3LNNA

Crystal structure of zneb from cupriavidus metallidurans
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
341
structure length
341
Chain Sequence
ALRHEGERLVVPAESPLRRTLAVAPATRETVAAPFNLPAMIEADPAKLVKVLPPLAGRIVSLNKQLGDEVKAGDVLFTIDSADLAQANSDAAKARAAMTMARRNLDRQRELDKSEIAAKRDFEQAQSDYDQAASESQRADARLAQLGAKGGGTLQAGGGHILAVRSPINGRVVDLNAATGAYWNDTTASLMTVADLSHVFVTANAQEKDLGHVYVGQSATVKFDAYDDPQPGKVRYVGQILDADTRTTKVRMVFDNPDGRLRPGMFAQATFLSQPHEGIVVPMSAIVQSGFYTRAFVEVAPWQFEPRVIKLGAQIGDRMEVKSGLSAGDRVVVKEGVLLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-induced conformational changes in ZneB suggest an active role of membrane fusion proteins in efflux resistance systems.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal transport
molecule keywords Membrane fusion protein (MFP) heavy metal cation efflux ZneB
total genus 58
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3lnnA04
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3lnnA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lnnA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3lnnA01
5KNBA 5K36H 1IYVA 1RSOA 1VDZA 2AUKA 3BDOA 3PV0A 3I72A 3OOCA 1Q12A 1VF7A 1DXMA 3WB1A 1O7LA 3GQBA 3MFYA 4BA1I 3PUXA 5C0XH 3CRKC 3GD7A 2YYZA 1Z7TA 3FPPA 1VCIA 2L5TA 3T51B 4DNRB 1O78A 1Q90A 3BG3A 3PUVA 3SDZA 1T5EA 1Q1BA 3D31A 3KLRA 3VR4A 1LABA 2B8FA 2EDGA 4G7OC 5JJNB 1IYUA 1FR3A 4KN4C 2F95B 2K33A 2B8GA 1GUTA 3NE5B 1OXSC 1CTMA 3IFTA 1EWHA 2A6HC 4XIGS 4KMUC 5K36G 3PUYA 1GUSA 1E2VA 2F93B 2LMCB 1DD2A 1GHKA 2EJFC 1HCZA 1OXUA 2ZT9C 2JXMB 3WB0A 2V4DA 4JK1C 1GJXA 4DK1A 2KCCA 3IKJA 3A8JE 4RCNA 2AWOA 1GUOA 3SE0A 3RLFA 4IQZA 1YNJC 1IW7C 1OXVA 1Y69U 1B9NA 1HPCA 3VR6A 4DK0A 2K32A 4H13C 3QJYA 1K8OA 1H9MA 3QIAA 3H94A 4L8JA 2F1MA 2BA1A 1FYCA 1V8QA 2JEAI 2D62A 1H9RA 2QF7A 1H9KA 3LWUA 4KKSA 2EVBA 1BDOA 3L7ZC 2E74C 5A35A 1DCZA 3EQLC 2A69D 4HR7B 4GZYC 3ND8A 2R6GA 3PUZA 1A6XA 2JEBI 3FMCA 1ONLA 4KI0A 1CI3M 3LNNA 3VR3A 1H2SB 2IT1A 3OPOA 2EJGC 4LK1C 1IW7D 4BA2I 4XTCS 3VA7A 2DNEA 3CRLC 3HGBA 3WDNA 2BE5D 1Y8PB 2D5DA 3M7NA 3I73A 3QG1A 1OXTA 5BN3A 4OO1G 5JEAH 4DNTB 4IFDG 4KKUA 2A6EC 3MXUA 5C0XG 2DNCA 4IFDH 3W3AA 1H9JA 1E2ZA 1TU2B 2A69C 3N6RA 2JE6I 4LJZC 3WB2A 1Y8NB 2PPBC 1QJOA 2A68D 4H44C 4G7ZC 1PMRA 4PV1C 2A68C 4GYCB 1HQMC 4KHZA 1B9MA 2CW0C 4OO1H 3T56B 1H9SB 1Y8OB 1TKWB 1ZYRC 1LACA 2PCFB 1VF5C 3BRCA 2BE5C 3M4YA 3M85A 5D5PA 2A6ED 2O5JC 1HTPA 3A7LA 3D4RA 1V43A 1E2WA 2E75C 2BDOA 2D2CC 3AB9A 3DXJC 2Q8IB 2K7VA 3T53B 1I6VC 2DN8A 4H0LC 1Q1EA 4TKOB 5D5QA 5KNCA 1G291 2NN6I 3A8IE 2E76C 3U9SA 5BN5A 1GHJA 2O5IC 3TZUA 1GUNA 5JJEB 3VR5A 3ND9A 3A7AB 3P20A 3A8KE 4OGQC 2NN6G 1H9SA 1CFMA 3I4LA 1K8MA 4KN7C 1ZKOA 3VR2A 3OW7A 1Z6HA 4G7HC 2PNRC 4JBWA 1YNNC 5BN4A 5KNDA 5JJJB 1OXXK 3PUWA 1SMYC 4TQUS 4I7ZC 1GUGA 5JEAG 2NN6H 2BA0A 4KKTA 2A6HD 2EJMA 2KA7A 2AUJD
chains in the Genus database with same CATH superfamily
5LXTB 2ETNA 1ROPA 2PGGA 2K6AA 3PV0A 3MFYA 1BLIA 5D65A 3WB1A 1K97A 1GXDC 1TIID 4IURA 3L75H 3E20A 4ALPA 3K7UC 5BN5A 4LF4L 4DNRB 3JAKA 3HS0C 4HIDA 2HQEA 1VQ8B 5L3CA 3NUCA 1QFYA 4ABMA 1E3XA 1X3QA 3KJPA 1FXVA 3ETEA 1E1RA 1WJJA 4CGYB 4UCOA 1E79A 3SPIA 1AEXA 2F0UA 2CAZC 3E8FA 3R3OA 4CKBA 3OEEG 4O4JA 2F4VO 2XWJB 5ELCA 2B8GA 1GUTA 3VYTA 2OTLA 2UUAB 2ZR2A 1G6ZA 1Z2GA 5ELBA 4XKVA 3FD9A 3A2FA 2PYKA 4QVAA 3A5ZB 5IGCA 3CCLA 4X65B 4MS2A 1SNPA 1KL9A 1JFFA 2WAMA 5ITZB 4I9QA 1TWGB 3PGZA 3JAMi 3H1KH 2BTOA 2V7VA 1IBLL 3A8JE 2IX0A 5LHY1 2IJJA 2V1DA 1V0FA 2J7ZA 4EB6B 5GROA 4QMGA 1P4RA 2EILB 2LW1A 4DK0A 4ASUA 3E35A 1VLOA 1CQVA 3ERQA 5FO9B 5H9CA 4GS3A 2CE4A 2RKSA 4JI4B 3DHQA 4JMQA 1XPUA 1MSWD 1V8QA 2OCEA 4P22A 3BNWA 2B2TA 1VQMA 2D9RA 1L8DA 2EIJC 4RD1A 2Y0SG 4HYOA 4OOXA 4X66B 1PFBA 2I46A 2Z1CA 3EJIA 1FXKA 4YWKA 2ZXOA 3TZDA 4DV3L 5K36H 3OMIB 1PJ6A 1A6XA 1WDTA 2B3GA 1GK9A 2JEBI 3GO5A 4OWTB 4X65L 1BBXC 3FHWA 1VMGA 4GCZA 3OW2U 3JAML 2XGJA 1GAWA 4JI3O 1JE5A 4PC7A 1SKVA 2GA4B 4B9XA 1KC8D 5CMDA 3OIPA 1XMQL 2BE5D 1I4GA 1LTBD 2K5QA 3QG1A 4H0LB 5CN0A 5LBQA 1FDRA 4U3JB 1Q81D 3VNUA 3QOJA 3TP5A 3TRZA 1R6KA 1Q81C 2WAQG 3VA5A 2B2TC 4NKGB 1RFYA 1WSVA 3J80c 2X8KA 2YIBA 4NKLA 1EIHA 4XN0A 2K5NA 3CE2A 1UD5A 1EUJA 3CQZB 3QOLA 3CHXA 4MVUA 2CQAA 3D6WA 5F2VO 4Z9CB 4CH4A 1WP7A 3GWOA 1BX1A 1AROP 4KHPL 1PVOA 4JYBA 3CCEB 3A0JA 4B44A 1YI2A 2ZR3A 2OK8A 4KHZA 3HOWG 1B53A 4OWWB 3VNVA 4RPBA 2AQ3B 2I5MX 1KRTA 1C8CA 1AILA 1PV4A 3S1RH 2HP8A 1UFIA 4KFMA 1F9QA 1PD3A 1L1OC 4RD4A 1H42A 4GQNA 4IPGA 4CBVA 1Y0RA 2ZXPA 1AP6A 4DRXB 4DR6B 4EQOA 4TT3G 3DXJC 4PC6A 1COWG 2EIXA 5ITZA 4GX5A 4XBFA 3CCQA 4Y9RA 1EOVA 4CH3A 2A73B 1V1PA 1AJQA 4B7EA 3VOUA 2XNAC 2QTLA 3RLOA 2B1GA 5JQGA 2JA5H 1SQXH 1JORA 5JJEB 1X3FA 4D7TA 2F3VA 2QGNA 4YJ2A 3HKDB 1M9NA 4XONA 3QSYA 1I3QH 5B3SC 4JV5B 2QEJC 1K8MA 2UUCB 5FO7B 4ZYSA 3HOZG 3BVOA 4UCSA 2B39A 2BCOA 2OCCC 3G6EV 2UXDQ 4YIJA 3AVYA 2FMLA 5JJJB 4C2MH 4XLEA 4HBNA 1GVHA 2R6HA 2NR5A 3RYFA 1SMYD 3HKBB 1VQ4V 2PW5A 1K83H 4QNHB 1SMXA 2AUJD 1VARA 3BABA 2HCCA 3K81C 1CEZA 4PV1B 1PHJA 5EZYB 1KP2A 1S76D 5DAUA 1GJRA 3SR2C 1QILA 5JPNC 1BCPC 1JA8A 3U9OA 2M6YA 2F4IA 1VCIA 2L5TA 1B6QA 1S5JA 4R1JA 1STHA 1OCCB 4A3FG 4DR7Q 2PUSA 3NBHA 4XD7A 1ENAA 1XREA 