3LNNA

Crystal structure of zneb from cupriavidus metallidurans
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
341
structure length
341
Chain Sequence
ALRHEGERLVVPAESPLRRTLAVAPATRETVAAPFNLPAMIEADPAKLVKVLPPLAGRIVSLNKQLGDEVKAGDVLFTIDSADLAQANSDAAKARAAMTMARRNLDRQRELDKSEIAAKRDFEQAQSDYDQAASESQRADARLAQLGAKGGGTLQAGGGHILAVRSPINGRVVDLNAATGAYWNDTTASLMTVADLSHVFVTANAQEKDLGHVYVGQSATVKFDAYDDPQPGKVRYVGQILDADTRTTKVRMVFDNPDGRLRPGMFAQATFLSQPHEGIVVPMSAIVQSGFYTRAFVEVAPWQFEPRVIKLGAQIGDRMEVKSGLSAGDRVVVKEGVLLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane fusion protein (MFP) heavy metal cation efflux ZneB
publication title Metal-induced conformational changes in ZneB suggest an active role of membrane fusion proteins in efflux resistance systems.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal transport
total genus 58
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3lnnA04
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3lnnA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lnnA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3lnnA01
4DK1A 1Q90A 2B8GA 3BDOA 3D4RA 1E2ZA 3VR5A 3M7NA 1GUGA 3EQLC 3H94A 3I73A 1FYCA 3IFTA 2EJMA 2E74C 3I4LA 2LMCB 4LJZC 3U9SA 3CRLC 1IYUA 1GJXA 4BA1I 4KN7C 3I72A 5BN3A 1QJOA 1FR3A 4IQZA 3SE0A 2D62A 4GZYC 2O5JC 2V4DA 5D5QA 3FPPA 1GUTA 1VDZA 3VR3A 4PV1C 3T56B 3PV0A 1E2WA 4KMUC 2DNEA 4H44C 4DNTB 1H9KA 4OGQC 3A8KE 4IFDH 2BA0A 4H13C 3A7LA 4G7ZC 5JEAH 2K33A 2JEAI 5JJEB 2NN6H 3N6RA 1Y8NB 1YNNC 1ZYRC 3MXUA 3ND9A 3T51B 1Y8OB 2A68D 5BN5A 1A6XA 1DXMA 2D2CC 2A68C 3HGBA 2PCFB 1DCZA 2KA7A 3A8IE 3A8JE 1K8MA 1CFMA 1E2VA 1K8OA 1OXUA 1LACA 2PPBC 3LNNA 3LWUA 3SDZA 2L5TA 1H2SB 2YYZA 2F93B 3NE5B 3VR6A 1H9SB 4H0LC 3QG1A 1GUNA 1SMYC 3A7AB 2JE6I 2R6GA 3BG3A 1V43A 2EDGA 3M85A 3WB0A 2EVBA 2JXMB 5KNCA 5KNDA 4L8JA 5K36H 1GUOA 1OXSC 2O5IC 2A6ED 3QJYA 2JEBI 2D5DA 5JJJB 2A6EC 4HR7B 1VCIA 3T53B 1VF5C 5A35A 3VA7A 3CRKC 2BE5D 1H9MA 4I7ZC 1PMRA 1OXVA 2AWOA 3OW7A 1Q1BA 1TU2B 1Q12A 1BDOA 3D31A 3PUXA 2AUJD 2BE5C 3WB1A 4JBWA 4KI0A 5C0XH 2QF7A 1TKWB 5D5PA 2F95B 3OPOA 4BA2I 2K32A 4LK1C 1IW7D 3RLFA 1Z6HA 2A6HD 4KKSA 3MFYA 3PUWA 3ND8A 4G7HC 4OO1H 3TZUA 1EWHA 1V8QA 2NN6I 1Z7TA 1YNJC 4TKOB 2A6HC 2E76C 3PUYA 4XIGS 1ZKOA 2EJGC 5BN4A 2K7VA 4XTCS 2A69D 1VF7A 1Q1EA 3WDNA 4GYCB 2IT1A 1GUSA 2ZT9C 3BRCA 2A69C 1HPCA 2BDOA 4G7OC 2DN8A 4DNRB 2Q8IB 1HQMC 1OXXK 4TQUS 2CW0C 4IFDG 3GQBA 3KLRA 1G291 1ONLA 3AB9A 3QIAA 5JEAG 2NN6G 5K36G 2DNCA 4DK0A 2AUKA 1DD2A 1RSOA 1LABA 2E75C 4KKUA 1CTMA 3L7ZC 1O78A 4RCNA 3VR2A 1T5EA 2EJFC 4JK1C 3IKJA 1CI3M 1OXTA 5KNBA 1IYVA 1I6VC 3PUVA 1O7LA 3FMCA 1H9SA 1B9MA 1HTPA 2B8FA 2BA1A 3DXJC 3WB2A 1H9JA 1Y69U 5JJNB 3GD7A 1Y8PB 1IW7C 2PNRC 3PUZA 5C0XG 2F1MA 3W3AA 1B9NA 1GHJA 4KHZA 3OOCA 1GHKA 3VR4A 1H9RA 3M4YA 3P20A 4KKTA 4KN4C 4OO1G 2KCCA 1HCZA
chains in the Genus database with same CATH superfamily
2HCIA 4DUZQ 1WFQA 4AVZA 2R92G 1W35A 4X66L 3V7AA 3NXSA 1VDZA 4JPBW 4OOSA 3KDFA 2X3UA 3K6OA 2K33A 2Q0OC 1YNNC 2JK8A 1HRJA 1IXMA 2PI5A 2KHSA 4KXRA 1XE1A 3H91A 1QVFU 4PQXA 3LNNA 4CDCC 3NE5B 1YNXA 5CA1A 4HEDA 1QHTA 2XSCA 3O13A 1I6HB 1M57B 4DUZO 3SVMA 1LTLA 4Z9CB 1TT2A 3ZJYC 2VL6A 2QKIC 3E8FA 2VUMG 4X64L 2UUAB 2Q69A 1K8GA 1VIBA 5IOCA 5LXTB 2W0XA 1W34A 2AZ2A 1AEXA 2GVAA 4QFMA 2ZTNA 4G7OC 1THZA 3PIO3 2JYOA 4IJHA 3NBHA 1QUQA 1MSDA 3K57A 1ZUNB 1H9SA 2K5VA 3T1CA 2I1LA 2Q4PA 2B5UA 3FYEB 4LR3A 1FRNA 3ABKB 2H1EA 3G67A 4B3RL 1J9OA 2XUMA 4G7WA 1QLEC 2MO1A 2K5HA 2EIJB 4I7ZB 1FNUA 3ZHSA 2Q68A 1EFCA 3I90A 2O57A 3AMUA 4DUZB 1QCBD 1OCRC 4DF7A 1OCOB 2CCZA 1QFYA 4DR4Q 5ELNA 5KAIZ 1RPOA 4IUPA 3CP0A 4FZ1A 2P90A 1PMRA 3GWOA 3QNEA 5FO1A 1J9ZA 3OMCA 1EBOA 4B9XA 4M4SA 4KY5A 1Q81D 4LNQA 4K5XA 2P22C 3CX5F 4DR4O 2Q7EA 3C1EA 3M4OH 3AG1B 3EJIA 3FKSA 3QIAA 1UD4A 1XUQA 1A62A 1U97A 4FNFA 1SESA 2ZXWB 3MDSA 1AJPA 3I5DA 1Y8PB 5CB4B 2JRIA 5HZBA 4A3LH 1FYCA 5C0XJ 3CPXA 3PIPA 2PE3A 4LP8A 3OSOA 4GZYC 1F9SA 2HUGA 4LF6L 1BQEA 2FL4A 3JCZA 3L2PA 4UP7A 2BOSA 1LTRD 3Q4HB 3ISXA 1DCZA 1FGUA 1CFMA 2YTVA 3A0HZ 5E4XA 4OWXB 4QJFB 1SLJA 4LF9Q 2NTSA 3BG3A 4XNFA 4DV0L 4JYAQ 5D65A 1G2TA 2EIXA 3CCJB 5H1SE 4DR4B 3L71H 2QF7A 3CPWU 4IIJB 3HG9A 2QWQB 2RA4A 3SGIA 3HOZG 3AG7A 5GAHC 3H6MA 4XYOA 4DUZL 4JG2A 4TT3A 4LF9O 5IYDO 4GQNA 4JYAO 1D5NA 4QE9A 4NR1A 1FKAO 1KK3A 4CHTB 2XZOA 1B9MA 1I8DA 4O2DA 2WA4A 1VQ7V 3HPLC 5C0XG 4GNXA 4U3FH 2F43A 3KYHC 1OCZC 2AHYA 1UEAB 3J7YW 2C5BA 1MJCA 4A3DG 3ZHRA 1KTKA 1DG1G 2UUBQ 1KYOF 2BF4A 1YI2B 1A6XA 1BX1A 2R9VA 1X3QA 1QVCA 1B50A 4DV1Q 5KUKA 2QILA 2PYLA 4KJNA 3ERSX 4BIZA 3WB0A 1SC5B 2QGQA 1X3PA 1VF5C 2E1BA 4LF9B 4JV5Q 1SQQH 3K5OA 2UUBO 3X3MA 4P6YA 4IFDI 4JYAB 3LSUA 1NR2A 3GTMH 4IUVA 4DV1O 4BY1B 2B2YA 1BCPB 3ASRA 1QCEA 4MVQA 2CW0C 1ET6A 3CCQB 5BMVA 2B29A 1OB2A 1IURA 4PA7A 4RJLA 3E0JA 2E3CA 1AI6A 1G1XB 2CWAA 2K04A 4YWLA 5G3LD 1KQSU 2N74A 4PC1A 1FFXA 4JV5O 3S1MB 1F4NA 2R92B 1CSPA 1NTGA 4J80A 1EQQA 1SMYD 3Q6RA 3CP1A 5LMUQ 5AN9A 2B2VC 3LGJA 3J80E 5M3MH 1HP8A 1Y1VH 4H0LB 3Q24A 3B2EE 2PI2E 4HCEA 1SR3A 1TIID 2L5TA 1W6JA 4UB6Z 2UUBB 3JYCA 2VUMB 4RD3A 3VDYA 1VQ4V 4O4HB 2DETA 5IY5C 4L63B 5LMUO 4DV1B 5C4HA 3H15A 3W2DA 1Q1BA 3HKZE 4ZHQA 