPB 2DIEA 2XGTA 3J81N 1FYJA 2BA0A 1VQPB 3OW2B 1K9MD 3AVUA 3T1HO 5L3DA 2VBUA 5EPKA 1RM1C 5C44B 4JI3B 4RCYA 1JORA 3ZHRA 4XT1B 1IHZA 1UD4A 4JVZA 2UUCL 3DLLA 1FXKB 1PH7A 1V1PB 1EQRA 2BPOA 2GTAA 3PUMA 1QVFU 5CMUA 2OTJV 1YEWA 4BWGB 4JYAL 2UXBQ 3FJOA 3OD4A 3CS5A 4C3JG 1MI2A 2F23A 2UUCB 2V7WA 2SDFA 1KC8D 4J80A 3QFCA 3CW2C 2LMCB 4NTYA 2XT9A 1E62A 1STEA 3OIPA 4LF9Q 1SS3A 1UD6A 2KQ3A 3BJUA 4DNRB 3VYTA 3R3OA 5IP7H 4NXMQ 1FR3A 1ZTEA 1G7CA 5EBDA 2R92B 1KRTA 1VQEA 4LC0A 1X3PA 3A54A 3MTSA 3OIQA 4ZRZA 1FYCA 4DV2Q 3ABMB 4I55A 1FNMA 1QFZA 4B47A 5EC2C 3TSSA 3F2DA 1IBLL 3S17B 2MO1A 1V5VA 2ZD9A 4B3TO 4KKTA 2EYOA 3FPKA 5M5WH 2ADQB 2PNRC 4GKKL 2A6EC 5J1ZA 2AGAA 3T2MA 1KLUD 2X6GA 1EM1A 2FL4A 3CCEA 2F0OA 2HHHL 3T1YL 1QCEA 5TV2A 2R92G 2F3IA 2I0QA 3BHPA 2B2WC 3CRZA 4HMIA 2RDHA 2IU3A 4GNXA 3HOYG 2ZTNA 5CGKA 2ZE7A 1T5EA 2B9ZA 1BHAA 2NN6I 2JEXA 1BSMA 2PLFA 1BBWA 3H6MA 2F0WA 4G1BA 3B6YA 1V8QA 5DNFA 1J5EQ 4HCSA 5KUMA 1HR0L 3CAMA 2WJYA 2LFSA 1EYDA 1Q86D 3PUYA 2BN4A 4B3RB 1H8EA 1H95A 5KA6A 1PMRA 4BY7G 1MNGA 3H1IH 4KKUA 4B3SB 2F52A 2HCIA 4LF5L 1WB7A 4FPPA 5KHHA 3D4RA 4DV1Q 4FXDA 1WU8A 3H94A 3SYOA 3ZHUA 3NEMA 2JGDA 5CBAE 2QGQA 3H1JH 1R3JC 2HDNB 5DN6A 1ENFA 2ES2A 1NUCA 1OGIA 3BABA 1RD9D 3C46A 2NPFA 1EQTA 4XDKA 4PA6A 2IJ0A 1VQLV 3F1ZA 1D5XC 4DFAA 4NR1A 4GOPC 2IPKD 4JI4Q 3M4QA 1V1QA 4FK5C 4XN0A 3PO3H 1WP8A 2QWPB 5IE9A 1XE1A 4Q5VA 1SSOA 3N52A 3M7GA 1V55C 2DYSC 1F9PA 3V96A 1NR2A 1OXXK 3CC2A 3I4MH 5JJLA 2K03A 4AYBE 4O2BB 1GUTA 1SE3A 3GIRA 1V54C 3CRKC 3JAMc 1IYVA 3R66A 5IGFA 1I94Q 4LFBB 4WFGA 2H3OA 1QVGA 3D36C 4GS3A 3CYOA 2KHSA 2PMDA 3GB7C 3KJOA 1N36Q 4MVUA 1SYCA 1PRTD 2I5HA 4CH3A 3ZIAA 1JJOA 3CC7B 1FNUA 3KF8A 3A8JE 4C56C 2QM8A 5JCOA 2DYRC 1Z7TA 3HRZC 1JICA 4APVA 2NTTA 3UO2A 3A56A 4TWKA 4TVAB 3J80c 4Q6GA 1WD0A 4FMTA 3JC66 3GVLA 1YITV 2V7QA 2H4OA 2GK7A 4QUCA 3JAWB 1V54B 1I4XA 1K8MA 4FZ1A 3H0GG 1IBMO 4GT1A 3QFTA 5J22A 1OTCA 5JJKA 1X32A 5C4ZA 1Y1WH 4FF2A 4KMUC 4AH6A 1CHQD 4PZ7A 2Q6OA 3JU4A 3MHHC 4QPJA 3GVMA 2EYLA 4H0LC 1HNZQ 5B1AB 1GOZA 3J80E 3S14H 5A9GA 3P26A 3W7WA 5A88A 4YELA 2F0IA 1GK9A 1VEWA 4GNXC 5EBMC 1PH4A 4JI6L 3LSQA 2GN5A 4DR2L 4ZCLA 4R1JA 1J95A 3EFXD 4XKVA 1ENVA 