4X62Q 2JA6H 1T5EA 2J0TD 1F4MA 1BVSA 3VR4A 4ZBMA 4M4SA 4B3MO 2XUMA 5IYQA 1HJPA 2E5LQ 2V7TA 1PLFA 2IHFA 3DWQA 1ZUNB 4DR4L 2F4VB 1OXSC 2J4XA 2E2IH 2A6HC 4B3GA 2R3ZA 1WVLA 1WTPA 4KMUC 4S3SA 5K36G 1GUSA 5FKAC 1HR0B 1RF2D 2B63H 1S4ZA 1C4QA 2QSAA 1AR5A 1EFRA 1PDQA 1IVSA 4ZCMA 1M57B 2Y69C 3M99B 5KA5A 1HCZA 4XOPA 1EN6A 5FNVB 4PA6A 2AZ2A 1STBA 2N88A 4P25A 5FL7A 3JQRA 4AF7A 1E0BA 2PNHA 4DV5L 2UXBO 4YWMA 4P9SA 2JA5G 3C2QA 4PMBA 3AMUA 5B1AC 2P22C 5CBHA 1VQ7V 1FYJA 3Q39A 2ZE8A 1ICWA 2KENA 1N34Q 1CSQA 1DYQA 4HIZA 3UE0A 2O57A 3C3SA 1EZ8A 3H94A 1FPOA 4AQYQ 3G67A 3N2KB 2EYMA 3AYHB 4OX9L 4A3BG 4RO2A 1B3QA 5DN6A 1EEID 3FJOA 1C48A 2PF4E 1HA6A 4DAVA 3HOUH 2UU9O 1FXKC 2QMUA 1MOFA 4RCZA 1H2MA 1Q3EA 4G7WA 4TSSA 3V96A 3L73H 3STBD 5I9PA 3AU7A 2YWHA 4AI8A 4ZAIA 4Q6GA 3CU7A 4C3IG 1HQRD 1HW7A 3LX0A 3VO1A 4NXMB 4PC2A 1EY8A 2E5LB 4AF6A 4FLUA 3SK5A 3P30A 2SOBA 4KD4A 2GTSA 2XZPA 4ZV4A 1O7YA 3UDIA 2VZLA 4B9WA 4BBRG 1N33L 1R73A 2ZIOA 1WOPA 4CDCC 2BSKA 5IP7G 2ZM6L 2F0SA 2F0OA 1EM1A 4JI0O 2RVLA 3FPKA 4DUYO 4LBEC 1YI2V 1AIPA 2EILC 1KK2A 4UZEA 5EBWC 4NR1A 3WB2A 1KDBA 3EA6A 2D3OW 3M3YB 1SXTA 5KHKA 1PA6A 3QNEA 1X3PA 1K73D 3WOEA 2N74A 3X2QC 4TMWA 1EQRA 1U2RA 4M1UB 1ESRA 3SJAC 3A35A 3ZN0A 5DEHA 1K9MC 4M1KA 2VBUA 1MD2D 2DWEC 2OTJV 1W0JG 2QDBA 4C1NI 4DV7Q 3OMNB 2JRIA 4B4DA 2DEUA 2Z4HA 5JBQA 5TRDA 2IBZH 1YBYA 3BRCA 2XHBA 5KUMA 1L1OA 3F5WC 1D5ZC 3M4PA 2OBSA 4C3IH 4P2ZA 1D2BA 1BBWA 1IL2A 3AB9A 4DR6O 3WYAA 2QA4B 4Z4YA 4X8AA 1JC7A 5COYA 4JV5Q 1HNWL 3UE1A 4TMVA 3ZHTA 1G1XB 1LT5D 2C5BA 1Y4MA 2DGYA 4LF5Q 2R7ZB 3OZUA 1R4QB 2H3OA 1YJWV 1PH9A 3GTJB 4MTOA 1JNYA 3UDXA 3WBJA 3OE7A 4A3MH 1EY4A 2M5SA 4I55A 1NJIC 3WG7C 1U4RA 2XNCA 3WNCA 2MQHA 1SKQA 2FJ2A 4DK3C 1ZKOA 4AQYO 5GONB 1AB3A 1AR1B 5LOVA 1S0UA 2C2WA 2X6WA 4YJ2B 4PC3A 5H59A 3SJZA 2Y0SB 4HAEA 1NR7A 1PL4A 4E6IA 3A5UA 3J81j 3TS2A 4IOCA 1YJNV 3ZX6A 2PQEA 2QWPB 4JAUA 4BW9A 1IZ6A 1ZSPA 1SA0B 2PTMA 2NN6H 4ZK9B 4HJ9A 1R4PB 3KF6A 3KLSA 3NENA 1IBLQ 4P73A 2UUAL 1FKAO 4KLKA 1L0LH 2O4XA 1K0SA 3AG4C 3R66A 3CEIA 1ET6A 1PRTD 2Q0AA 3STLC 4BBSB 4JI5L 1VF7A 4PI0A 3G4SV 1PFNA 4I7AA 2VQEQ 4FF2A 5C0XH 1W35A 3ZRXA 1UWVA 5EBCA 4HE5A 1KK1A 4NTYA 1S72V 4G4KA 5LMNB 1JICA 2K04A 4DV0Q 2WLNA 4FP5D 1E1QA 5M5WB 3L71H 3D31A 2YI8A 3S3XA 4LC1A 4X89A 4U3FH 4LF5B 2N55A 3DWAA 3RZDH 4WZEA 2XIWA 3D26A 5CA1A 2JEXA 4DR3B 1O9GA 5IJ9A 4X64O 1XNRQ 4JGSA 2DYSC 5IYDO 1IBML 1QLNA 3I56V 4LF4Q 4FNFA 2F0KA 1XL4A 3F2UA 3MA2B 1VQNB 3JAWB 4NNJA 2GVAA 3J81E 2EFGA 3TSSA 3S1RB 4I4TB 4IN3A 1BOSA 4ME3A 5C6AA 4JI5Q 1NT2B 4DAYB 2DQ0A 4B7KA 4F6RB 5KGUA 2AWNA 2QA4A 1YNJC 2F0TA 5DNFA 2WR8A 4Y7NH 5IYBH 5CV6A 1MKHA 1LNQA 3S1QH 2AQ2B 4CJ2C 3PF4A 5JOBA 4G27B 3D0FA 4FM1A 1S5ED 4JI1O 1FYCA 4ZCIA 2D62A 2ZJRA 4JF3A 4KKSA 3EFFK 3KLSX 2E74C 3L7ZC 3RMHA 4IOAA 4JYAQ 2ZQMA 3JD1A 3N2KA 1EFID 1I3QB 3EQLC 3SK8A 1YNXA 3K5NA 3SEJA 4OIKA 3ICEA 5C44B 2YIDA 2EPBA 1YTFB 5A2QL 5C8YB 5J39A 2QKCA 4RLZA 2L11A 4RAIA 2VWJA 4N8FA 5HZAA 2YWEA 1ET9A 4XL9A 4YXWG 3BZCA 1QVFU 4G7XA 3M7NA 4FLWA 1R3JC 1JFFB 1WLEA 1HR0O 1N06A 4WWVA 4E0FA 1OXTA 2VQFQ 4UY8C 2TSSA 3HKZG 3J7AF 3J81i 4DV7B 3RY8A 3H91A 1I94B 3AG1B 1L1FA 3CCRB 4IUUA 4RQFA 2OTJA 4JZ2A 1LYLA 4DF7A 5LMNL 1IX9A 5JVDB 5BY1A 2QWQB 3OEHA 2XAQA 3CPWU 3WY9A 2QKAA 1NJID 1WN7A 5C4XG 4A5UB 1UD6A 3O9OA 1EY7A 4A3MG 4MTNA 5LOVB 4FMTA 4IUQA 4XDXA 5E3FA 3CCUA 2EJRA 2BSAA 1A3TA 5ELEA 5EKLA 4AQYL 1PTOD 1ZYRC 3M4YA 4HJ8A 1VQLV 4CDEC 4XN3A 4WQMA 2VY3A 3W1GA 3W7UA 2XZOA 3Q4HB 1NH2B 2YTVA 4O2DA 2ZM6Q 1I5XA 1XXGA 2KJXA 2MFIA 4JI3L 3T53B 4WFN3 1WTXA 4EX5A 3KDFB 1RP3B 3GVMA 3CYOA 4BIZA 1BUVT 2VYQA 1IXRA 2F0NA 1VQGA 2NVXH 3B8HA 1TS5A 2HIXA 4B08A 1Q7YC 1RIPA 1K73C 5FPOA 1K8AC 4MW3A 1CKMA 1Q7YD 3CCLB 1CHQD 1GUNA 4P9OA 5GAHC 4YCWA 5EGTA 1TVKB 1H9SA 1YTFD 4DV1L 1BL8A 1DONA 4JI0Q 2L35A 4BWAA 4JASA 1Z6HA 3K08A 3UCSC 3NTKA 1STAA 1SQQH 3HKZB 4UAJA 2R7ZG 3H0GG 4B3SB 3MHHC 1FNCA 3OZWA 3DEOA 2XTIA 2I5LX 3S9WA 4IPHA 2A6HD 4ZKCB 1QVGU 4CH6A 2UUCQ 4YJ3B 1G8ZD 1NY4A 4J15A 4LFCL 1BMFG 1XUQA 1Q5OA 2WLMA 3OR6C 4I4TA 4Z2WA 2UXDB 5M5WH 1PH7A 1NTGA 3TJTA 3KF6B 4BA1I 3JAME 2VNJA 3RN5A 2EYFA 3ONYA 4HCSA 1N33O 1F2YA 3SDZA 3ZHRA 4RUFA 2YWFA 4E4EA 3NK9A 4NW2A 3DUZA 1JCKB 1S5BD 3I56A 4LFAQ 1W87A 5CORA 4A3BH 2B8FA 2Q68A 2RHSB 2Y69B 3RFRA 4K35A 2ZT9B 4WCEV 2VQFB 1Q3LA 2KVMA 3IFTA 3TN2A 1J5EO 1YJWB 3Q0AA 4QQBX 1QCBD 2E2IB 1AP0A 3HKDA 3O13A 4G1VA 1BQQT 4NCNA 1BNZA 1Y66A 3PJSK 2CTQA 1XMOB 2K14A 1KTKA 3BVGA 1E2VA 2F93B 1DD2A 2BTQA 1A8PA 5EYPA 1Y76A 1L0YB 2VJIA 1SEBD 2JXMB 4JK1C 3S1QB 2B63G 1W2BB 3HOXH 3CCLV 4G28B 4IQZA 3S24A 2E2DC 3R6KA 2R93G 4KJNA 2LXKA 3M8AA 2VXWA 2PO4A 5F4OA 1TQOA 2EBOA 2B2UC 4KY6A 1MABA 4XM3A 4LF9Q 2L9HA 3ZMUA 3S1MB 4FK8A 5C4JH 4LNQA 2A3QA 2E2JB 5KHIA 1PFMA 3GDEA 2P4KA 1ZM3A 2GJRA 4DR6L 1YHAA 3ABMB 3QFRA 1XMOL 1PH8A 1R3LC 4LF5O 2B2VA 4C3JB 4UFZA 3A55A 3BA9A 3IAYA 1H2SB 1FGUA 5EQ0A 2EJGC 4LBWA 4DXGA 5CGKA 2UUCO 2EIKC 3JATB 2VBSA 1I94Q 1HNWQ 3OZVA 1SNCA 4RCOA 3JSLA 4X3TA 2L15A 3K5LA 1OB2A 4C7UA 4J42A 1EQVA 1MBYA 3SYPA 1Y8PB 4M0LA 2C5CA 3I73A 4IHJA 4DV2O 3T1YB 5EK0A 4XOTA 2HD3A 3P7JA 4PZ8A 1TUBB 3CF5A 3H3VH 3HOYG 1OCRB 3CPWB 3TXQA 2BDNA 2AMCB 3BVMA 2F0MA 4HIKA 3G71V 1IYJB 