1C0AA 1VQ9V 2K32A 4YXWA 3BZKA 2YC0A 5ELEA 2FMMA 1XMOL 1ZKOA 2JEUA 1EQTA 2Z4HA 5EBLC 2Q73A 5J2TB 1A8VA 4MTGA 5HGTA 2P6JA 4JV5B 3OUFA 5BSYA 1IYVA 3CMEB 1VQPA 2PW5A 2RCFA 2WB1G 1TUEB 4KKTA 1MGSA 4PHZA 5LOVB 2HKOA 3ONYA 3ZYYX 1NH2B 2WZPP 3IC9A 1BSMA 4O4JA 5EKKA 1EYDA 1YX2A 1VQMA 1SYCA 5JJLA 5K5PA 1VQFA 2BSKB 3CF5A 4HMJA 4RDJA 1X9NA 5C4JB 3BEHA 4B08A 1A3UA 3S15H 4IYIA 5LMUB 1BE3H 4WZTA 5FO8B 2TMPA 5KNCA 1OCCC 2JA5H 2LZJA 4X20B 1Y76A 1GJXA 4XLAA 4DAYA 2AUJD 1KNAA 3RLFA 2XIWA 1GUWA 1AZQA 1QZHA 3R3OA 1BF4A 3CCMV 2Q2IA 1HNXO 4MTFA 4XONA 4XXEA 2P06A 1F7YA 1SNOA 5TR9A 2JQOA 1N8RD 4X1IA 2HLDA 1I50B 1PFBA 1FXKB 1M4UA 1U96A 1WJJA 5IDJA 1QFZA 1VQGA 2UUBL 3EBEA 2CH4W 2YIDA 1UJWB 3CJHB 1A3TA 1HZAA 1EWIA 1HR0L 4NYKA 4EKWA 4WJ3M 1PVOA 3JAKA 4IPDA 2NVTH 2X6XA 1KIXA 1C8CA 1LTBD 1H2GA 2VJIA 3TETA 4QVJA 2RC6A 3DMUA 4JV5L 3PCOB 4LUOA 4AQYL 2LSSA 2IH1C 2NWGA 5J2UA 4G28B 4ACAA 5IP7H 3C46A 1DTOA 1AJNA 1BQZA 3NEMA 1HNXB 2F0QA 3C2PA 1F9QA 1J5EQ 3CQZH 5F4MA 4C2MH 1YJWB 5CV5A 3HOWG 4OO1H 2VNHA 4Z4SA 1YJ9A 2B63G 3BA9A 4DO2A 1XHZA 5LMUL 4Z4YA 2GQFA 4HAMA 1OGIA 3HOVG 1IW7C 4XOPA 4C3IG 4RD4A 2J0TD 1J5EO 4TMWA 5HXBA 4BS9A 2D3NA 5EIBC 2RHQB 3NK9A 1K73D 4A3KG 1C4QA 1QFJA 1UD8A 4A3DB 3G6EV 2HG5C 4L87A 4C1NK 1FS0G 5JBQA 4ID6A 1E24A 3JD4A 4XN0A 3OZWA 3E9IA 4A3IG 4A93G 2RDCA 4BWGB 1G7CA 3T4AC 4HIKA 3VQXA 4K2KA 5I6WA 1I5XA 4EEQA 1WTHD 1CXZB 5IYQA 3K59A 4QF4A 3GO5A 1SE8A 3OMAB 4PMCA 3JASB 1T6YA 1A3VA 3CAMA 1X54A 3FPKA 3F7VC 1JJOA 1P8LA 4OXPA 2JA7G 4L5TA 4TVAB 4A3JH 2HMAA 2MNAA 5IYRA 3CPWA 1GUSA 1QNMA 1J5EB 3S14H 2NVYB 2YTYA 4IL6Z 1O78A 2RF4A 3KCYA 5IYWA 4RGNA 4A3BG 3IGAC 3SJBC 1KRHA 1VQKA 3TMEA 2VQEQ 4DK1A 4EQ5A 2DIEA 3VYRA 3WG7B 4YAOA 3E8BA 4TQDA 3I73A 1LO5D 5C4XH 5ELFA 4LMQD 2ZIMA 3U9SA 2IW5A 2B5OA 5CYUA 1QJOA 4GCZA 4A3GG 2ATKC 3DC6A 1I5FA 1HW7A 2H94A 3J7AV 5A9GA 4KV6A 3WU2Z 3MWYW 3BNWA 3PGZA 4LF5Q 4TSSA 5KNLA 4EX5A 1F2ZA 4B3FX 2OK7A 2A9HA 3GTGH 2VQEO 2UXDO 2EJ7A 2ZDIA 4L6TB 4OOVA 4TV8A 3RGBA 5H6QA 3CRMA 5H5NA 4UP8A 1XWEA 4A3FG 3PV0A 3WBJA 1E1QA 3KOJA 2A6HD 5B1AC 5CV4A 4LF8O 5IJ9A 4LF5O 2V1DA 1M90D 3I4MG 5A2QL 3F2DA 1QH0A 4CS3A 4MVZA 4DR1Q 5M9OA 1D8LA 2UXBQ 3X2QB 4LBWA 3VBBA 2WB1B 1I94Q 2L15A 2Y0SE 3L9DA 4QE7A 2BDNA 4N8FA 1OO9B 3FAVA 1KQSA 5FLXN 3ZCCA 5IJ0B 4DN4M 5CBAE 3J80c 4TMXA 2ID0A 4JAVA 4DR1O 3GTPB 3RYCB 2UXBO 5FLMG 2VQEB 4Z4WA 2UXDB 1YHQB 3CCEA 1I94O 3NP8A 1J5EL 4F4LA 2B1GA 2K5NA 1TWGB 3VR6A 3I91A 4BBSH 3HKCB 1VQCA 1RHPA 3HKSA 5D3DA 4CJ2C 3K79A 2VYQA 3CC7A 4LF8B 4LF5B 2OBTA 4FN5A 3B09A 3BYTB 3QO8A 2ZTCA 4UV8A 2X7RB 3F7YC 5IGEA 2GK6A 5A89A 5F4JA 4HAEA 1BXTA 5KMGA 5AFWA 3CW2C 4NNJA 3T16A 1PZID 1WPBA 1B7YB 1L0XB 4MN3A 4JI3Q 4UPAA 2RSNA 1QG0A 3D4DA 3CCVA 4X9QA 3N2GB 1CQVA 3MA2B 4DR1B 3CCSB 2UXBB 4WF9V 3OP1A 2WLLA 3H94A 2CTPA 1I94B 1E0BA 1BR9A 1K3BC 3GTJH 2Y0IA 1S5FD 4OIJA 5DM63 3EXAA 2OTLV 1EY0A 1UD6A 3OIPA 2NN6H 4JI3O 1Y8NB 5M5WH 3M99B 3CRAA 2EIJC 3CMAA 1O80A 1SKVA 5C3EG 2EXZA 3B8HA 4JW0A 1A32A 2WLJA 4AH6A 4G27B 4K5WA 1OCOC 1ROPA 2RNBA 1Q8KA 1HNWQ 4I0XB 3F2BA 4YCWA 2EJRA 2NZOA 3VO1A 4QMGA 5ELCA 4OHJA 5IY0A 3HOWB 3S1NH 1I5YA 1BDOA 3TZDA 3GVJA 2KQ3A 3DTUB 1Q82C 1JVMA 5LYJB 4GT1A 3GV3A 4YWMA 1K83B 2B63B 3ZIAG 1PH4A 2BTOA 3TK1A 3A8JA 1GK9A 4XD7A 4P72A 2P7TC 3HOVB 4C3IB 1X65A 4JZ2A 1HNWO 2I46A 4JI2Q 3AG1C 1YNND 2FMCA 4N8X1 3MZ5A 3W5VA 4A3KB 2OCHA 4LF5L 1CM9A 5LL6X 4JI3B 3Q23A 5EPKA 1PJ5A 1SRUA 2LXKA 4N23A 4PJ0Z 5FNVB 4A3IB 4A93B 3BYYB 1E1TA 3A7LA 4LWSA 1BMFA 1IB0A 3E1YE 1PL4A 1B04A 4JI2O 4RQFA 4HIDA 5LHIA 2DGYA 1LUVA 4RHSA 3CRRA 2EDGA 3PO2H 3PO3H 2ODMA 1OGJA 1STEA 4UVBA 3HOUH 2UXBL 1F9RA 2XAGA 3FJOA 2B2VA 4A75A 2A6EC 3HKEA 3W7TA 2BE5D 3JALA 1I94L 3ZJZA 4BA2I 2A06H 4Y9UA 4K8ZA 4POGA 1CQXA 1Q6IA 1H8HG 1HNWB 4YHHQ 1YEWA 4H44B 1FVIA 2MP1A 1HQRD 1OXXK 2ZNIA 4Z4ZA 4N9PA 4A3BB 3RWRD 1EN4A 2E5LQ 2VBTA 4UCOA 4U673 2QW7A 1LTGD 1HZEA 3WNDA 4ZOLA 4RAIA 1ILPA 4GLXA 2QE7A 1H2NA 4IUTA 3RYIB 4YALA 1VQNB 3NR7A 4FXDA 3RR5A 4A3GB 1I7FA 3JQPA 2VXWA 3DHQA 4B4DA 1GN2A 4JI2B 1JB3A 2IBZH 4OL7A 3CC2B 4H13C 3JAML 4FO2A 1WA8A 2E5LO 1KBHA 4Z4RA 4K6DA 1KMHA 4OP7A 4NTYA 1TR5A 3EVKA 3BVGA 1D2DA 4LW1A 3PSIA 3ML0A 1KK1A 1YIJA 4NXMQ 3EFXD 2RDFA 2Z6KC 4LBVA 4A3FB 2OTJA 4JI3L 2AQ3B 2CTWA 3P3PA 4Z4VA 3E83A 1VQ6A 3I4MB 3CCRB 5EZYA 1MABG 4D7TA 5NUCA 3ZRWB 1WOPA 1VQIA 1LTAD 4DK0A 4NXMO 3A0BZ 2E2IB 4BWAA 1WPXA 4B3XA 3LDDA 2WLIA 2O4XA 3SJPA 5KX5B 3UDIA 1UFIA 2D9RA 1I0HA 1KRTA 5J35A 1V0EA 1VLYA 2E5LB 3QO2A 5JVDA 4AI8A 4HIZA 4JBKA 3VOUA 3K3WA 2O5JC 1Q82W 1BBUA 4JYYA 2PZUA 1E2WA 3CPFA 1HNWL 2VBUA 4PI0A 5BN5A 1TVKA 1K97A 3PMFA 2VNJA 5LMNO 1NTKH 3GVKA 1KZLA 4ME3A 4H0LC 4K35A 1CKNA 1X56A 4LF4L 3CS5A 3W2EA 2B2UC 1O9HA 3S16H 4NBSA 1ILQA 1I4PA 5JOBA 1YITB 1JOOA 4JBWA 3BZDB 4HBNA 3KJOA 4GLVB 1BGYH 1F77A 2L12A 4LK1C 1O7ZA 4NXMB 2L11A 3ONAB 4H7BA 4DR5Q 1KRSA 2A69D 4MIUA 1FD7D 2BDOA 3BU2A 2IHFA 3LUTB 5F2DA 1K92A 2IX0A 4U9UA 5C0XI 4OX9O 5LHGA 1KC8C 1QE6A 4LFCQ 3U2QA 1ZTEA 1HTPA 1H9JA 2W6JA 5JEAJ 2F1MA 2D3LA 1P84F 4TSFG 1EY5A 1VQOB 3K08A 5KHJA 3ETQA 2YWHA 3P30A 4DR5O 3MHHC 4IQZA 3Q0AA 5LMNB 1V5VA 5FKAC 1SNCA 1Y8OB 4CZZA 4X1YB 4LC0A 5C3EB 4LFCO 1E22A 1TY2A 2YIBD 4BXXG 4KHPB 3FKIG 4P9OA 