2IL8A 3RN4A 1LO5D 1HR0W 1Q7YD 4BBRG 2WR8A 2ZL7A 1XBLA 4DR2O 1IJEA 2A69C 4IUQA 4YY3L 2JA8B 3B78A 2V7UA 2KCMA 4O4IA 3Q38A 1A15A 1I8DA 4G7WA 5C93A 2K5WA 4O0AA 1XTDA 4IIJA 3N2GB 3CJHA 1H2MA 4QGPA 1DCZA 5FPOA 1HQMC 4MTOA 1HNWQ 4IZ8A 1SQQH 3ND8A 2UUBO 1GN2A 2OTLV 4OXPA 1L0XB 3AG2B 2YWGA 4I50A 3W2GA 1YNNC 1XNQL 3S24A 1H38A 2QGGA 5E6TA 3CCLB 1R4PB 1E7ZA 3F2UA 4ZQ3A 3HOVG 1YITB 4O4LA 2OCCC 4LF4B 1FXHA 4HAMA 2KVOA 1OCCC 4A5UB 3ZEDA 3BVGA 1DZ1A 4DR2B 1TT2A 4W4LA 5FL7G 1S72B 3CD6V 1TWCH 2C4UA 3G48A 2F4VO 4MVMA 4MVQA 2YU9B 3ZS8C 1UFIA 4DUYO 2QN6A 4OWXB 3K9AA 4RDLA 4LUOA 2HHHQ 3ZC3A 2WLIA 5M5YH 5IWAB 4DV1O 2XRQD 1QGYA 2EYMA 1OHHG 1PYSB 1IBKQ 1RQRA 2EY5A 1BT8A 2JRIA 2VYQA 2ASBA 4AQYQ 1TUEB 1S3OA 3ZHQA 4BXXH 4LF4O 1E2WA 2R93B 5JVDA 4TT3G 3RYFB 1I7PA 4X07A 4PMBA 5IY0A 4B3SQ 1DJRD 2I5LX 1NZ6A 1IXBA 1D8LA 2BGIA 1U5KA 2MO0A 2EIMC 5HGTA 1NI8A 2WLJA 3FD9A 4HIMA 3AMUA 3NTKA 3CWBH 3A8TA 2PIAA 4F7DA 4X64L 5JPNC 4Z4UA 3WB0A 4UXNA 3ZZUA 4DR7B 5C3EB 1PA6A 2NNUA 2UXNA 3K0XA 1BXTA 2C5HA 1WTHA 4M8AA 2GREA 2XSCA 3AG1B 1ML0D 3D8GA 1DOKA 4B44A 2AQ1B 1VQ4V 1BR9A 4HJAA 5EQ0A 3EFFK 5IYRA 1A32A 1D6EC 4IT5A 3WNBA 1XNRQ 3GTKH 3ASRA 1JQYD 4ULLA 2R92H 1JFFB 3CMAV 3H1HH 4C2MH 4DXWA 2F66C 4JI0O 3CCVA 2W0FC 2YIBD 2KCCA 3I3CA 4EGVA 4RKBA 4KLKA 2ZR3A 2C4TA 2DUDA 2OQKA 5EYPA 1JWSD 2DY1A 2A8VA 5FL7A 2KB1A 3WB2A 2ZBVA 3HKDB 1HHVA 4MN3A 2ZM6L 3T1YQ 1QBZA 3OZVA 1QNKA 1XTCD 2Y4UA 2B3GA 2QMUA 1BHBA 2Y0PA 1NBMG 1CSPA 4Y9UA 1TUBB 4POGA 4CDCC 4BY7H 1EP3B 4DR6Q 1I94O 1ROPA 1HR0B 4B3FX 1VQMB 1NTGA 3A0HZ 1CA6A 4B3TL 1S5HC 4FM0A 2CQOA 5C4XB 2PZTA 5HFMA 2QWRB 1VQBA 3BC9A 5IYPA 3K6OA 2DNEA 4PMWA 3G6BA 1BPLA 2ATWA 2X53S 2CW0D 1G6PA 3AU7A 5GROA 3U6KA 3WFVA 2PQEA 3PIOA 4WF9V 4RUFA 4WZTA 2XZPA 4DV3Q 4ZGNB 4JV5Q 4XDLA 3FKIH 4EQNA 1TKWB 3S14B 2C78A 3Q4HB 1KTKA 5EBWC 4F4LA 1PZKD 1FFXA 1MSDA 3SPCA 1HZEA 1BDOA 3ASQA 2X6BA 2UUCO 4B4DA 2ODMA 3GVJA 2EE1A 5KNCA 3CCUA 1Y69U 2VQEO 1G2SA 2A9HA 2LFRA 5KNBA 3BS1A 2V1DA 2W6IA 1N32B 3Q22A 4P25A 3D4WA 2PW5A 3PO3B 1EWCA 5KYLA 2DN9A 3KK7A 3MEFA 2MJ8A 1PH6A 2P67A 4LH7A 3W5VA 1L1OA 4TQDA 1ZYRC 3AFPA 2A68D 3Q0AA 4DV4L 4F88A 4YWMA 4DXGA 2XVSA 2UXDL 1B04A 4CQJA 1STGA 