3LNNA

Crystal structure of zneb from cupriavidus metallidurans
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
341
structure length
341
Chain Sequence
b'ALRHEGERLVVPAESPLRRTLAVAPATRETVAAPFNLPAMIEADPAKLVKVLPPLAGRIVSLNKQLGDEVKAGDVLFTIDSADLAQANSDAAKARAAMTMARRNLDRQRELDKSEIAAKRDFEQAQSDYDQAASESQRADARLAQLGAKGGGTLQAGGGHILAVRSPINGRVVDLNAATGAYWNDTTASLMTVADLSHVFVTANAQEKDLGHVYVGQSATVKFDAYDDPQPGKVRYVGQILDADTRTTKVRMVFDNPDGRLRPGMFAQATFLSQPHEGIVVPMSAIVQSGFYTRAFVEVAPWQFEPRVIKLGAQIGDRMEVKSGLSAGDRVVVKEGVLLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane fusion protein (MFP) heavy metal cation efflux ZneB
publication title Metal-induced conformational changes in ZneB suggest an active role of membrane fusion proteins in efflux resistance systems.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal transport
total genus 58
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3lnnA04
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3lnnA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lnnA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3lnnA01
1FR3A 5KNDA 1QJOA 4JK1C 1HCZA 2KA7A 3FPPA 4TKOB 4KN4C 4H13C 3QJYA 3VR6A 2DNEA 2F93B 3OW7A 2K33A 2A69C 2K7VA 1BDOA 3U9SA 1DD2A 3BG3A 4IFDG 3P20A 1HPCA 3T51B 1B9NA 3PUXA 5JEAG 2JEAI 4RCNA 4G7ZC 2JEBI 1OXSC 4L8JA 4KKUA 3WB1A 5JJJB 1VCIA 3ND9A 3VR4A 1ZYRC 3WDNA 3A8KE 1Y8PB 3LWUA 3CRKC 3VR2A 4IFDH 2NN6I 3TZUA 3I4LA 4IQZA 5D5QA 4KHZA 3D31A 3PUWA 1GUNA 3OOCA 5JEAH 1CI3M 2D62A 5KNBA 2B8GA 3ND8A 3N6RA 1IW7C 2D2CC 2BA1A 1ZKOA 2BE5D 3PUVA 5JJNB 1GUGA 4KKTA 2F95B 4KI0A 4OGQC 2EDGA 5JJEB 1IYVA 2O5JC 2QF7A 1FYCA 1DXMA 4HR7B 4DK0A 1H9SB 2A69D 2A68D 2DN8A 2JE6I 2JXMB 4KN7C 1E2ZA 1K8MA 1VF7A 1Y69U 3PUYA 1V43A 1Z7TA 3GD7A 2L5TA 2D5DA 3BRCA 5C0XG 1H9SA 4PV1C 2A6HD 1O7LA 1B9MA 2O5IC 2E75C 5BN4A 4OO1G 2A6EC 1ONLA 1CTMA 1OXXK 1OXVA 3CRLC 4LJZC 1CFMA 3MXUA 2ZT9C 4KMUC 2F1MA 1E2VA 1HQMC 3SE0A 5C0XH 4XIGS 2B8FA 1HTPA 3A8IE 2K32A 1LABA 3PV0A 3VA7A 1VF5C 1EWHA 1H2SB 3HGBA 2AUKA 4DNRB 5A35A 1V8QA 2BA0A 3QIAA 5BN3A 3D4RA 1Q12A 2BDOA 4XTCS 3T53B 1GHJA 3WB2A 1TU2B 3IFTA 3FMCA 3I72A 1Q90A 2LMCB 1G291 1TKWB 1A6XA 1H9RA 3T56B 1YNJC 2EJMA 2Q8IB 2V4DA 1H9JA 1LACA 3A8JE 3L7ZC 3VR5A 3MFYA 1GUOA 3NE5B 3SDZA 2YYZA 3EQLC 2NN6G 4BA1I 1VDZA 4GYCB 1DCZA 3OPOA 1H9MA 1Q1BA 3I73A 3W3AA 1I6VC 1PMRA 1Z6HA 3H94A 3QG1A 5BN5A 2NN6H 2EJFC 3A7LA 1IW7D 1GUTA 3VR3A 3A7AB 3M4YA 3WB0A 1OXUA 1OXTA 2KCCA 4OO1H 1GJXA 3DXJC 4G7HC 2CW0C 2A68C 4KKSA 2PPBC 4GZYC 2AWOA 4TQUS 2AUJD 1RSOA 2EJGC 4I7ZC 2PCFB 2PNRC 2E76C 5KNCA 3M85A 3M7NA 1GHKA 2A6HC 2E74C 4H44C 1E2WA 1YNNC 5K36G 4JBWA 4LK1C 2EVBA 3RLFA 3KLRA 1Q1EA 5D5PA 1O78A 2IT1A 2R6GA 3BDOA 1T5EA 4BA2I 1GUSA 2A6ED 5K36H 3GQBA 1SMYC 1IYUA 3AB9A 3IKJA 3PUZA 2BE5C 1H9KA 4H0LC 2DNCA 4DNTB 3LNNA 1Y8NB 4DK1A 1K8OA 1Y8OB 4G7OC
chains in the Genus database with same CATH superfamily
1K73D 1GN3A 3TXSA 2V1CC 3ZBHA 2HHHO 1MJCA 1UNSA 4KUMA 4AYBE 2OT2A 3HOZH 5DECA 1U4MA 5J9PC 2VQFO 2K9PA 4NXMO 3QR8A 3I4LA 1JA1A 4Y7CA 4FLYA 4A5UB 4LCUC 2D2CC 4GX5A 3MXGA 1WOCA 1ZM2A 1UD5A 4W4LA 2JXMB 2CC2A 1D6EC 2VBVA 5IYCH 1AI6A 4DKAC 3EVKA 3W7TA 3HAGA 2OF1A 3DWQA 2FMCA 4DR3Q 1FPOA 4DV1Q 1AFPA 4H13B 2GV9A 2X6CA 2PYJA 1KQSB 4JBMA 5FNVB 2VBUA 1TWAB 3ETGA 4DUZL 4MVRA 4J9ZB 2HCIA 1P4MA 2RSOA 1GVHA 2JVDA 2HQLA 3LVBA 3H9NA 4QHYA 4G7HC 2NUCA 2V7TA 2EULA 5KHKA 2I07B 3M4QA 1Y1VG 1NB0A 5CV9A 4YEJA 1K33A 1NU1H 5LP6B 4Y52H 4QIWB 2VUMB 1C48A 2XZPA 1VQ9A 1EQTA 1F60A 1BL8A 2ES2A 3JCUZ 2ZZEA 3R93A 3PUVA 4K8IA 4WZTA 2R9RB 1JWSD 2IJJA 2BN4A 4EQNA 1QZGA 4JI4L 5LL6S 1YI2V 2F0EA 2E75C 2YUAA 3JSLA 1HUNA 1FNVA 2DEUA 2LJ2A 3CCQA 4XTCS 3I72A 2OK7A 2EYMA 5GV7A 3KJOA 4P73A 1EOVA 4KLKA 4YJ2B 1I94B 2CDYA 1X6OA 1SR3A 2NN6H 3JD2A 2N3SA 1GJXA 2V7VA 2CTWA 2EFGA 4OEMB 4NDXA 2KSDA 3EHBB 3HKDA 4F87A 3I5DA 4DR6L 4H44C 5LMUO 1LUZA 1CA6A 5JJKA 1KTKA 1WFQA 4BA2I 1S72V 1SYBA 3STBC 2EY2A 3S16H 3FPPA 1E0BA 1PJ7A 1A8PA 1GAQA 5FO8B 4AH6A 2F0NA 3G6BA 5E79Z 2KOLA 3V05A 1IBKL 1GKFA 2G9DA 3CCRB 1WTQA 1Q9SA 5DEHA 4N9TA 4U7NA 1JJGA 4OGQC 1KKCA 1FYCA 1WTWA 5BR8L 5LA6B 1SF9A 3G6EV 1Y1VB 3KF6A 4RGOS 1VP7A 1L0XB 4R50A 1STHA 1PRTF 2OBSA 4BS9A 4AVZA 2VQFQ 2DGYA 4H0LB 3SLNA 3DMUA 5EYPB 4IOCA 1HW7A 2CGNA 1Q90A 2X85A 2D9UA 5EBLC 3G7LA 4K5WA 2IJIA 2YC0A 1WTXA 4CC6A 1HVXA 2SDFA 2JA6G 1S4MA 1LUVA 2DWEC 4FXGC 3PO2G 4OONA 3NSWA 4DV0Q 5C44G 1SRUA 1FNBA 2XNCA 5IGFA 1DONA 2NVXH 1VQKV 3J81c 3CRMA 5F4OA 4X1IA 3WBKA 1JT8A 1JCKB 1H8EG 2V7QG 5KNBA 4JI3B 2P67A 4ME5A 3N2GB 1IL8A 1XXGA 2Y4TA 2UXBL 2QA4A 1EIFA 2HJFC 3GDEA 3QOJA 4DUYL 2XIWA 4YIJA 4LBWA 5G3LF 1AE3A 1RPOA 1VQ4V 2R92H 4LUVA 2P3MA 3UT5A 1M9NA 1H8HG 3VR5A 3GTMH 3EQLC 5IT9c 4A3BH 4KHPO 1Q81C 4LFAO 4AYBG 3W2GA 4O4JA 3FHWA 1VMGA 1HNZL 3BYYB 3I4NG 4NR1A 3AVTA 2Y69C 3ABMB 5M3MG 1RD9D 3CMAA 2XUMA 3ETEA 5A2QL 4WWVA 3OR6C 3ND9A 2OWOA 4JYAB 4OX9B 4DV2L 2JA6B 2EYOA 3MHSC 4RD6A 4DR7L 3PO2B 4LBZA 4BR6A 4A3FH 3U4VA 3RYIA 3QG5A 3CTAA 5C44B 1Q5OA 1TVXA 5DAUA 1W0KG 2ZBVA 3VYSA 1YI2A 3W1BA 2ZT9C 2F4NA 2L1BA 1YJNB 3ULJA 1XMQB 3E5SA 3A8IE 4BY7H 1M1KD 5FL7G 2QDBA 1PPJH 2P7TC 4DV4O 1HNXQ 1ELOA 4B3MB 3SYCA 1DYQA 4JAAA 4CKBA 