2Q8RE 3D26A 2R9RB 2OK8A 1RTNA 2HIXA 4YHHL 2G5DA 3L0OA 2CW0D 4XKWA 3L70H 2QGGA 1P4MA 2IHEA 5M3FH 2E5LL 1FX0A 1SM4A 3AGPA 4QUFA 4OX9B 3AYHB 4N3NA 4DR3Q 3PUMA 2QJ1A 2FMLA 5JH7B 2M7WA 5JEAG 1VQ8B 3KLWA 4FPPA 3I55B 3A3BA 1JE5A 2EYHA 1O7LA 4DR5B 2IU3A 1RQPA 2RSOA 4WJ4A 2BGJA 1UE1A 1NR1A 2V7QG 4UCUA 2OCEA 1JNYA 4LFCB 5C44H 1AI5A 4U3JB 2XOKG 3RZDH 2DNEA 2I0QA 4ZAIA 4RD1A 3CB2A 2YWEA 4S3SA 2XVSA 3OFNG 3TS0A 3S1QB 5EC2C 4PZ7A 2ZTEA 3DWAA 4HNAA 3J81k 1VP7A 2DYRC 4CDFC 4ZKCB 5L3CA 2XAQA 3JU4A 5C8YB 1STNA 1DK1A 3OW7A 1Z5WA 1KLGD 1RJTA 4ACBA 2ZTGA 3MXNB 1C9OA 3KF6A 4JI7Q 1IKMA 4X1KB 1P16A 3IFXA 4IHJB 2UU9Q 2A74C 1WJZA 1S72B 2JJ1A 1P4RA 2QR4A 1U4LA 2K5DA 4KKUA 5KNBA 4XLCA 1KDCA 1QZGA 1R9TB 1I6VC 1WORA 5T1GA 2JS3A 2HP8A 1DARA 2DY1A 3M8AA 5A2QN 3M9BA 2K1EA 4QPKA 2QEXB 5DLQE 2KHIA 1B3QA 1IL8A 2UXCO 3M7NA 2EJMA 4JI7O 1Q86D 1VF6A 5LGUA 2UU9O 1WTVA 1I6HH 1ZM4A 3G71A 5F2VO 2NZ1D 1BHBA 4PA9A 1PPJH 2XNDG 3ND9A 3OKXA 2X6WA 5CBFA 2F3IA 1G8ZD 1E1RA 4XOTA 3F8TA 1TS5A 4K0KQ 1KC8W 3PF4A 5L3FA 1NB9A 2CC2A 4DR5L 1YDXA 1S5LZ 3JCUZ 1SFOB 4O4LB 3DWPA 4DR6L 4UAJA 4HJAA 2ZT9B 4LFCL 4UP9A 4X6AH 1NKDA 3BVZA 4AHCA 5IT9E 4WZKA 5IODA 4K0KO 3UE0A 4A3MG 4NKGB 2UXCB 2PNHA 1SQGA 1L1FA 4JI7B 1BS3A 3QFSA 4AYBG 2UU9B 2WPDG 1B9NA 1GHKA 2FX3A 5KW9A 4C56C 2KJXA 3CW2A 5AJ3Q 3A8KE 5LXTA 3J81L 3E3XA 5CV7A 2ATWA 2PLFA 3BS1A 4HZ3A 1WI5A 4PDRA 3CU7A 1E2VA 2H8PC 3GIRA 1NR4A 3QG1A 4DR3L 1M4VA 1W0KA 4LWCA 2XNCA 4P75A 2WACA 3TJTA 1ZSPA 4K0KB 3K06A 3W7SA 2GK7A 2R3ZA 2QTOA 4DR2Q 2ZJPA 2KHJA 1IW7D 3ND8A 2WJVA 3CRQA 1RTOA 4JI4Q 2KECA 3SYAA 2IT1A 4F6RB 1Q81C 4LH7A 2P4VA 2D0OA 5ELDA 1VQPV 2P4KA 2ZXPA 1EQVA 1PV4A 4RPBA 3GD7A 3PUZA 4GN4B 3X2QC 1IBLL 2KEDA 1JMCA 4DR2O 3KFUA 1IDSA 4JI4O 4YJ3B 4ROXA 4JOIC 1LT5D 5TISZ 1MIUA 4WCEV 2YEVB 1JPXA 1QU7A 3UDXA 5BSXA 1VQEA 2NBFA 4BIOA 4J10A 3FKIB 5FO7B 4XLHA 3VQYA 1W2BB 4UFZA 2RVLA 1PNKA 4R8NA 2R6GA 4ULLA 2UU9L 3Q3AA 5CB4A 2F0FA 5A2QE 2OBRA 2Z6BD 2QDOA 3BFRA 2VJJA 2A5HA 2L1BA 4IYHA 4GUNA 3DM1A 2H5XA 5HKKA 1RD9D 4MTKA 2RJZA 1HFNA 1Y66A 1QLEB 3RVYA 2ZNJA 2FKXA 3OAAA 1VHOA 4RUFA 2OT5A 2EBOA 2PZTA 1SYBA 3KLRA 4M0LA 4DR2B 3Q4HA 5CC4A 4RG1A 1OCRB 4P25A 1SS3A 5CBHA 2VS1A 3U6KA 2MW2B 4ALPA 5HZAA 1JWMD 4QJFA 4JI4B 2Q2TA 4JI8L 2PYKA 2ICIA 3ZHUA 1KNEA 3CCJA 4ZKBB 4DQLA 1PFMA 4LAAA 3T4DA 1YTFB 2QSAA 1VQBA 4K8JA 4FXGC 2ICEC 3BY6A 2C4UA 4DXWA 1CUKA 2F0UA 4EQNA 2YWGA 4IIJA 4BBRH 1KECA 3C3SA 3TS2A 2WWWA 1L0LH 3K0GA 4ZYSA 2WAMA 5IYDH 4DNIA 2RCVA 1YJNB 1SYGA 3JAMN 1SSOA 1ICWA 4BY1H 2XGJA 4MT8A 2CK3G 1RF2D 1EYGA 3OT7A 4I50B 1YJ9V 3UKMA 3QSYA 1PXUA 1AVMA 3PA2A 4J9ZB 2FHTA 4B9WA 3S1MH 1LT3D 2Q6LA 1YI2A 3D3QA 2Z6KA 1E43A 2C5HA 3A1PA 5AJ3L 4PNYA 1KP2A 1TS2A 1PL0A 1U9RA 3RZOB 3CMMA 2ZE7A 5KYIA 3BDOA 1EN5A 4DKAC 1GAWA 1RQRA 1IYJB 4G4KA 1GM8A 3I56B 1ELOA 2VUMH 2LXJA 2BH2A 3SJCC 1Q81W 3CC4B 4RKLA 3NENA 1M1KD 4DR2L 2WSSA 3CCQA 2XNAC 2A8VA 1ZUQA 4K1XA 1GUNA 1AR1B 2V7XA 3ETGA 3IJ4A 3OIQA 4FF3A 4TOIA 1CPYA 1HJPA 3BDCA 2KCNA 4OXSA 4B3TQ 2CGOA 2OEOA 1ENCA 4HN7A 3TQYA 4LFBQ 3MCAA 4DV7Q 2HDNB 1OCZB 4JYBA 4RWUA 4A3MB 1I4XA 1WTOA 2GA4B 2YI9A 2AUKA 3PJSK 2WINB 1VQKV 3E89A 2ZBUA 3L7ZC 4AYBB 2R72A 3PUVA 4OEMB 5COYA 1BCPF 2AW9A 2H3OA 4RQEA 4HJ8A 4XDJA 4B3TO 3BQJA 4LFBO 2EYFA 4DV7O 4O4HA 1AROP 4J15A 5C4JH 4KFMA 3ZHVA 2QA4B 1VF5B 1MG1A 5FO0A 3VR3A 1XHXA 3HOXG 5J2TA 5B6IA 2PCFB 2SNMA 1EXMA 1H2SB 2ZXIA 3CMEA 1B53A 3QB3A 2E2HB 4PZ8A 3E22B 2AMCB 1VMCA 3NTKA 5I6YA 1PFSA 4YAFA 5IE9A 5J3OA 1I50H 4G1BA 1H9MA 4IN3A 5LOVA 2JN4A 4DFAA 1Q12A 2OYNA 3W5OA 1K0SA 3PUWA 2ZE5A 3AG3B 4V0BA 2ZXOA 1VEWA 1GM9A 4B3TB 2CNDA 2FYUH 2BSKA 1N8RC 1S5HC 2UXXA 4LFBB 4DV7B 1F60A 2J7ZA 1AIPA 4RHRA 3BA8A 1CI3M 4B3SQ 2B8FA 2K9PA 4IOAA 2WYRA 4YHBA 3JAME 5CDFA 4RPDA 1JICA 1K3RA 5CBEE 1IYUA 1NT2B 4X20A 3FB5C 3CCEV 2AQ1B 3F5WC 4FDBA 4QUZA 4F7XA 4DV3Q 1K5SA 1R4QB 3D6CA 2R9IA 2HIVA 2PW7A 1YXBA 3H09A 3UT5B 4IUQA 2EULA 3OD4A 1CA5A 1XTCD 1FGBD 3R65A 2A19A 4ZQ3A 4UZEA 3CC7V 1FXKA 2XT9A 1B2TA 3GV6A 3HOZH 3AVXA 1L1OB 2XWBB 1AI4A 2YIAA 1SKYB 3ZMSA 4FWTA 1EP3B 2LGQA 4DV3O 4FXUA 4PC7A 3R66A 4MTXA 2WZNA 5T1IA 3LX0A 3W2FA 1GJRA 5C0XH 3CJHA 1EWYA 3W1BA 3J7AF 1KK2A 2WAQG 4UUJC 5EKLA 2R70A 4M1UB 1Q1EA 4I65A 3CCVV 3K81C 1G7SA 1S3JA 1Q7YC 4A3DH 2ES2A 1G8MA 4DAMA 1XL4A 1AN8A 4EFBA 4UZUA 1BKBA 3K7UC 3TSSA 4P74A 1YVWA 5L3EA 4YAUA 1K73C 4QGPA 1X55A 3T1YQ 1YJWA 4OGQC 3CMAV 4DXGA 1I4RA 4ZRZA 3DEPA 4QUCA 4FF1A 4R9WA 2NR5A 4DV7L 2Z5UA 4I9QA 4YIPA 3W7WA 3IFDA 4DV3B 3W2IA 5C93A 1EOTA 1JX9A 2FJ2A 3S1RB 3ZRXA 4MZ9A 3FP9A 5KHHA 3T1YO 2NVYH 1A0IA 1QQCA 2PMZB 4MVSA 3E2EA 3L72H 1IZ3A 1BJKA 1W87A 1SQPH 4WZEA 2YU9B 1E64A 4I55B 2I5MX 4PZ6A 2DN8A 2XTAA 1FNDA 2IJKA 3A3GA 4RFBA 4JI6O 1C7YA 5LHHA 1EYCA 3A54A 1ORQC 3B6YA 4QCLA 1MSWD 1R5OA 1J95A 3C3TA 2W6IG 3JASA 5IE8A 5GTIZ 3CB4A 3UDFA 4HMIA 2F52A 2LQTA 3AVYA 5IYBG 4K8IA 4CKEA 3AK2A 1N8RW 3OJWA 2JGUA 3K03A 1NQTA 1KMIZ 4ZK9B 2R93G 3DSQA 4BW5A 3J81N 3J7ZC 3SLNA 3ZBHA 1ASYA 1KC8D 4YAWA 1Z2GA 4ZLTF 4B3SL 1OZ0A 3TN2A 4X65Q 1EEFD 2N05A 1NY4A 2A6HC 3PUYA 4JI6B 3W7XA 2N8NA 1M90C 1ZL8B 4OOXA 4G2KA 1K8AD 3GTQB 2UUCQ 3GTPH 4FZ0A 2ASBA 1CT1D 1F20A 2WJYA 2FINB 2B7BA 1XI1A 5JJKA 1Q5OA 3GVMA 2C2WA 2Q2UA 3FPUB 