1RPOA 3JCZA 4F6RB 4FLVA 3NTHA 1K9MC 1FRQA 2IJKA 2F0EA 4XM3A 2ZXRA 2E2IB 1H8HG 2XAFA 1XMQQ 4WFHA 2CTPA 2VJIA 1W0KG 5J2TB 4CS3A 1RIPA 2CQAA 2E8GA 2JP1A 4KHVA 3OPOA 5EMNA 1I08A 1YI2V 3GWKC 4UVAA 1B9NA 3OMCA 1I50B 3CX5F 3J81c 2WB1G 4DR1O 1Y8NB 4Z4VA 2KVMA 3AQQA 1SAPA 5IOCA 2K9PA 1EFRA 4PAAA 1I4HA 4C3JH 3M9BA 3WOEA 2QA4V 5KGUA 5C0XG 4PGOA 1QB5D 3CP8A 4WFBV 2QA4B 3GTLH 3K79A 4HTHA 2K5NA 2RDFA 1U97A 2FKXA 3STZC 4R4QA 1AP6A 3WG7C 3HKBB 4BBRH 1UD2A 2P4VA 3SGIA 4FZ0A 3FHWA 4HAEA 3RYFA 2QSAA 2VUMH 4ALPA 2DEUA 2QWNB 2X0KA 3PSIA 2PZSA 2NVXB 3U10A 3AGPA 2Q6KA 4JI0B 3OJWA 1IBKL 2A73B 3DTUB 3DGEA 3P7JA 4JI4O 1E64A 3EVKA 1R5NA 3GV6A 3UT5B 3SK6A 1TS3A 2YWHA 4ABNA 3U58A 1G91A 3ETEA 1PH3A 1VQAA 1OV9A 3WQZA 4AI8A 5D5QA 5LMNO 2WAQG 5EYPB 5HFLA 3JD1A 4OONA 1VQKA 2JA7B 3B09A 4JI6O 1KL9A 1V1PA 1WJJA 3K0YA 1TGOA 2WINB 3TP6A 2DW4A 4R4TA 3E9HA 3HOWB 2ZXOA 4XL9A 2Z6KC 3GP7A 3S15H 1JFFA 1E43A 3SK5A 4U68A 4NCNA 3L9DA 2VZLA 3EQLC 1JOKA 3AFQA 4M0LA 3TBIB 4MTGA 1XMOL 1DONA 4JI1B 3CCMA 1GO3F 1N08A 4DR3L 1XNQQ 3SPGA 4NXML 3J7A5 2D3OW 3ZBTA 1Q7YW 3T13A 4R4IA 5EZYA 2X85A 5ELDA 3CCMV 1D1NA 4OX9L 1CPYA 1RODA 1BF4A 1LTAD 5GV8A 3OM3B 1H8EG 2VQFB 4DK3C 2PMZE 1WJZA 1IXRA 1VQ7V 4FJCC 4GKKQ 1JR9A 1XJVA 1PVOA 4Z9CB 1L1OB 2RQXA 1JMKC 5EBLC 1GHKA 4RO2A 1N34Q 5JEAH 3STLC 3CCJB 4OO1H 3ERSX 3JALB 2UUAO 1IVSA 4PC7A 4X64B 2EIMB 2DYIA 4PC3A 5KNLA 5HGQA 5IIFA 1HTLD 4X1KA 5EC1C 4J11A 1DGSA 1B1ZA 3SHLA 1NVPB 3Q6QA 2D62A 1EL0A 4GLXA 3L71H 4DQLA 1UWVA 4DV4O 3QO2A 4PA9A 1HNXQ 1J8IA 4JASA 4YALA 5GAEC 4J9YB 1VQ4A 3GVKA 3T51B 1AI5A 1FGUA 2EIFA 5I2YA 2IW5A 5FO8B 5KIXA 4X8IA 5B1BB 1FDRA 4QVAA 4LUZA 3CMEV 3WY9A 1B4OA 3S3WA 5BN3A 1VQLA 4BAYA 4OOVA 2JN9A 2HJDA 1ELOA 2YTVA 4IFDJ 1HZAA 1SYFA 3I7FA 3I4NB 2C9OA 1N36O 2QEXV 4OWWB 1P4MA 4X89A 2CK3A 1IX9A 1WOSA 3D26A 2KG7A 3ABTA 4JCVE 2QTOA 1YBYA 4HMJA 4ZKCB 3F2BA 2NN6G 2GVAA 2QTSA 1YNXA 5JJEB 2R9AA 1N07A 3QIAA 3PF4A 3QE2A 3GSIA 4A3DG 1UD3A 2YIAA 5B1AC 5BR8B 3DDYA 5EBCA 2PI4A 1NH2B 2VQEQ 3QF7A 4PC2A 1N8RD 3L75H 3OYYA 4J10A 3PIO3 3BG3A 3W7TA 1QVFA 2Y0IA 1K73C 3CC2B 4XKWA 1CK1A 5BXZA 4TQUS 1B2RA 4RHSA 3M7MX 1F2MA 5THXA 4HJ7A 2LFNA 4UCSA 1XMOO 1VLYA 2ICIA 