2ZR2A 4ZGNB 4A3DG 4ABNA 3DTUB 1PMRA 3HKZE 4BIZA 1KXLA 1N32O 1D1KA 2PPBC 2JJQA 5LMNO 1JB9A 1H2MA 5KHHA 4JI8B 3CC4B 5IYBH 4X3UA 1S5LZ 1X3PA 5FO1A 3ZN1A 1TXYA 4RG1A 2X6AA 4QJFA 3JCZA 3MAQA 1N34Q 2YIAA 2LXJA 3BY1A 1IL2A 1T6ZA 4DW0A 4KKUA 2ZJPA 4TMZA 4KY7A 4FJCC 1V1PB 5FPRA 2BCOA 1W0KA 3WU2Z 2EQSA 4ZHQA 4AYBB 2CW0D 3VNVA 4DR5O 4IL6Z 2E76B 3I4NB 3G6EA 5A89A 1FJGO 1HTPA 4PA6A 2OTLV 5M3MB 3CCEV 2DJVA 1JE4A 2A19A 5M5WB 2EJMA 3OEHG 1YIJV 1S72B 2GBOA 1KMHA 2W6IG 1Q81W 2K01A 1Z6HA 3WNCA 4X8IA 3A1PA 1CP9A 1I4GA 1JE5A 1M57C 2PO4A 3FEWX 2ZXIA 1EM1A 1V5VA 2ZM6O 4CC5A 1OCOB 5IWAL 2DY7A 1JMKC 2YU9B 2OQ0A 4AQYO 3MMPA 2X6LA 5BXZA 2A73B 1PFSA 2R7ZG 1OCRB 4YCVA 1R73A 1B44D 1VQKA 4K2KA 4KHPQ 1VQJA 2EZVA 4LFAQ 4AHCA 1XL4A 1WU8A 4X3SA 1BHAA 5EPKA 4A3DB 1WOOA 1QG7A 1KK0A 5EBMC 5IYDH 1B23P 2GA4B 1CPYA 3VA5A 1PFBA 4RDJA 5JVH3 4DK0A 1I18A 2L5TA 2RCNA 4PDVA 2EINC 2A6EC 4Z9CB 2JIZG 1UAPA 1AI5A 3B82A 4TWKA 5C0XJ 1FFTB 3OEHA 5C0XH 2Y0SE 1BCPC 1N36B 1WCMH 2HR3A 1VQ4A 2WIIB 1Z5VA 2WZPP 1GHJA 5CA0B 2KCNA 3A8JE 4XN3A 1R4PB 1J5EB 4YWMA 2EZOA 1BLIA 3P75A 1I7FA 4X20B 4CBCA 4A3LH 2CNDA 1OXTA 4DO2A 1VQLB 4NBSA 1NJIC 3K7UC 5C6AA 3PIOA 3KF8A 1IXMA 1OHHG 4C3HG 4K8XA 2MGSA 3B2EE 4I0XB 1YNXA 3A54A 1VQFA 1DF4A 1FR3A 5ISRA 3ZRWA 4WBNB 4QFMA 5E4WC 4I65A 5CBAE 2OYNA 4UAJA 4WFN3 3EFFK 1PHJA 3T1CA 4K0KQ 1YBYA 4NMZA 4UP9A 5E7NA 2QTZA 1VQ4B 3BFRA 3F2DA 4XONA 3I3CA 1TVCA 4PA9A 1D8TA 1WB8A 1NAPA 3D3RA 4KFMA 2H8PC 4YELA 2VBTA 3U6KA 1A2UA 4HJ5A 1H2GA 2QEXB 4WF9V 4ASUG 1V0FA 1DF5A 3KBGA 3W1GA 3P3NA 1WTOA 3R6KA 2R7ZB 3S1NH 2A9HA 1J6QA 2OBTA 3Q24A 1RTNA 1VF6A 2R7DA 4ZCLA 5LMNW 3G67A 3GTLH 2F0JA 2CHBD 3ZZUA 4NKLA 5M3FG 2I1LA 4C1NK 1I6HB 4O2DA 5KX5A 3BAAA 3FFQA 3LO8A 4YY3O 2E74C 1Q43A 3DM3A 1PTOF 1QR8A 2WFWA 1G7TA 4U9UA 4Q6GA 2JS5A 4FP5D 1BQQT 1EWIA 4GOPB 1XNRL 4XDXA 1UE6A 2WSSG 3ONYA 1UD3A 4C2MB 2E2JB 3PUWA 2B7CA 4NXNQ 4QCLA 1E64A 1PH5A 1XEQA 2UXCB 3IC7A 2C35B 1K8AD 2ZM6Q 1E1RA 3CEIA 4ASUA 2OK8A 4GS3A 4DR4B 4C3HB 1TIID 2ITCC 4J6HA 4Q0FA 4PZ7A 3DXRA 3H1JH 2Q68A 1M90W 5DNFA 1LTTD 2OTLA 3BH4A 4QL5A 5B1AC 3CCEA 2CGOA 1G7CA 4Q7JB 3NBIA 4FF4A 4QY7A 2G5DA 4DR1L 4DNIA 2AHOB 1EYCA 1BF4A 1YIJA 4OPOA 1ZM4A 2PI4A 1U96A 4A3CG 4PNYA 4GKJB 1NJIW 3HKBA 3T1YO 1HR0Q 1RSOB 1IVSA 3DXJC 5D3IB 3NBHB 3ASOC 3IRBA 4P9SA 4H9GA 3E8GA 1N33L 5IP7H 2WAMA 2WSSA 3FB7C 3QFTA 2PI2E 1I08A 2JEXA 3S1MB 1SQXH 4QIWF 3A8IA 4MZ9A 5F2VO 3JAKA 3Q8DA 4U68A 4LFBO 3P20A 2MJ8A 4RCNA 3VR4A 1DDIA 3BZCA 3DXRB 1UE1A 3E8HA 1JA0A 4GN4B 1CI3M 2L15A 3CCEB 2VRZA 5M3FB 2Q69A 1AVMA 3NENA 2K04A 4JI7Q 1RPRA 2Q8VA 2XAJA 1YX2A 3AFQA 1K28A 2MFIA 3VA7A 3F2UA 4IHJA 3C46A 4B3TQ 2VB3X 3WNDA 4FLWA 1UMKA 3T13A 5KGUA 3VQXA 1R1BA 4IPGA 4GYCB 4DR3L 4DV1L 5IYNA 2HFEC 4R1JA 3HP3A 2YTXA 5BY1A 2A68C 2IH3C 1PJ5A 1DM0B 3D6CA 3RYFA 3J7AV 1QUQB 4DUZB 2IT1A 3FB8C 2KQXA 5LBQA 2ZCEA 2WAQE 1WSRA 4NTXA 1W0JG 2XVSA 2P4VA 3AG3B 1ENVA 1NBMG 1IBMO 1Y74B 2JSOA 3OGCC 1EZVH 5E4XA 2X3UA 5EZYA 1WTHA 3HKEA 2N8NA 3NTIA 4A3GH 1JICA 4WJ3M 1R5NA 3M3YB 5CV5A 1S0UA 3ASNC 3IFXA 4FM2A 4DYLA 4FO2A 1L1FA 2CQAA 1GH6A 2JGUA 3WB2A 3W2HA 5ELOA 1G8ZD 1PH1A 2UXNA 4RLZA 3E89A 3PO3G 4Z4UA 3SDZA 1W87A 1OB2A 1P49A 3JAMc 1XMOO 1BS3A 1ET9A 1R5OA 4BW9A 5LHY1 1W0JA 5CA3A 1IURA 1XPRA 4EH1A 5EZYB 2DY8A 3WYAA 4MS2A 3K3WA 3HOYG 2F1LA 1IXRA 3T1YQ 3VBBA 3ES9A 5L3FA 2WYRA 4X05A 3SYPA 1HHVA 4DAYA 3SK6A 3S2DB 3L72H 3ZIAG 2LW1A 2WV6D 5IGDA 3ZRVA 3ZRXA 2ZTNA 3NELA 1B53A 5C4XG 1O7LA 1IBKB 1GK9A 3TRZA 3QO2A 3W5OA 5ITZB 4TT3A 4PMBA 4A3EG 5IYCG 3E3XA 5BR8B 4JI5L 1KABA 2QKCA 1PL0A 4JYYA 1KU9A 2B7BA 3CCJV 1H9MA 1GKHA 4X1KB 1QGYA 2L0CA 4ZRZA 3I55A 1TY2A 1A0IA 2RC6A 2A6HC 3VDYA 1SEBD 1PRTC 4LFCO 1GVPA 3C1EA 2NPFA 2XAFA 2QWNB 4B08A 4DV0L 4RD2A 5JPMC 1MBYA 1MJEA 3PO3B 3T1HO 5H6QA 3SJCC 3MD0A 1BPLA 1ESRA 2XHBA 1V1QA 4ZKIA 3BVOA 1KAWA 4GKKO 5IGBA 3PGZA 3CCLV 1V55B 3FPUB 4LBYA 2A69D 3IGAC 1QG0A 2OTJV 3CRQA 1IYJB 2WLNA 3S14B 4JYAQ 3HOYB 3D26A 2A8VA 3RN5A 1HNWO 3CB4A 3AG1C 1RF2D 2VNIA 2UUBQ 1CEZA 1ET6A 2QKSA 1SZXA 4DUYB 1D7QA 2CAZC 1YEWA 3G4SA 4G7XA 4FFBA 1E43A 4DPGA 1EIYB 1D5AA 4X65O 2PQAA 4DV5O 1SC5B 5B5EZ 3U2QA 3OGIB 2M00A 2QW7A 1LTAD 3IC9A 3W5UA 2KVMA 3I4MH 2MQHA 3JARB 1JJCB 3WBJA 4ZUIA 5C4XB 4I50A 3CC2V 1MD2D 3X2QB 2R9VA 3RN4A 4HAEA 3ASQA 1X54A 1ZL8A 4QGPA 1TAEA 4A76A 3AGPA 1JJ2U 4A3EB 1IKLA 3SVMA 4JI0B 4XKVA 5IY5B 1N08A 3CRZA 1WJJA 2NN6I 2N49A 1HNZB 3CYOA 2K52A 5HZAA 1ZEQX 4KD3A 4GCZA 1MI2A 2O5JC 3RLNA 3A56A 1GR1A 5CC4A 1N05A 2BH2A 1I5XA 1LV9A 1Q7YD 1K97A 3SE0A 4P22A 4DV2B 4WCEV 1Q90D 3S24A 1EWHA 1N8RC 4Z4SA 2VZLA 4DR7B 3Q4HB 3IFTA 4PA7A 3LDEA 5LOVA 3BCFA 3G6JB 1JFFB 1ZL8B 4WFBV 4RPDA 3SJZA 2WAQG 1S5HC 2AXTZ 3F1ZA 3ERSX 1HNXL 1TVKB 1JQYD 2JEUA 5BSXA 4AI8A 3KLSA 3AG4B 1KLUD 2YTYA 1HFGA 5LYJB 3CAMA 3HOVG 5CDFA 2LP7A 3IKJA 4YIOA 2IW5A 3SEJA 4ZI7A 1KLGD 2BF4A 1JJ2A 1QJOA 2IL8A 4YIPA 2DNEA 4N3GA 1NTMH 4ZBMA 3OW7A 3P26A 4X6AH 2NYZD 5J2TB 3WDNA 2X8KA 1K9MD 4A3JH 1N34L 3MXPA 1F2LA 2EYHA 1CXZB 4LC1A 2NVYB 1GTOA 3ULPA 2QGQA 4JZGA 3KDFA 1AB3A 1YHQV 5K1PA 4F8MA 4LR3A 1RQPA 1ZXTA 2WLIB 3K5OA 1MMMA 4ZQ3A 1SNQA 2QJ1A 2HDMA 2MNAA 1Y76A 3JAWB 1OTCA 3SGIA 4JOIC 3F2CA 1EY7A 4I4TA 2R70A 2Y48A 3CP2A 1XJVA 