2XWJB 4X65O 3CCLB 3STBD 2EE1A 1R6TA 1VQLB 2OIGA 3LSSA 1WP7A 2XAFA 1TWGH 3S9WA 4JAAA 2E1RA 3D0FA 3HOXB 1S0VA 1UAPA 4K8XA 2RDGA 1O7IA 2UUCO 2F0PA 1KAAA 4GOPB 5J1ZA 1Q7YW 1YIJV 3TCUA 2OTJV 1QVGB 4H9GA 3CE2A 2X6CA 3N27A 5LGTA 3R6KA 3OZUA 4KK7A 4JOIA 1TWHB 1VQ6V 4GN5A 1VMGA 1K73W 1D5XC 5IJ0A 1X59A 4FLWA 1Y4MA 2CF4A 4KKSA 4KD4A 1WP8A 1L0YB 3ASPA 3NSWA 3RYCA 1Z7TA 1H95A 4JYCA 2CTRA 2Z8LA 2ZT9C 1TS4A 2F4VO 2RCNA 1YHQA 1VHEA 3STLC 2Y69B 5LMNW 3HRZC 2KVMA 1CKMA 2F0NA 3S2DB 1T9HA 3G6JB 3T1YL 2F0DA 4O2BA 4RH6A 3HKCA 3SEBA 1WP6A 1XPUA 1U4RA 3P20A 3MFGA 3JD0A 1HCZA 1QNUA 3O65A 1PTOC 3ZMZA 3OM3B 5FOBB 2UUCB 2NVXH 2UUAQ 1SXTA 1QVFB 2Z4IA 4B48A 1S77D 1X6OA 4DW0A 4FK5C 1XFOA 1H8EG 4RD0A 1SRYA 2Q5ZA 3SKBA 1R6NA 3HOWH 1B8AA 2Q67A 2BE3A 3MXGA 4G57A 1L2FA 1PHJA 1Y1WG 1Z47A 1K83H 3N2GA 2N55A 3K8AA 2Z3YA 1GUOA 1XYIA 3AU7A 3QJYA 3CCSA 1SE4A 3QFTA 2F4VB 3HOVH 1R3IC 4X7FA 4C3IH 1R3LC 1TKWB 2EOTA 2WAQB 2OCCC 3ERQA 3RUZA 2OT2A 1V8QA 3HAGA 1ET9A 2AGAA 4A3KH 2QEJC 4RGOS 2N88A 1K28D 4KY6A 3U11A 3K9AA 3QO5A 2OYQA 4ZUJA 2LO1A 1PYWD 2P67A 3G4SB 2QWPB 2KSDA 3JAMc 4A93H 1QR9A 4ZGNB 5BXZA 4LF7Q 3A0JA 1FFTB 5DSZA 2OQKA 2K50A 3J81E 4I0XA 2KB1A 4IPHA 4II2A 3C1FA 2PMDA 4UXNA 1FR3A 4Z1MG 2D2CB 1NMGA 5LYJA 1HNZQ 5DEHA 4QGUA 1M90W 1IZ6A 2BN4A 2K5WA 5JPNC 2JA7H 4E0FA 1X32A 5IYBO 1JOYA 4LF7O 3M7GA 4X65L 3SDLA 1IBMQ 2GJPA 2F0JA 3SLDA 4N3GA 2YXLA 2Y48A 5JCOC 1HNZO 1MOFA 1DDGA 1ZM2A 2UUCL 4A3BH 2WIIB 5I2XA 4YEJA 2BE5C 4UCVA 1PDQA 3NTHA 2L6LA 4OONA 5FNVA 1N08A 1AP6A 1IXRA 2NVTB 2CKZB 4DNRB 5LP6C 1IBMO 1D2EA 3QWNA 2NN6G 4A3GH 4KLKA 2M00A 4AF7A 2QKSA 4TMVA 3Q39A 1ZEQX 4RCOA 1H9RA 4IOCA 3B40A 3FYIB 1JB7A 4A3EG 2OBSA 4AF6A 3WXMA 1OHHG 3WYAA 3BVOA 4LF7B 3W5UA 4A3FH 4FYDA 3R93A 1PH1A 4DYLA 2R93B 2F0IA 2LJ2A 3MAQA 3U50C 3P26A 3I4MH 1HNZB 1D6EC 1SMXA 2D3OW 1G2SA 1V43A 4ZV4A 3M85A 5IP9H 4WFGA 1GVPA 4UHVA 2A73B 2VQFQ 4JF3A 3RYIA 5FLXL 1VQNA 1IBMB 2E2IH 4R4QA 2NYZD 5EJWA 4A3CG 1OJHA 4YJ2B 1T5XD 2VNKA 3CC2A 4PDLA 1KD1D 2Q8IB 2UUAL 3NELA 4QHYA 3P32A 5FLMH 2VNIA 2JIZG 4V190 2EFGA 4CS4A 5EYPB 2BM1A 2VQFO 1RODA 4FXKC 2ZXRA 4NKLA 4JVZA 1E3ZA 2CE4A 1J6QA 3AK1A 5B1OA 3DM3A 4E6IA 3G71V 4XQQA 3I70A 3BAAA 4GX0A 2FTKA 3K58A 1BBXC 3W7UA 3CCRA 1FJGQ 3NXWA 3ZRWA 1NUCA 2JJ2G 4ZI7B 2GHYA 4B3GA 1RCVD 3CCUB 4C3JH 3BJUA 2K14A 1AH9A 2ZBVA 2MK3A 3EVQA 1II3A 5KX5A 1QGAA 1PYSB 2FB5A 1FJGO 4RKBA 1YSCA 4WORA 3VO2A 4AC9A 4LF7L 2VQFB 3CTAA 4Q5VA 2A69C 1W2BU 3FX7A 3IC7A 4H13B 1BCCH 2CHBD 4J11A 1GO3E 1SA0B 1XPOA 4RCNA 1WCMG 3GTGB 1HNZL 1CZGA 2L0CA 1PRTF 1Y69U 1VQ5B 4UCSA 1XNRQ 5C3EH 1FYJA 1R5BA 3BPZA 4Y9RA 1TQOA 1EY8A 1DONA 1YITA 1BPLA 1IBML 3VNUA 1V54B 1GUTA 3FB6C 3ZHQA 1GN3A 5C3WA 3ASQA 4OPHA 1Y1WB 1XNRO 1FJGB 3OE7G 1QUFA 5IIFA 2CTQA 3NPPA 1VQOA 1BT8A 3GWKC 5TRDA 5H9CA 4J9YB 4EB6B 1JA1A 1WLEA 3A35A 4RM0A 4LBEC 2JA8G 2EINC 3AVWA 2NPFA 4X1YA 1WTHA 2DNCA 4WFFA 1NMFA 4DR4L 1STYA 4UB8Z 2MGSA 3AG3C 2HHHO 3CXCB 2MHVA 4M53A 2E2JB 2IH3C 3W3AA 4K6LA 3KKYA 3RD4A 2B8GA 2OXPA 4OPOA 1H2KA 1S5CD 2RN9A 5C5LA 2GSMB 3S1QH 4XLFA 3ZIAA 1N34Q 1TWAB 1XNRB 1K4DC 2ARHA 3ZHTA 2VQFL 3W1GA 5JH7A 5JVH3 4LH6A 2YTXA 1VQ8A 2QDXA 3SK6A 1WB7A 2F93B 4C1NI 3I55A 4RLZA 1PNLA 3ABMC 2EYLA 1WTXA 2EVBA 5KNDA 3KG2A 5JWPA 1PZJD 2C9OA 1KXLA 2WR8A 1L1OC 1N34O 2L4NA 4DGZA 4IT5A 4U3JA 3CSXA 2HHHB 2SNSA 3STZC 2L9HA 2BCCH 2IWHA 4L5RC 4XMYA 4U68A 4FK8A 4TQUS 3GQBA 4NVPA 1MSHA 1RKNA 4JC0A 2HFEC 4LF9L 2R7ZG 5JJIA 3CCJV 1FJGL 4JYAL 3J81c 4A3EB 1WN7A 1VS0A 3A74A 2BOBC 3K0DA 3RN5A 4ABNA 1WOOA 1HNXQ 5C8YA 3BH4A 3EFFK 1GVHA 4NXNQ 1CZWA 4BY7H 1Q86C 1SZTA 3MXNA 1H8HA 2OWOA 4DNTB 3ZZUA 1T6XA 1BVSA 1SFOH 1E79G 3RMHA 4X1KA 5GONB 5DN6G 4IHJA 2Y4UA 3JAMi 5KSWB 2EQSA 2WLKA 1S72A 3A8JE 3W5HA 3BDLA 1OXUA 2QWOB 1W59A 2ZZEA 1N34B 2Q6KA 1HA3A 2YXYA 1PA6A 4NTWA 1PRTC 4F88A 2QEXA 4NXNO 3FRPB 2ITCC 4FLVA 4TMTA 2QCPX 3UI2A 3H1JH 3EIVA 1EIHA 3CRKC 1WTRA 2FVGA 3A5UA 3JSLA 1YI2V 1B1ZA 5C44G 1XNRL 4EVOA 4IALA 5KEEA 4GLAC 3B77A 1F4MA 4LFAO 4DV1L 1ONLA 2XZPA 4GNXC 2F0WA 4X7DA 3ULLA 1IVSA 1NJIC 3VYTA 4JI5B 4XQFA 1I4QA 4FFBB 3T2MA 1QB5D 1WTPA 2CWPA 4O4LA 3JD3A 3Q8DA 2DYRB 1V1QA 1CNEA 1NS1A 1MABA 2V4DA 4ZKIA 4FLXA 3Q6QA 1TXYA 3CCQV 2CH7B 3RYHB 1TVCA 1KK0A 1JFFB 4NXNB 1UE6A 2YYZA 1S5JA 2AKWB 4MNOA 4ICGA 2A0LA 5LMZA 5DNFA 1F2LA 1JORA 4PC2A 1Q7YD 4NCNA 2F0EA 1TU2B 4LFAB 4R4CA 1A8PA 3WWVA 2EIKC 1GM5A 2B2YC 2ZZFA 1EWHA 1GKHA 4GX5A 1SAPA 3K5LA 1CHPD 1WCMB 5C3XA 2MQHA 1MKHA 2OQ0A 1N34L 4WFN3 1GD7A 5THXA 4GX2A 4Y7NB 4CQJA 1TWCB 3D6WA 4IO9A 4BXXH 4XLEA 1JCKB 1XMQQ 2EILC 3FKIH 3IFTA 2LP7A 3CRLC 4MVOA 1LUWA 2PZSA 4XBFA 3B8MA 1GRJA 1GR1A 4F6RA 5EGTA 3CMEV 1JR0D 1G6ZA 4J6HA 3S3WA 1HUNA 1Q46A 1MJEA 3L75H 2DCUA 2WP8J 1XMQO 3IAYA 1UD5A 4TSFA 4GOPC 1UPGA 1PZKD 5CN0A 4DW1A 3LVBA 4JCVE 4B7EA 2JN9A 1WAZA 1Q86W 2B7CA 3RLOA 1QUEA 4YJ3A 2JA8B 3ZX6A 2HJDA 2LGWA 1CEZA 2YEVA 2UXDQ 3A8TA 1HNXL 4GZRB 1YVCA 3C3LA 3LDEA 4FF2A 2DWEC 4X3KA 1W2BA 2ZD9A 3OWEB 1Z5VA 1MNGA 2DQ3A 2XNJA 2Y69C 1N0NA 4LF8Q 2BMWA 4X66O 1EOVA 4X64Q 4XR6A 4BA1I 5BN3A 4Q7JB 1NBWA 4P2CB 3FPPA 3LWEA 4ZIBA 3SPHA 1AFPA 4PAAA 5L3BA 1Z9FA 1XMQB 1SQVH 4ZCMA 1H2MA 2KA7A 1EEID 4LUVA 3CHBD 4EQOA 4OPAA 3B82A 4D7SA 2JXMB 4X64O 