1I94L 1JT8A 2F0QA 1MABA 5D3DA 5LHGA 3ZHSA 3T1YO 5FO0A 5C8YB 4X7DA 3JALA 1F7YA 3WNDA 1CNEA 4LCUC 4POFA 1AR4A 3L70H 2Q0AA 4LF6B 4WQMA 2QILA 2JA8G 5IWAO 2IHFA 2X0LA 1F20A 2ALYB 3GO5A 2Z5UA 4P72A 1M57B 2P06A 2ID0A 5L3EA 5A35A 3CCLA 2NN4A 3NENA 4AYBB 4UV8A 1E0BA 4GZRB 1QG7A 1V0EA 1STNA 1D2BA 1VQ4B 5I9PA 3FAVA 3G4SV 2EIKC 4RJLA 4LFBO 1YNND 2B5OA 5M9OA 3T1HB 5FNVA 4NPSA 3I55A 1IKMA 3FKIB 3F5TA 1R6TA 3CW2A 1H2SB 2YIBA 1MABG 1XEQA 4FF4A 2E75B 2IU0A 1XQBA 5DEDA 5LOVA 5BSXA 1BCPD 1HDJA 4J7KA 3G80A 1B23P 1MSHA 1RJTA 2Z4HA 4IJLA 3CRAA 2EJMA 2ICEC 2RF4A 1XQ8A 1D7QA 3HFZB 1AILA 3VQVA 5J3BA 3JD2A 2WA4A 2GBOA 2ZNIA 4MSWC 4X66B 1N8RW 2B2UA 3DXRB 2L9HA 3U50C 1VMCA 5I2XA 5E4XA 3OEEG 1ZWIC 2BM0A 4ZKBB 4LF6L 4TMZA 4UZFA 4DR7O 4EQPA 3ZHTA 1QQCA 1IYJB 3J80N 2Q73A 4LMQD 3ZMUA 5IGEA 3G71B 3JD0A 1BMFA 3UDIA 2CVRA 1C4QA 5KAIZ 2E5LB 2AZ0A 1EYCA 4CGYB 2DMXA 3F7YC 4JMQA 3LWEA 4WORA 1SYEA 5IYDO 1SQVH 2RDCA 1H9MA 3BPZA 3NXWA 2Z6BD 2R3ZA 3OFNG 3QR8A 1WN7A 3JSNA 4BXXG 4X6AH 1R6NA 1DG1G 2OEOA 4P12A 1XMQL 3ETDA 1RL2A 1Y8OB 2YTYA 1KC8W 1HRJA 1FX0A 5KAFZ 4DV0B 5CV6A 4WFN3 3JAML 4X3UA 1D2DA 1TVKA 1OXVA 4NKGB 3LNMB 1QFJA 2WAQE 1KAWA 4QFMA 3U6BA 4R50A 4Z1VA 4IUTA 1TY2A 4ASUG 1TWAH 3CCRB 1PFMA 3MXNB 3TEHB 5IYZA 1VHEA 1AR5A 1B70B 4EEQA 4YHHQ 4L8JA 4KN7C 1S0UA 1GXDC 4DR4L 5A8AA 5AN9A 1K83B 5T1GA 4JI1L 5GADC 1D2EA 4CC6A 3EIVA 4JAAA 1EIHA 1HPCA 4QF4A 2VS1A 4DV1B 5L3FA 4A3CG 1EYAA 4QJFB 2YIDA 5JQGA 3T4DA 1Y0YA 5F4JA 2EULA 4P9PA 5FNVB 1NBMA 2R7DA 1N0UA 2F0HA 3M85A 3WNCA 1G51A 3CXCA 1V1OA 1X9NA 2HR3A 1STAA 2EY6A 2CH4A 3EBEA 2F93B 1K8AC 4EB6A 1TWHH 1QLEB 2CRVA 2Z9HA 3FPUB 3L2PA 4RAUC 5LP6B 1ZM9A 4HBNA 3JAME 2AHOB 1S3JA 3E5SA 1YJNV 1JWMD 1WPXA 4QV2A 3ABUA 1YCIA 5E1AC 2Q8RE 3RLNA 4XONA 5H5NA 1UD5A 2PYKA 3I8ZA 2ZJPA 4A3FG 5CA0A 2CDYA 2CTQA 4GOPB 1KQSA 4E0FA 2TSSA 3GTMB 3HZXA 1JE4A 2GJRA 1E2VA 2K14A 3OW2U 2ZQMA 1LTID 4OO1G 1MKHA 1EY8A 2KA7A 4B9XA 4XIGS 2RSNA 1CKMA 1ZM2A 3PMFA 3S2HH 2OF1A 4FNFA 2MNAA 1MBYA 3B8MA 4B3SO 3CF5A 4XDXA 4K8ZA 1O80A 1CFMA 1SJED 4TT3A 4KK7A 4ICGA 1WTVA 2Q4PA 4P9SA 3ETGA 3HPLC 3SJBC 4WBNB 1QG0A 3JSLA 3K04A 4TMWA 4YXWA 5TSSA 2R61A 2VL6A 4WFEA 4YAUA 4EVOA 3Q4HA 