2YYZA 4I7ZB 1KDAA 4JV5O 3ZJYC 3S16B 3I73A 1L0WA 3N27A 2X53S 3CCJA 4R4TA 3QF7A 1O9GA 2HLDA 4I9WA 3ZMTA 2IJ0A 2VNJA 1K8GA 1NTKH 3SPIA 3TJTA 3KJPA 2J0TD 2NZOA 2ZXWC 4LAAA 3QWNA 4KP4A 5B1BC 4XLCA 3VR6A 4HJ9A 2HVJC 2ADQB 3GB7C 4DV5Q 4MTOA 4K1XA 2JA5G 1EEFD 2WAQB 3QSYA 1SMYD 3JD3A 2JYOA 1QFZA 3OUSA 5JJEB 2YTVA 1QLNA 1O7ZA 3E8FA 2EIJC 4LFAL 5J22A 1SKVA 4O4HA 5FLXc 2ZL7A 3UE0A 2OTJA 4QB4A 3FAVA 3CCJB 4DGZA 3HOVB 3CRCA 4HIMA 1IZ3A 2MPMA 2UUCO 3SJPA 5L3BA 1CQVA 3HZXA 2NN4A 4A3FG 3UDIA 3S3WA 1B04A 1XILA 1OO9B 2Y0PA 5KNLA 4R8NA 4JI2Q 2GVAA 5IOCA 1OGIA 4FF3A 4BA1I 3M4OH 2MO1A 1MGSA 4LBEC 4OL7A 2EILC 1NMGA 1WVLA 3AK1A 2F0FA 5JQGA 1UD8A 1ROPA 3NTKA 3DEPA 3CC2A 1GN4A 1Y1WH 5C8YB 2OCHA 5TV2A 3CCLB 5IT9L 3SR1A 4P74A 1SYDA 1E3ZA 5DSZA 4IFDG 3C1FA 2AGAA 1NY4A 2F23A 1VQOA 4ABMA 1E3PA 5CV8A 1QNUA 3OMNB 4NCNA 2F43A 1AILA 4TV8B 5GAEC 3V96A 3K7AH 4FMTA 5IE8A 3OE7G 4CZZA 4K0KL 1SXTA 3SK4A 4D6TH 2UUAB 4MSWC 1CZWA 1HRJA 4DAVA 2Q67A 4CS2A 4PI0A 1I50B 1RM1B 1N9WA 3QIAA 2OCCC 5B66Z 5JQGB 4O4IB 3OWEB 1VQGA 1ORQC 1F23A 4F6RB 3FKSA 4DV7L 2JA5B 1QHTA 2VL6A 1AH9A 3EA6A 3ZHVA 4UPAA 1G8MA 1LTLA 1XX8A 3GTPB 4C3JH 5IDJA 3FB5C 4I5SA 4LF5Q 1U9RA 4LH7A 3QNEA 1LUWA 5JBQA 3SPJA 1IX9A 2X69A 4TKOB 5J1ZA 4A3FB 3Q38A 5C93A 2R9AA 4JAUA 4JTCB 2OEOA 3ITPA 4I55A 2K5HA 3B77A 1SE4A 3NWTA 4APVA 2OXPA 1KK1A 1XNRB 2CK3A 2B2VC 5IYZB 4NXNL 1LTRD 4HAMA 1HZCA 3SXHA 2JP1A 1PTOC 3AFPA 1ZSPA 2ZM6L 4RD4A 5IYDG 4XIGS 4P3IA 3E22A 4G5GA 2CH7B 2F0GA 2RA4A 1Q8KA 4HNAB 1Q86C 1YCIA 4V0BA 2DUDA 2YIBA 1PH4A 2BOCC 2Q73A 2HUGA 1NKDA 2ZE7A 1FRNA 4CH6A 1K73C 4ZOLA 5I6WA 1GUTA 1W34A 2MHVA 4XLHA 2UUCQ 4DR1B 1NVPD 4QE9A 1B50A 3BDLA 1BCCH 4BBRG 1YNJD 2IU3A 2OQKA 3JQPA 1HR0L 3J7YW 4A3LG 3CJHA 2BOSA 3JATA 1Y8OB 1KDCA 2E5LB 4H13C 2GJKA 1SETA 1YHQB 1EFWA 3CXCU 3AU7A 2E2IB 2VWJA 1NVPB 3SKBA 1BMFA 2YICA 4B3RB 1S5BD 1GUWA 1DOLA 4KHZA 3IJ4A 1K83B 1VQ5V 3GTGH 5EBCA 1TWFH 4KHVA 1I94O 4X66O 1I4XA 3A35A 1JCHA 4DQKA 1KK2A 3R8BA 3CSXA 3RFRA 2PW5A 2IX0A 1QH0A 5LP6C 1HQMC 4JI7L 1PFMA 1U4LA 3VNUA 3MHBA 4PJ0Z 4PC2A 1S3OA 1MIUA 3AG7A 2J7KA 3RZOB 1MSHA 4O2AB 1VARA 4LH6A 5EC1C 4B3TL 5H9CA 1ASZA 1M4VA 3ABLB 2WA3A 1M93A 3UO3A 2GUZA 3DHQA 2ZE5A 2EY6A 2N05A 3HOUH 4UFZA 4DR3B 3JALA 1GRJA 4DV1B 2B63H 3DDYA 1M8AA 4YCUA 2XNDG 4JK1C 3WG7B 3CXCA 3AG2B 1BO0A 4TVAB 5EC2C 2EY1A 3S17B 1U2RA 3AK3A 3DWPA 4LC0A 3OOCA 2D62A 1WD1A 3OM3B 3JASA 2AQ1B 1ENFA 4N9PA 1EQQA 1A15A 2R93H 1KB9F 1QLEB 3WFVA 5TSSA 4BBRB 1ICWA 3FKIH 1VQ8V 3KCXA 1JOQA 2JQOA 3VMFA 1ZX3A 1X3QA 4Q20A 2F1MA 1YSCA 1WA8B 1A3TA 2P06A 1YDXA 3M7GA 4ACAA 1THZA 3MVVA 3PIP3 1UD4A 3ZRSA 3UO2A 2HT1A 3W7XA 2C5CA 2Z8LA 3R3OA 3CXCB 5LGTA 2HP8A 4F4LA 4X06A 1FD9A 3E6ZX 1PNMA 3OWFA 3LSUA 3CCMV 1K4CC 5K36G 1WOPA 1LR1A 3ZBTA 3JASB 2KQ3A 1R9TH 5L3CA 4R4QA 3EBEA 4H0LC 1EFRA 4H37A 2KG7B 1HCZA 3B4SA 5IT9E 3I56A 2XEXA 1H85A 1NT2B 5IP7G 4IPDA 3AEVA 4K2LA 4LUOA 4NPSA 5C5LA 4HBNA 2EYPA 3M4PA 1HQRD 3T1YL 1N07A 5GAGC 2JN4A 1TWCB 1KMIZ 1EY6A 3ONUA 3CCUB 3TS2A 1YITV 5IYRA 4FZ1A 2NZHA 3H1IH 1STGA 5CB4B 4J7JA 1W2BA 1OXVA 1E1TA 3U58A 4FXDA 4X66Q 1G291 2N88A 1XI1A 4PDLA 3L0OA 4AF7A 4OX9O 3J80c 3AVWA 2HHHB 5EPLA 2F4VO 1EXMA 2SNSA 2VQFB 1XNQQ 1YNNC 4DAPA 4NXMB 2WR8A 1ZTEA 4YJ3A 4TV9A 3PUZA 1UD2A 4BIUA 1K0SA 2CCZA 5BSYA 1Y0YA 3H15A 4FPPA 3D0FA 1VQ7V 4NNJA 1VQ5A 5HFMA 4ROXA 3UE1A 3ZHSA 1LTBD 2Q7EA 1S5ED 4UCUA 3TP6A 1NTZH 4F88A 4JI8O 3ABMC 4JI0Q 2WP8J 1W59A 1QVGU 2F0VA 1NR4A 5FKAC 1VQHA 3J7AF 1US6A 4GUNA 1X65A 4JYAL 3OEEG 4TV9B 4B3SO 1GUOA 4MVOA 2UUBL 4XLFA 4A93H 3I91A 1XL6A 1D5XC 3CPXA 4UV8A 2P5ZX 4Z2WA 1EP3B 2NNUA 1E2WA 1NE3A 4CJ1B 1ICFB 3AB9A 1WPXA 4MIUA 3K06A 2IHFA 1PFNA 2C2WA 3H3VC 3QO8A 1KRTA 1OGJA 4IIJB 1I4PA 1VF5B 1RL2A 3CCSV 2ZL5A 3CCVV 1E1QG 5CN0A 3LNMB 1GN6A 3UDXA 3BJUA 5JWPA 3CWBH 4U7OA 5ELBA 5FIUA 2VS1A 1NB9A 1I3QB 1TS5A 4X3KA 1XYIA 4GX0A 2V1DA 4X0CA 1QVGA 4FM0A 3K08A 1QWYA 4B3FX 2GHYA 1PJ6A 2GN5A 4IUQA 4HEDA 4HSPA 5F4JA 4OHJA 4QNHB 4DXGA 4XDJA 1MABA 1SFOH 2E1RA 5LMUB 5CMUA 1J8IA 1JR9A 4RH6A 1D2DA 4HIDA 1DCZA 2IY5B 2V7UA 1FYJA 3ZX6A 2B5UA 3H1HH 4M1UB 1BVSA 3LWEA 2E76C 1ZUQA 3CCMA 2ASBA 5ELEA 1KP2A 3JAML 4DR2Q 1AJQA 5IJ9A 1HNXB 5JVDB 1NRKA 1HDJA 1SQPH 2AMCB 2GPJA 1VQ8B 4F7XA 3A74A 1BBXC 3TN2A 3CHXA 2LY7A 1BR9A 2F4VQ 4JOIA 3D31A 5FK9C 2F66C 3BZKA 3APOA 4JBJA 1AZPA 2Q7HA 5GQOA 1Q81D 1SROA 1NS1A 1PL4A 4CS4A 2BMWA 1OCOC 2O5IC 1QVFB 2K5NA 2XRSD 1N34B 5IJ0A 1W6KA 2AW9A 5FO7B 2Q2TA 4RKLA 4POGA 3X3NA 2JJ1G 2ZQMA 5H59A 4YCWA 1BE3H 5ELFA 4FIPC 5IJ9B 1EQRA 5IY0A 4P30A 2R61A 5C3EH 4QUFA 1WP6A 5KYLA 4FK5C 1SYEA 5FNZA 1GHKA 2PZUA 3CQZB 1YJ9A 2BV3A 4R8CA 1PDQA 5BN3A 2KENA 1ILPA 5CA1A 1H9KA 2F0OA 3R65A 4B3SQ 5IP9H 3DM1A 1KRHA 1QR9A 4LF6O 1XUQA 2VNKA 1EOTA 1YITB 5E6TA 4ZCKA 1A3VA 1WDTA 1XB2A 4P9PA 1VHOA 4WFHA 3PSIA 3DGEA 3RUZA 4DV5L 2Y0IA 3U50C 5NUCA 4TQDA 3STZC 5L3EA 4TSFA 4KN7C 5B1NA 2QM4A 5J2UB 2FXQA 3CMEV 5GONB 5LXTA 4OO1I 2ITDC 2HQEA 1EY5A 2QKAA 4J42A 4KHPB 1PTOH 4X9QA 4LFAB 2K1EA 1Y6XA 3JSNA 2JA8H 2WLKA 5ELCA 1SZTA 4J0QA 1WORA 2IWHA 4MHEA 2NVQB 1EU4A 1E79A 5J39A 1VDZA 2GSMB 3N2KB 2FMLA 3I1FA 4JI2L 1GMGA 2UXCO 1IZ6A 4KK7A 2F0DA 2RDGA 1XPUA 4UZEA 4E4EA 2F3VA 2WINB 4LBVA 4NW2A 1VQ7B 