3LORA

The crystal structure of a thiol-disulfide isomerase from corynebacterium glutamicum to 2.2a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
154
structure length
154
Chain Sequence
LDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFEHHDVMTPEALKVFIDEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLSET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Thiol-disulfide Isomerase from Corynebacterium glutamicum to 2.2A
rcsb
molecule keywords Thiol-disulfide isomerase and thioredoxins
molecule tags Isomerase
source organism Corynebacterium glutamicum
total genus 42
structure length 154
sequence length 154
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lorA00
2GS3A 2N5AA 3DGQA 2H72A 2H6YA 1NHYA 2J23A 4KSMA 2DJJA 2C4JA 8GSSA 3M9KA 3BOAA 3IBHA 4IP1A 3KZQA 2R4VA 1TP9A 2LNSA 2C3QA 1UA5A 3VWWA 17GSA 1HQOA 3GYKA 5H5RA 1R4WA 4LL4B 3HY2A 2LQOA 1XOAA 1TTZA 1ACVA 3K8NA 2A2SA 1Z3EA 2VL2C 3VI7A 3VI5A 3TKSA 1KTEA 2FA4A 14GSA 4KX4A 5CRHA 3M0FA 1PL2A 1AW9A 1ML6A 2HSHA 3I6AA 4IP6A 4MZCA 3HZ4A 2HFDA 3G7IA 2OKAA 1XWCA 2HLSA 2GSQA 1O7UA 3ZVJD 2WB9A 2J9HA 3VWXA 1MTCA 3GL3A 3L9UA 3LYPA 2IMEA 5KN2A 5F8BA 2FWGA 2OACA 3LORA 4XCSA 2GSRA 4RI6A 1G0TA 4POBA 1U6TA 4ZIJA 5D9VA 5GSSA 1XPVA 2O89A 1MEKA 5A4WA 4K0GA 1GSYA 4E8EA 4I5QA 1VF4A 3HYPA 2WJUA 3D22A 2H71A 1ZYEA 4X43A 5ELAA 2L57A 2FWFA 4DEJA 3DVWA 2L5OA 2CAIA 3ISOA 5DCGA 3VWUA 4PUFC 2B3SA 2M80A 3UIWA 4XTSA 3RBTA 1Y6EA 1K0MA 2V32A 1YDKA 4OO4A 5CREA 2K6VA 2VCZA 4MLYA 1BG5A 3AY8A 3UBKA 3LQ7A 3QFAC 4OMVA 4O7HA 2GZPA 4KDYA 4ML1A 5CO3A 3CRUA 2DJ0A 4GF0A 3UJ1A 5D93A 3VPTA 2CAQA 2R6KA 1EWXA 3C7MA 4KUNA 3RHCA 3FZ9A 4MA9A 2YNXA 3FR3A 3MSZA 4MZBA 4EO3A 1M0UA 3ZTLA 1K0BA 3QAVA 2AB6A 4ML6A 4ZL8A 4HQSA 1RW1A 1WE0A 3G7YA 4RI7A 3HJPA 4AGSA 4MF5A 11GSA 1OC9A 5EY6A 3D4MA 4MMMA 1AIUA 4KCEA 2GGTA 3V1WA 2GQKA 4O32A 4O92A 2YOIA 2JZSA 2WS2A 1M2AA 5IO0A 1YF1A 3PINA 2JZRA 20GSA 2CA8A 2H76A 2R3XA 3PH9A 5COHA 3ED3A 5H5SA 4PX1A 4PNGA 1XIYA 3NOFA 4J57E 1GTAA 5D96A 3HKRA 1EOGA 2V6KA 1K0OA 3VK9A 3FZ4A 1EEJA 5DQSA 1U3IA 1KEBA 2LRCA 3IV4A 2CX4A 4NWYA 4ZXGA 2D2ZA 1MD3A 3APOA 5JCGA 2MBTA 1XOBA 3EC3A 4I6XA 4O5RA 2O85A 2L6DA 2DJ2A 4GRFA 1OAZA 4H86A 1SKWB 3EYTA 4YAPA 4V2LA 1J0FA 3QPMA 2IFQA 2DJKA 4GSNA 1GLPA 4NMUA 2P5QA 