1Y66A 1PJ5A 5GW7A 2BA1A 4LW1A 1OHHA 4GKJL 4FFKA 3VO2A 5BZBA 2KHIA 4UB6Z 4V190 4G1VA 1UAPA 2FFKB 5C5MA 1PFSA 3DUZA 1Q81C 1IBMQ 4RKLA 5J39A 2D2CC 2YI9A 4WFAV 4KI0A 2BDOA 3ZBUA 3OR7C 1J9ZA 2B2VA 2ZTEA 1BVSA 2JJQA 1A63A 3ZYYX 5GAGC 3T1HQ 1DD2A 4IOAA 2Q8TA 3JASB 1N32L 3AVWA 3S16H 1X55A 4X62B 4FM1A 4X65B 4LJZC 4R4CA 2K6AA 1CNFA 2DOGA 3CTAA 4BS9A 3MZ5A 5BN5A 3CCUB 1WA8A 2V7TA 3CRCA 2XRSD 1EZ8A 5I9OA 2QR4A 4A3EH 3CC4A 2DOSA 3CRMA 2PYLA 1LM0A 4JG2A 4CZZA 4FLUA 1WYDA 2XAQA 1AP0A 1Q90A 1VQOB 4TOIA 3S1MB 4I0XB 1PRTC 4DXFA 1QNMA 2QGNA 2ITCC 2IJJA 2VNIA 1KNEA 1TWFH 5NUCA 4DUZL 1FJGL 2B1IA 1XPUA 5CBGA 1E2ZA 1HH2P 2WACA 2VUMG 1OCRC 2HIXA 1XOUA 3QOJA 1WVLA 3H91A 3CC2V 1OGJA 1A3VA 4O2BA 4A3BH 3TS2A 3K81C 3AG2C 1QFYA 4U9UA 3A74A 5LMUQ 1K5SA 3CHXA 4JBWA 3RZDB 4Z1MA 3A3BA 1K8OA 1Z5WA 1MHWC 4BR6A 4CDEC 1PYBA 2Q69A 2E1RA 4C3IG 2Y69B 3CCQA 1WB8A 3OWFA 4GN5A 5C5LA 4U7NA 1FD7D 4XOTA 1PZID 3DM3A 1KQSU 3K9SA 3H3VH 1KNAA 2NB0A 2EFGA 1M1KD 3K08A 5LMUB 2X6AA 4JI4L 1BGYH 3BDLA 4I7ZB 1IBKO 1TU2B 4FLXA 1BS3A 2F43A 3A0RA 4BY1B 4ZI7A 5M5WB 4G4KA 3U9OA 5DEHA 3JD3A 4O42A 5GQOA 1FVIA 3IJ4A 4IHJB 5GONB 1VQKV 1Q9SA 1E1TA 5C0XH 3BDCA 1HUMA 3RYHB 1XYIA 2F4VQ 2DNCA 1JOYA 3F7VC 3G7LA 4B3ML 1XWEA 3P30A 1DARA 3R6KA 2N88A 2N05A 2AMCB 3CXCB 3CP1A 2W0XA 2DY8A 3A5ZB 3BFRA 2HFEC 1YJNB 1VQ8A 1IBLB 3TXSA 3PUXA 1JE5A 1VQFA 4IUVA 4XLEA 2N04A 5IYCO 4IUUA 1JB3A 5JEAG 1PH9A 2EILC 3KCYA 1HA6A 4IYHA 1NDHA 2UUCQ 5D65A 2HCCA 3FB7C 2FX3A 2C5CA 3ABMC 4MVOA 5L46A 2EYPA 3QSYA 1T6XA 3E89A 5KHKA 1Q81D 4DR5L 2ADPA 3I1FA 4RD3A 1HCZA 2VS0A 2ZCEA 4UV9A 3TXQA 3IC9A 4AF6A 3K06A 3KF6B 1PDQA 3VMFA 1SYDA 4ZLTF 4YIPA 3MXNA 3ETQA 1TUIA 3RNUA 3CCMB 4JBMA 2GV9A 5IYWA 2HVJC 2E2HB 3CCVV 5FLMG 4Z4RA 4UCTA 2H5XA 2ZTDA 4O2AB 5AFWA 2OTJB 2IJHA 4EQOA 1SN8A 1JVMA 5A2QN 3PUVA 4OX9Q 2K1BA 1AROP 4ROXA 5C44H 4IPGA 1CTMA 2CF4A 1MRZA 1H9SB 3FVQA 4HJ8A 4QPKA 4TV8A 5L3CA 4K6LA 2UXCB 3UQ8A 1TWAB 4ZOLB 4DR5B 4K8JA 4N23A 4JPRA 5B5EZ 3FKSG 2KEDA 2NN6H 4HCEA 3ASTA 2W6JA 3W2FA 1L0YB 2RKSA 3I4MB 1I3QB 5KMGA 4X05A 4ZI7B 1Y1WB 2GTSA 4G5GA 3HKCA 4YHHO 1D8TA 3OZUA 5EAYA 1KU9A 2HEPA 2WJVA 2IBZH 2ZIOA 4LF5O 1K4DC 2Z6KA 3BVOA 5LXTB 4X06A 