5H6RA 1EEID 4Z4RA 4R6ZA 3UQ8A 3W7SA 1COWG 1NNXA 1Q3EA 4B3XA 1SYGA 4UZFA 1HZBA 3CCSA 4Z4TA 2HD3A 3CCVA 1I5YA 4Y9RA 1SE2A 2GK6A 4IALA 1TWAH 4LWSA 4CKCA 3E8BA 2Z1CA 4ZYSA 2F0UA 2VXWA 4YALA 4YXWA 2Z6BA 1VQNB 3SPHA 1AR5A 3F7VC 2YI8A 2JDIG 1K92A 1UFIA 1HP8A 2VS0A 4RDKA 4GOPC 3CD6B 2B9ZA 2I5HA 4K8ZA 2HDNB 2BDNA 4MNOA 1VQAA 2VJIA 2YXHA 1C9OA 1SMXA 4XYQA 3Q23A 3AVUA 2K5VA 3Q6RA 3IL8A 1KQSU 2I46A 1AEXA 2Q0OC 3CCSB 3CCVB 5A8AA 3KFUA 2JS3A 3QOLA 4N8FA 4X62O 3GTJH 2A6ED 4PV1B 2B2VA 2QWPB 4LF5L 1JJOA 1SDFA 5IE9A 1JR0D 4RGTA 3FX7A 4DR5B 1F2YA 1M90D 4RGMA 2F3IA 3GSIA 5H2FZ 5KAIZ 3KKYA 1VQMB 3S1QB 4FXKC 4KKTA 2QTSA 3B8NA 5DEDA 3WOEA 3CS5A 4KJOA 3WOFA 4PELA 5H5JA 4JI6Q 5CV6A 2E5LQ 4LF6Q 1NJID 1AIPA 2PE3A 4B3RQ 1H2SB 2HIVA 4Z1MG 2FJ2A 2EIXA 5FLMH 5I2XA 2ZXOA 3CE2A 3BCCH 3B6YA 2ZM6B 5ELNA 1EFTA 2BSKA 1KQSA 4JYCA 5FNVA 1RHPA 1SE8A 5DN6G 4PQXA 5C4HA 1HA6A 1QOHA 4RUEA 3PIO3 4FLUA 3UDGA 4DK3C 4IFDI 4EB6B 2KECA 4E0FA 3PJSK 2KB1A 1XDCA 3OAAG 1G6ZA 3JAME 1X9NA 3D6WA 5EIBC 1Y1VH 1JOOA 3S9WA 2DWDC 5LP6A 5E3FA 2JEAI 3ZUGA 2JEBI 2RCFA 1PA6A 4TMXA 1HR0B 4MN3A 4JI4O 1NR7A 3OUFA 1Y1WG 2Z9HA 5EKLA 1RDPD 3K8AA 1QNKA 1L0YB 2YEVA 5J35A 2ODMA 2BSKB 4MTFA 4XYOA 2O57A 3AYHB 2YWHA 3P1HA 4HJ8A 3E35A 2CW5A 3AG3C 1YJNV 3UCSC 3OTOQ 3LX0A 2LZJA 4UVAA 4DXFA 5LHHA 4QUZA 4DR6O 3L7ZC 3OFNG 1P7GA 4JI7B 2EYFA 4G1VA 3OZUA 1NQTA 4YJ2A 1KK3A 1C8CA 5THXA 3MTSA 4B44A 3I8ZA 4JBWA 1EN5A 4P12A 3CC4V 1SBBB 1KL9A 4Y7NB 1IBKO 1KKDA 4B3TB 3KK7A 4B48A 3K0XA 2YEVB 1CK1A 5EMNA 4JASA 1Y4MA 2WPDG 1CNEA 1TWHB 2ZJRA 5JEAG 3CMEB 2UXDQ 1KNAA 3TZUA 1FXVA 4QE7A 1ZUNB 2B8GA 1XWEA 3ETQA 2KEDA 4J1MA 1EUJA 3E0JA 4X62Q 1Q82W 4E6IA 3CCRA 4HJ7A 4EEQA 2FYUH 1DXMA 4PMCA 3MEHA 2Z3YA 3GTOH 4ID6A 2ZITA 2YDEA 5LA6A 1FFXB 3W7UA 1X3EA 1PM9A 3L73H 2AUKA 4YAOA 1CSQA 1NSNS 3FB6C 4X7CA 4K5XA 1R3JC 3PUMA 2QDOA 1JNYA 5EYPA 1LACA 4H7BA 1WJZA 3B8MA 1GAXA 4I9QA 2QTLA 3GWOA 2K1BA 1Y1WB 2C77A 4NVPA 2N04A 2QWRB 2K75A 5TR9A 4M4SA 3A7AB 1F9QA 2JA6H 3I90A 1G1XB 1SNCA 3ML0A 3PO2H 2W0FC 4G7WA 1B3QA 4R7CA 2RHSB 3SJQC 2OIEA 1A3UA 1R3KC 1CZGA 1I0HA 2UXBO 3GVLA 3P32A 3E9IA 2HHHQ 2DN9A 2L6LA 1NR2A 4DUYO 4JZ2A 4U3FH 4TQFA 4NXMQ 3EFXD 2EYLA 3BABA 2IW3A 3PVDA 2P22C 3CKIB 2P4KA 2A68D 3N2GA 4PC6A 2X0LA 2M7WA 3LQ6A 4WZEA 3OZVA 4EQOA 4R71A 4OWTB 3E83A 1SM4A 3T1YB 3K5MA 1Q6HA 1W6JA 3F8TA 5LMZA 3BVMA 3ISXA 3JYCA 5I9OA 5L37A 3CP0A 2G38A 1K34A 1HNZO 3GV3A 3RBZA 5HGQA 4X66L 4L5SA 1V55C 1FXKB 4LNQA 2AHYA 3QFCA 1HA3A 4LFBB 2D3OW 1VQLV 5KHJA 2WLLB 1WSVA 2LS01 1AI4A 5D5PA 2VZAA 4PG3A 4DFAA 4DR6Q 3U6BA 4DK1A 2SEBD 2ZJQA 1XNQL 3DSQA 2PGGA 2A69C 3U4ZA 3QTCA 5M3MH 3BG3A 3NHHA 4DR7O 1K3BC 4M1KA 1Q46A 4BIOA 1F7YA 1PVOA 1Y8PB 1VQ6B 5M5WH 1HA5A 3JQQA 5GV8A 3TP8A 1LNQA 1GXDC 2RQ6A 4IUVA 1TY0A 3D4WA 5T1GA 1SNDA 3X2QC 2KHJA 2LGWA 3PUYA 2KHIA 4XD7A 1FDRA 4JTDB 1QGAA 1FD7D 1JWUD 4DV3O 2LGQA 3ZMUA 2QEXV 2F0IA 1WB7A 5JH7A 2R93G 1FX0A 1YJNA 5B3SB 5IY5C 2EYJA 4C1NI 2FHTA 4JI0L 3VO1A 5FO9B 4CJ0B 1H8EA 2FVGA 1MG1A 2ZR3A 1UWVA 2V7QA 2BSAA 2XWJB 1OXUA 4A3DH 5M5YB 4LP8A 4I7AA 3M85A 2L11A 4U3JA 2F0PA 3NWSA 4S3SA 2GDSA 2EIKB 2W0XA 2UUBB 3CC4A 3FD9A 3LNNA 5LMUQ 4CS3A 3S1RH 4CDDC 2NWGA 1CSPA 1VQEA 3EROA 1XFOA 4JF3A 1IBLO 1FNCA 1Q7YC 5JH7B 2UXXA 1H8HA 4PGOA 3VQVA 4B47A 4XQFA 1TWGB 2XTAA 1V1PA 2QGGA 3AG4C 4ZAIA 1KC8C 2QF7A 2PI5A 2XAHA 4AILC 4JW0A 2A6HD 4X88A 4CGYB 3ICXA 4JCVE 2H3OA 1SQFA 2B1GA 1PRTD 1PV0A 4DV6O 2YXLA 4RD0A 2WACA 2XSCA 4U3JB 4BPRA 1G2TA 2LO1A 3D3IA 2BM1A 1F2ZA 4TUYB 4RJLA 1MSWD 5KHIA 3MXNB 2EOTA 1S72A 5IWAO 1BNZA 5BMVB 1GM8A 5KNCA 2X7RB 2IHEA 2ALYB 2IU0A 4H33A 3V7AA 4GX2A 1O78A 1L2FA 2RSNA 1T5EA 4AIMA 1BBWA 2R93B 3NXSA 3OT7A 3F5WC 2RHQB 2P6JA 2K33A 2ZE8A 2BGJA 1YJWB 5FL7A 3SLDA 4DR2L 1MSDA 1VIBA 1VJSA 1AR1B 1E22A 2PW7A 1HTLD 3RN2A 3E2EA 1IDSA 1FXHA 3HR0A 4FDBA 4A3MG 4PD4F 2F4VL 1H9SB 4J7KA 4X1YB 1SQGA 2BM0A 1I6HH 4GNXB 3ABKB 3JD0A 1PH7A 2GJPA 1EYDA 4IN3A 4M8AA 1Q6UA 3ZJZA 4C3IH 3IAYA 4LF4O 2ZZGA 4WORA 4FVMA 4PHZA 3A3GA 5CA0A 3K6OA 1EL0A 5M5XB 4C2MH 4YHHO 2E2JH 4DV3Q 2CBXA 2D3NA 4X20A 1B4OA 4M2LA 5IGGA 1L8DA 5LL6Y 1C7YA 4FF1A 3K81C 1DOMA 1BT8A 1P4RA 4ZCMA 3TDQA 1VQLA 1VLOA 1SRYA 5KMGA 4A93G 2Q7GA 1PH6A 3RD4A 1SMYC 1IYUA 4C3HH 2BTOA 3WWVA 4GKKB 4OXSA 4JI1O 2DYIA 3J80L 4I0XA 4KN4C 2QWOB 4DRXB 4WBNA 4OIKA 1G6PA 1WTVA 4B3SL 4O2BB 5CMDA 3J7ZC 1KC8W 1AJNA 4C7UA 2IX3A 1I8DA 1O9HA 5IODA 2AQ3B 2W6IA 1K3EA 2LFNA 3PMFA 4XR6A 3SR2C 1V1OA 2JE6I 4TN1A 1EYAA 2X0KA 1I4QA 2E2HB 2CH4W 2QCPX 4KMUC 1IBLQ 4DV5B 2QEXA 2CUGA 4WJWA 4PDMA 3P7JA 4UV9A 3SHLA 5I2YA 3S1MH 5KMGB 3GVKA 1XOUA 1L0LH 3QO5A 2C5HA 2L12A 3C3TA 4DV4Q 2FFKB 2WLJA 5AJ3Q 2ICIA 1B2RA 2PTMA 3M4YA 5A2QN 4X7FA 4A3MB 4DV6Q 5M3FH 5J3BA 1XNRO 1N32Q 4CHTB 2UUAL 5LMNQ 3UDFA 2VY3A 2IH1C 1RM1C 1D2BA 1Z5WA 2JIZA 1ZM3A 4JI2B 2B1IA 4POFA 2K7VA 1BX1A 3ULLA 4YWKA 4GOPA 1XTDA 2FX3A 1QGZA 2V31A 5TRDA 2GK7A 1GUGA 1XQBA 2WWWA 2IJHA 3EN2A 2JK5C 2PQEA 4DR1O 3GD7A 4A93B 4UVBA 4DR5Q 1OHHA 4G27B 2ZTCA 1FJGQ 5JJZA 4XLEA 1YZBA 3RGBA 5C4ZA 4XM3A 1N33O 3Q3AA 1P84F 4FYDA 2AHOA 4F6EA 4LF7O 4XOPA 3VYUA 3L2PA 1CHPD 1KTVA 2K6AA 2JA7G 4A3CH 1CM9A 1JB3A 2BVNA 1RSOA 2EJGC 5A2QE 4JMQA 4UCRA 2PY5A 5C4JH 3NBHA 3R2TA 1NDHA 5F2DA 