4ZUIA 4B44A 2V7QA 2RBMA 3SXHA 3NBIA 4BPRA 1CNFA 4HR7B 2XOKA 1R5NA 1KUQA 3AG4B 1Q90D 2FXQA 4IZ8A 2XRSD 1JMKC 1Z6HA 4F6EA 4G7HC 3UQ8A 2E75B 3RZOH 1FXHA 1QG7A 2IL8A 4DAVA 3K5NA 3ZZTA 2R7ZB 2ETNA 4P3YA 4RA8A 3OFNA 4X66B 3BABA 4ASUG 1YF2A 2PNRC 1EZ8A 1YJNA 5M5YB 3H1KH 3S2HB 5FA6A 5B1BB 1YJWV 2R7DA 1S5BD 2XRQD 2ADQB 1HTLD 4I50A 1KKCA 3EHBB 4ILWA 1XBLA 2DN9A 1J8IA 2CUGA 1PKVA 2D2CC 4X64B 1M1KC 2LW7A 4TV9B 1GKFA 2GUZB 3R2IA 4PA6A 4A3MH 1P7GA 1BNZA 3E8HA 1ESRA 2G9HD 1UE5A 3URYA 1STHA 1SNPA 4U7NA 5LBQA 5C44B 2V7UA 3SYCA 5J22A 4DQKA 1AP0A 4MTOA 1FAFA 2DJFC 5M5XB 2F66C 4LBZA 5FPOA 2XNDA 4KJOA 3AGQA 3I56A 1I3QB 4GYCB 1PTOD 1XMQL 4BBRG 3I4NG 4I9WA 1XOUA 4QIWB 2AWNA 3JATB 3CC4A 2A1AA 1QVGU 3F2UA 2CAZC 3CXHF 1UD3A 2V1CC 5AG2A 3GTKH 4DV0Q 2EY5A 4N21A 4A4IA 2Z9HA 1LV9A 1PH9A 4I4TB 4LF6O 4UCRA 3I2ZA 4IPCA 2E2HH 3D8GA 3B8NA 3S3XA 3IRBA 2NNUA 2E8GA 3K80C 1KAWA 3J81i 2GDSA 3VMFA 2DEUA 4RD2A 4DV0O 1Y6XA 4B43A 1WB8A 2WPDA 1QBZA 3HOYG 2VQEL 3A5ZB 2UXDL 1N36Q 1O7YA 2GREA 3H01A 1VQ7B 4YCUA 2CRVA 1K7DA 2AWOA 1FNWA 3CRCA 2CH4A 2K52A 2QA4A 5FJ8G 1TWFB 4PA4A 2YIBA 1QNKA 4LF8L 4FF4A 2EY1A 3TP5A 3M4PA 1FNBA 2C5CA 1N36O 2AZ0A 3JAWB 1BOSA 2K05A 2R6HA 3WNCA 3ZBTA 2WAQE 2EYMA 5TY0A 4LF6B 3E22A 2GN5A 1LYLA 1BL8A 3GTLB 3MHPA 1KP3A 3TXSA 1I7PA 4PC6A 3HKDB 1YCIA 1PP9H 1VQHA 4JPRA 4DV0B 4DR1L 1EM1A 4RD6A 3BC9A 3DDYA 5JQGB 5IGFA 2YICA 2ZDIC 3A0RA 3LO8A 4CBCA 3SK8A 5FLXE 1B70B 1DF4A 3AQQA 1FDRA 1EIYB 1A2TA 4GS3A 4C7UA 2K6AA 2LKVA 3QFCA 5J39A 1N0UA 4J8QA 3H1IH 2LFSA 3JC66 1QILA 1YHQV 1HDJA 2ZL7A 4XM3A 3MHSC 2CBXA 2NN6I 3ABLB 4TKOB 1XQ8A 1N36B 2EJGC 2VBSA 4P73A 1N32Q 2OIEA 2NV4A 5JAVA 1YZBA 2LY7A 3UT5A 1XL6A 3BZCA 1RM1B 2VWKA 5C5MA 1K34A 1TGOA 1UUPA 3QOLA 1M1KW 3OR6C 4Y52H 1YTFD 4MVRA 5IYZB 3J80N 3TXQA 1L1OA 2CDYA 5LHY1 1FPOA 4H33A 4KP4A 3OHXC 4DR7Q 5LGNA 1YBYA 1V1PB 5KA5A 3M4YA 3KL9A 1G6UA 1V0FA 4I7AA 1EIGA 4OPVA 2F0MA 4P6VF 1STBA 1VQ4B 2DYIA 2F0TA 1N32O 1HXYD 2B2TC 5FNZA 1ZM9A 3LQ6A 4YWKA 3S1RH 4IFDH 1W6KA 4TN1A 1SKQA 2QM8A 1VQ9B 1XMOQ 3OEEG 1V54C 4MW8A 4DR7O 3GTOB 4MW3A 4ZCLA 3CCSV 1CKOA 1A63A 3NWSA 2YU9H 2YXHA 5L3GA 1GOZA 4LCUC 1N05A 3E9HA 1X4TA 3ZN0A 1PH6A 3R8BA 3U6BA 2G38A 1XMOO 1PYBA 3TEHB 4PC3A 1SNDA 1KL9A 5LMNQ 5B3SB 4JTDB 3JQRA 1QGYA 4K2LA 2JEXA 1NDHA 3IL8A 4P3IA 1CHQD 1NBMG 3BHPA 2YS8A 4CH3A 3CYOA 4PI2A 5IYNA 4KHPQ 4PDVA 1N32B 5L46A 3CRZA 3ZPNA 2NUCA 1Q6UA 1IX9A 5BZBA 2CK3A 2V7TA 2Q6AA 1BQ0A 1F51A 3ASOC 2AHOB 2XTIA 4RAUC 5A8AA 5LL6S 4DR7B 3T56B 4OX9Q 3DEOA 3K7AB 1N36L 2XZLA 2X53S 3P3NA 3AG2B 4TUYB 1QR8A 4KHPO 2A68D 3QF7A 4I55A 1V55B 4XYQA 3CCMB 4C3HG 4R1JA 2IX3A 5L3DA 3HZXA 5IYCG 4JI2L 1XMOB 3ZUGA 2BVNA 2D74A 5CBGA 4JBJA 2JDIG 1SN8A 3GTQH 1WOCA 4O1NA 1HR0Q 4KTAA 3A56A 1SROA 4BBRB 4FLZA 2UXNA 2HQEA 4CDEC 3I4NB 5FL7G 1SYDA 1DGSA 3CHXA 4ME5A 3JARB 4OGQB 5LA6B 2L35A 2KOLA 4O0AA 1QWYA 1EFTA 1DZ1A 4R71A 1K8AC 3HOXH 5BR8Q 4AQYQ 4ODGA 5E1FA 3AVUA 1BBWA 1GXDC 1XDCA 2NN4A 2DQ0A 4PGOA 1LM0A 4KN4C 3WFVA 3M3YB 2ZL6A 1BQQT 2BTQB 3TREA 4TMZA 1HR0O 1A15A 4FJCC 2LMCB 1MA1A 1MZEA 3STBC 2V31A 2YUAA 3H0GG 1SYEA 4N9TA 2BOCC 3K9SA 2D62A 2VW9A 3RVZA 4XN3A 1E7ZA 1XXGA 1BLIA 5DS0A 4G7ZC 3MEFA 2DE0X 4F87A 1TWHH 2N04A 3R6JA 5BR8O 4AQYO 1ZL8A 3CWBH 1I4GA 2HD3A 3D36C 3I4OA 2PPBC 1VQDA 4KHVA 3HOYB 1VQAA 1JQ0A 2ZE8A 4II3A 2FFKB 1N32L 3PIOA 1VQNV 1TA8A 1LTTD 1U4PA 5IWAQ 2Q2HA 3CCLA 3T53B 3AVVA 3S2DH 3CC2V 1VQLA 1K4CC 4M8AA 1PJ6A 1IKLA 2F23A 3OEHG 4DR7L 1YNJC 5K1XA 3G6EB 1E62A 2PQEA 3ZMTA 3B4SA 1FRQA 1EP2B 1SJED 5C6AA 4GOPA 1HR0B 4FLUA 1GN4A 3ZMVA 5IWAO 4NXML 1QVGA 2Z6BA 2Q0AA 5KHIA 1S4ZA 2VWJA 1GHJA 1H2LA 2HT1A 5CA0B 4W4LA 3CCRV 2E74C 1N0JA 5BR8B 3NUCA 4PDMA 4AQYB 1SF9A 3QR8A 5D5QA 2F1LA 3CP2A 1ZYRD 2RMKB 2SDFA 4ZBMA 3CXCU 2G9DA 2UXCQ 1MD2D 3MC0B 1OB5A 5LMNL 4P2NA 3I3CA 1B2RA 5EK0A 3MEHA 2YI8A 5IGBA 3OJXA 1JJ2B 4JBMA 4KHPL 2CW5A 1FNCA 1W0JG 1NRKA 3QTCA 1HVXA 2Z0SA 4DXFA 2MFIA 1QVFA 5CV6A 3H1LH 5I9PA 5IWAB 1AJQA 4W4KA 1COWG 5K36G 1LABA 2DJGC 1EY9A 4OX9L 3KF8B 1AMOA 4X7CA 1EFRG 4MSWC 3N2KB 2JK5C 2K5QA 1YITV 3VR4A 1EUJA 2B2WC 3EQLC 3DLLA 3SPIA 1PH7A 4CDDC 1SE2A 2KCTA 3AVTA 2ZCEA 3HKBB 1HZ9A 1PRTD 1GAQA 5EQ0A 2JGDB 1H9KA 1D8TA 1LTSD 3QFRA 4RGMA 3NHHA 1UD2A 5FLXc 5B5EZ 2F0OA 5ELBA 1PJ7A 4F8MA 1EIFA 1K8AW 2R7FA 3G4SA 1VQOV 3THOA 1PLFA 2PQAB 5IYCO 3I1FA 4DRXB 2VB2X 2XGTA 2V7WA 1YHAA 2IPKD 2I07B 5JJJB 1GM7A 4H02A 1XQBA 3ZRVA 5BR8L 3ABUA 1NJID 2IJIA 1PTOB 3KLSX 2VS0A 2EX3A 3DWQA 4QVAA 3O9OA 1R3JC 2PYJA 2PO4A 1RIPA 2EJFC 1D5ZC 5IYBH 5J3BA 1TUBB 3DXRB 3RY8A 2HVJC 3T1HQ 3HOZB 1ZX3A 2EXDA 1AR4A 2DOGA 1E3PA 2LW1A 1YEZA 1TAEA 2JA6G 4FM2A 2R93H 4HSPA 1P7BA 4TRDA 2HEPA 5IT9L 3HFZB 4BAYA 5GQOA 1D5AA 2OCCB 1VQ8V 4C3HB 1S5DD 5IWAL 3ETDA 3T51B 3I55V 4F7DA 2MO0A 3T1HO 1RSOB 2GJKA 3A8IE 2ZR3A 1ENAA 1K8OA 3WY9A 1NTMH 3BCCH 3AFQA 1JJCB 2Z0AA 4O4IB 1V1OA 2W6IA 4FLYA 4XT3B 4NB5A 2WV6D 2KUMA 2BV3A 1G7TA 4MYUA 1EQRA 3OW2B 2N49A 1QLNA 3OUSA 4HSVA 4WBNB 1FNVA 2KG7B 4HCSA 3AG4C 2OTLB 1KD1C 2QTZA 3PVDA 3T13A 2E75C 5CMUA 3BY1A 1NE3A 3MXPA 1JE4A 4UVAA 2L55A 2X6AA 4K5VA 3H0GB 1DF5A 4CGYB 4XDKA 3KEWA 2UXCL 1BZKA 5A88A 4WZLA 2ZE6A 1RFYA 3T1HB 4JI7L 5DECA 5B1BC 1S72V 3PQIA 4YJ2A 3TDQA 2F3WA 