1B44D 4A3FH 4UCUA 2IW3A 3N2GA 4LFBL 2DERA 3I72A 4DV3O 3M99B 4JV5O 1UD8A 4ZKIA 1BQ0A 1I4PA 1CXZB 3PENA 3U2QA 3CESA 1LUZA 4LF5B 2RQ6A 4LK1C 1TWHB 5I6YA 1C8CA 4LUVA 4TKOB 1EYGA 2GSMB 3I56V 4H44B 2GK6A 3KYHC 5E3FA 3BY2A 4A3IB 3GTQH 1Q6IA 3VBBA 4EFEA 5B3SC 2D74A 1WFQA 1VQ5V 4JPBW 2JA8H 1TS2A 3E83A 2V7XA 4KKSA 3WB1A 1W2BU 4KN4C 1LTLA 3ASPA 1RDPD 1TVXA 4TUYB 2CHBD 2NTSA 4JI2L 1KJZA 2JQOA 4PA4A 3KEWA 1T9HA 3SJQC 2CKZB 4B3TB 3FB6C 3RYHA 4WBNA 4U3JA 4UHVA 5M3FB 3OMAB 1YF2A 4A3KH 3D36A 1VQMA 3BYYB 4NXNB 1EU3A 1Q6UA 3TP5A 1G6UA 3B2EE 2X7RB 4FDBA 5BR8O 4FFBA 2YEVB 1S5FD 1QHTA 3JQQA 1VMPA 1TUBA 1YXBA 5CYUA 2WZPP 2P4KA 1WTHD 4HIKA 2JJ2G 3BCDA
chains in the Genus database with same CATH topology
3OFNA 4IN3A 4O2AA 1S5DD 4O1NA 4NVPA 1QJOA 3NBIA 4F8MA 5IJ0A 4DUZB 1FJGB 2ZXPA 5ITZA 4L63B 4DUYB 4OL7A 1Q8IA 3JAKA 1K28D 2L12A 2QE7A 4FLWA 3O13A 3FFQA 2P22C 2WIIB 3IKJA 1SBBB 1CHPD 1PKVA 3A7LA 3A55A 5ELEA 4BA1I 3DEOA 4ZK9B 3H3VC 2A5HA 5LOVB 4I7ZC 3VYSA 3U11A 2EY1A 5ELCA 2E75C 2PPBC 3RYIA 2XNDA 4FLTA 2J7ZA 1S5ED 1HNWB 4FF1A 4Q0FA 3GTOB 5KX5A 4ZOLA 1EY9A 2RDGA 2NVTB 3X3NA 3HKEB 2SOBA 4P2CB 3HP3A 2F0LA 4HN7A 3MA2B 4GKKB 3SJCC 4N9PA 5A2QL 2FMCA 5JVH3 4DR4B 1D5MC 1M4UA 1EY6A 1SJHD 3J7AV 4UCRA 4XLCA 1E1QA 1EU4A 2PYJA 4C2MB 3OW7A 2NZ1D 4YJ2A 5JCOC 1TS4A 4J6HA 1V9PA 5JVG3 3GTPB 4D7SA 4O4HA 2EPBA 2J0TD 2G9DA 5LA6B 5CV9A 1IKLA 1F2YA 3N2KA 3CU7A 4BY7B 1S5JA 1WP6A 4K8XA 2KEEA 2QJ1A 2L55A 3MAQA 4OIJA 3VYUA 3CMMA 1MGSA 3NTIA 2MHVA 4X1IB 1XNRB 4LF9B 5KEEA 2B2TA 4NXMB 3OE7A 1EIGA 2AWNA 1E3ZA 2DY7A 2KOLA 1WPBA 1PXUA 3MFYA 2Z8LA 2X6WA 4FXKC 1SKYB 3SK8A 1LTSD 2K5QA 4JI2B 1Q43A 3JARB 2UUAB 1S5BD 1Q5OA 1D5ZC 3OAAA 4FVMA 1BCPC 5D3IB 3FDTA 4TRDA 4AHCA 4GKJB 2B2VC 4CJ2C 4C3JB 5C3XA 3KLSA 1HFNA 3NE5B 2QM4A 1EY0A 1MD2D 4X1KB 3H09A 3C2PA 1IBMB 4KV6A 1B2TA 3M3YB 1AFPA 3RZOB 2WV6D 1LT3D 2G9HD 4PNYA 4CBVA 2F1MA 5IGGA 5KHIA 4LFAB 4PHZA 4CS4A 1HUNA 1DXMA 2CAZC 4DU9A 3SR2C 3HS0C 2WKDA 1MSGA 2XWBB 2WB1B 4CJ1B 3DSQA 1OXSC 4RGOS 4JI6B 2X6LA 4C1NI 4X1IA 3M4OB 1F9SA 2JE6I 1M4VA 2JJ1A 4DV2B 3QOLA 1I94B 3IFTA 1IW7D 5CR3A 2X8KA 1COWA 2AUJD 2N55A 3LX0A 1NT2B 5A2QE 4LNUB 3K5OA 3C1FA 1H9JA 1WTPA 