3BY2A 5CBEE 2EY5A 5C3EG 4LF4Q 3M3YH 3ZHRA 2IBZH 4OELB 1TUBB 2KA7A 4YHHQ 3M8AA 4AQYQ 1JORA 3CB2A 4G7ZC 1OCCB 2JA9A 2XWBB 1LT4D 3TP5A 2BPOA 3H1LH 5KRUA 2SOBA 4LF5B 1WLEA 4MTNA 4FK8A 2RN9A 1VQ9V 4JI1Q 1XE1A 2DN8A 1F9RA 2PUSA 2EJRA 1EIHA 1BQZA 1VS0A 1ZYRD 3E86A 2K03A 1ONLA 1D5NA 4W4KA 1CA5A 4A3IH 1VQPB 2JJ2G 4DR3O 4JI6L 2E5LL 4LF6L 5HGTA 4QVAA 3GTQH 4M53A 3E9HA 3EJIA 2RKSA 1A6XA 1YNJC 4B3RL 2RJZA 4XT3B 4CJ2C 3M99B 3ZMVA 3OW2U 2JA8G 3CCQV 4IUPA 4LF8O 1LT3D 3S2DH 2PCFB 2PNRC 2ENBA 1KAAA 2L55A 2H4OA 5D65A 1V54B 2XOKG 1QUQA 2VJJA 2B2TC 1I4RA 2QN6A 3MWYW 1UD6A 1M56B 1EQVA 5FJ8G 1G4YB 2NB0A 4AF6A 1PH3A 4BW5A 5I9PA 1Y74A 4HE5A 4IQZA 3ABLC 3O65A 4O4LB 1FKAO 2UUCB 1IJEA 1RJTA 4RHRA 1FS0G 1S3JA 4PA4A 2JA7B 3OSOA 3VOUA 1KIXA 1F9SA 4RQFA 4F7DA 4WZLA 4BY1G 2TSSA 5C3EB 3K58A 2NLJC 1GN2A 2QDXA 1CFMA 4J10A 3WG7C 3AG2C 4UB6Z 1P7BA 2K32A 4IOAA 1BOSA 5CORA 2HDLA 2LXKA 2Q9LA 1N4CA 1FGBD 5JJIA 2K50A 3OTOL 1EZJA 3AQQA 1MHWC 3CC7B 1NTGA 2Z4IA 2QEJC 4JGSA 3PO3H 2Q6AA 1QLEC 2XOKA 5JCOC 4FN5A 1R5BA 2IPKD 4XQQA 2J7ZA 4G6IA 5KLVH 3O13A 1YVWA 1PTOD 4YY3Q 3D4DA 1DK1A 5A9GA 2DNCA 2VQEO 4RD3A 1N33Q 4LMQD 1F20A 3J80E 4DF7A 2X6YA 1EBOA 2ZINA 3LDDA 3KEWA 3S14H 1OJHA 5T1IA 4LF7Q 4XOTA 3HOYH 3JU4A 4QPKA 1IHZA 4TMWA 4QGUA 2ICEC 4G28B 4BWGB 4P6YA 4HIOA 1GOZA 4KY5A 2JA8B 2UXDL 2YWGA 3SDLA 3OW2B 3HOWH 4JI5O 3AK2A 5CBHA 1G7RA 4X62L 1X32A 3ONAB 5C4XH 1X3GA 1FNDA 2JN9A 1G6UA 2QA4V 3SK5A 3ABUA 5ITZA 1E62A 4UDUC 3GTKB 1NBMA 2RF4A 2V4DA 1EIGA 4A3EH 1IXBA 4UCVA 3CW2A 3M7MX 4J11A 1U4RA 4Z4YA 3OIPA 5FLMG 4X1KA 4QV2A 3G48A 2KBNA 3HRZC 3RY8A 4L5QA 1CKMA 4DV0O 4BY1B 1DG1G 2EVBA 3TEHB 3A8JA 1GD7A 3QVNA 1BJKA 3HOZG 3JAMi 2YWEA 2RCVA 1B9NA 3JQRA 4O42A 4LF8Q 1UE5A 4LFBQ 4FLVA 2DYSB 2XGTA 3SJAC 4WZKA 1MKHA 2IX1A 2RNBA 1R6KA 4PDRA 3CMAV 4WRDA 1TUEB 2DIEA 4GT1A 2VNUD 4GN3B 2HHHL 3T2MA 2VQFL 4GN5A 4NXML 3W7WA 1DLBA 3THOA 1G2SA 1URFA 3RZDH 1LABA 3CX5F 5KA6A 3VO2A 3ASPA 1STNA 4RCOA 1Q12A 4HIKA 2WKCA 5LGNA 3TP7A 1IKMA 2WLHA 3GTJB 4V190 1VQCA 2A7WA 3J7AU 5BN5A 2Q2UA 2HJDA 3G80A 3G71V 2K5DA 1WD0A 3ZIAA 4GLVB 2NVYH 1KBHA 2B2YC 1VMPA 2KUMA 5A88A 3JARA 4G57A 3KBXA 4X66B 1KJZA 1TA8A 4G7OC 4Z1VA 4GQNA 3UI2A 3Q39A 3WY9A 1VQ9B 4NB3A 3P3PA 5CV4A 1PKVA 4TRDA 1BGYH 1IBMQ 2M2LA 5EJWA 2J4XA 3PQIA 3A0RA 5GTIZ 4OWXB 3EVQA 1XNQB 5KW9A 1HUMA 4K35A 4HR7B 2VQEQ 3S2HB 1KUQA 1M5IA 4HYOA 3SEBA 2NV4A 4LF9O 3BY6A 4UB8Z 3CCQB 1L1OA 1VF5C 4BXXH 1PNLA 1HNXO 3HOZB 5LHIA 2DQ3A 4P9OA 3A8TA 4X7DA 1EWCA 3ASSA 4P72A 2A06H 3Q4HA 4RWUA 2NN6G 3EIVA 1JFFA 3ETDA 4JI5Q 2X6XA 1XMOQ 3H1KH 3HKDB 4OO1H 4U673 1TVKA 5DM6V 5AN9A 4N8X1 1XTCD 1ASYA 2C78A 1X59A 4OXPA 2EZPA 3F5TA 3L74H 1EFCA 3R66A 4IPCA 5LYJA 1N34O 1UEBA 3I7FA 1Y8NB 3A55A 3HOVH 1FAFA 3K9AA 1SKYB 1FNMA 3ZMSA 1SA0A 5JJJB 2XZOA 5LMUL 3NQIA 3P30A 2CH4A 1L1OB 2ZL6A 1SYCA 3NUCA 5J2TA 4L6TB 2PI2A 2BE5D 3J81j 4TSSA 2DCUA 1OCZB 1EY8A 3KF6B 4XBFA 1CQFA 5L46A 3M9BA 1YNND 4KXRA 2ZIMA 2WLIA 3BS1A 3AVYA 5IK2A 1V8QA 1PKXA 2KCTA 3JAWA 3H3VI 4DAMA 1WNSA 2ZD9A 2I5MX 1HJPA 2TMPA 4YHBA 2PZWA 4CH4A 1N0NA 3HKSA 3ZHQA 2MUYA 4K3AA 3KLSX 3RR5A 2E1BA 1SA0B 1U4PA 2GQFA 1T6XA 3D3QA 1KHIA 2H5XA 2DYRB 1F4MA 1H95A 2ZDIC 1Z2GA 1WN7A 1W3SA 1HXYD 1Q6IA 2R6GA 1STAA 1QX4A 1X56A 4LFCQ 2FINB 2XN9C 1PH8A 4ZLTF 4X1IB 1KD1C 3GTOB 1QE6A 1I50H 1PLFA 5DLQE 1GJRA 2QGNA 1S76D 5EBDA 3TCUA 5D5QA 3EXAA 1IW7C 3T1HQ 2JA5H 2QA4B 1SKQA 4FLXA 4ZKBB 4EX5A 4GKKQ 1T6YA 2B2WC 3U10A 4DR2B 3GTPH 1MZFA 5JAVA 3V76A 1EFID 3ZZ0A 3NEMA 3RT3C 2R92G 3UT5B 3QE2A 4MVSA 2F4VB 3D4RA 3KOJA 1HNWQ 4BBSH 4A3BG 4B7EA 2K05A 4LF9Q 4H02A 1NH2D 4O4JB 4FF2A 3JD1A 4X65Q 1YVCA 3G71A 4GLAC 4DV3L 3OP1A 3DUZA 1WPBA 4B7KA 3CMAB 4KHPL 3DEOA 3NK9A 5JPNC 1V9PA 3J81L 1U5KA 1BUVT 3BA9A 5C8YA 1NH2B 3CCLA 3U9OA 3K59A 3VQYA 4K0KO 5I6YA 5GROA 4IFDJ 4IFDH 3MDSA 1N8RW 4OOXA 1MA1A 4II2A 5COYA 1I7PA 1IHMA 2EIMB 2RVLA 1O80A 3RYIB 4TV8A 4X64O 1B8AA 2FKXA 4B3SB 1YI2B 4BY7G 4DV7O 2CTQA 3CRLC 2NVXB 3RYCA 4HIZA 4ALPA 2JRIA 4IJHA 4QVJA 3G71B 1VQBA 1U0LA 3FMCA 1IBLL 4O4IA 4NB5A 3RMHA 2QE7G 3KCYA 4F6RA 2E2IH 3X3MA 1FNWA 4HSVA 3OYYA 2DERA 3A7LA 2LQTA 1K83H 4B9XA 5IYBG 4DV4L 2QILA 5AJ3L 4FLTA 4UCSA 2DE0X 3RLFA 3NP8A 1EY9A 1KD1W 4QJFB 2R92B 3V2TA 4DV6L 4DNTB 1GO3E 1KNEA 5KNDA 1N32L 5LMNL 2F93B 3DC6A 3GTMB 2WA4A 1HPCA 3OKXA 2FMMA 3RYCB 5CR3A 1H42A 4NXNO 4A3BB 2UU9O 4QQBX 4NKGB 1CUKA 3RZOH 4ZHQB 4KI0A 3WQZA 3D8CA 4MW3A 3CCUV 4PZ6A 2DMXA 5LGUA 3Q0AA 3G6EB 2D5DA 4PV1C 4QF4A 2PF4E 5IYZA 1PXUA 2QE7A 4HE6A 3FDTA 1AJPA 3E20A 2ZXRA 3UM7A 2CH7A 4EVOA 4XQJA 2N55A 4DR5L 2DJFC 4HNAA 2VBSA 2IJKA 3S17H 1HR0O 1FJGL 3S1RB 4C3IG 3OTFA 4X89A 1KDBA 4JV5Q 3WB0A 2ID0A 1DTOA 4ZCIA 3BA8A 3LSQA 5HURA 4YAWA 1M90C 4RDLA 3OMIB 4YAUA 3OE7A 2F0SA 4BY7B 4IJLA 4C56C 1KRSA 4XKWA 4X7EA 4BBRH 5FOBB 5GW7A 1VQKB 1BDOA 4LF4L 4RA8A 2A74C 1YHQA 1F77A 2PMZE 4YHHL 3D8GA 4K5VA 4AQYL 4JI7O 2BE3A 2BGIA 4MVMA 2F95B 4RO2A 4P2ZA 4KL1A 5C0XG 3ERQA 2DETA 1HZAA 1A8VA 2RDHA 5M9OA 3ABTA 1WCMG 3TQYA 2F0LA 2AZ2A 3CHBD 1JB7A 4JI1L 4B3TO 1RQRA 1QFYA 2B2TA 3GVMA 4HMIA 4AC9A 4KJNA 4X64Q 3HPLC 3OMGA 2Z5UA 3T16A 4O2AA 1E1RG 4JI6B 3LGJA 4LF6B 2N74A 4DV7Q 2MO0A 4KKSA 3KF8B 5FPOA 3Q6SA 3A0BZ 2WLMA 1TWCH 2HIXA 