5F06A 4IBPA 4FYCA 1NM3A 3GKMA 5DDLA 4WF5A 4AJ8A 1A0RP 3RDWA 1X9SB 3EINA 2IMDA 4Z7XA 3DIEA 1SYRA 4HQZA 2WFCA 2JL4A 2E2MA 1FAAA 3FR9A 4YQMA 7GSSA 1F3BA 2H66A 3WD6A 1K3YA 1BJXA 1SKRB 1ERUA 1K0CA 1N8JA 3G7JA 3TCOA 2LRNA 3KIJA 3DXBA 3Q6OA 4ZBAA 4J2FA 2IFQB 3M9JA 3ME7A 2NPBA 2FD3A 3O3TA 1JZOA 2YV9A 2C0FA 2MBSA 2QKEA 3LWAA 4KE3A 4K6XA 2OADA 2CV4A 1SYXA 2WZ9A 1KNGA 4KA0A 4WKWA 3DRNA 5HR1A 3GKXA 1JZRA 1FB0A 2IIYA 1JZWA 2GDRA 4TVEA 4FO5A 4NV2A 4X1UA 4HS1A 1HYUA 1X5CA 1AAZA 3KEBA 1XVWA 2KP2A 3KP8A 2FWEA 4HI7A 4MJCA 2C3TA 2PMTA 1A24A 2FA8A 2OBKA 2YJHA 2L6CA 5IMDA 1JFUA 5GZZB 1EGRA 2LEGA 4V1Ag 1R7HA 3TRQA 1YF0A 1PMTA 5IPHA 3EMPA 5ECRB 1QGVA 1A2MA 2E7PA 1X0RA 3D21A 5ECNB 4IQ1A 4JU5A 1DBYA 2KOKA 1IYIA 4TOPA 4OFMA 2PVOC 1ERWA 1M2DA 4N11A 4EL1A 3M1GA 5CP1A 5CYYA 2EIOA 1OE8A 2HYXA 4JEDA 4EDYA 4IVFA 2VUPA 3ZIJA 1G7OA 3L9SA 3GUSA 4EXJA 5IM9A 1GH2A 2CZ2A 4EF0A 4WF4A 1Z7RA 4POLA 3FRCA 2H6ZA 4G2EA 5C00A 2JZTA 3KGKA 2V2GA 2LNTA 5B6NA 3VLNA 3NZNA 3TKSE 2RUFA 3OR5A 2C3NA 1BEDA 2H1DA 2CQ9A 5HR0A 5HFIA 4MH3A 1PSQA 5CRWA 2MMOA 3HVSA 3KMOA 2G0FA 2ON5A 3H93A 1UN2A 3O6TA 3C1SA 3IAS2 1OKTA 2PPTA 4IGJA 1T00A 3EVIA 1SL1B 3LFLA 3WGEA 1SJ6A 2H75A 4CW9A 2E2GA 3QDNA 1SK2A 3ME8A 4AJ6A 5KEJA 1F37A 1HNCA 2KLXA 2GZZA 3TJJA 2YANA 3D5JA 4F0BA 1SENA 2H73A 4ULXA 4PXOA 1J9BA 2NTOA 1H4OA 3EURA 5ECSA 3TOUA 3UAPA 1TK0B 2NVLA 2I9HA 4I97A 2LS5A 1M2BA 1V9WA 2N5BA 4MABA 1WP0A 3SWLA 2H1BA 1XW6A 3GURA 2TRXA 2XPEA 2N5FA 3J7Yk 3A5WA 2GSSA 1XFLA 5AN1A 4TKYA 3DYRA 2FLSA 3GTUA 1NSWA 4POMA 1M9AA 5E59A 4MK3A 1Q98A 5A4VA 2F3MA 1WRYA 1WJKA 3DD3A 3F0IA 1XWAA 4MF6A 2V6OA 1GTUA 1SL0B 3KP9A 3IAM2 4HEA2 1O8WA 2K8SA 3EU3A 2WDUA 1DE1A 4ZILA 2GSTA 3HDCA 3MDKA 2YWIA 6GSTA 1XXUA 2M46A 13GSA 3LSZA 1B4PA 3GTUB 5D9WA 2VO4A 2VCTA 1TI3A 2B1LA 2VCXA 3EWLA 2H0IA 5JCUA 4GQFA 3C8EA 5INYA 4MJEA 3KH7A 5IMVA 3HHVA 1TRUA 2GVPA 1XWGA 1JHBA 3DMLA 1A23A 2H19A 4K7OA 4KNDA 2YP6A 2KP1A 4ZB6A 1O6JA 3IE3A 3GH6A 3IXRA 1V98A 5HFKA 4DVCA 3F3RA 3FK8A 3HVXA 3GA4A 2VCVA 3CSHA 4TR1A 4BVXA 3HZ8A 3TKSC 4L8EA 1ON4A 3ZLPA 2EIRA 4AF2A 1SU9A 4CDOA 2HE3A 3L4NA 4ZBDA 4HJ2A 4KDXA 2YJ7A 3CSIA 4MCUA 2PWJA 1T3BA 3HCZA 3QCPA 5ECMB 1MDKA 2C0GA 3N5OA 4L5LA 2VAFA 4TRXA 4ECCA 5ELGA 1THOA 6GSUA 22GSA 3FZ5A 3TUEA 3A2XA 1PX6A 1B9XC 3GIXA 1TW9A 