4EFEA 1G6PA 1EN6A 1ESFA 1M9NA 3FKSG 3SDZA 5LP6B 2QEXV 1CQFA 1W9XA 1L0NH 5EYPA 4X06A 3SPCA 4APVA 2KKWA 4J41A 3SK5A 1H85A 4ZGQB 1VCIA 1B6QA 5GROA 2LFRA 3FD9A 5I9OA 2QDLA 3ULPA 3PENA 2F95B 4KL1A 1SQXH 4FIPC 5E3FA 3OWFA 2AXTZ 4A76A 4WFHA 4K0KL 1Y74B 3E86A 4ZI7A 3CCUA 2ZXHA 1DOMA 2C78A 2EZVA 1S5ED 3RT3C 4P2ZA 4R6ZA 1VF6C 4L5SA 3F5TA 1N33Q 2CQOA 3Q22A 2X8KA 3ZN1A 2V7VA 2DYSB 5IP9G 2B9ZA 1Y1WH 2NVQB 4CBVA 5CV8A 1EL0A 2IJJA 1SZXA 1BHAA 2I5LX 4FM1A 5ITZB 1S3OA 5KAFZ 1AW7A 4FLTA 1EFUA 1F23A 4TT3G 4JASA 5HFMA 4A3LG 2F3VA 2M6YA 1SA0A 2Q9LA 1N33O 1M56C 3MHBA 2HCCA 3SYOA 1G7RA 4IGGA 4B47A 5GAEC 1VQ5A 3FEWX 3WNBA 2R92H 2B2TA 4FVMA 5EC1C 2F43G 1PNMA 5BY1A 1Q43A 1PFNA 1OXVA 3T1HL 1HA6A 4PG3A 4I5SA 4O2BB 1G91A 4P30A 3V96A 2E2JH 1H8EA 1GO2A 3WDNA 3AEVA 4M2LA 3BRCA 3QE2A 1EFWA 2PI2A 4JGSA 5KIXA 1M57C 2BH8A 4WQMA 2WB1E 2XAJA 1TWAH 4O2AB 4C3JG 3CP8A 4X3SA 4KHZA 3CD6B 1Q3LA 1SJHD 3S17B 4XORA 4PV1B 2BSAA 3D4RA 1VQJA 4IURA 1GUGA 1QOHA 1EWCA 2B1IA 2F0GA 2DMXA 1NR7A 2QN6A 1NNXA 2A3QA 4HIOA 4JI4L 4EB6A 4LNUB 1H38A 1N33B 4WJWA 1DXMA 3RYFB 1KD1W 3P75A 5KLVH 4JI0Q 2IY5B 3CXCA 3BCDA 3ABKC 2WKCA 3VQVA 3ER0A 4XKVA 3L9AX 3R2TA 4I7ZC 2H4OA 4Z1MA 2B2UA 2NVXB 1IXBA 3WB1A 1N06A 3OPOA 4PMWA 1IJEA 4CKCA 3KDFB 4BIUA 4A3EH 2QDBA 3RW0A 1JOKA 5JJZA 4JI0O 1LT6D 3QO7A 1SNMA 3ABLC 2OF1A 5CA1B 1RM1C 2JA6B 1MRZA 4LF4Q 5E4WC 3OOCA 1AB3A 4FM0A 1WOSA 2N3SA 2VY3A 4OWWB 4DK6C 1AE2A 4QIWE 1QX4A 3SE0A 1IJFA 4P9PA 1ENFA 4YXWG 1HUMA 3GP7A 5I4DA 1JJGA 2P5ZX 5EKIA 4ZCKA 2F0HA 1XILA 1LR1A 3NBHB 4A3CH 2ZXWC 1QUQB 2EINB 5CA3A 4LF4O 4AILC 1H9SB 1NCVA 1UMKA 4HE5A 1M93A 4GX1A 1WNSA 2PF4E 5M3MG 1Y1VG 4JI0B 1OHHA 3EROA 4GKJQ 1AP5A 3OTFA 3OMGA 4P1VA 2E2DC 3D36A 4RCZA 1WDTA 5BN4A 1ZM3A 4XIGS 1RDPD 3DGEA 2NZHA 2AQ2B 1N33L 2EZOA 5GONA 1BX0A 1YJNV 2JA7B 5B3SC 1E1OA 1X3GA 1JQYD 4GKJO 3ABMB 2DOSA 1UNSA 3VR5A 1ASZA 1AI7A 3I4LA 3W2HA 3PN1A 4P26A 3CEIA 1XJVA 3V76A 4LF4B 3P27A 3OMIB 2JEAI 2X6GA 4DV6Q 5ISRA 4P22A 5C4ZA 2JIZA 1HA5A 2HLDG 4YHHO 3AG2C 1D1KA 4K14A 4DUYQ 2JE6I 4OIKA 1V55C 4E4EA 2Q8TA 2M2LA 2XEXA 4FFBA 3VQWA 4LUZA 2ALYB 1EZVH 5H5JA 1HHVA 3A8IA 1WCMH 3I56V 4KI0A 1K3EA 5D5PA 4DV6O 1JC7A 3CD6V 3CC4V 4Y7NH 1TWCH 4BY7G 4XTCS 1KKDA 1JT8A 2JJ2A 1MSGA 2ZITA 4DPGA 5JVG3 2CH7A 2RC5A 4GKJB 2JA5G 4DUYO 3RYHA 1JFFA 2EYJA 3OTOQ 4NTXA 3MMPA 3ASNB 1G51A 4B3TL 3M4OB 1PH8A 4PD4F 4YIJA 1PRTB 1D5MC 4LFBL 4JI0L 3NQTA 2PZWA 1R73A 1K28A 4YHHB 1BCPC 5EPLA 4HJ9A 3VYUA 4JI6Q 3MXUA 3PF5A 3OTOO 4LC1A 3ZEDA 3ZBUA 1JCHA 4XDLA 1D1IA 2B2WA 2EIMB 4OELB 4UAIA 2JA8H 4GNXB 4DV6B 2QWNB 2JSOA 1NAPA 4L5QA 4PA3A 1M5IA 4RDKA 4L8JA 2VZAA 2O5IC 3GB7C 2K28A 2QA4V 1GH6A 1RPRA 2VZLA 4G7XA 5IYPA 3PUXA 4DUYB 5KA6A 2BPOA 1SERA 3E8GA 2K4KA 2LFNA 5IP7G 2KEEA 1HQMC 4JZGA 1B23P 4C3JB 4R8IA 3MD0A 3OE7A 4J7KA 3IKJA 1NZ6A 1PH2A 4JTCB 3DC5A 1SYFA 4OO1G 5H6RA 4OPSA 4J7ZA 2EYPA 4DR6Q 2KENA 4X62Q 1ENVA 3OTOB 1QGZA 4X05A 3L74H 4QB4A 2IU0A 4WRDA 2EIKB 2ITDC 2EIFA 3N6RA 1TTTA 4MVUA 4GKJL 5BMVB 2F0KA 1Q3EA 3U4ZA 1LACA 1SQBH 1SQFA 2X6YA 1PH3A 1Y67A 5IT9N 2GTSA 4DR6O 1LUZA 4X62O 1FFXB 3D3IA 1N9WA 2R7ZH 4BR6A 4TQFA 2M9VA 2EILB 4DV3L 3PUNA 2CVRA 4U7OA 3OGCC 2ZR2A 3SEJA 3TP7A 5M5YH 3J80i 3S2HH 1K9MC 2IM9A 1XB2A 1B44D 1R6KA 1NB0A 5FK9C 3TGUH 5KYLA 1CTMA 3OYYA 1EP1B 4ZCIA 4J42A 1GTOA 1EY6A 4QPJA 2AHZA 4R50A 4DV6L 3GTMB 1ZLZA 2X6LA 1D7QA 1GMGA 4A3JG 2DWDC 4Q20A 3K5MA 3ZZ0A 4ZHQB 3K0YA 2F4VQ 2HDLA 2YWFA 3RLNA 4DUYL 1AR5A 1E1QG 3SK4A 1FNMA 2K03A 1FXKC 4DR6B 4X62B 2EYOA 4JAUA 4YY3Q 4DR3O 3G05A 3JQQA 1HZCA 3LWUA 4MS2A 1VQPB 2SOBA 5LL6Y 4K3AA 1YNJD 5C4XG 5M5XH 4UVCA 4HJ5A 5M3MB 1I3QH 1Y1VB 4EQPA 1IBLQ 3SYPA 4X07A 1BUVT 4X0CA 3OTOL 1DYQA 3OMNB 2VBVA 3MTSA 4O4JB 1ICFB 2VNUD 1E79A 4YY3O 5DN6A 3NTIA 1VQMB 3TRZA 2QKCA 3QVNA 5EBMC 2ZL5A 4X7EA 5H2FZ 2KCMA 2PI4A 5E7NA 2XAHA 4WFAV 4Z4UA 1IBLO 4GKKQ 3DXJC 4TV9A 3WB2A 3APQA 3SYQA 4JI6L 2GUZA 1AE3A 1Q9SA 4Q6GA 1URFA 3UDGA 5KHGA 2IJ0A 1Y76B 4IJLA 2XN9C 4DAYB 2QTLA 5E6TA 2GV9A 2R9AA 4DR3B 2B63H 2ZTDA 1WSVA 1KLUD 2KBNA 4X1IB 1SEBD 2RQXA 2ZM6Q 4GKKO 5TSSA 1FD9A 4CC5A 2KQXA 3JATA 1US6A 3FFQA 3HKZG 2K75A 1TWFH 4B3MQ 1XREA 3E6ZX 4FFKA 3A55A 5FO9B 4JI8Q 4YY3B 1HR0W 2E76B 3HR0A 2PUSA 1EZ6A 2JJQA 5IGGA 3KLSA 5HY6A 3S15B 4BY7B 3Q38A 4A3IH 1O9GA 2Y0PA 1TY0A 4I4TA 2ZM6O 3JAKB 1P49A 3CESA 2JP1A 1IBLB 2JA5B 4BBSG 3S24A 3W2GA 3GTLH 5GV8A 3PA1A 4X62L 3OR7C 4HJ7A 1S40A 4JTAB 4B3MO 3SJAC 3NQIA 3UO2A 3KK7A 3T4ZA 5J2UB 2HR3A 1DOLA 4JI8O 3H3VI 4PELA 1S4MA 3KBXA 3FMCA 2NB0A 4QIWF 1JJ2U 2J7KA 3M4QA 2DW4A 1FL0A 2KCCA 1U5KA 4Z2WA 1VQ7A 2QKAA 4P71A 3L73H 4B7KA 3ULJA 4GKKB 3LNMB 1VMPA 5I2YA 3J7AU 5D3IB 2C35B 1YJ9B 4DAPA 3EN2A 3WBKA 1K9MW 2W0FC 2HJFC 1NI8A 2HDMA 5L37A 4YIOA 3ZC3A 1NTZH 3JAWA 3CCLV 3WG7C 1VQLV 2ZM6B 3WOFA 1MI2A 1XPRA 1NVPD 2D0PA 4R4IA 2DY8A 2B3GA 4B3MB 3HKDA 4ABMA 4JI8B 3MVVA 5G3LF 4CH4A 1NSNS 5EAYA 1XNQQ 3ASSA 3RN2A 5JQGA 1BMFG 2F4VL 3CQZB 4C2MB 1HH2P 4C43A 5JPMC 4AIMA 3KCXA 5K1PA 2ZKOA 2X0KA 3APOA 5EIBD 5CGKA 4YY3L 2X6BA 1WSRA 2Q7HA 4RO2A 3KBGA 4A5UB 3GTOH 1FXVA 4NPSA 1XNQO 3ONUA 1F2YA 1XTDA 2XHBA 3CPWB 2DYSC 2JVDA 2DY7A 2HQLA 1CK1A 1RL2A 4R4TA 2RHSB 1VQMV 1IL2A 1KTVA 2ENBA 5IYZA 3FDTA 3FB8C 1VQKB 3FB7C 