4CQJA 2CF4A 5C3WA 3ZRWB 1WYDA 2FB5A 3J81N 1SNPA 4FFKA 3QJYA 4P2NA 3ASRA 4DU9A 3VYTA 2A1AA 3CRAA 4C3IB 1W9XA 3H01A 2EDGA 3K80C 4RPBA 1RTOA 1QUFA 1ZLZA 1UJWB 2QTOA 5JCOA 3PA2A 2H1EA 2FTKA 4J15A 2UU9Q 1WA8A 4EGVA 3HG9A 2HMAA 2B2UC 1XHZA 1E7ZA 3W2DA 1X4TA 2EBOA 1YF2A 1JMCA 3A2FA 2Q0AA 2M6YA 3LUTB 5IT9N 1I6VC 3HKZG 5KX5B 2K28A 2XNJA 3WNBA 4GZYC 4TQUS 1MZEA 3OTOB 1EWYA 1Q82D 1E3XA 4TMTA 1QVCA 1WCMB 4N3NA 5K36H 3GP7A 4HJAA 3LQEA 2YXYA 1YTFD 3J81E 3UKMA 3I55V 1HZEA 4YY3L 2KG7A 1J9ZA 2DJGC 3HOXH 3OJWA 4LF7L 1Q86W 2A5HA 5JJNB 3QB3A 4IZ8A 1YTFB 3C90A 4ZUJA 1CKNA 1N0VC 1A2TA 1K73W 3CCUA 3AGQA 3N52A 5AG2A 3KG2A 2OTLB 5CB4A 2B8FA 3ER0A 1SYFA 1HR0W 2LSSA 5EIBD 2QSAA 4JI3O 2UXDB 3U11A 4XDLA 2XNDA 2A0LA 5FO0A 1YIJB 1UPGA 4X62B 4A3IG 4M0LA 4RD1A 1F51A 1JOYA 3HKBB 4K6LA 1PNKA 1KECA 3OZWA 1H2NA 2D2CB 2ZXPA 2C4TA 2AWNA 3OJXA 2B5OA 4CH3A 1SJHD 3E1YE 3G4SV 4HN7A 3KLRA 2DY1A 1I3QH 5KUMA 3GQBA 2PYLA 4A75A 3S1NB 1AP0A 3JAKB 4FWTA 3PUNA 3BNWA 2RBMA 2Q6KA 1CKNB 1PH9A 2GREA 4UAIA 1D8LA 1T9HA 3GTLB 1SQQH 1K28D 1TTTA 1SAPA 3CRKC 2D74A 1FXKC 3HKZB 1KYOF 1AP5A 4LF8L 4PA3A 4HCSA 4LFBL 4PC3A 1I94Q 1E2ZA 4UVCA 3K0YA 3BVGA 2ATWA 4JYAO 3DC5A 2BTQA 5I4DA 4GX1A 2Y0SG 4EKWA 4IHJB 3A5ZB 2UUBO 2B2YA 3ZZTA 1WTRA 3L3OC 4Z4WA 4XORA 2A79B 5C4JB 3FYIB 1WTPA 1Q8IA 2CKZB 2CRVA 3PF5A 2YWFA 4ULLA 3CP1A 4OIJA 4K8JA 2XZLA 2HEPA 2CFMA 4O1NA 1XMQO 3TBIB 3BHPA 1QFJA 4R4CA 4ILWA 3STLC 1BBUA 2AWOA 3RYFB 1WTHD 4XDKA 4FM1A 4JI4B 1EFUA 4B3MO 1RFYA 4TT3G 3CRRA 1RP3B 3BZDB 5B3SC 2E75B 3RNUA 1FL0A 2Q6OA 5CGKA 2M9VA 1DZ1A 1OB5A 4JPBW 4IIJA 2BTQB 3J80i 3HKEB 4A3IB 1FGUA 1GUNA 1N06A 4A3GG 3GTQB 1SN8A 5ELDA 3STBD 3C3LA 3FJOA 1IBML 2JGDA 1B6QA 1VEWA 2EIKC 4DR6B 1Y69U 1DGSA 1VQNV 2PLFA 4OWWB 4FLZA 4JTAB 2EXZA 1OXXK 4H44B 4RCYA 3CQZH 4O0AA 2VQEL 1D2EA 1QVFU 3HOWG 3CD6V 3K0GA 3JD4A 3RVYA 1C4QA 3CMMA 3GV6A 1K4DC 3OPOA 1H2KA 3SK8A 1BQEA 3H0GH 4OGQB 3MEFA 4JI3Q 3K0DA 4LK1C 2XGJA 2QM8A 4HTHA 1XMOL 2Y0SB 1EY4A 2KKWA 3SPGA 2JGDB 1M1KC 4UP8A 4R9WA 5EQ0A 1A63A 2P90A 5JVDA 3U9SA 1EU3A 1RIPA 1SERA 4WQMA 1VQ8A 1Z47A 4DAYB 3OEEA 4A3KH 2NVQH 1ENAA 1VQMV 2X6WA 4L63B 3PN1A 4RQEA 2L4NA 1WOSA 4IUNA 3URYA 2CWPA 4RM0A 1G91A 2PMZB 1ESFA 5LL6X 1TUIA 1SLJA 1QVFA 2Q8TA 5H1SE 2F0TA 2EJ7A 1MRZA 2ZDIA 4UHVA 5EPJA 3JC66 3CPFA 3ZCCA 4X3TA 1E1QA 4CDFC 3FVQA 1PP9H 5GADC 1VQDA 3SJBC 2RDFA 4A3GB 3RYHA 1AE2A 3I55B 1PH2A 1N36O 2UXBB 2CW0C 4OX9Q 4GNXC 1LT5D 3ABKC 5KIXA 1N0JA 2QKIC 1CKOA 1JOKA 5EAYA 1JPXA 1O7YA 3FP9A 1J5EO 2B2WA 2MP1A 3HOWB 4Z4VA 3T4DA 4ME3A 4IW3B 3VQWA 4RCZA 1EP2B 4WFEA 1XMQQ 2GTSA 5EKIA 4KD4A 3S15H 1YITA 4LFCL 4B4DA 4IUTA 2IM9A 1OCRC 4B3MQ 1RODA 2Y4UA 2CE4A 1SQBH 1LT6D 4D7SA 3W2IA 5D3DA 2NVTH 3T1HL 4IT5A 2Z0SA 4CDEC 1MNGA 1VQOV 5J2UA 3RYHB 2ILMA 4LJZC 4GKKL 2O2LD 5GONA 4JI8Q 2F0QA 3TETA 1GM9A 4XN0A 3I4OA 3W5VA 1LTSD 2Y69B 4JI2O 4LW1A 1BSMA 1VMCA 5K1XA 5B1OA 2EXDA 3G4SB 2Q2HA 1H9RA 2KJXA 2BCCH 4FFBB 1AN8A 2QR4A 1Y14B 3K04A 3ZYYX 2PQAB 1A32A 4BXXG 1GAWA 2F0HA 4N23A 1TR5A 1HNWL 5JOBA 4MVUA 1I5FA 4FXUA 3I4MG 3N2KA 1R3LC 4OOSA 1KC8D 3S1QH 3TREA 4I50B 3MFGA 5KEEA 2H94A 3CESA 1EZ6A 5L3DA 1M1KW 4IPHA 5DM73 4LF9L 1NI8A 1S4ZA 1PD3A 1HZ9A 3BDOA 4C43A 2XRQD 4X65L 4OO1G 2OCEA 4RAIA 3ZS8C 3H6MA 1VQ7A 2F3WA 4JPRA 2ZT9B 1XREA 4L5RC 2JJ1A 3MZ5A 4WFAV 4DV3B 2F0MA 3RZDB 1WPCA 3SYOA 3TSSA 2HLDG 2GVBA 3KLWA 2DOGA 2ZE6A 1S5DD 1NBWA 1VQNA 2JK8A 1MOFA 5KAFZ 3HEJA 4CH5A 3CF5A 4DXWA 1B2TA 3C2QA 2D9RA 2Z6KC 3D36C 2BA0A 3CD6A 4PC7A 2LW7A 2CVRA 5LOVB 2QDLA 4RFBA 2C2AA 4DR4O 5CYUA 4QMGA 5KA5A 1XPOA 3H94A 2ADPA 2ARHA 4LF5O 2KCCA 1K5SA 5H5NA 4MYTA 4CBVA 1R6TA 4J80A 1QCEA 3F7YC 3PCOB 1IBLB 3GWKC 4IGGA 2KCMA 1DARA 5BZBA 4ZI7B 1JJ2B 4G2KA 2VYQA 4GKJO 1VLYA 4DV4B 1GO2A 1DD2A 2RMKB 4A3JG 2KHSA 1VCIA 1N36Q 4PABA 3KYHC 1SESA 2V7WA 4RMFA 1LTID 4DV6B 2WB1E 2ZZFA 3R2IA 1N32B 3I4MB 5LMNB 4R8IA 3KDFB 1VQMA 1J5EQ 3A0HZ 3DWAA 1Y67A 3K9SA 2VUMH 3K79A 5CV7A 1B9MA 1LO5D 3KUPA 1CTMA 4DK6C 1Y76B 1M57B 4A4IA 5IWAB 4Y7NH 2ZTGA 3ZHUA 3HGBA 1OCCC 4I4TB 1COWA 3ZBUA 2ZTDA 2RC5A 2OIGA 3JAMN 1TWHH 1QCBD 3HKCA 1LM0A 3TXQA 1F4NA 2F43G 2WZNA 4HZ3A 1TLLA 1NMFA 1K8AC 1BCPD 4JBKA 4BBSG 3DLLA 5EGTA 4MW8A 4EB6A 4JV5L 1FJGB 2JDIA 2EINB 3L9DA 2ZTEA 1BCPB 3FKSG 4UXNA 2AZ0A 1JA8A 2I0QA 3MHHC 3K57A 1ZYRC 3AVVA 1VQ6V 4DUZO 1NUCA 3RVZA 2ZNIA 3N6RA 2BA1A 2W6JG 4O4HB 3MA2B 4LF4B 3HKCB 2OTJB 3FAVB 5GTHZ 1V54C 1KZLA 2AKWB 4B43A 5BN4A 2VB2X 4YHHB 1M56C 4AQYB 1STYA 4RAUC 2NTTA 3PENA 3QFRA 3C2PA 1CQXA 2CWAA 4A3JB 2HCJB 3QO7A 3T4ZA 3RWRD 1RCVD 2UUCL 3ZPNA 3B40A 2BH8A 3OMCA 4JI1B 3IFDA 2CK3G 3Q22A 2ZXHA 4X64L 2UXCQ 1XBLA 3CC2B 5IGCA 3WXMA 2ZIOA 5HKKA 3OIQA 4EFBA 4DR4Q 2I5LX 1ENCA 4K6DA 5JJLA 2OT5A 2W6JA 4Z1MA 3A0JA 1JQ0A 4R4IA 3SPCA 4ZKCB 1HH2P 1VQOB 3PA1A 5JEAJ 3CMEA 5JEAH 2B2UA 2X6BA 1P8LA 4P6VF 1MSGA 1ZKOA 5DN6A 4D7TA 3I56V 1N0UA 4BBSB 5IIFA 4GKJQ 1K8MA 1Q3LA 5FLXL 3VYRA 3U0ZA 3TZDA 2XASA 1J9OA 2AQ2B 4P1VA 2E74B 1RKNA 2HG5C 3CU7A 3L71H 2K4KA 3OAAA 1FFXA 2EE1A 5EBWC 5EK0A 1JC7A 2ETNA 1WI5A 1TU2B 1BMFG 4PMWA 4P2CB 1F9PA 2L9HA 1K8AW 2B29A 2UU9L 1Q1BA 4LUZA 4C3JG 4L87A 4II3A 3APQA 2D0PA 2Q5ZA 3OMAB 2YV5A 5BR8O 2R9IA 1D1IA 4RWSC 1JX9A 2QM7A 2GTAA 2D0OA 1B70B 