3J80E 5BZBA 4DV7O 5IYRA 1SFOB 1TVCA 3B78A 3JAMc 5BMVA 3K03A 1VMPA 1WFQA 2M7WA 1T6XA 1VQEA 3FPUB 4A3CG 2MP1A 1B1ZA 4A75A 2UU9L 1E63A 4CS3A 5GW7A 1M1KW 2Z4IA 4MVOA 1PH3A 3R2IA 2F0IA 2OYNA 1AVMA 4YY3O 3RZDB 1X65A 3S17H 3CTAA 3IL8A 4MVSA 5M5YH 1B2TA 1VF5C 3ES9A 3ZRSA 1EFTA 5BN3A 1VQ9V 2TMPA 5C0XI 1S77D 1VF6C 3M7GA 2Q8IB 5J3BA 3OMAB 1P4MA 2EIMC 4LF7L 1KLUD 5AN9A 2VUMB 1A2TA 2E3CA 5LL6S 4XQJA 3CRQA 4R8CA 3K0GA 4DR5B 1VQJA 2X6LA 4GN3B 4AYBB 4BIUA 4MHEA 2W6IG 4C3IB 3OMCA 2HIVA 1WCMH 4ZHQA 3KKYA 4Y7NB 2F0QA 2GPJA 3KEWA 3RYCA 4UZFA 2OTLV 3FRPB 2HJFC 2ZZQA 3L9AX 4YALA 2EXZA 4OELB 1D2DA 4J41A 1W2BU 5E1AC 4K8JA 2R7ZH 2KB1A 1CT1D 2XAFA 3E9IA 4DFAA 4KXRA 2ASBA 2FXQA 1YNNC 4A3MB 2RJZA 3E8HA 1H85A 1SQPH 3ZS8C 3J81k 2OTJB 1UE5A 2CH4W 3OIQA 3T4AC 1AFPA 3HFZB 1HA3A 3SPHA 1IURA 4X1YB 4DV3B 5IYWA 1B23P 2CBXA 3OM3B 4JI3Q 4APVA 2E1BA 2Q2TA 2B7CA 3CC7B 2OCCB 1EWYA 3HRZC 1RPOA 1VDZA 3CPWA 4A3EH 2WLLA 2Y4TA 1I5FA 3DMUA 3ZRWA 2Z6KC 1W2BA 1GN4A 4IHJB 3R6JA 4UAIA 5E1FA 3KFUA 1MMMA 5CBFA 2ZXRA 3BG3A 1SESA 1KMHA 1E7ZA 1DLBA 3S16H 5L3DA 3EVQA 1NI8A 1QHTA 1VQMV 1ILQA 2E5LO 3ERSX 1JJ2U 4TSFG 1HFGA 1JQYD 2CRVA 2IHEA 2N8NA 3ZHSA 3U0ZA 3ISXA 3ULJA 1K4DC 1HNZB 3HB3B 4O2AB 1XTCD 1XYIA 3OTOL 2HHHL 5JJNB 1W0JA 1PYWD 1Q43A 5IGGA 1FR3A 4KN4C 1DJRD 4TSFA 2FHTA 1I4RA 1HR0L 5EBDA 2GUZB 3CAMA 4MNOA 4A3LH 4RFBA 2DCUA 2HQLA 2L55A 1SE3A 4LWCA 2VQFL 5KIXA 4OXSA 4NBSA 2W6JA 3ZBTA 2EY1A 1FRQA 3FKIB 4R4CA 1V9PA 2PI2A 2MW2B 1IHZA 3A0RA 3W2DA 1FNUA 1N0NA 1M93A 5A2QE 4A3EG 1BKBA 4K8XA 3OTOO 2HHHO 1WOOA 4JBJA 1KP3A 5JJLA 3BY6A 2PIAA 1QWYA 1D7QA 4IZ8A 2E2JH 2VL6A 4V190 4ZKIA 5JEAJ 1Y74B 1L1OB 4YHHO 1MA1A 3IGAC 2NVXB 4L8JA 4Z4WA 1E22A 2RDGA 3R2TA 4LBYA 5J1ZA 1D6EC 2K4KA 4LAAA 2JA8B 2WAQB 4O1NA 3UI2A 2UUBO 3W5OA 4PA9A 1CZWA 1B50A 5BMVB 4DR2B 4J1MA 2VB2X 4RD6A 4A3KB 4DYLA 1Q90D 1QUEA 2Z0AA 2EYPA 3VR3A 1BJKA 1SYBA 4LK1C 4BA2I 3CC4V 3Q6RA 1CKNA 4HJ5A 1WORA 5IYNA 1CZGA 1KRSA 2ZTCA 1WD0A 4JI7Q 4X05A 3T1HL 3BS1A 3TDQA 3AGPA 3WFVA 3U2QA 1WAZA 2VRZA 3PO3H 1JJGA 4JI8B 4BBSG 2WLLB 4IFDG 3K3WA 3QO8A 3TREA 4TRDA 3H15A 2YIBD 4LH7A 2JA8G 3CCSA 1FL0A 4OX9B 3MHBA 3I55B 1TWCH 2JGUA 3U58A 1ZX3A 2MJ8A 1PH6A 1SYDA 4CDFC 3AK2A 1Z5WA 5LP6B 1SERA 1PRTC 1HH2P 1WOCA 3G6EA 4AYBE 3APQA 1BXTA 4TVAB 4X1IB 2A68C 3RW0A 2YIAA 4DV0L 4B3RL 1VP7A 4OO1H 2JJ2G 2F52A 1YVWA 3A54A 2VUMH 1LACA 2PCFB 4LF9L 3C3LA 1UUPA 3K06A 4GKKB 4PAAA 5JQGB 3LVBA 5KSWB 1EWCA 1NUCA 1QUQB 1N36Q 2CWAA 3ABTA 2BGJA 2ZE7A 2K7VA 2KCMA 3J7AU 2WACA 4DUZQ 4EEQA 4C3HH 1JOKA 3HKSA 3QTCA 4TKOB 2ITDC 4DR3Q 1CP9A 2R9VA 2LW7A 3F7YC 1N8RW 5FJ8G 5ELFA 3HKBA 3GIRA 2LQTA 2F03A 4ZI7A 3HKZE 5G3LD 4NXNO 1U5KA 3ETQA 1WNSA 1ZM4A 1LTAD 2DUDA 1IBMQ 4OO1I 1EP2B 1BHAA 1SE4A 1XWEA 2NN6G 5ELOA 4DUYQ 3BH4A 3VR2A 1CA6A 4B3RQ 4WJ3M 1I4HA 1RPRA 1I08A 1R3KC 1CXZB 1VQ8V 1KBHA 1A15A 1SAPA 2IM9A 2DY1A 3ZIAA 2AQ1B 3J7AV 4LW1A 3KCXA 1QQCA 5CC4A 5BSYA 4IL6Z 4A93B 4KKTA 4TMZA 5C0XG 2RQ6A 2ZBVA 4QIWE 3AK1A 4L6TB 3A3BA 4FF1A 2R93H 4O42A 1C0AA 3GVLA 3WU2Z 4JPRA 2NYZD 1YJNA 2K05A 2UU9B 4JI6B 1VMCA 3I55V 3HP3A 1IBKB 3CP2A 5J2TB 1D8LA 2OQ0A 4ZKBB 2B5UA 1JT8A 1YF2A 1U4LA 4BY1G 3GTMH 1O78A 3PUVA 2QDOA 4IALA 2FMMA 3JSNA 1SLJA 1S5LZ 1BE3H 2LFRA 2LO1A 1SFOH 4LF7O 1S4MA 3H9VA 1PRTF 3S1NB 1N34O 1P7GA 3ABLB 3B09A 1LLRD 2ATKC 4X8IA 1MHWC 1S72A 2RC6A 2VS1A 4X1IA 1EQTA 3DSQA 3FKIH 4M2LA 4Q0FA 4PI2A 3RYIA 5KX5B 1BF4A 2OYQA 4YCUA 1P7BA 3RYCB 2M2LA 4A3BB 3ASNB 4DN4M 1IBKL 4LUOA 5M5YB 4DW1A 3L9DA 1V1PB 2VZAA 5B1NA 3WB0A 2V4DA 3OAAG 2ZITA 3J81c 2ZJPA 2H5XA 5C5MA 2KCCA 3PIP3 5AFWA 4LF8Q 1IKMA 1OGIA 5FOBB 2WLKA 5T1GA 3T1HO 2FB5A 4UP7A 3OHXC 3PO2G 2YV5A 4KHPO 4YIPA 1UD2A 4WBNA 4DUZO 1HZAA 2Q8RE 2VS0A 1V55B 2K32A 3DM3A 2NTTA 3JD4A 3M4QA 2ZZEA 2XNDA 5EBMC 3CW2A 1GTOA 5BR8Q 2WYRA 4RD0A 1Q6HA 1XOUA 4LR3A 1H9KA 4XT3B 3I4MG 4JI2O 1MRZA 1R5OA 2SDFA 1J5EL 2JA7H 2EULA 1SQGA 2UUBB 5JVH3 3NHHA 2EXDA 1NAPA 5M9OA 3AQQA 1L0WA 2JIZG 1UNSA 2C77A 4CJ0B 3CRAA 4DR1L 4JI4Q 1WTHD 4LF9B 4B3ML 1WB8A 3H1JH 4DR2L 1S3OA 1M1KD 1SNDA 2A8VA 4QL5A 4EKWA 1QVGA 4QFMA 1K83B 2W0FC 4EQPA 5FA6A 4C3JH 3S1MH 4UVAA 2F4NA 1AE3A 4A3EB 4UV8A 4YJ3A 2VQFO 3QB3A 4QE7A 1TU2B 2QE7G 4MVMA 5IGBA 4B3SQ 1P16A 4QUZA 4X7CA 1W3SA 4RHRA 4Q5VA 3CMAA 1P84F 1VQOA 4GLXA 2PPBC 4JTCB 2UXBL 3OUFA 1MZEA 3V76A 3ZZTA 1QX4A 2WPDG 5BSXA 2JN9A 2CW0C 3I4OA 3WNBA 3U6KA 2Y0PA 5CA0B 4ULLA 1IBKQ 4JYAO 4C3HB 1Y0YA 4EQNA 1RL2A 1ZYRD 5D5PA 2B2WC 2A6ED 1SKYB 3G4SA 1LT4D 2Z6BD 1LR1A 3JAKB 4CS2A 1JOQA 1OCOB 2E75C 3CX5F 1IZ3A 3F7VC 3D3RA 2HDMA 5EKKA 2HJDA 2B63B 1I6VC 1VQNV 2RDHA 3ZRWB 4O2BA 4ROXA 4DK6C 3CMEA 1GKHA 1HHVA 1QNUA 3CXCU 3D36C 1Y76B 1OZ0A 1QBZA 4RWUA 4JI5O 1KJZA 1GO3F 2IH1C 2C9OA 2NN6I 2XGTA 3AG3B 1ELOA 1MABG 2NNUA 3OJXA 4DPGA 1UD8A 1PL0A 4FJCC 5LHHA 3ITPA 5D3IB 1XMOQ 4LWSA 3CCMB 4V0BA 1NTZH 4UVCA 4LF4O 4ZGQB 3ZUGA 4MTXA 4H44B 1S5DD 3ONUA 3OW7A 3X3NA 4F8MA 1D5AA 3A0HZ 1K3EA 1Q6IA 3TQYA 1SYCA 3UDGA 4GX0A 4UCTA 5LGUA 1SMYC 4X64L 1HNXB 4LF8O 2XASA 2L6LA 4P72A 2K28A 1QVFA 4YEJA 1EFUA 2RHQB 1STEA 5FLXc 4GOPC 1JPXA 4GKKO 2DYIA 1VQHA 4FIPC 1PJ5A 1H2GA 4QIWF 2YYZA 3PSIA 5JJIA 2OXPA 4X3UA 2DJFC 2Q73A 5IT9E 4IJHA 1MSGA 2R72A 4PJ0Z 1CQFA 4CHTB 5J2UA 1OCZB 