2EZPA 2ZJQA 1V1PA 1OTCA 1ZXTA 2QE7G 2BM0A 1EFID 4NDXA 3SPGA 1U2RA 4RGTA 4WFEA 1DDIA 2HCJB 4X3TA 1VQ4A 4GKKL 3RN4A 2ZJRA 4CH5A 4J1MA 1KB9F 1I08A 2PIAA 1CP9A 1MZFA 2GTAA 3D3RA 1VQ9A 1R4PB 3LQEA 1DM0B 3PO2G 4UY8C 3PO3G 3AB9A 3HOUG 1NU1H 3I7FA 3RFRA 1X3FA 1E63A 5F4OA 4TV8B 4IFDJ 3K7AH 4A3JB 1XNQB 2K1BA 3TP6A 1XX8A 2ZM6L 3S14B 2F03A 3OW2U 3H3VC 4WFBV 2QWRB 4B3ML 5IJ9B 4PV1C 4KMUC 2C77A 1VLOA 1PV0A 2PY5A 3UM7A 2HVKC 3TP8A 1JB9A 3G4SV 3KUPA 2A68C 3P7JA 5FIUA 5C4XB 4ASUA 1WD1A 3ICEA 3E35A 1I18A 3I4NH 3ES9A 3V05A 4RCYA 3KZIZ 1MMMA 3FAVB 1KQSB 4PMBA 3LDCA 2A79B 3GSIA 2AHOA 4IW3B 1XEQA 3CCEB 3UE1A 4UV9A 3K0XA 1D2BA 3M3YH 4TUYA 2VB3X 4G5GA 4IFDG 1G291 1LLRD 3CCMA 1JA0A 5HURA 4RDLA 1WD0A 2N78A 4D6TH 3CC7B 3F1ZA 4G6IA 3OGIB 2K01A 1E2ZA 2Q8VA 3ZMUA 2R61A 1C48A 4DV2Q 3HOYH 2YSUB 5KMGB 1PKXA 2HHHQ 2CGNA 5GADC 4NP5A 3JARA 4RWSC 4IPGA 3BVMA 1HFGA 3HKZB 5LA6A 5FJ8H 3SHLA 2EY6A 1Q6HA 2GJRA 3CCVB 2GBOA 4FP5D 4X88A 1SMYC 1SNQA 3A7AB 2WFWA 3AFPA 2ZQMA 4O42A 1TS3A 1XNQL 2W6JG 4TWKA 4DV2O 1D1NA 2CFMA 4J7JA 2WLLB 4DV5Q 4QV2A 3FVQA 2D5DA 1STAA 1SETA 3G80A 2BCOA 2BTQA 1S76D 1KDAA 3ETEA 1EY4A 4OWTB 3P1HA 3ASOB 1BO0A 4BBSB 1K0RA 2Y0SG 3RBZA 2Y4TA 3CMAB 2P5OA 1KDBA 3F2CA 4DV5O 1DJRD 3KJPA 4XDXA 3LSQA 5CR3A 4MTNA 3VA5A 1VARA 1S0UA 1KHIA 3U0ZA 2C4TA 4KN7C 3G7LA 3QG5A 1IBKQ 1YHBA 4H44C 4RMFA 1AZPA 2QMUA 3WOEA 3G6EA 3HP3A 1ZYRC 1ZWIC 4DK3C 2F0VA 3B78A 1CSQA 4DV2B 1PH5A 3X3NA 1L0WA 4R4OA 1R9TH 1WPCA 3GTJB 4J0QA 4HE6A 3E20A 3J80L 2A7WA 4JI5Q 4Z4TA 1OXSC 2RKSA 2QGNA 3GTKB 5CA0A 5M5WB 4MVMA 4X8AA 1IBKO 1Q82D 4CKBA 5CMDA 1G4YB 3MFYA 1WTWA 5IGCA 4LWSB 4DV5B 3CCUV 1VF7A 1SE3A 1PM9A 4XQNA 2PGGA 4C0SA 1DLBA 4X3UA 4JI5O 4DV4Q 1JR9A 3S1NB 3BCFA 5IT9c 2DJVA 4AYBE 4CH6A 4GN3B 5KHKA 5M3FG 3U4VA 4POFA 2F4NA 4P9SA 4DU9A 2O2LD 5ELOA 4Z1VA 5GW7A 1Q90A 3HKEB 1JJ2A 2XASA 1L8DA 3JALB 3ASNC 4LFAQ 5KGUA 2LS01 3U9OA 1E3XA 4DV4O 2M5SA 1HWYA 3H9VA 2QM7A 4DA2A 2ZZGA 5EBCA 3HB3B 2JJ1G 1PD3A 1VQ5V 1PTOH 1WVLA 5IY5B 1IBKB 5E1AC 5EPJA 4JMQA 3H9NA 3KF8A 4E2LA 4EGVA 3H1HH 1AILA 2X85A 3ZRSA 4ZOLB 1SDFA 3N2KA 2JA9A 3JSNA 1LTID 2J4XA 1B3AA 2A6ED 1SBBB 4B3SO 2D9UA 2EIMC 3L3OC 5DM73 4YCVA 1F2MA 2SEBD 2E74B 1ML0D 3TZUA 2GVBA 2WA3A 3HKBA 4HYOA 3A8KA 3PO2B 1WA8B 2JGDA 3PO3B 3QOJA 3OEEA 2MUYA 1KU9A 1HPCA 1IHZA 3HOUB 4QNHB 2ZIOA 3U10A 2NLJC 4DV2L 1DD2A 4QQBX 2PTMA 1E1RG 1OXTA 4XT1B 4NW2A 1YIJB 4HIMA 2HHHL 4C3HH 4CJ1B 2PQAA 4DRXA 2OTJB 2DUDA 3DUZA 5IYCH 4DV4B 1HZBA 1VQ6B 2ZZQA 5EZYB 3SR2C 2Q6OA 1U4MA 2BGIA 4YELA 4CJ0B 3ITPA 4CS2A 2C2AA 2BA0A 1WTQA 4P12A 4DV5L 2Q6IA 1T6ZA 1NBMA 1A2UA 1WU8A 2CQAA 1OCCB 1YLOA 2F0LA 4B3SB 1M8AA 2WLIB 1STGA 3OZVA 2WLHA 1TUBA 3DXRA 3SJZA 1UEBA 1DOKA 4RUEA 1U0LA 2I5HA 1GAXA 3RNUA 1N07A 3GVLA 3ICXA 5JVDB 4NMZA 4JI1Q 3JD2A 2Q7GA 5GAGC 1H42A 4Q0FA 1TVKB 2F4IA 1PTOF 3H0GH 4QL5A 5DAUA 2P3MA 1RSOA 1TVXA 2KVOA 4IUNA 1CKNB 3VR2A 1T5EA 1IBKL 1BCPD 1V9PA 3E5SA 2BA1A 3NWTA 4UZFA 5GV7A 1W0KG 2TSSA 5IGDA 4O4IA 4JI1O 2JDIA 1LT4D 3C2QA 5B66Z 2WLMA 3C90A 1Y0YA 1YZ6A 1B06A 3J7A5 2RDHA 4JI5L 3J81j 5FL7A 3D8CA 4X8IA 3K04A 3A2FA 3OW2A 4WBNA 5JEAH 1Y0RA 2KG7A 4H37A 2OTLA 1K8MA 2RQ6A 4MYTA 4PABA 3D4WA 1OV9A 4X66Q 1R3KC 1NVPB 4QY7A 2YV5A 3BY2A 1TLLA 4WWVA 1ZAUA 1B4OA 4KY7A 5B1NA 1EU3A 3E0EA 4NXNL 4DV4L 1WYDA 4HTHA 4CC6A 2YDEA 3VNVA 2Y0SB 3T1YB 1I4HA 2PMZE 4NB3A 2NTTA 5JCOA 3S16B 1EYAA 1W3SA 4KD3A 4EH1A 4JI1B 1JA8A 2WKDA 4LFAL 2NVQH 4OO1I 5LP6A 3U58A 2X69A 5HGQA 3AK3A 5DEDA 1N4CA 3TBIB 2IW3A 4FMTA 1TUIA 3I72A 3AEIA 3OEHA 1NJIW 5KRUA 1JWSD 5CORA 5JJEB 3V2TA 1NH2D 2ZINA 4Y7CA 3OAAG 3EA6A 3HGBA 4UDUC 1Y74A 3G48A 4B3RQ 1CA6A 2VRZA 5GTHZ 1EZJA 1X3EA 3ASTA 5CV9A 1GO3F 1KABA 3G6BA 5K36H 2WLNA 3FHWA 1K9MD 5A35A 3VA7A 1RP3B 3D31A 3SJQC 4MHEA 3H3VH 3ZS8C 2E76C 2K7VA 1MHWC 3PIP3 3S17H 4KUMA 4B3RO 5ITZA 2EY2A 5E79Z 1F9PA 5TV2A 2ILMA 3UO3A 3WQZA 1K5QA 5M3FB 1N0VC 2QTSA 4HNAB 5JJNB 5D14A 4IUUA 1Y14B 5HFLA 3VYSA 2Z1CA 2ADPA 5J9PC 4LJZC 1W0JA 4XL9A 4X65B 2X0LA 3HS0C 2DERA 3KF6B 1IHMA 2EPBA 3I8ZA 1COWA 3UCSC 3HEJA 3ABTA 4M1KA 2F0SA 1K33A 2MJ8A 4LBYA 4JI1L 3GDEA 1UE7A 2GPJA 1LNQA 1EFRA 2MPMA 3RZDB 5KUMA 4O2AA 4LF6Q 3CD6A 5B1AB 1R1BA 5EBWC 2JEBI 1KJZA 5EBDA 5EMNA 3JD1A 4B3RB 3M7MX 2B39A 1VJSA 1GN6A 4XQJA 3G71B 1EY7A 4X89A 5IYDG 2JA6H 3CKIB 5DM6V 3Q6SA 2UUAO 5IK2A 1JWUD 4LNUA 1OB0A 3N52A 4G1VA 2IX1A 4R7CA 2QM4A 1EU4A 1UWVA 4BY1G 3RYFA 4BW9A 2IJHA 4JK1C 2WSSG 5H59A 5FPRA 1Q8IA 3SPJA 4UCTA 1JOQA 4R8CA 1MBYA 2JS5A 3SR1A 1M56B
chains in the Genus database with same CATH topology