4I55B 1YJWV 1IJFA 2K5WA 5B1AB 1OB0A 3M4OB 4L8JA 4K14A 5C0XI 3A8KE 3LWUA 2C9OA 1K3RA 3TS0A 3OFNA 1ZWIC 3CPWU 2A3QA 2YIBD 1NZ6A 4YY3B 2C4UA 2VW9A 2XNAC 3PF4A 1Z7TA 3I2ZA 5M5YH 1O7IA 4IURA 1N33B 3SYQA 3ASOB 3E22B 4LF7B 1H38A 4ZV4A 5D14A 4DUZQ 2B3GA 3GVJA 5A35A 4OPSA 2SNMA 2DYSC 2WPDA 5KUKA 3ZN0A 1CT1D 4ZOLB 3TMEA 3K7AB 5C44H 1EP1B 1TS3A 3CW2C 4RHSA 1XNQO 1FXKA 4ZK9B 1TWGH 3MCAA 3HS0C 3J7A5 4NP5A 1G7SA 2F03A 1NCVA 3CJHB 3H3VH 3JATB 2WLLA 2WB1G 1ZAUA 3FRPB 2Z0AA 5LHGA 4UCOA 4KTAA 4ZIBA 3PUXA 1OXSC 1PZJD 1GO3F 1VQ6A 3CPWA 4C3JB 4JI4Q 1NR1A 1BHBA 2F4IA 3P27A 1AZQA 5IYCO 4DN4M 4JI0O 3LDCA 4B3GA 4B9WA 4C0SA 1EFRG 3H9VA 1I94L 2YIDA 4LF8B 2LMCB 1S40A 2Q8IB 4XNFA 2K14A 1KP3A 1JWMD 1LYLA 4FNFA 2D3LA 4MVZA 4EFEA 3W3AA 4DV2O 1W2BU 3HFZB 3I4NH 2GUZB 2NZ1D 3VR3A 2WKDA 1S5JA 4XXEA 1BX0A 4JG2A 1UUPA 1QNMA 4EQ5A 4MTXA 3HOUG 2R6HA 4RGNA 5GAHC 3JALB 1A62A 2B63G 3CPWB 3ZMZA 1CNFA 3QFSA 5CBFA 3A3BA 1GM5A 1IBKQ 3ASNB 4EQPA 3T51B 4X8AA 2WJYA 3H91A 3J81i 4XL9A 1HWYA 4JAVA 2PNHA 2PZTA 1S0VA 1PYSB 4KY6A 5BR8Q 1DOKA 3LSSA 5M5XH 1F2MA 3FKIG 5FLXN 3L75H 2YU9H 3I70A 1ML0D 1EN6A 3HOXG 2XTIA 2V7XA 5TY0A 3RW0A 2WB1B 5DS0A 5J3OA 1BZKA 2YS8A 4FZ0A 1IBMB 3BEHA 1L1OC 2VWKA 3GTGB 1BKBA 5IGEA 1TWFB 4R4OA 1QZHA 2VQEB 3NTHA 1OCZC 3QG1A 4TUYA 4N21A 3MXNA 3B09A 2EX3A 1STEA 5B6IA 5BMVA 2O4XA 2Q2IA 4MVQA 3F2BA 4DR2O 2BOBC 1GUSA 3BQJA 1W35A 4JC0A 2BE5C 3I56B 4JI3L 2E2HH 1AROP 1C0AA 1K0RA 1T5XD 5IYWA 4JI5B 2NR5A 1YJ9V 2X6GA 1YJWA 2UXBQ 1XMOB 1J95A 4RKBA 3AVXA 5E1FA 4DUYQ 3MC0B 2HCCA 2DYRC 1SSOA 3HOUB 5K5PA 1V43A 1K7DA 2LFRA 1W2BB 5FLXE 4A3MH 1D5ZC 1H9SA 2B63B 4X1YA 1E24A 4OPHA 4GNXA 5HY6A 1E2VA 3BPZA 3ZHTA 1VQPV 1PRTB 3ZC3A 1K5QA 4HCEA 4DNRB 1YZ6A 1QB5D 1Y0RA 4DV0B 1WAZA 4GZRB 1B06A 1TKWB 4WJ4A 1STBA 1UEAB 1K9MC 2F52A 3NE5B 2B39A 1H2LA 3ZEDA 2ZBUA 4Y9UA 3AMUA 1HNZQ 3AEIA 3KZIZ 3FKIB 3HOXB 2RQXA 1SJED 4I7ZC 1TS4A 3H09A 2PMDA 4IYHA 4YJ3B 2R7ZH 3TGUH 3B78A 2DW4A 1FRQA 4OX9L 2KVOA 1B1ZA 2G9HD 2LFSA 4ODGA 3GIRA 4OPAA 1MABG 2PZSA 1QQCA 4DV2Q 1EY0A 5HFLA 3AG1B 4XQNA 4YAFA 4DRXA 5G3LD 4DR7Q 1VQ5B 2Z4HA 4O2BA 2MW2B 4NYKA 1XMQL 4X07A 3BU2A 1TGOA 1AI7A 2EPBA 4DA2A 3W5HA 1X55A 1D1NA 5KSWB 1R9TB 3BRCA 4B3ML 4LFCB 4PC1A 4ZGQB 1X3FA 2VNHA 4Z4ZA 1EZ8A 4YWLA 4CKEA 4QUCA 2XAQA 2Q8RE 1QUEA 3T53B 4UP7A 3T1HB 4MT8A 5TISZ 4JI8L 5L3GA 2UUAO 2NTSA 1ZM9A 3A8KA 3CC7V 2EIMC 1L0NH 4IYIA 3B8HA 1N8RD 1Q7YW 4NTWA 5HZBA 4QIWE 3L9AX 1CHQD 1VQIA 1Q1EA 4OP7A 4OOVA 2CQOA 1EN4A 3NXWA 1HNWB 3H0GG 2Q4PA 2NBFA 5C3XA 2CTPA 1S5FD 3WB1A 5E1AC 4LF9B 2Z6KA 3D36A 4X65B 2XT9A 1R3IC 1IYVA 2PYKA 4J8QA 3SYAA 5CBGA 2MK3A 1VF7A 1QVGB 1PV4A 2QWQB 4A3KG 3S3XA 2PIAA 1K9MW 2L35A 1D5MC 1LTGD 1AMOA 1KD1D 1P16A 1I4HA 1YHBA 4PAAA 4KV6A 3T56B 2AHZA 1H9JA 2K5QA 2YSUB 2LKVA 4IUUA 3MFYA 2HVKC 3W2FA 4UZUA 4TSFG 1IW7D 4XT1B 1YXBA 3BVZA 2KEEA 1XHXA 3CCMB 3GO5A 5IWAQ 1II3A 2XAGA 5IYBO 3M7NA 2JA7H 3L70H 3FYEB 2R7FA 4P26A 4HMJA 5IYQA 1BXTA 4NTYA 1BCPF 4G1BA 3C3SA 1PZID 1B7YB 1TUBA 1WP8A 4TMVA 4UCTA 1B3AA 3O9OA 1E79G 1IB0A 1Z9FA 1S77D 3VR2A 5F4MA 2ZZQA 2OBRA 2ZKOA 3NQTA 3BCDA 1N36L 4JI6O 2E5LO 5AFWA 3CP8A 5IJ0B 3K5NA 1DJRD 3TK1A 1SE3A 4QPJA 5C5MA 4B3RO 2E8GA 1J5EL 4P25A 4DQLA 2R3ZA 1BQ0A 3H0GB 2C5BA 1VQPA 4E2LA 2ZXWB 5JVG3 2F0KA 5B1BB 1QBZA 3MHPA 4IO9A 3NPPA 1OV9A 4UY8C 1TS2A 4LNUA 3HB3B 1R4QB 3W2EA 2E2DC 4TOIA 4YXWG 1SNMA 4DW1A 1YJ9B 5FA6A 4MYUA 2EIJB 2RDCA 2OYQA 4A3KB 5IP9G 5CA1B 1U97A 4XLAA 3ASTA 2UUAQ 2M5SA 3T4AC 1SFOB 1EYGA 1M4UA 2DQ0A 2E3CA 1YEZA 3CXHF 1R6NA 4JV5B 5KHGA 5FJ8H 1AR4A 3GTKH 4JVZA 2ATKC 3ND8A 2DOSA 4DV1O 4LWCA 5IYDO 4O4LA 4RUFA 5IYPA 1HFNA 2YI9A 4J9YB 3RLOA 4PI2A 2EILB 4LNUB 4MTKA 1QU7A 1DDGA 5LXTB 3OTOO 4G4KA 4WFFA 3MXUA 4BY1H 4UUJC 2CTRA 3PV0A 3CCRV 1Y66A 5EKKA 4CDCC 2ZNJA 4P71A 4GLXA 5HXBA 2Q6IA 3J80N 1SS3A 1UE7A 1OZ0A 3K5LA 1TT2A 3CC7A 5DM63 4J41A 3S15B 1JVMA 4MTGA 1G51A 2QMUA 4K0KB 4WFGA 4ICGA 3OHXC 3BYTB 2FL4A 1XNRQ 5KYIA 1YHAA 1VF6C 1WP7A 2Z6BD 1AW7A 2UXCL 2HKOA 3K03A 2R72A 2JJ2A 1XQ8A 2NVTB 2Q6LA 2UXDO 4X64B 1TQOA 4P3YA 2OCCB 4DR4L 2F0WA 1E1OA 3BDCA 4DV7B 3Q6QA 4LWSB 3G05A 4JYBA 3OD4A 2P5OA 3OR7C 4Q5VA 4XMYA 4P75A 1YLOA 1SNOA 2EIFA 1ILQA 4BAYA 3NR7A 3OW2A 4J7ZA 4ACBA 1PZKD 1FNUA 4DR1Q 3BC9A 1PYWD 2GJRA 1QILA 2WJVA 3J81k 4GKJL 1FVIA 4L5TA 4PZ8A 2N78A 2BDOA 1V0EA 2VUMG 3R6JA 1E63A 1Q82C 4OPVA 3PIPA 1PYBA 1SQVH 3KL9A 2EJFC 3FPKA 3E0EA 1S5CD 3ICEA 3A5UA 1LLRD 2AUJD 1Q86D 4NXNB 1AP6A 3S2HH 2UU9B 1PTOB 1VHEA 4BWAA 1K8OA 1GM7A
chains in the Genus database with same CATH topology