2RQXA 3M3YH 1HZEA 4TV9B 1PNMA 1VQ7B 2JQOA 3D4DA 5A88A 4CS4A 3MMPA 2F3IA 2PW7A 1V0EA 4WJWA 1M56B 3MDSA 1EXMA 3QFTA 3DM1A 2HT1A 1Z5VA 5H1SE 3S15H 2PLFA 4KUMA 2HLDA 1U4PA 4ZGNB 4UP9A 4LFBQ 3A3GA 4FLZA 1MSHA 1G2SA 2JJ1A 4RJLA 4ACBA 2A19A 5LHIA 3F1ZA 3HOUG 4N9PA 2QKSA 2Q69A 2A9HA 3B8NA 3K9SA 4Z4UA 4JW0A 1QE6A 2GTAA 5GQOA 1ESFA 5KEEA 2X6YA 3H6MA 2IJKA 3OFNG 1DOLA 1UEBA 4X20B 3ABKC 3A0BZ 3VR6A 2VBVA 3E83A 3JAWA 2KECA 3RYFB 4H7BA 2X6CA 1YIJV 2P6JA 3K9AA 1E62A 3K57A 2EVBA 3FB5C 3HR0A 3VQVA 2AXTZ 1AW7A 4FVMA 3AVUA 3BCFA 1KTVA 3D36A 3MCAA 1JJ2B 1Q86W 2B9ZA 2DYSB 3KBXA 2J7KA 3ZCCA 4ZHQB 4DAMA 2I5HA 1EQQA 2DJVA 2KEEA 4PA3A 2CH7B 1CQXA 2ZXWB 3SLNA 3ABLC 2K5WA 3KLWA 3T4ZA 1K73W 1UAPA 4QB4A 1EY9A 4A3KH 4JYAL 1BS3A 2ZCEA 3CMAV 1KABA 1WTQA 3T4DA 3MXUA 4LNUA 5IGFA 1E1OA 1HXYD 5AG2A 3JCZA 2SNMA 4HJAA 3ZBHA 2VJJA 2B1IA 2JE6I 4U7OA 1M8AA 2PQAA 2DN9A 4LJZC 3GTLB 2QCPX 1EIYB 4ID6A 4DU9A 1NR2A 4O4IB 3NTIA 5ELNA 1FJGQ 2D3NA 2V31A 3CC7V 3CCMA 4PV1C 5IYDG 1G6UA 3G6EB 1SNOA 2QM4A 1K9MD 2D2CB 3OE7G 1V54B 2EIFA 5KW9A 1EZJA 4GT1A 2EOTA 5IYZA 3SHLA 3T56B 4OGQB 5IJ0A 3EIVA 1TKWB 3OW2B 1GAXA 5CMUA 1SQBH 4P9PA 3CMEV 2HKOA 2XAGA 3TMEA 5IY5C 1TWHH 4ABNA 4LMQD 5IP9G 1SBBB 1BGYH 2XNJA 3BY2A 4O4LA 1GD7A 4OPHA 1SETA 4LF8L 2E74B 3ZMTA 1V1OA 1DTOA 2K5HA 5B1BC 1J5EB 2X3UA 4DV6O 2R9RB 4IPDA 3G80A 1ENFA 3HEJA 3STZC 4JYCA 1KUQA 3GV3A 2YS8A 1XNRL 4R71A 4W4KA 3P20A 2Q2UA 2Z6KA 2WLIB 4BY1H 1KRHA 1CFMA 3NPPA 4KN7C 5KMGA 1XB2A 1QZGA 2GV9A 3S2DH 4BPRA 2XNDG 5LMUQ 2UXCQ 3OTOQ 2HHHQ 2KCNA 2YXHA 4K1XA 2XT9A 1Y74A 3H1IH 4P75A 5C44H 1R5BA 2ZTDA 1PJ7A 2K75A 2PI2E 3CKIB 3W2FA 4A3IG 3HOVG 4X66L 4WFHA 1X55A 2I1LA 1LTGD 1M90W 2ADQB 2DIEA 1DK1A 3CPFA 2RDCA 3BHPA 3FX7A 3I72A 5I6WA 2D74A 3PUXA 5FLMG 4HN7A 2H4OA 3VQXA 2QTZA 3T51B 3F8TA 4BY7H 2R93B 2VNKA 1F51A 1GOZA 3SVMA 1ASZA 2Q6AA 1N0JA 1SA0A 1IXMA 1VEWA 2DE0X 1N08A 2F0GA 2PMZB 3KLRA 3RLNA 4DR6Q 1I6HH 4NXNL 2QEXV 1K8AW 2F0HA 4X1KA 4DR5Q 3GTMB 4NB3A 3M9BA 5E4WC 2UXDL 4OPSA 3QF7A 3HKCA 2JSOA 5L37A 4J9YB 1D1IA 4L87A 1CTMA 3JYCA 4WORA 1AI4A 1RHPA 4YHHL 3K5MA 4XT1B 2EINC 2RMKB 3PA1A 3JALA 1TWAB 3KDFA 2F0PA 2DYRC 2WPDA 3JARA 5L3BA 2ZDIC 1S0VA 4NYKA 4BY7G 3PUNA 2BM1A 4CJ1B 2F0VA 4OXPA 2G9HD 1N0VC 1GJXA 4RCNA 3QFSA 4DXFA 2QWRB 5IDJA 4LF6Q 5KA6A 1Z47A 2DERA 4QGUA 2HUGA 2JYOA 1OXVA 3PMFA 3T13A 2F0LA 5C93A 2N04A 3HOVH 4A93G 1JCHA 5B1OA 4D6TH 4GKJL 4WF9V 1DOKA 1X3EA 2PZTA 2F1MA 1HZCA 3EHBB 3K0XA 4PD4F 2QF7A 1LUVA 2C78A 1G2TA 1H38A 4HSVA 1EYCA 2WLIA 3CD6V 1PV0A 1DM0B 3MZ5A 5HURA 4U9UA 2EIMB 3AEVA 1UPGA 2PQAB 1STGA 3TEHB 2IU0A 4DUZB 5KHJA 3E0JA 3ND8A 5JJZA 5KAIZ 1KECA 3PQIA 1E64A 3ML0A 1ZEQX 2B2VC 5CDFA 1OTCA 3OPOA 3RYHB 3CC2V 2IW3A 1FNDA 1IBMO 1OHHA 1VQ5B 4NMZA 3I70A 3VA7A 2JA7B 4P3IA 3OTFA 2BSKB 2IU3A 3WNDA 1WSRA 3E8GA 3E6ZX 4O2BB 5HFLA 4DNTB 3CMEB 3TCUA 5KHGA 1BSMA 4DV1O 2ZZFA 1Y1WG 1IBKO 4LCUC 3CC7A 3PA2A 1W9XA 1JR0D 1YLOA 1HR0Q 3BA8A 4LF6O 1OV9A 2WB1E 4FLYA 2A69C 1G8MA 4IYIA 1SE8A 3CXCA 1FXKB 1W6KA 3HAGA 3TP7A 1B06A 3L74H 1JR9A 4LF7B 1VQMB 2QW7A 4DNIA 2VNUD 1OO9B 5CBGA 4JI8Q 5IY0A 1AI7A 4ZOLB 3GVKA 1I7PA 3W1BA 2ZTNA 1WI5A 3JASA 4OX9Q 1Y6XA 2YC0A 4O4IA 1UMKA 4O2AA 4K5XA 4DR1B 4FFKA 5LP6C 1MSDA 3VYSA 4QGPA 4X66O 3MEFA 4UP8A 1R6TA 3I5DA 1JE4A 4K14A 4E2LA 2Z3YA 2ZXIA 4A3LG 5LMZA 4ICGA 1X56A 5TSSA 2BDOA 1MGSA 2L4NA 2SNSA 4GN5A 5M3FB 5DS0A 2QGQA 1Y1WB 4K8ZA 4DR2Q 4DR7O 1CA5A 4BY1B 2WWWA 2NWGA 1QVGB 2RSNA 4QJFB 1PZJD 3KOJA 2XZLA 1TS3A 3HOXB 3FAVB 2NZ1D 2DMXA 3BPZA 4J7KA 1FJGO 1BQEA 3MHSC 5IJ9B 4YELA 1YJ9A 3ND9A 5IP7H 2ZM6B 2R70A 1YI2B 1ZL8B 2ODMA 2JK5C 4LF9O 3BYYB 1G51A 2PZSA 4JI3B 5E79Z 4L5TA 3FKSA 1VF6A 2L1BA 2WV6D 5I4DA 5BR8L 5I2YA 4NXML 2V1CC 3BAAA 4R9WA 1S40A 1VQ6A 1FXHA 1RJTA 1F77A 1ENVA 3BZDB 3C46A 4QCLA 5E7NA 1VQBA 2CTPA 3PUWA 4HMJA 4MYUA 4NB5A 1GUGA 4OHJA 2X0LA 4CDDC 3S14B 4EVOA 4X62B 1FNMA 1AI6A 4LUVA 3F5TA 4MVZA 1RM1C 1BCPD 3OOCA 3P3NA 1Q12A 1DXMA 2N49A 1YITA 3RD4A 1I6HB 4FPPA 4FZ0A 2UXXA 1QFZA 4MSWC 2WSSA 3ULPA 2UUBQ 5JH7A 3NXSA 4XQNA 2AHZA 5GAEC 4UVBA 1R6NA 4EFBA 3RN4A 4B3TL 4F7XA 5EC1C 3KBGA 4DV6L 2PMDA 1KHIA 2QTOA 3NXWA 1IJFA 3V05A 4BXXG 1XQBA 3SYAA 3UO3A 2PYJA 1BPLA 2P3MA 2AHOB 2XAHA 4IFDI 1XBLA 5B1AB 3UKMA 2ZXHA 3S17B 2FVGA 1QU7A 3RR5A 1Q82D 4YHHB 3KF8A 3K58A 3N2GA 3KCYA 1TWHB 4NTWA 4DK1A 1QVFB 3IKJA 5M3FG 2Z8LA 3R8BA 3S1NH 3S15B 4LP8A 3QG5A 3P75A 3MHPA 2UXBB 5HKKA 1ICFB 4DR2O 1PXUA 3OWFA 4H13C 1CKNB 3OKXA 3LGJA 3QIAA 1JMCA 2WZNA 4DUYL 1G4YB 2V7WA 3LWUA 2YTYA 2YXYA 3HKEA 3CJHA 4JZGA 1D5XC 1TT2A 2WB1B 4RH6A 4DR4Q 4F6EA 2BCCH 1FD9A 3AG2B 4TV9A 3OD4A 3JCUZ 4MTGA 4LFCB 4Q7JB 5D14A 5H6RA 2BGIA 4ODGA 4LWSB 4B3MB 1WPXA 3CRZA 2QILA 3L70H 3LNNA 4XORA 3ER0A 4PZ7A 4XDLA 1XEQA 2RN9A 3ZJZA 3U9SA 3CESA 2ZTEA 4U673 4DUZL 3QVNA 2K01A 2BE3A 4YWLA 4DR7L 2FYUH 5EZYA 1QNMA 4IIJB 3J81N 4JYAB 3EVKA 3J80N 2JDIA 1ENCA 1EYAA 2O2LD 3N52A 5EPKA 4TT3A 4OO1G 1PP9H 1FFXA 2NBFA 1TAEA 3B4SA 3SJCC 5LGTA 1FS0G 3S2HH 2EX3A 3CS5A 4R6ZA 2X0KA 1NNXA 1VIBA 4PGOA 4JTDB 2KEDA 1XQ8A 4C1NK 5C4ZA 1Y1VG 1SN8A 2W0XA 4QF4A 2Q0OC 5GADC 4JI5B 1HR0W 5DSZA 1QJOA 1KC8W 3FDTA 1EU4A 4ZLTF 2I07B 1N32L 3ASSA 2UU9Q 4DV4Q 4CKEA 1OB0A 4NXMO 3GTLH 5LP6A 3F2CA 