4PI2A 1DYQA 4O4HB 2V31A 4XQJA 1PFNA 5J2UA 3OHXC 3SDZA 4LH6A 1RCVD 1JOQA 2EVBA 3D6WA 3K7AB 2KUMA 1A6XA 2HQEA 3EROA 2JEAI 2ZIMA 2OT2A 2A6HD 5K1XA 2LY7A 4I55B 2BCOA 4FP5D 4NMZA 1S4ZA 1LTTD 3G05A 3GTJB 4KY5A 2H1EA 2L5TA 3RGBA 2ZTGA 5JJJB 3K5NA 3KLSX 3MHBA 3SEBA 3TZUA 5KRUA 4G7ZC 4A3JB 2LKVA 4IFDI 3URYA 3I73A 4E6IA 2VUMB 1H9KA 4IALA 3K57A 1FNWA 1H9RA 4TUYA 4DV7B 4AILC 4KJNA 5M9OA 2FHTA 3WOFA 2B39A 4DK1A 1HXYD 2JGUA 2EXZA 2ZM6B 2AWOA 2F03A 1O7ZA 2K32A 4K5VA 1TQOA 5JJNB 3IAYA 4DAYA 2PUSA 3S15B 1WCMB 5BN4A 5LXTA 3VR6A 1SNCA 1XHXA 4P22A 4LF8B 3Q24A 1CT1D 1EOTA 1SKVA 1WD1A 4N9TA 5D5PA 4PI0A 2A68C 4KTAA 5BMVB 3PO2B 3QTCA 1RTOA 2FMMA 3NHHA 1RSOA 4BW9A 1G2TA 4I9QA 2R6GA 5G3LD 3VQWA 1JWUD 2J4XA 4A3MB 2K33A 5CC4A 1S5CD 2RBMA 1NAPA 1W6KA 3SVMA 4GQNA 1CI3M 2X6XA 4FXGC 1CZWA 4XQNA 4WJWA 3ICXA 4S3SA 4HSVA 5CV5A 5LL6X 1H8HA 4B9WA 2BE5C 1O7LA 4C3HB 5KNDA 1QE6A 4CJ0B 3HOUB 3ONAB 5CB4A 4CKCA 4RCOA 1U4MA 2CW0C 4R8IA 5LYJB 2BDNA 2EJFC 5ITZB 2EJGC 4IQZA 4A3IB 1TY0A 1KMIZ 3RYIB 1Z6HA 1A3UA 5FPRA 4AQYB 5CV4A 4X3TA 4JI4B 2F4VB 4DAPA 2FINB 1TR5A 3V05A 3LWUA 3ERQA 4MHEA 4EFBA 1U9RA 1ET9A 1EY4A 4BBSB 4C3IB 3VA7A 3NUCA 3R2IA 4NDXA 2JYOA 2QDBA 3RUZA 1II3A 4FXUA 1KDCA 3CB2A 1KDAA 2XNAC 5C0XJ 3E0JA 4I50B 5EPJA 2EX3A 4CH4A 5CMDA 3RFRA 1XI1A 5E4WC 5M5XB 4XTCS 4FF3A 3CRLC 2R7ZB 5CBEE 3W2DA 2VXWA 2K5DA 3OOCA 4DR6B 5T1IA 3GD7A 4YEJA 4XORA 5JAVA 4XNFA 2NBFA 1E3XA 1A3TA 5EKIA 1ZEQX 5JEAJ 2ZZEA 3A35A 1U4LA 4XT3B 4QIWB 3J81L 4TV9B 4KL1A 1BQQT 2SNMA 4DF7A 1D1IA 1ZAUA 4UDUC 3CKIB 3MXGA 4ZYSA 2KKWA 2UXBB 1F2ZA 2L0CA 3PV0A 1VCIA 4A3EB 3HKCB 3R2TA 3D6CA 2XOKA 2XGJA 1I18A 5FO7B 1F9QA 3J7YW 1AZQA 5CDFA 4ILWA 3OEHA 1HVXA 3NQIA 2O5IC 3A3GA 4FM2A 1PTOF 2B2UC 2M9VA 2QCPX 1LT6D 1RTNA 2JA6B 3SJAC 3HKZB 4RCNA 1LACA 2Q8IB 2PY5A 3IFDA 4I4TA 4FFBB 1O7YA 5DNFA 1EY5A 5IT9E 4UCVA 3NQTA 4UAIA 1XX8A 1SA0A 3BVMA 4A3BB 3DXJC 3J7AF 5KYIA 4UZUA 2MUYA 4OIKA 1PFBA 5IYZB 5HKKA 4TQFA 4X20B 3S2HB 4XYQA 1SNOA 2M2LA 1UNSA 2B8FA 4K5WA 4QMGA 1PLFA 4QCLA 2EDGA 1B9MA 3HOYB 4TV8B 1BLIA 2SNSA 2GJKA 4X1YA 1SYGA 1JC7A 4DRXB 2VB2X 2L4NA 1TVKB 3BA8A 1ESRA 3BCFA 3E22B 5FOBB 1F9RA 3C1EA 3BH4A 3K5MA 4Y7NB 1DM0B 2BE5D 