5C8YB 5IT9L 3SR1A 5CGKA 2M9VA 2K33A 1SYDA 1E3ZA 4IFDG 5FL7A 1UNSA 1DZ1A 3C1FA 4IIJA 2BTQB 2OT2A 1U4MA 1VJSA 3HKEB 4A3IB 3I4LA 2PW7A 1GUNA 1HTLD 4FLYA 3GTQB 5CV8A 1QNUA 2D2CC 2F43A 5ELDA 3MXGA 4TV8B 3C3LA 3V96A 1UD5A 1H9SB 2JXMB 4X1YB 1SQGA 1D6EC 4DR6B 1Y69U 1SXTA 1DGSA 3SK4A 2UUAB 1CZWA 4FLZA 1HRJA 2EXZA 2GJPA 1OXXK 4DAVA 4CS2A 3HAGA 4PI0A 1EYDA 4IN3A 2OF1A 4M8AA 1I50B 3DWQA 2FMCA 3QIAA 5JQGB 1AFPA 4O4IB 3IAYA 3OWEB 1C4QA 2GV9A 2ZZGA 4WORA 4F6RB 2PYJA 3FKSA 4FVMA 3CMMA 5FNVB 4PHZA 1TWAB 3A3GA 2JA5B 5CA0A 3GV6A 3K6OA 1EL0A 5M5XB 2HCIA 3OPOA 2RSOA 1QHTA 2JVDA 3EA6A 2D3NA 3SK8A 4X20A 1B4OA 5IGGA 1L8DA 1XX8A 4G7HC 4FF1A 3GTPB 2NUCA 1DOMA 3TDQA 5KHKA 1U9RA 4LH7A 4LK1C 2I07B 2XGJA 5KMGA 4HTHA 5CV9A 2Q7GA 2X69A 4YEJA 2Y0SB 3RD4A 1EY4A 2KKWA 1IYUA 2BTOA 1SMYC 4GKKB 3J80L 4R9WA 5LP6B 5EQ0A 4TKOB 4KN4C 5J1ZA 4A3FB 4QIWB 5JVDA 3U9SA 2VUMB 1C48A 1EU3A 2R9AA 4DRXB 4WBNA 2XZPA 4OIKA 1EQTA 2OEOA 1WTVA 4O2BB 3ITPA 4I55A 5CMDA 1Z47A 2ZZEA 3OEEA 3R93A 1SE4A 3NWTA 2IX3A 1I8DA 1O9HA 5IODA 1ENAA 3PUVA 4K8IA 2AQ3B 2X6WA 2W6IA 2OXPA 4L63B 2LFNA 3PN1A 1JWSD 3PMFA 4XR6A 1XNRB 2L4NA 3SR2C 2CK3A 1V1OA 4IUNA 2B2VC 3URYA 2JE6I 5IYZB 4EQNA 1LTRD 1G91A 1EYAA 3SXHA 2PMZB 2JP1A 1PTOC 5LL6S 1ESFA 2F0EA 1I4QA 2E75C 2E2HB 5LL6X 2QCPX 4KMUC 3JSLA 1HUNA 4XIGS 2Q8TA 4DV5B 1FNVA 3E22A 4WJWA 2F0TA 3P7JA 2F0GA 3SHLA 5I2YA 2RA4A 4HNAB 4XTCS 5KMGB 3GVKA 5EPJA 3I72A 4V0BA 2EYMA 2L12A 4X3TA 2YIBA 2HUGA 1E1QA 2FFKB 3FVQA 3SJBC 2RDFA 4YJ2B 1I94B 4A3GB 4CH6A 2ICIA 4ZOLA 2NN6H 5I6WA 1GUTA 2PTMA 3RYHA 3M4YA 2MHVA 4XLHA 1GJXA 4A3MB 2UXBB 2CW0C 4NDXA 4DR1B 1B50A 3HKDA 3BDLA 1LT5D 4F87A 5KIXA 4H44C 4CHTB 2QKIC 1YNJD 1JOKA 3J7YW 1CA6A 1O7YA 1KTKA 1D2BA 4BA2I 2BOSA 3JATA 1Z5WA 2B2WA 1SYBA 2JIZA 2EY2A 1Y8OB 2MP1A 1KDCA 3HOWB 2E5LB 4JI2B 3FPPA 1E0BA 4H13C 2GJKA 3VQWA 2K7VA 3AU7A 5EKIA 2E2IB 5FO8B 2VWJA 4KD4A 2F0NA 1BMFA 4B3RB 2KOLA 1S5BD 3V05A 2V31A 1GUWA 4IUTA 1DOLA 4KHZA 1K83B 2G9DA 5EBCA 2IM9A 1WTQA 2GK7A 1RODA 4KHVA 5DEHA 4N9TA 1GUGA 1I4XA 3A35A 4OGQC 1LT6D 1FYCA 1WTWA 4D7SA 3R8BA 2PQEA 3CSXA 5LA6B 5D3DA 3GD7A 3RFRA 4A93B 2PW5A 1Y1VB 2IX0A 4RGOS 1L0XB 5J2UA 3RYHB 4LJZC 1OHHA 5LP6C 1STHA 1HQMC 1PRTF 4BS9A 4AVZA 2O2LD 5GONA 2F0QA 1PFMA 1U4LA 4XN0A 3MHBA 5JJZA 1LTSD 4XLEA 3DMUA 5EYPB 1HW7A 1VMCA 5K1XA 1Q90A 2X85A 3RGBA 1H9RA 5C4ZA 2D9UA 2KJXA 4FFBB 1AN8A 3G7LA 4K5WA 3RZOB 1MSHA 4XM3A 4O2AB 3ZYYX 4LH6A 4FYDA 1WTXA 4CC6A 1HVXA 2F0HA 2SDFA 4XOPA 3VYUA 1TR5A 1M4VA 1CHPD 5JOBA 2K6AA 4FXUA 1M93A 3N2KA 1CM9A 1JB3A 3DHQA 1RSOA 4I50B 2EJGC 3MFGA 4FXGC 5A2QE 5KEEA 4JMQA 4UCRA 2PY5A 3CESA 1EZ6A 3NSWA 3NBHA 3R2TA 5F2DA 2EY6A 5DM73 5CBEE 2EY5A 1S4ZA 4UFZA 4DR3B 3BDOA 3JALA 4DV1B 2XRQD 4OO1G 3ZS8C 3DDYA 5IGFA 3H6MA 2F3WA 1M8AA 1DONA 4JK1C 1TUBB 2KA7A 1BO0A 2JJ1A 2EY1A 4X1IA 3MZ5A 3S17B 1JORA 3CB2A 4G7ZC 3DWPA 4DV3B 2F0MA 2XWBB 1JCKB 3RZDB 1WPCA 1LT4D 3TP5A 3OOCA 2D62A 5KNBA 1WD1A 3TSSA 3JASA 5KRUA 2AQ1B 2SOBA 4LF5B 4JI3B 1ENFA 4N9PA 4ME5A 3N2GB 1A15A 1IL8A 1XXGA 2DN8A 5TSSA 1F9RA 3QOJA 2PUSA 4BBRB 1ICWA 1S5DD 1EIHA 2XIWA 1JOQA 4YIJA 1ZYRD 2K03A 1X3QA 1ONLA 5G3LF 3HEJA 4CH5A 2F1MA 1CA5A 1B2TA 1A3TA 5HGTA 3M7GA 2BA0A 3UT5A 2CVRA 3EJIA 5LOVB 3MVVA 3PIP3 2RKSA 1UD4A 4RFBA 1A6XA 1YNJC 5CYUA 4QMGA 2RJZA 4XT3B 3VR5A 3EQLC 4CJ2C 2C5CA 2Z8LA 3R3OA 3H94A 2KCCA 3E6ZX 4IUPA 1LT3D 3OWFA 4CBVA 2PCFB 2PNRC 4O4JA 1IBLB 2ENBA 1KAAA 5K36G 2L55A 2H4OA 3JASB 5D65A 2KQ3A 3BYYB 4ZI7B 2VJJA 2B2TC 4H0LC 1EFRA 1I4RA 1RD9D 1HCZA 3MWYW 1UD6A 1VLYA 5IT9E 4DV4B 1EQVA 1DD2A 5A2QL 2NB0A 2KHSA 1NT2B 1VCIA 3ND9A 2OWOA 5I9PA 4JYAB 4IQZA 4K2LA 4O4LB 4OX9B 2UUCB 5C5LA 1LTID 1RJTA 4DV6B 4HBNA 2EYPA 2ZZFA 4RHRA 1HQRD 2JA6B 2EYOA 3R2IA 1N32B 3I4MB 2JA7B 5LMNB 4R8IA 1TWCB 1KMIZ 3OSOA 1EY6A 3DWAA 1F9SA 3PO2B 3RYIA 2TSSA 5CV7A 3QG5A 1B9MA 1LO5D 1STGA 3KUPA 1Q5OA 5C44B 5CB4B 5C3EB 3K58A 1CTMA 1TVXA 5DAUA 3VYSA 1OXVA 1CFMA 2ZT9C 2L1BA 1XMQB 3E5SA 3A8IE 5IWAB 2K32A 1BOSA 2ZTGA 3HGBA 2QDBA 5CORA 4I4TB 2HDLA 1COWA 4FXDA 1FGBD 1G291 4B3MB 2N88A 1XI1A 1DYQA 1QCBD 3HKCA 4CKBA 2Z4IA 2QEJC 4ABNA 1PMRA 1BCPD 2XOKA 5JCOC 2HHHB 1D1KA 2PPBC 5EPLA 2IPKD 4XQQA 2J7ZA 2SNSA 4G6IA 5EGTA 2VQFB 5KHHA 1YNNC 4DAPA 4NXMB 4JI8B 4X3UA 4EB6A 3O13A 1PTOD 1X3PA 4YJ3A 1FJGB 3D4DA 2JDIA 4TV9A 3PUZA 1UD2A 2DNCA 3MAQA 4LMQD 3J80E 4DF7A 2X6YA 2ZINA 3KEWA 2YIAA 1BCPB 5T1IA 4XOTA 3JU4A 4KKUA 1IHZA 4KY7A 1ZYRC 3K57A 2ICEC 4BWGB 1NUCA 1V1PB 5FPRA 2ZNIA 3N6RA 4NNJA 2BA1A 2BCOA 1W0KA 1GOZA 4KY5A 2JA8B 4O4HB 3MA2B 4ZHQA 1LTBD 4LF4B 4AYBB 2Q7EA 2CW0D 3HKCB 1S5ED 4UCUA 3TP6A 1KZLA 5BN4A 1X32A 2VB2X 4F88A 4YHHB 3I4NB 2WP8J 3ONAB 4AQYB 1HTPA 2F0VA 1STYA 1NR4A 5FKAC 5M3MB 1G6UA 4RAUC 2NTTA 1JE4A 3SK5A 5ITZA 3J7AF 5M5WB 3C2PA 4A3JB 4UDUC 3GTKB 2EJMA 1NBMA 2V4DA 1EIGA 4TV9B 3RWRD 1GUOA 4UCVA 3M7MX 1RCVD 1KMHA 3ZPNA 4XLFA 3I91A 3OMCA 2K01A 4JI1B 1Z6HA 1D5XC 1U4RA 3IFDA 3OIPA 4X1KA 3Q22A 2ZXHA 3HRZC 1I4GA 1E2WA 4BY1B 2PO4A 4CJ1B 3FEWX 2EVBA 2ZXIA 5IGCA 2ZIOA 5HKKA 3OIQA 4CC5A 4EFBA 3AB9A 4MIUA 2DY7A 1PFNA 1JMKC 2YU9B 1ENCA 3H3VC 2X6LA 2A73B 4K6DA 4IIJB 1B44D 1I4PA 4K2KA 2W6JA 1B9NA 4Z1MA 4O42A 4ZKCB 4FLVA 2EZVA 4AHCA 5JEAJ 3SJAC 5JEAH 2B2UA 4X3SA 2IX1A 5EPKA 4A3DB 1ZKOA 1MSGA 1QG7A 4WRDA 5DN6A 2DIEA 4D7TA 5ELBA 2VNUD 2GA4B 3VA5A 1PFBA 5JVH3 4BBSB 5IIFA 4DK0A 1I18A 1I3QB 1K8MA 1Q3LA 5FLXL 1TS5A 4X3KA 3VYRA 2L5TA 3U0ZA 1XYIA 3TZDA 1J9OA 2A6EC 2AQ2B 4Z9CB 1UAPA 5C0XJ 3OEHA 3THOA 4FM0A 1G2SA 1QWYA 1RKNA 5C0XH 4B3FX 1BCPC 1LABA 3CU7A 4IUQA 3OAAA 1FFXA 1N36B 4HEDA 2EE1A 4HSPA 4OHJA 1JC7A 2WIIB 1Z5VA 1STNA 4RCOA 1Q12A 4DXGA 2WZPP 1GHJA 1TU2B 2WKCA 3TP7A 1IKMA 5CA0B 4PMWA 4P2CB 1MABA 1F9PA 2KCNA 3GTJB 2L9HA 3A8JE 5LMUB 1J8IA 4XN3A 4RH6A 4V190 1R4PB 1J5EB 1BLIA 1DCZA 3P75A 1I7FA 1Q1BA 4X20B 4C3JG 5BN5A 4II3A 1OXTA 4M1UB 2K5DA 1WD0A 3ZIAA 3LWEA 2E76C 5C6AA 2B2YC 3KF8A