5BR8B 2BOSA 2CW5A 1TWFB 5KRUA 2QDXA 3I55A 4X65O 3Q8DA 2YICA 4DR4B 1H8HA 3E2EA 1CNFA 4XQFA 4IUTA 2B5OA 1JVMA 5CV4A 3TETA 1AP5A 2UUAO 1QFJA 1R9TB 3UO2A 5B3SB 1QH0A 5GV7A 1NS1A 3H3VC 3GSIA 5LXTA 5TR9A 1J6QA 2NLJC 3NR7A 1VQ6V 1GHJA 5I9OA 4A3GG 4HEDA 2RA4A 3SYQA 2F1LA 1O80A 3MTSA 4LBZA 4DV7L 3HOVB 3W7SA 3I7FA 3C1EA 3MWYW 4JI6L 1KK3A 4MVQA 2N78A 3NWTA 4J6HA 3WQZA 2CNDA 4YHHQ 3T1HB 4DXWA 2WLJA 4KY5A 1N32Q 1ZL8A 3KK7A 4Y52H 3U4VA 3A74A 1B4OA 1GKFA 3TXSA 1LV9A 2GVBA 4CC6A 1D5NA 1DF4A 2GDSA 4KY7A 4J80A 1V55C 1W34A 1GM8A 1HWYA 2YWGA 1OJHA 3CCVB 2KA7A 4U3JA 3UM7A 4JI0B 4YXWA 1R1BA 3S2DB 3MXNA 4H37A 1RSOA 1THZA 4UV9A 2ZIMA 2F0WA 2WKDA 4O4LB 3OAAA 4P26A 2K50A 1XJVA 2IY5B 1NB9A 1HZBA 2KHIA 3KF8B 4DQKA 3PO3B 5K1PA 1I4PA 1KQSU 5L3FA 1XNRB 3OYYA 5KX5A 2B7BA 5CV5A 1GM5A 4N3NA 1Q1BA 1WA8B 1TWCB 4ZCLA 1SF9A 2GK6A 4PDMA 1FNWA 3FKIG 1XFOA 1N8RC 1KU9A 5B1BB 1JWUD 3BYTB 4G7OC 3DXRB 2K33A 2D3LA 4ZUIA 3LDEA 3NE5B 1YJ9B 1WCMG 3GTGH 4X64B 1HRJA 4OPAA 2JN4A 1L0NH 2P7TC 2A79B 2Q6LA 2H94A 2XOKA 3IFDA 2YXLA 1B04A 3E89A 1BO0A 2WA4A 2AKWB 4DAYA 1P49A 1SC5B 4R8NA 3CCRA 1K33A 5F4JA 3I90A 2DW4A 3SE0A 2FL4A 1BMFA 1U9RA 1EBOA 1EEFD 4IPCA 2QWNB 3BDCA 1JWMD 4MZ9A 3TBIB 4LF5L 1Y69U 4JV5L 2K1EA 1AI5A 1TWAH 2A1AA 3I8ZA 4FLXA 1VQOV 4TN1A 1YVCA 4NDXA 4ZQ3A 4A3FB 4TQFA 4IYHA 3QJYA 1KC8C 2BOBC 1HNXQ 2V7UA 4X1YA 2X53S 4XLFA 4HZ3A 3G7LA 3TGUH 1VQLB 4GLVB 5IYBO 2V7QG 5GONA 4CBCA 1F20A 3G6JB 2CUGA 4NP5A 1GN2A 3W2HA 2DETA 1BDOA 1Q8KA 2FFKB 4NXMQ 2LJ2A 1JOYA 2DOSA 3JD0A 1SROA 2P5ZX 4JOIC 2BF4A 1E24A 3ZMZA 1NMFA 3ASTA 4PMCA 3CCJB 4HSPA 5M3MH 3E1YE 1E3ZA 3FMCA 2V7QA 4RGNA 2ES2A 1AH9A 4K3AA 1MJCA 4JV5O 3T16A 3DEPA 1WOSA 4C56C 1EIFA 5FO8B 3C2PA 5F2DA 4UUJC 3ABKB 1EN4A 3HGBA 1FFTB 4MT8A 2D5DA 4A93H 2OQKA 1ZLZA 4CH5A 3E0EA 5JEAH 3IFXA 4POFA 3MC0B 2ATWA 1N9WA 3X2QB 4N3GA 4GKJO 4WZTA 1SZTA 1ZM9A 3AVXA 1G7CA 4YY3Q 4XLCA 2R92H 2GUZA 2DNCA 2JK8A 2EINB 2LP7A 1K9MW 4I50A 5JCOC 3W3AA 3ASNC 3RWRD 2D0PA 2XAJA 2G9DA 4Z4SA 5HZBA 5B5EZ 3W7XA 5IYCO 4F7DA 3NEMA 4A4IA 1M4VA 4LFBL 1SR3A 4GOPA 4RUEA 1PZKD 4X9QA 4BAYA 3KG2A 5EIBD 1PMRA 1LTLA 1BR9A 1TWFH 1TY2A 4R8IA 4WZLA 3A1PA 3K0DA 1B9MA 3CSXA 2B29A 3D4WA 4MW8A 5KNLA 4YHBA 2P90A 4Z4RA 2CW0D 5DM63 1R9TH 3CB4A 3FP9A 1E43A 2HR3A 2Q7HA 1A32A 4UCVA 2VQEL 3W2IA 1JB9A 4FXUA 4MYTA 4OIJA 2IJHA 1XPRA 4X07A 3CRRA 3KL9A 3MXNB 2EYLA 2X69A 4G6IA 3JALB 4RM0A 5LGNA 1NRKA 1Q1EA 2NVTH 3H01A 3HG9A 4NPSA 1SQVH 1H2LA 3RT3C 5CA0A 1AJNA 2BM0A 1KNAA 3LUTB 1LUZA 2K1BA 3K0YA 5M3FH 2R92G 1EY6A 1XHXA 4JI1B 4K8IA 5I2XA 1GM7A 4JTAB 4R50A 3SYCA 3LO8A 4YAOA 1NB0A 1FRNA 3K7AB 4QVJA 1M4UA 1VLYA 4G7HC 1NBWA 2ALYB 2E5LL 2XRSD 1KXLA 3HOXG 3WG7B 4KHVA 3BZKA 4MTFA 1Q6UA 1OHHG 3M7MX 4B3RO 1VHEA 1LTSD 3B2EE 4I7ZC 5CR3A 3PO3G 2LMCB 3E5SA 2GJPA 3CCSB 4B48A 1IB0A 4GUNA 3IC9A 1X59A 1RKNA 2AUKA 5KAFZ 4XKWA 3BY1A 3CCEV 1QG7A 4R4TA 3RZOH 1O7LA 3K79A 2YUAA 1YIJA 4DA2A 3OGCC 4B3TB 4X06A 2GJKA 2RDFA 4JI1L 2MO1A 4DV3Q 4TOIA 4A3JB 3S2HB 3RYHA 1PH2A 3GTGB 1DGSA 5CBAE 5K5PA 4XDKA 4LFAO 3HZXA 4U68A 3KYHC 3SPCA 3L3OC 1YJWA 3CW2C 3GTOB 3CCUB 1IJEA 2NV4A 1A3UA 1I4QA 2F95B 3AG7A 1NU1H 5CV8A 1ZXTA 4DR7B 3U50C 4XIGS 2BH8A 4DKAC 5FNZA 4B43A 4IGGA 2QEXA 1LTTD 1B3AA 1PM9A 1XMOO 5THXA 4PQXA 1R3IC 2A06H 1GHKA 3AVTA 3SJBC 3JQQA 3W2EA 1QB5D 4RGOS 4I0XA 3CCJV 3CP1A 4RQEA 5E6TA 3VO2A 3H9NA 3H0GH 4IUNA 4P2CB 3I4NG 2R7FA 3IJ4A 5JJKA 2MUYA 5C3EH 2EIKB 1NVPD 2Y4UA 2CF4A 3NSWA 2HDNB 4IFDJ 1D1NA 4NVPA 3BCDA 1HPCA 3JC66 3OMGA 2UXDO 4RCYA 3U4ZA 4A3KG 1Y1WH 3CCMV 3GTKB 3GWKC 1HP8A 1H9MA 2KG7A 4KTAA 1KB9F 5M3MB 3Q38A 3IRBA 3ZHVA 4X7FA 2WLHA 1I5YA 5IWAB 1NZ6A 4Y7CA 2PE3A 4LF6B 4GOPB 4DV4L 2G38A 5A35A 1Y67A 3WXMA 1VQLA 2F23A 4B3TQ 3K8AA 2A69D 2VQEO 3GV6A 4H33A 1U4MA 3PCOB 1BBUA 4WBNB 4JI8O 3CPXA 1CI3M 1NTKH 1GN6A 2CHBD 2OEOA 1KD1C 2JA8H 5J2TA 1IW7D 3F2DA 3GVJA 1QGYA 1IXBA 1MNGA 1YCIA 5FPRA 3E22B 2DNEA 3NQTA 3PIO3 2OIEA 2Z5UA 1CSPA 4LFCQ 2ZZGA 2YSUB 1TS2A 1VQFA 4X0CA 3RNUA 3CC2A 4LH6A 1SDFA 1XNQL 2R7DA 2CC2A 4GKJB 1WPCA 4JYYA 1JOOA 3SKBA 1X32A 5C4XH 4POGA 1E2ZA 4FZ1A 4I7ZB 3QO5A 3M4OH 4ZIBA 4U7NA 2QA4V 2NVTB 4UDUC 5TV2A 2MHVA 3OUSA 3ABUA 4RDJA 3I56B 1K5SA 1OCOC 2E75B 4UXNA 2K9PA 1JWSD 3HKEB 4X62L 3D3IA 1NBMA 4XMYA 3AVWA 3J7YW 3FAVA 2CVRA 1CHPD 2YTXA 4GKKL 3PUMA 5IYPA 4K0KB 4JI2Q 5IIFA 3MFGA 2MNAA 3K6OA 2DY7A 4MIUA 1HTPA 5IT9N 3OT7A 1GRJA 1J9ZA 4CKCA 1W0KG 1ZTEA 5CV7A 2ZJQA 2Q6KA 1J8IA 1G6PA 5EYPB 1TUBA 3AFPA 1PYBA 1GAQA 3LDCA 2CGOA 2UXNA 5EBLC 3ASPA 3J81L 3BEHA 1S5HC 3GTPB 1Y1VH 4PMWA 4Z4TA 3D3QA 2BMWA 4EH1A 2DY8A 2O5IC 4GKKQ 2VB3X 4JI7B 4QPJA 4A3FH 3VMFA 2OWOA 3QO7A 2HDLA 1UEAB 5LYJA 3C90A 5H5JA 4AC9A 2A74C 2EY2A 3I4LA 5LMNO 1W6JA 2RF4A 4QE9A 2CDYA 3DXRA 1YNJD 3U11A 3G05A 1YJ9V 3PIPA 4GKJQ 5BN4A 1B70B 2JDIG 1QG0A 2Q6OA 5KNDA 1UJWB 4TQUS 2ADPA 5C44G 4A3IH 5JEAG 4K5WA 4BS9A 1PZID 3J7ZC 3CCUV 4LF7Q 1S5CD 1HNWO 3G4SB 4FK5C 3A8IE 2X6GA 2W6IA 5FNVA 3RVZA 4I0XB 3CC2B 2GK7A 3I4MB 2CTRA 1I18A 2M00A 1VQ5A 4F4LA 2NPFA 2GN5A 1XHZA 1WYDA 1RSOB 2DYRB 2Z0SA 3Q22A 2G5DA 2NN4A 2F4VQ 3PN1A 4OPOA 1U96A 1WP8A 1EYDA 4K6DA 1YZBA 3ETDA 5LL6X 2R92B 5B6IA 2IH3C 4UZUA 4UCUA 4C43A 1Z9FA 3NP8A 1ASYA 3Q24A 3SPJA 4FDBA 4LUZA 