1IL8A 2HCIA 3M7NA 4ABNA 2EJMA 5C8YA 3BH4A 4AVZA 1CZWA 3SE0A 1WTVA 1VDZA 3MXNA 1H8HA 1ENFA 2OWOA 4DNTB 3RMHA 3K6OA 2K33A 1HUMA 2NZ1D 4X1KA 3GP7A 5GONB 1YNNC 5I4DA 3ND9A 4IHJA 2X6WA 5EKIA 1G8ZD 1HRJA 2F0HA 2KHSA 1E1RA 4XOTA 3A8JE 3H91A 1TS5A 3BDLA 4PQXA 1OXUA 3LNNA 3NE5B 4AILC 1H9SB 5CA1A 2ZZEA 1N34B 4HEDA 1QHTA 2XSCA 1NCVA 3O13A 1I6HB 3SVMA 1SFOB 1PRTC 4Z9CB 1M93A 4O4LB 1TT2A 3DWPA 4F88A 3FRPB 2QKIC 1WNSA 4FLVA 2QCPX 3UI2A 2UUAB 1EIHA 4JI0B 1OHHA 3CRKC 3EROA 1WTRA 3OTFA 5IOCA 3OMGA 3JSLA 3BVZA 5LXTB 2E2DC 4AHCA 1B1ZA 5BN4A 4EVOA 5IT9E 4XIGS 4IALA 5IODA 5KEEA 1AEXA 1RDPD 2ZTNA 2AQ2B 4G7OC 5GONA 3PIO3 2JYOA 1ONLA 2XZPA 2UXCB 3NBHA 2JA7B 1SQGA 4JI7B 3K57A 2F0WA 1H9SA 3VYTA 4JI5B 4XQFA 1JQYD 1I4QA 2UU9B 4FFBB 1B9NA 1QB5D 1WTPA 1GHKA 4LR3A 4O4LA 1UNSA 3VR5A 2H1EA 3I4LA 1J9OA 4G7WA 3PN1A 4C56C 1MABA 2KJXA 2V4DA 4FLXA 4LF4B 1FNUA 3A8KE 5LXTA 2JEAI 3I90A 3J81L 2X6GA 3AMUA 5ISRA 5CV7A 4DUZB 1QCBD 3BS1A 4P22A 3RYHB 4DF7A 1JFFB 4NXNB 3CU7A 5C4ZA 2JIZA 1E2VA 1HA5A 2YYZA 1NR4A 3QG1A 1M4VA 1W0KA 1S5JA 1D1KA 4K14A 2JE6I 4OIKA 2Q8TA 2M2LA 4FFBA 2WACA 5DNFA 1F2LA 3VQWA 1JORA 4IUPA 4K0KB 1HHVA 2GK7A 2R3ZA 1PMRA 2F0EA 1TU2B 4LFAB 4KI0A 5D5PA 1JC7A 1IW7D 3OMCA 2B2YC 4B9XA 4KY5A 2ZZFA 3ND8A 1EWHA 2WJVA 1RTOA 1SAPA 4XTCS 3K5LA 2KECA 2IT1A 2JJ2A 4F6RB 1MSGA 4LH7A 4K5XA 2P22C 5JVG3 2Q7EA 3C1EA 5ELDA 1CHPD 4GKJB 3EJIA 3FKSA 3QIAA 1UD4A 3RYHA 2ZXPA 1WCMB 5C3XA 1JFFA 2EYJA 1EQVA 4FNFA 4WFN3 3GD7A 1Y8PB 3PUZA 5CB4B 4Y7NB 1TWCB 3D6WA 2KEDA 4XLEA 1JCKB 3M4OB 4YIJA 1PRTB 3IFTA 1D5MC 1FYCA 3CRLC 5C0XJ 2PZSA 4YJ3B 3NQTA 3OSOA 4GZYC 1F9SA 1LT5D 2PZWA 2HUGA 4YHHB 1BCPC 5EPLA 3VYUA 3MXUA 2NBFA 4F6RA 5EGTA 2BOSA 1JR0D 3FKIB 1LTRD 5FO7B 1G6ZA 4J6HA 4XLHA 1DCZA 3VQYA 3ZEDA 1CFMA 1HUNA 4UFZA 1D1IA 2WP8J 2B2WA 2RVLA 5E4XA 4R8NA 4UAIA 2NTSA 2R6GA 3BG3A 4ULLA 3IAYA 1UD5A 4DV6B 4TSFA 4XNFA 2JSOA 1NAPA 1M5IA 5D65A 1PZKD 5CB4A 1G2TA 4L8JA 2F0FA 5A2QE 2O5IC 2K28A 2Z6BD 2VJJA 2A5HA 4DR4B 2L1BA 4G7XA 3DM1A 3PUXA 5HKKA 1RD9D 2QF7A 4DUYB 4IIJB 4YJ3A 2RJZA 3HG9A 1HFNA 2RA4A 2JA8B 2LFNA 3SGIA 2ZNJA 3OAAA 3H6MA 4XYOA 2PZTA 2KEEA 1HQMC 4TT3A 1SYBA 3C3LA 3KLRA 4GQNA 4DR2B 4FF2A 5CC4A 4X3KA 4R8IA 4C3JB 3OE7A 3IKJA 4CHTB 2XZOA 1B9MA 1I8DA 1JWMD 3OWEB 1Z5VA 4JI4B 1SYFA 5C0XG 2PYKA 2ICIA 2F43A 1KNEA 4OO1G 4ZKBB 1PFMA 4LAAA 4K8JA 2EYPA 4FXGC 3OTOB 1UEAB 4XR6A 2ICEC 4BA1I 3J7YW 5BN3A 4P2CB 4QB4A 3FPPA 2F0UA 4EQNA 3LWEA 4IIJA 4ZIBA 4WRDA 1KTKA 1AFPA 3N6RA 1XMQB 1A6XA 2R9VA 5BMVB 1X3QA 2KA7A 2F0KA 1Q3EA 4ZYSA 1LACA 1B50A 1SQFA 1EEID 2X6YA 2QILA 2PYLA 3CHBD 4KJNA 4EQOA 1SYGA 1SSOA 3WB0A 4D7SA 1ICWA 2JXMB 1FFXB 4ZUIA 2RBMA 2V7QA 2XGJA 3SXHA 3NBIA 1RF2D 1X3PA 4HR7B 1VF5C 2XOKA 4TQFA 2E1BA 2M9VA 4I50B 4LF9B 4IZ8A 2XRSD 3K5OA 1JMKC 2CVRA 1Z6HA 3X3MA 4IFDI 4G7HC 3UQ8A 4JYAB 1PXUA 1NR2A 3TP7A 2FHTA 4B9WA 4IUVA 2IL8A 1QG7A 4BY1B 2B2YA 4DAVA 1LT3D 3K5NA 1BCPB 2IM9A 2CW0C 1ET6A 2R7ZB 1B44D 5BMVA 5FK9C 4RA8A 3OFNA 5KYLA 1E43A 4X66B 1CTMA 3BABA 3E0JA 2E3CA 4PNYA 1EY6A 2K04A 1TS2A 2PNRC 5G3LD 1EZ8A 1U9RA 3RZOB 3GTMB 3CMMA 5M5YB 2X6LA 1FFXA 5KYIA 3S1MB 3BDOA 3S2HB 2R92B 3K5MA 1S5BD 4ZHQB 2XRQD 3K0YA 2HDLA 1HTLD 1SMYD 4I50A 4ILWA 4G4KA 3SK4A 2B2VC 3J80E 1J8IA 3SJCC 2K03A 3Q24A 1PKVA 4DR6B 4X62B 3B2EE 4HCEA 2EYOA 2D2CC 4X64B 4RKLA 2WSSA 3G05A 2XNAC 3LWUA 1TIID 2L5TA 2SOBA 1YNJD 1GUNA 4TV9B 3OIQA 1W6JA 2UUBB 3R2IA 2VUMB 5M3MB 4FF3A 1Y1VB 4EQPA 1BNZA 4O4HB 1ESRA 4TOIA 2G9HD 3BDCA 4L63B 3URYA 2KCNA 4DV1B 1STHA 1BUVT 2OEOA 1SNPA 5C4HA 1ENCA 1DYQA 4HN7A 1Q1BA 3W2DA 4ZHQA 5C44B 3MTSA 5J22A 1AP0A 4O4JB 2K32A 2VNUD 5M5XB 1E79A 4YXWA 2F66C 5ELEA 5FPOA 2FMMA 2XNDA 5DN6A 4KJOA 1ZKOA 2Z4HA 1EQTA 3NTIA 1I3QB 4GYCB 5J2TB 1PTOD 1I4XA 4A3MB 1WTOA 2GA4B 2YI9A 4QIWB 2AWNA 3JATB 5HGTA 4JV5B 2AUKA 2WINB 3F2UA 3L7ZC 4AYBB 1IYVA 2R72A 2CAZC 1UD3A 3PUVA 5COYA 2PW5A 3DXJC 4TV9A 3WB2A 1BCPF 4KKTA 2EYFA 4Q6GA 4O4HA 1MGSA 2EY5A 4PHZA 5KHGA 5LOVB 2IJ0A 1LV9A 2XN9C 2GV9A 3ZYYX 2R9AA 4I4TB 2WZPP 4DR3B 4UCRA 3VR3A 4O4JA 5EKKA 1EYDA 1XHXA 3D8GA 1KLUD 1SYCA 5K5PA 4X1IB 5J2TA 1SEBD 2RQXA 4HMJA 5TSSA 2PCFB 4CC5A 2SNMA 5C4JB 3JATA 4B08A 1A3UA 1H2SB 3FFQA 5LMUB 2ZXIA 1B53A 2WPDA 3QB3A 2E2HB 3E6ZX 3E22B 5FO8B 1VMCA 3A55A 2TMPA 5FO9B 3NTKA 5KNCA 1O7YA 2LZJA 5I6YA 4YY3B 2PUSA 4X20B 1EZ6A 1H9MA 4IN3A 5LOVA 5IGGA 2AWOA 4DFAA 1GJXA 3KLSA 4XLAA 1Q12A 4DAYA 2AUJD 1FNWA 3S15B 1KNAA 4BY7B 3RLFA 1O9GA 1TY0A 2XIWA 4I4TA 1GUWA 3PUWA 1AZQA 3R3OA 1BF4A 1TWFB 3JAKB 1P49A 3CESA 2JP1A 4V0BA 1IBLB 4XONA 2ZXOA 4XXEA 2YIBA 1SNOA 2JA5B 1QNKA 4FF4A 4B3TB 2EY1A 3TP5A 4X1IA 3NQIA 2HLDA 3SJAC 4LFBB 4DV7B 1I50B 1PFBA 3KK7A 1M4UA 2J7ZA 5J2UB 2C5CA 4RHRA 3BA8A 1CI3M 1DOLA 3JAWB 1BOSA 2K05A 3KBXA 3FMCA 2B8FA 2NB0A 2EYMA 4LF6B 3E22A 2KCCA 3GTLB 3JAME 5CDFA 1JICA 5CBEE 1IYUA 1NT2B 1A3TA 4X20A 4GKKB 2AQ1B 3HKDB 4F7XA 1R4QB 3D6CA 1VMPA 4DV0B 3JAKA 5I2YA 2PW7A 5D3IB 3H09A 3UT5B 4IUQA 2X6XA 4DAPA 3BC9A 3DDYA 1CA5A 5JQGB 1C8CA 5IGFA 1XTCD 1FGBD 1LTBD 2VJIA 4ZQ3A 3DMUA 3SK8A 5FLXE 2HDMA 1B2TA 3GV6A 2NWGA 5J2UA 1A2TA 3JAWA 2XWBB 2YIAA 3C46A 2K6AA 2LKVA 2ZM6B 5J39A 1SKYB 3WOFA 1MI2A 1HNXB 2F0QA 4J8QA 4FXUA 3C2PA 5T1IA 1F9QA 3LX0A 2DY8A 5C0XH 1QILA 4B3MB 5CV5A 3HKDA 4XM3A 4OO1H 3J7AF 2NN6I 4TKOB 1XQ8A 1N36B 2EJGC 2R70A 4JI8B 3MVVA 4M1UB 4CH4A 5EKLA 5G3LF 1NSNS 1Q1EA 5JAVA 4I65A 2LY7A 3UT5A 2VWKA 5C5MA 5JQGA 1TGOA 1UUPA 3QOLA 3BA9A 1XHZA 3CQZB 4C2MB 5IYZB 1AN8A 5JPMC 4EFBA 4UZUA 5LHY1 1IW7C 4XOPA 4C3IG 5K1PA 3OHXC 2J0TD 1V1PB 3M4YA 1G6UA 1V0FA 4BS9A 1EIGA 5EIBD 5CGKA 3TSSA 2D3NA 5EIBC 2F0MA 3NK9A 1STBA 1C4QA 2Q7HA 3KBGA 2F0TA 1UD8A 4A3DB 1HXYD 4C1NK 2B2TC 1F2YA 2XHBA 4ID6A 4OGQC 4DXGA 4IFDH 1W6KA 1I4RA 4XN0A 4ZRZA 3DEPA 4QUCA 4FF1A 2JVDA 4R9WA 2DY7A 4BWGB 1CK1A 3T4AC 3VQXA 4I9QA 3GTOB 4K2KA 5I6WA 3IFDA 4DV3B 4EEQA 1WTHD 2ENBA 3K59A 4QF4A 1EOTA 5IYZA 3FDTA