1KMHA 1SQGA 5CORA 3RYCA 4FO2A 4LR3A 2NWGA 4DAVA 4ZUJA 4JYAB 1ZXTA 1SA0B 4QUFA 1OB0A 4RWSC 1PTOC 3LNNA 2Q7EA 2ZZFA 1PZJD 2AQ2B 1VF5C 1L8DA 5LL6S 4XXEA 4O4JB 1W6JA 4OGQC 5IGDA 1LABA 3VR2A 2QF7A 2E2JB 1PTOB 1FGBD 3QJYA 3VYRA 1SNPA 4A3FB 4ZIBA 4H44C 2OYQA 4C3HG 1R4QB 1SE4A 1WTXA 4OX9B 1SYBA 4O4LB 3UI2A 4XQFA 2Q7GA 4DR3B 4A3DB 3L3OC 5JPNC 1CQFA 3VQXA 2HHHB 2V4DA 1SNDA 4X20A 2VJJA 2QKIC 1A2TA 1EFID 1XHZA 3EVQA 1HNZB 2LZJA 1YNJC 1BCPF 5IT9L 4O4IB 2ZZGA 3OTOB 1GUGA 3N2KB 3DM1A 4PMCA 3RLFA 4TSSA 1TAEA 5EKKA 3MXUA 3CQZB 1BCPB 2F0JA 3FRPB 1BBXC 3V2TA 1F2LA 1G8ZD 4DRXA 1ENAA 1SXTA 2NVYB 3K59A 4J8QA 2X69A 5IGCA 1O78A 4NKLA 1BNZA 4KD4A 4XLHA 1LT5D 2IX3A 2B2YA 3I70A 5C4HA 1WTRA 1Y1VB 2ZINA 2PZUA 4O4JA 2K04A 4XOPA 4RHRA 2F0FA 1DOLA 1GHJA 4HSPA 1SE2A 3VR5A 4V0BA 3D4DA 3H0GB 2LS01 3KBGA 1KZLA 3GTQB 1M5IA 3QG5A 4PQXA 1IBKB 3T16A 4CKBA 2MP1A 4LF7B 1Q3LA 2BTQA 4DV3B 4JV5B 1SDFA 4MIUA 2JJ2A 1H9SA 1P49A 4A3KB 3UT5A 3NK9A 1E79A 2B2WA 4ME5A 2EY2A 1M93A 1F77A 4K0KB 2Z1CA 1SEBD 1IL8A 5DAUA 2AUKA 3S1NB 4H13C 2IM9A 5JJZA 5J2UB 3A7AB 4ID6A 2K01A 3CSXA 4B3GA 4CS2A 2IX1A 5EIBD 3L9AX 3SXHA 4XQQA 3VR3A 3SR1A 4C1NK 1DOMA 3T1YB 3BAAA 1ZYRD 3Q6SA 5EZYB 2KECA 1HTPA 1QWYA 4R9WA 4A3GB 5COYA 2F3WA 5C4JB 1UUPA 4QB4A 5JH7A 4WRDA 2F0NA 1O9HA 3L7ZC 2SEBD 4CHTB 3FKSA 3U0ZA 1TWGB 3HOZB 2HDMA 4JI8B 1I6VC 2IX0A 4K5XA 1ZKOA 2VB3X 2Z4IA 3HOVB 1X3QA 2RSOA 4H7BA 1CM9A 4LFCB 1PTOH 2IT1A 5KX5B 3VQYA 1RKNA 4LNUA 3D3RA 1FNVA 5FO9B 4G57A 4IURA 5CA1A 5LHY1 2XWJB 4XMYA 1PRTB 1C48A 3MXPA 3A8KE 1JCKB 5DM73 3HKDA 3HOXB 2F0TA 4KHZA 3J81E 2VNUD 3P20A 4F87A 2ZNJA 4OO1I 4AVZA 4DNTB 2M00A 4RGTA 4G7HC 3QG1A 2JSOA 2NVQB 1T5XD 5M3MB 3HGBA 2PZWA 5JVDB 3TZDA 1VDZA 1BOSA 1Z5VA 1TWCB 5LA6A 4KJOA 3TMEA 1QOHA 5KMGB 1V43A 4XN3A 5M5YB 2UXDB 2JIZA 2XZOA 3E22A 2B8GA 4NNJA 2WKCA 5GONA 1SMYC 2MGSA 2K05A 4RA8A 1SQFA 1XNQB 4TSFA 4FLZA 1AN8A 2GA4B 4V190 3VA5A 5JH7B 2VWJA 3S1RB 4XLFA 2BTOA 2ZXIA 4XYOA 4ZAIA 2PMZB 5ISRA 2DN8A 3P75A 1UEAB 1R9TB 2P5OA 4A93B 3HAGA 2B2TC 3CHBD 3G6JB 1STHA 4I65A 4IUPA 1B50A 4HEDA 5I6WA 4HNAA 5EJWA 2E1BA 2F0UA 3KUPA 2A69D 4DV4B 4YJ2B 2GJPA 1ENCA 2F0DA 4K2LA 5CB4B 3DMUA 3WDNA 1KLGD 1QCBD