1IYUA 3RUZA 3NTHA 3MXPA 1NQTA 4G2KA 4DV3O 1UE1A 4K6LA 3JU4A 2WZPP 5C3WA 4JBMA 1GO2A 4X7DA 1K0RA 1D2EA 2XWBB 3C1FA 3MXGA 4HMIA 1STYA 4J7ZA 4K0KL 1N0UA 2ZD9A 1QVCA 3NWSA 3GTKH 5EPLA 2QN6A 4B3RB 2FMCA 1KAAA 5CA3A 3B8MA 1VQ9B 1WTWA 1EFWA 2A5HA 2E8GA 4DR1O 1NR4A 1IW7C 1B9NA 4Z1MA 2M9VA 1VJSA 4JC0A 3JARB 5JVG3 2ILMA 1N36O 1TUIA 4P1VA 2C2AA 1XPOA 4K0KQ 1MG1A 1Q46A 2CK3G 3I1FA 2BA1A 3LQ6A 2WINB 4I65A 5EPJA 4HIMA 1G7TA 1TTTA 4RMFA 1EYGA 1ORQC 2ZE5A 5IWAO 1O7ZA 2RSOA 3HOZB 3DGEA 1L0XB 4F87A 1SM4A 2XVSA 3NBHB 1X4TA 2JEUA 4XR6A 4HTHA 1JB7A 3QFCA 1WA8A 5TISZ 3T2MA 4UCRA 4K5VA 2DOGA 4KJOA 5IOCA 2XOKG 3B82A 2OF1A 2XN9C 4XTCS 5IYDH 1KKCA 5CBEE 5HXBA 4RWSC 1PTOB 1G7RA 2ARHA 5HFMA 2F4VL 3KZIZ 5BR8O 3HOUB 1FAFA 5E4XA 3ASRA 4HJ7A 5L3GA 2LFSA 2PZWA 4PC1A 2KBNA 4KKUA 1WTVA 2NVYH 2Z6BA 1PNLA 4JI4L 4YIOA 1Q9SA 3RZOB 2W6JG 1B2RA 1H9JA 2WAQE 3MD0A 4CC5A 5KYIA 5LMUL 4RKLA 2JGDA 1KLGD 1QNKA 1HNZO 4BY7B 5J9PC 1CK1A 2YEVA 3KUPA 1X6OA 1EZVH 3NQIA 3BCCH 3U6BA 1HQMC 1MI2A 3QWNA 4Z4ZA 4ZUJA 1H9SB 2JS5A 2QTSA 4L5RC 4P6VF 4C0SA 4B3SL 1RODA 2WJVA 5F4MA 1I0HA 5DLQE 3M85A 3GTPH 1YDXA 1FJGB 1ZWIC 1KKDA 2QDLA 1DDIA 3CHBD 4D7SA 2QGGA 3AVVA 2ICIA 4OPVA 2DQ3A 1CKOA 4B47A 3A8TA 2QJ1A 1I8DA 1T9HA 4J8QA 3I4NB 4DV4B 2ZKOA 3UQ8A 4DAPA 5KLVH 2Q2IA 4EQ5A 1YZ6A 1N33Q 1P8LA 1NR1A 3RYIB 3N27A 1ZAUA 3VR5A 1A63A 3LDDA 3GTQH 2F43A 2QE7A 1TS4A 3A8KE 4TUYA 3BC9A 4A3IB 4X6AH 3G71A 3UT5A 1YHQV 2BPOA 1JJ2A 4LFBO 3Q6QA 3V2TA 1WTOA 1AZQA 1PPJH 3ZEDA 4PHZA 4JBWA 4BWGB 1F2ZA 4HCEA 1HNXL 5IODA 2JA6G 1QLEB 1OXXK 1UD3A 2X6BA 4YAFA 2XEXA 2UXBQ 1F2MA 5I6YA 5A8AA 4YY3L 5LMNQ 2WSSG 4I5SA 4ZCKA 1I4XA 4P2NA 1BQZA 1CNEA 2FINB 1PNKA 1C9OA 3ZRVA 2EZVA 3H3VI 1EWIA 4IUPA 2MPMA 2NZHA 1B7YB 2QM7A 1TXYA 3CC4B 3BDOA 1H8EA 4II3A 2Q8TA 4GX2A 3VYUA 4AYBG 3ZC3A 1VQ9A 1EY5A 4C3HG 3FPPA 4IIJA 3ZIAG 1K4CC 1M90C 1H8HG 1NTMH 4ZRZA 4DQLA 4B3MQ 2HG5C 2PI4A 5J35A 1RTOA 1AN8A 2B2WA 3NBIA 4JI8L 4P71A 1K8GA 4PDVA 3PVDA 3B6YA 4FXGC 3K04A 1VQAA 4HAMA 1II3A 3L72H 1N07A 5GV8A 2SEBD 3ASOC 5A2QN 1IHMA 5FO0A 1EIGA 1GM9A 3LNMB 1KNEA 4RGTA 2GBOA 4WFEA 2JJQA 1BZKA 1H2KA 3AK3A 4X3KA 4BIOA 4YY3B 1Y14B 3I91A 4XQQA 3PUYA 1SSOA 3MVVA 4DV2B 2EZPA 3T1YO 1QR8A 4LFAB 1AR4A 2X6XA 1TUEB 3CD6B 1Q82C 2EJFC 3GTOH 1OXUA 4DV5Q 2CH4A 5B66Z 2WJYA 2ZT9C 4F88A 1DARA 4X20A 3CCSV 4NXNB 2VBTA 4LC0A 5FLXN 1D1KA 1F9RA 4R4OA 1U97A 2ITCC 2AWOA 2NUCA 3I2ZA 3JATA 4X64Q 3JAMN 2B2YA 1QCEA 2ZBUA 3EFXD 4OL7A 3WOFA 5J22A 3K59A 4DRXA 3CCRV 3HOZH 2H1EA 1M1KC 2EY5A 4BXXH 4JAVA 5EC2C 5CYUA 1YHQB 4W4LA 3ZMVA 5FLMH 1Y1VB 3VQYA 2OT5A 5EJWA 3OW2A 1N05A 5C3EB 4ILWA 4DV0O 3T1YL 3ICXA 2YEVB 1RM1B 3G71B 1NH2D 2WIIB 4PDLA 1EFCA 3J7A5 4JVZA 1A62A 4GZYC 1JQ0A 1M57C 2K5DA 4RDLA 1XL6A 3PUZA 1FD7D 4IW3B 2VW9A 4B3TO 5GTHZ 1FVIA 1YEWA 2HLDG 1H2NA 1EOTA 1EZ6A 2IT1A 1RQPA 2ZNIA 5LA6B 1RD9D 3CRMA 2NVYB 1IBLO 5FLXL 1DDGA 4EGVA 3CRLC 3KJOA 4DR3L 3S14H 3W2GA 4JI1Q 4KHPB 3W5VA 1K92A 4WFAV 1VQ4B 4RKBA 1PFSA 4QY7A 3CCVA 2AHYA 2JA9A 2H8PC 3RGBA 2WB1G 4XYQA 3I4MH 4ASUG 3P27A 4II2A 1OB5A 1DOMA 4DV2Q 2EQSA 2N05A 2IX1A 5JAVA 4C3JG 3FFQA 2OK7A 3N6RA 5M5XH 2HFEC 3AEIA 3JQPA 3AG2C 4O4JB 2OBTA 1A8VA 2HEPA 4X7EA 1RDPD 4HIOA 3PO2H 1KDAA 1PH5A 5CB4B 1N36B 2LKVA 3SGIA 1F2LA 2JGDB 4GYCB 2L12A 5C4XB 1PTOC 2EY6A 1Q8IA 4GX1A 1XNRO 2EZOA 4L5SA 3UT5B 4QHYA 4H13B 2JP1A 3E3XA 1Q86C 2BE5C 2KHJA 4I55B 2ZL6A 4XXEA 4QV2A 3AFQA 1NKDA 1OCRC 2ZE6A 3E86A 3PENA 3X3MA 3TK1A 2D2CC 4UB8Z 4X66Q 1SNQA 2EIJB 1OCZC 1XNQO 3OFNA 1XMQQ 5EKIA 3Q4HA 4WZKA 1CUKA 1NMGA 2DN8A 4L63B 3CC4A 4DR1Q 3T1HQ 3C3TA 5BXZA 2A0LA 5D5QA 2MK3A 4JI2B 3W5HA 5AJ3L 1G291 2P67A 1IL8A 4DR4O 3TZUA 4J11A 4N21A 1G7SA 2R9IA 4X1KB 1HTLD 4OGQC 1UE6A 4TWKA 3QO2A 4FM2A 2FTKA 4DV5B 3TS0A 1LO5D 5H5NA 4DV1Q 2Q4PA 5DM73 4N23A 2VQEB 4RD2A 1B8AA 1YNND 3BU2A 1ZM2A 2ZTGA 4J7JA 2BA0A 3CXCB 3DLLA 3ZZ0A 3SXHA 1OGJA 3ZJYC 3SK4A 1FNBA 3W5UA 1H8EG 4JOIA 2HCIA 5LMNW 4TV8B 5FO1A 1E1TA 1PTOH 2BVNA 3HOYB 2PZUA 3A56A 2YI9A 4DO2A 4PG3A 4PDRA 3IC7A 5IWAL 1PH1A 4KP4A 4FN5A 3E22A 1PTOF 1Q90A 2X6AA 4OEMB 3P26A 2I0QA 4JI7L 4EFEA 2EE1A 3A8KA 2NVQB 1KQSB 4LF4B 1HZ9A 3CP0A 4X3SA 2RCNA 5CV9A 1QGZA 3CCEA 4A3DG 4XYOA 1GMGA 1N4CA 1LABA 4HNAB 2K52A 1A0IA 1MZFA 5LYJB 2LXJA 4CZZA 1BQ0A 4LF8B 2GQFA 2VWKA 1S3JA 4UPAA 2BH2A 3LSQA 1K3RA 5A9GA 1EWHA 2F3WA 3L2PA 3FB8C 4PA4A 4XDJA 5L3EA 1QLEC 2JIZA 4P6YA 4FM0A 2P4VA 2BN4A 2R9AA 2C4TA 5C5LA 4GNXB 3FB6C 1VQ8A 3QE2A 3O65A 4IUVA 2JVDA 1HUNA 3EBEA 4PA7A 1YX2A 3STBC 1FNVA 2IJ0A 1HNZL 4FF4A 3RVYA 2AW9A 4RAUC 5LA6A 3OTOB 2HHHB 3RLFA 4IO9A 1VQ4A 5JWPA 4GNXC 1JB3A 2E2HH 1XMQO 4A3JG 1FGBD 2C35B 4RD3A 1N36L 1K8OA 5D3DA 3CCJA 1SNMA 3JASB 3W7WA 4N9TA 4TMTA 3ABMC 4O4HB 1OCCC 1VQPB 1QOHA 5A89A 2CCZA 1GUWA 2XTAA 2JEAI 4LBVA 1L2FA 1HNWB 4AHCA 1LT6D 2KHSA 4L5QA 4GZRB 1T6ZA 1E3PA 5DEDA 1DCZA 4FLTA 5IT9L 4G57A 4MTKA 4HR7B 2ZXWC 5IT9c 1K28D 1BCCH 2F43G 4I50B 1N34L 1XDCA 1TVKA 5HY6A 1V5VA 4KI0A 4Q20A 5JVDA 5IGDA 3ZPNA 1HA5A 1GH6A 1WTHA 2DJGC 2RCFA 5IWAQ 2DWDC 2CTWA 3WDNA 4LNUB 5M5XB 4K0KO 1IDSA 4UHVA 1NJIW 2AGAA 2BOCC 1XI1A 2UXCO 4RDKA 5IK2A 5DM6V 2LGQA 4JI6O 4TMXA 2GREA 2NZOA 1S5FD 3ZZUA 3ONAB 4YCVA 3PO2B 1F9SA 4OX9O 1O9HA 4IFDH 3RBZA 2ICEC 4Z1MG 1VQCA 3G48A 5M3MG 2OTLB 1Q81W 5LL6Y 2PY5A 3QR8A 2AHOA 1C7YA 1I50B 3P32A 1VQ7A 5IYZB 4TQDA 1GVPA 5JPMC 1JX9A 1IYVA 1HDJA 4WJ4A 1VQKB 3H1LH 4Y9UA 3OR7C 1KD1D 4FO2A 1FJGL 2OBRA 3CMMA 5ELDA 1J5EQ 1E1RG 4M8AA 1NCVA 1K7DA 3CCQV 4QIWB 3TP8A 1US6A 5G3LF 2ID0A 5IYCG 2B2UA 3B77A 2KSDA 5JH7B 1PKVA 4P30A 1E2WA 4AILC 1PH4A 2ZINA 3PF5A 2YU9H 2RCVA 4QJFA 4RA8A 4BBRB 5IP9H 2LSSA 1XE1A 4JI4O 1QUFA 3DDYA 3Q3AA 4RGMA 3E8BA 1TR5A 3GP7A 4PABA 4DV6B 4AVZA 2IWHA 5HGQA 4H02A 2IPKD 2Y0SE 2C5HA 2OT2A 4KD3A 5EAYA 2LFNA 1JJOA 3HOWH 5LMUB 2NB0A 5C0XJ 2CK3A 2ZDIA 1SRUA 4A3DB 3I4NH 3VDYA 2IL8A 3T1CA 4JAAA 4G5GA 5IJ0B 1AE2A 1JJCB 3CXHF 1SS3A 3T1YQ 4P74A 3OEEA 4ZOLA 2F0DA 1UD4A 2D0OA 3D8CA 3GTQB 3FB7C 2RBMA 2EYJA 1N32O 3FYIB 4EB6A 1WP6A 4J0QA 1H95A 3ASOB 2PI5A 1WTRA 3I3CA 2NVQH 4AQYB 4OOSA 1PYSB 1STNA 2P06A 1F7YA 5KNBA 1KMIZ 4BR6A 1YXBA 4K2KA 4KV6A 1K8AD 5GTIZ 1QGAA 2QKIC 1SQFA 3D4RA 1V1QA 2Q7GA 2KQXA 1QUQA 3W7TA 1VQNA 2OIGA 2UUAQ 1HVXA 4B3XA 4LF6L 2VNHA 3H1HH 4CQJA 1B44D 1F9PA 3VYRA 5FLXE 1VQ5V 4P3YA 2MO0A 4X65Q 5KMGB 3DC6A 2EDGA 3OP1A 4WFFA 4ACAA 1VQOB 4FF3A 4FFBB 1MJEA 1EU3A 1DZ1A 4O4HA 1VQPA 4DW0A 1E1QG 1RTNA 4DV4O 1CPYA 4HNAA 2C4UA 4A3GH 2FKXA 3F2BA 4TUYB 2EJ7A 1KZLA 2JJ2A 3AG1C 4MN3A 1WB7A 4QUFA 4WFGA 4P12A 1YHBA 2QR4A 3GB7C 1EL0A 1KAWA 1BT8A 1XTDA 3FEWX 2KKWA 5IE8A 3J80L 1LTRD 3K80C 2CGNA 1COWA 1KIXA 2B2YC 4FLVA 4LFBB 1VQDA 3M4OB 1SYFA 1Q86D 5C8YA 3E9HA 4JPBW 2XRQD 2KVOA 3G6BA 4FWTA 4QUCA 2UXCL 2Q5ZA 3URYA 4LFCO 4DGZA 1TGOA 3HKCB 5L46A 2KCTA 1YSCA 1IKLA 1K3BC 1WJZA 4OOVA 4RPDA 4ME5A 3CB2A 1H9RA 4DR5L 2K03A 3FKSG 5TY0A 2KOLA 3B40A 1PKXA 2GHYA 4YAWA 2QWOB 2MGSA 4JI0L 1W59A 2Q67A 3MAQA 2R6GA 3SJPA 1PRTB 3K7AH 5J3OA 3SJQC 4Z4VA 1NSNS 1ONLA 2CWPA 2XSCA 3J80i 2KQ3A 4DV6Q 4LFAL 1UE7A 1HNZQ 1AJPA 4H9GA 1VQKV 4B3FX 3SDLA 4PNYA 2P5OA 1WU8A 2EYOA 3N2GB 3DC5A 1Q7YW 2VUMG 3CQZH 5IYBG 1D5MC 3FVQA 4RHSA 1I50H 4G1BA 2IX3A 3R93A 1SRYA 3SLDA 2A6EC 3NELA 3LSSA 3AG3C 3P3PA 3WWVA 3HOYH 1TLLA 1X3GA 1F60A 1J9OA 4NTXA 4JI2L 2Y0IA 1LUWA 1NBMG 3JD2A 5CA1B 2PYLA 1SYEA 2Q7EA 4FFBA 1SYGA 4R4QA 3RN2A 4A3JH 3LQEA 2OCHA 4PZ6A 5EIBC 2ZL7A 1FX0A 1YEZA 4FYDA 3PIOA 2X7RB 1W0KA 1AMOA 1M90D 1Y8OB 2PMZE 1RCVD 1EY0A 3Q23A 2O5JC 4F6RA 1KK0A 3ZHUA 1V43A 4JI7O 3DTUB 3V7AA 4QPKA 3BQJA 1EN5A 4XNFA 3ETGA 1HNXO 4YAUA 2CQOA 1NVPB 3BFRA 4TV8A 4DUYB 5FL7G 2N3SA 5ISRA 2JS3A 1BX0A 3H0GB 1NDHA 5IY5B 5KNCA 4AIMA 2E76C 3S3WA 1I7FA 2UXCB 4KL1A 3EXAA 5C4JB 3TP6A 2E2HB 3BVZA 4BBSH 3WBKA 3L0OA 4B3SO 4J9ZB 1A3VA 2RNBA 1IBLB 1SE2A 1O7IA 5J2UB 5DN6G 2A7WA 2JJ1G 4AH6A 1S72B 1D8TA 5IE9A 1TY0A 2Q2HA 2YU9B 3AG4B 3HPLC 5CB4A 4WFBV 2HVJC 1U0LA 2ENBA 4OWXB 5LHGA 4JI6Q 1M5IA 1AZPA 3CP8A 1URFA 1IBMB 1EFRG 2AZ0A 2LS01 3MEHA 1YHQA 1K28A 1WD1A 4DV5O 1EP1B 4X62O 1BHBA 3K5OA 2HMAA 4PELA 1VS0A 4GN4B 4DV1B 4BW5A 4IT5A 3GQBA 1X9NA 5C4HA 1K5QA 2R61A 3CRKC 3GD7A 5KYLA 1Z7TA 5K1XA 2EYHA 3CWBH 3ULLA 5C3XA 1A2UA 1R5NA 1VQPV 3U10A 3CD6A 5H6QA 4XLHA 1VQ6B 2JA7G 4A3GB 1SJHD 5C3EG 5DECA 1X54A 3A8JA 1G91A 1MIUA 2WFWA 4FXDA 1ILPA 1T5XD 1E79G 4M53A 2IW5A 1BCPF 3BJUA 2FX3A 4KHPQ 3FYEB 3VQWA 4JG2A 4DV2L 3SPGA 4R7CA 3R65A 4RG1A 2WKCA 1N34B 1BCPB 2Q6IA 4I9WA 4IJLA 3THOA 1N32B 2K5VA 1TA8A 1YITB 3OEHG 2F0JA 1GUOA 2HCJB 5HGTA 3UDFA 2JA5B 2CFMA 1YJNB 5IYCH 3CRCA 1WCMB 4O0AA 2RC5A 1LM0A 4BBRH 4JBKA 2D9UA 2BTQB 1TWGH 1VF5B 2ZM6O 1ZUQA 5JCOA 1XNQB 1CM9A 1M56C 2Y48A 1LTID 1VHOA 5KHHA 3SR1A 2GSMB 3EROA 5EMNA 1DG1G 2V7XA 1TVXA 3D8GA 3DWPA 4C2MB 5IGEA 1VQKA 1GO3E 3OSOA 1XMQB 3BDLA 2WA3A 1KQSA 1N33B 3ZBUA 2E76B 4ZI7B 4HE6A 1FFXB 1KDCA 4MVRA 1EP3B 4KK7A 3P1HA 1KD1W 1K34A 1VQIA 4FXKC 4WRDA 1GR1A 3S16B 1LT3D 2JA6B 5T1IA 2CH7A 2IJIA 1JA1A 1RQRA 3JD3A 1QZHA 2L0CA 4OONA 1SZXA 2E1RA 2ZL5A 4N8X1 2QEXB 1NE3A 5AJ3Q 1I94L 3ZN1A 1Y8NB 1JMKC 2CKZB 3CCVV 3Q6SA 4NXNQ 2A68D 4H44C 4G7ZC 2Z9HA 1HFNA 4DR3O 3SYOA 5FJ8H 1ML0D 1JA0A 5FK9C 2KUMA 1F23A 1XNQQ 2LGWA 2UUCL 1XILA 4DR5O 2KG7B 5KUKA 1YIJB 3ZYYX 1YITV 5GAGC 3A7LA 2Q8VA 3OWEB 2UUBL 3GTJH 2QM8A 1I94O 3ASQA 2LY7A 4A3CH 2F0FA 4K2LA 3APOA 4H0LC 1GN3A 3VBBA 5NUCA 5H2FZ 4OP7A 4XLAA 1KYOF 2F0EA 1HUMA 4A76A 2YDEA 4UB6Z 4GLAC 3A8IA 4GNXA 3A7AB 1V54C 1XX8A 1F4NA 2LZJA 4R4IA 2Q9LA 1WPBA 2NTSA 3CJHB 3LSUA 3OJWA 3AGQA 5FIUA 3SK6A 4X88A 3CMAB 3H09A 1DF5A 2ZNJA 1Q82W 2BV3A 3SEBA 3HOWB 2PNRC 3EN2A 4JCVE 4J10A 5LMUO 4Z1VA 1N8RD 1SJED 2WP8J 3LWEA 4A3DH 1T6YA 2F66C 2HVKC 3ZMSA 1QR9A 2VNIA 1J95A 3ZHQA 2X85A 3CCQB 3D6CA 4DV0B 2EJMA 3OGIB
chains in the Genus database with same CATH topology
5LXTB 2PGGA 2K6AA 3PV0A 3MFYA 1BLIA 5D65A 3WB1A 1GXDC 1TIID 4IURA 5BN5A 4DNRB 3JAKA 3HS0C 2HQEA 3NUCA 1X3QA 1E3XA 1E1RA 4UCOA 1E79A 1AEXA 2F0UA 2CAZC 3R3OA 4CKBA 2XWJB 4O4JA 5ELCA 3VYTA 2B8GA 1GUTA 2UUAB 1G6ZA 5ELBA 4XKVA 3A2FA 2PYKA 5IGCA 4X65B 1TWGB 1JFFA 5ITZB 4I9QA 2BTOA 3A8JE 2IX0A 1V0FA 2J7ZA 4EB6B 4QMGA 4DK0A 1CQVA 4ASUA 3ERQA 5FO9B 2RKSA 4JI4B 3DHQA 4JMQA 1V8QA 4P22A 2B2TA 1L8DA 4BBSB 2I46A 1PFBA 4X66B 2Z1CA 3EJIA 3RD4A 3TZDA 2ZXOA 1A6XA 2JEBI 3GO5A 3JAML 2XGJA 4B9XA 2GA4B 1SKVA 5CMDA 3OIPA 2BE5D 1I4GA 1LTBD 2K5QA 3QG1A 3TP5A 3QOJA 4U3JB 3VA5A 2B2TC 2X8KA 2YIBA 4NKLA 1EIHA 4XN0A 1UD5A 3QOLA 3CQZB 3CHXA 2CQAA 3D6WA 4Z9CB 4CH4A 4KHZA 1B53A 2AQ3B 1C8CA 1F9QA 4GQNA 4CBVA 2ZXPA 4EQOA 4DRXB 4DR6B 3DXJC 5ITZA 4CH3A 2A73B 1V1PA 2XNAC 1JORA 5JQGA 5JJEB 4D7TA 2F3VA 4YJ2A 3HKDB 4XONA 4JV5B 2QEJC 1K8MA 2UUCB 5FO7B 4ZYSA 4UCSA 2B39A 2BCOA 4YIJA 5JJJB 4XLEA 4HBNA 1SMYD 3RYFA 3HKBB 2PW5A 2HCCA 2AUJD 3BABA 5EZYB 5DAUA 3SR2C 1QILA 5JPNC 1BCPC 3U9OA 2F4IA 1VCIA 2L5TA 1S5JA 1STHA 2PUSA 3NBHA 4XD7A 1ENAA 1T5EA 2J0TD 3VR4A 1PLFA 3DWQA 2F4VB 1OXSC 2J4XA 2A6HC 4B3GA 2R3ZA 1WVLA 1WTPA 4KMUC 4S3SA 5K36G 1GUSA 5FKAC 1HR0B 1RF2D 1S4ZA 1C4QA 1EFRA 1SNPA 1PDQA 1HCZA 4K2LA 5LHY1 3J81L 4XOPA 1STBA 5FNVB 2N88A 5FL7A 1E0BA 4PMBA 3AMUA 2P22C 1ICWA 1DYQA 4HIZA 1EZ8A 3H94A 2EYMA 3N2KB 1EEID 5DN6A 1C48A 1HA6A 4DAVA 1Q3EA 4TSSA 4G7WA 3V96A 5I9PA 4ZAIA 4Q6GA 3CU7A 4C3IG 1HQRD 1HW7A 3LX0A 3SK5A 4NXMB 1EY8A 2E5LB 4FLUA 2SOBA 4KD4A 2XZPA 1O7YA 4B9WA 2ZIOA 2F0SA 2F0OA 2XSCA 3AU7A 2RVLA 1KDBA 3M3YB 3WB2A 3EA6A 1SXTA 5KHKA 1X3PA 3WOEA 5DEHA 4M1UB 1ESRA 3SJAC 3A35A 1MD2D 2QDBA 4C1NI 2Z4HA 3BRCA 2XHBA 1D5ZC 1D2BA 3AB9A 1JC7A 5COYA 1LT5D 2R7ZB 1R4QB 3GTJB 3OE7A 1EY4A 2M5SA 4I55A 1U4RA 2FJ2A 1ZKOA 5GONB 2Y0SB 5LOVA 2X6WA 4E6IA 4YJ2B 4HAEA 2PQEA 4BW9A 1SA0B 2PTMA 2NN6H 4ZK9B 1R4PB 3KLSA 2O4XA 1PRTD 1ET6A 2Q0AA 1VF7A 4PI0A 1PFNA 5C0XH 5EBCA 4G4KA 5LMNB 1JICA 2K04A 4FP5D 1E1QA 5M5WB 3D31A 2YI8A 4LF5B 3DWAA 2N55A 2XIWA 5CA1A 4DR3B 1O9GA 5IJ9A 4FNFA 2F0KA 3F2UA 3MA2B 3JAWB 4NNJA 3J81E 3S1RB 3TSSA 4I4TB 4IN3A 1BOSA 5C6AA 1NT2B 4F6RB 5KGUA 2AWNA 1YNJC 2F0TA 5DNFA 5CV6A 2AQ2B 4CJ2C 5JOBA 4FM1A 1S5ED 1FYCA 2D62A 4KKSA 3KLSX 3L7ZC 2E74C 3RMHA 3N2KA 1EFID 1I3QB 3EQLC 3SK8A 3K5NA 4OIKA 5C44B 2EPBA 5A2QL 5C8YB 5J39A 2L11A 2VWJA 1ET9A 4XL9A 3M7NA 4G7XA 4FLWA 4E0FA 1JFFB 1OXTA 2TSSA 3J7AF 4DV7B 3H91A 1I94B 4IUUA 4DF7A 5JVDB 3OEHA 1WN7A 1UD6A 1EY7A 5LOVB 4IUQA 4XDXA 5E3FA 1A3TA 5ELEA 5EKLA 1PTOD 1ZYRC 3M4YA 4XN3A 2XZOA 1XXGA 2KJXA 4WFN3 3T53B 1WTXA 1BUVT 2F0NA 1TS5A 4B08A 5FPOA 1GUNA 1CHQD 5EGTA 1TVKB 1H9SA 1DONA 4BWAA 1Z6HA 3NTKA 1STAA 3HKZB 4B3SB 3DEOA 3S9WA 2A6HD 4ZKCB 4CH6A 4YJ3B 1G8ZD 1IYVA 1Q5OA 4I4TA 2UXDB 3JAME 4BA1I 2EYFA 4HCSA 1F2YA 3SDZA 3NK9A 4NW2A 3DUZA 1JCKB 1S5BD 5CORA 2B8FA 3RFRA 3TN2A 2VQFB 1Q3LA 2KVMA 3IFTA 1AP0A 3Q0AA 1QCBD 3HKDA 3O13A 1BQQT 1BNZA 1XMOB 3BVGA 1KTKA 1E2VA 2F93B 1DD2A 2BTQA 5EYPA 1L0YB 2VJIA 1SEBD 2JXMB 4JK1C 3S1QB 4IQZA 2E2DC 4KJNA 2VXWA 2PO4A 1TQOA 2B2UC 4KY6A 1MABA 4XM3A 2L9HA 3S1MB 2E2JB 5KHIA 1PFMA 2GJRA 2B2VA 4C3JB 3A55A 4UFZA 3BA9A 3IAYA 1H2SB 5EQ0A 4DXGA 2EJGC 5CGKA 3JATB 1SNCA 4RCOA 3JSLA 4X3TA 3K5LA 1EQVA 1MBYA 1Y8PB 2C5CA 3I73A 5BN3A 4IHJA 3T1YB 4XOTA 3P7JA 1TUBB 2BDNA 3BVMA 2F0MA 3J80E 1SFOB 5BMVA 1VMPA 3FPUB 2MP1A 1B1ZA 4CS3A 2Z4IA 3R2IA 2F0IA 1B2TA 3RZDB 3IL8A 1VF5C 2TMPA 5C0XI 3M7GA 2Q8IB 1KLUD 2VUMB 1A2TA 2E3CA 5LL6S 4XQJA 4DR5B 2X6LA 4AYBB 4MHEA 4C3IB 3OMCA 4ZHQA 4Y7NB 2F0QA 3KEWA 3FRPB 3RYCA 2ZZQA 3L9AX 2EXZA 4K8JA 1CT1D 4DFAA 4A3MB 1YNNC 2RJZA 3ZS8C 3OIQA 1AFPA 3T4AC 4X1YB 4DV3B 2E1BA 3HRZC 1VDZA 3DMUA 4IHJB 4UAIA 5E1FA 2ZXRA 3BG3A 1KMHA 3EVQA 1QHTA 1ILQA 1JQYD 1HFGA 3U0ZA 1HNZB 4O2AB 1XTCD 1XYIA 5JJNB 1W0JA 1PYWD 1Q43A 5IGGA 1FR3A 4KN4C 1DJRD 4TSFA 2FHTA 1I4RA 5EBDA 4RFBA 2L55A 1SE3A 5KIXA 2EY1A 2W6JA 3FKIB 1V9PA 1IHZA 1FNUA 1M93A 5A2QE 4K8XA 1QWYA 4IZ8A 4V190 5JEAJ 2NVXB 4L8JA 2RDGA 3R2TA 5J1ZA 1D6EC 4LAAA 2WAQB 4O1NA 3UI2A 1B50A 1CZWA 5BMVB 4DR2B 4J1MA 2VB2X 4A3KB 2EYPA 3VR3A 1SYBA 4LK1C 4BA2I 1WD0A 1CZGA 3BS1A 3TDQA 4JI8B 4IFDG 4TRDA 2YIBD 4LH7A 4OX9B 3MHBA 2JGUA 2MJ8A 1SYDA 1Z5WA 5LP6B 1PRTC 1BXTA 4X1IB 2A68C 2YIAA 4OO1H 3A54A 1LACA 2PCFB 3C3LA 1UUPA 4GKKB 1NUCA 5JQGB 1EWCA 2K7VA 2WACA 4EEQA 1JOKA 3QTCA 4TKOB 2R9VA 2F03A 5ELFA 3HKBA 4ZI7A 5G3LD 3ETQA 1WNSA 1LTAD 4OO1I 1XWEA 1SE4A 2NN6G 1CA6A 3BH4A 3VR2A 1I4HA 1SAPA 1A15A 2IM9A 2AQ1B 3J7AV 1QQCA 5CC4A 4A93B 4KKTA 5C0XG 2RQ6A 4FF1A 4L6TB 3A3BA 4O42A 3GVLA 2NYZD 2K05A 2UU9B 4JI6B 1VMCA 3HP3A 1IBKB 3CP2A 5J2TB 4ZKBB 1U4LA 1O78A 3PUVA 4IALA 2FMMA 3JSNA 1PRTF 1LLRD 2EZVA 4X1IA 1EQTA 3DSQA 4Q0FA 4PI2A 3RYIA 5KX5B 1BF4A 2OYQA 3RYCB 2M2LA 4A3BB 4DN4M 5M5YB 1V1PB 3WB0A 2V4DA 5C5MA 3PIP3 2KCCA 5AFWA 1IKMA 5FOBB 5T1GA 3OHXC 1UD2A 4WBNA 2Q8RE 2K32A 2NTTA 2ZZEA 2XNDA 4LR3A 1H9KA 4XT3B 2SDFA 1SQGA 2UUBB 5JVH3 3NHHA 1NAPA 5M9OA 1UNSA 4CJ0B 1WTHD 4LF9B 1SNDA 1K83B 4EQPA 4A3EB 4YJ3A 3QB3A 1TU2B 4RHRA 4Q5VA 4GLXA 2PPBC 2CW0C 4ULLA 5CA0B 4C3HB 4EQNA 1ZYRD 2A6ED 5D5PA 2B2WC 1SKYB 1LT4D 2Z6BD 4CS2A 3JAKB 1JOQA 2E75C 3D3RA 2HDMA 5EKKA 2B63B 1I6VC 2RDHA 4O2BA 1HHVA 1QNUA 3W2DA 2NN6I 4KD3A 5C0XJ 1GUWA 2C9OA 1UD8A 3ITPA 5D3IB 4V0BA 4F8MA 3X3NA 1S5DD 3OW7A 1D5AA 1SYCA 4UCTA 1SMYC 1HNXB 2K28A 4YEJA 1STEA 2YYZA 2OXPA 4X3UA 5IT9E 1MSGA 2R72A 1CQFA 4CHTB 5J2UA 2RQXA 1HZEA 4TV9B 3D4DA 4CS4A 4WJWA 2PW7A 1V0EA 3DM1A 3S1NB 1Z5VA 2HLDA 1U4PA 3A3GA 4FLZA 1MSHA 1G2SA 2JJ1A 4N9PA 5KEEA 1QE6A 1ESFA 2X6YA 3H6MA 1DOLA 4X20B 3VR6A 3JAWA 2KECA 3RYFB 4H7BA 3K57A 2EVBA 3VQVA 1AW7A 4FVMA 3BCFA 3KBXA 4ZHQB 2KEEA 3NWSA 2K5WA 4QB4A 1UAPA 1EY9A 2ZCEA 1KABA 1WTQA 5IGFA 3MXUA 4LNUA 1HXYD 2SNMA 2JE6I 2VJJA 4LJZC 1M8AA 3GTLB 2QCPX 4ID6A 1NR2A 4O4IB 3NTIA 2D3NA 2V31A 4PV1C 1G6UA 1SNOA 2QM4A 2EOTA 3SHLA