5ECHB 1K3OA 4TR1B 3P2AA 2K18A 2OA7A 3H1NA 1B48A 3HJMA 4WETA 3LYKA 2X8CA 3IK7A 3L9VA 5ECPB 1X9WB 1PRXA 1Z7PA 3FW2A 3Q74A 1G6YA 5IO2A 2YWNA 4PQHA 5AIVA 1SJZA 2A2RA 4MH2A 3ZRDA 1XZOA 4IN0A 4KDUA 1FVKA 1IYHA 4PQ1A 6GSVA 1ZYQB 2K8VA 4NAXA 1U3AA 1A2JA 1ST9A 1TK5B 5F07A 3FEUA 2PERA 5LNKe 4WBRD 2RUEA 4K9ZA 1Z6MA 1XW9A 3GHAA 1GRXA 4MJAA 3M8NA 1E2YA 2PN8A 2O87A 1HD2A 3F4SA 5IMCA 4FYBA 1AQWA 4K0NA 1PKZA 1R5AA 3I43A 5GSTA 4F82A 3C73A 2CVKA 4XS6A 19GSA 1F6MC 4N10A 3F6FA 2HNLA 3E9JB 5DBQA 1ILOA 1BQ7A 3CBUA 2YCDA 5FT3A 2IN3A 4WEYA 4TXVA 3US3A 1YEXA 2BTOT 1BX9A 1QUWA 2WGRA 1TRSA 1T4YA 3WT1A 3LGCA 5CRGA 1XVQA 1AQVA 2C0DA 2OE3A 4HJMA 3KD0A 5FHIA 1O85A 1Z5YE 1BYEA 4MPGA 3L0HA 4ECJA 2JSYA 3IC4A 4KCAA 4JR6A 3WYWA 3H79A 5IMAA 2JU5A 5CNWA 5HFGA 6GSYA 5ECLB 5D9XA 3RPNA 3IDVA 3I9V2 4HU9A 1QMVA 2P31A 1GUKA 4TR3A 3RHBA 5J9BA 4RUVA 2H8LA 2P5RA 4PGTA 4GCIA 5IQYA 1SD8A 1GSEA 2LJKA 4ECIA 1OKDA 3EMXA 5AIXA 1K0DA 4CHSA 1VF1A 2PBJA 4AJ7A 3QAWA 3MNGA 3ZFLA 1TJDA 2V41A 3FR6A 1RK4A 2HZEA 1JZDA 4GSSA 2E0QA 5F05A 5LCZA 1R5PA 2QC7A 3KMNA 5HR3A 2PGTA 1I9DA 3W8JA 2O7KA 4ZB9A 5ID2A 4IW9A 4XRAA 2C80A 2H6XA 3GX8A 2GQMA 3N9JA 3IA1A 2VD0A 3EU4A 2NBSA 2B7KA 1PN9A 4PUAA 3P7XA 2HZEB 3CMIA 3ZMLA 5ABRA 4JZQA 4ZL7A 1WIKA 1AXDA 2VOCA 5IOWA 1FHEA 4NHZA 3TKQA 1OVNA 2M72A 4OFNA 4BL7A 4FIWA 4EUYA 3APQA 5ID2B 2VM1A 4GQCA 5B8AA 2VLVA 3G9BA 1J08A 1HNAA 4NPBA 3CRTA 1TK8B 4DSQA 3BJ5A 1PD21 4PNFA 5D73A 1OC3A 3A3TA 4EC0A 4LLRA 4Q5QA 3F3QA 2OE1A 2FHEA 1Y25A 2DMMA 2DSAA 2PU9C 4HZ4A 4N30A 10GSA 4K1FA 1FO5A 3GRXA 2CX3A 3P8WA 5D9TA 16GSA 3F6DA 4EKZA 3F4RA 4X0XA 4F2IA 2MZCA 4K2DA 5IMFA 3TJFA 1TOFA 3SBCA 5J4UA 3W8SA 2ALBA 1GNWA 4MPFA 2GLRA 3WGDA 1YKAA 2IWTA 3GMFA 2DBCA 4XHMA 4NXIA 3IOSA 1A8YA 1T4ZA 5B6MA 4YQUA 1FOVA 3D6IA 3UOMA 4J56E 2YN1A 2PUKC 2IMFA 3QMXA 4WBJA 1H75A 2QGVA 4ID0A 3HVVA 1V57A 1V2AA 2AHEA 4V1Ap 3D0ZA 6GSWA 2HRNA 1VRSD 5G1LA 2B5XA 1LU4A 3LXZA 1UVZA 5DALA 1GULA 1O73A 3LJRA 4IJ3A 4GTUA 5DQYA 4MP4A 5G2ZA 3KM6A 2HZFA 4L5OA 3F8UA 1CQHA 3GV1A 2XHFA 1U87A 5AGYA 3FHKA 2TIRA 2VM2A 2X8HA 4GLTA 4OCFA 4OFTA 4WXTA 4DSRA 1NW2A 5A4UA 3KJYA 1G6WA 4L0WA 5GAND 5DAKA 1F2EA 5KN1A 1ERTA 2P0GA 4MF7A 2DJ3A 4F0CA 5DALB 5G30A 3GH9A 1MDJA 2B6MA 2PVQA 2WRTA 1GL8A 3HD5A 1B8XA 5F0GA 2VL3A 2RLIA 2VL2A 2VIMA 1QXHA 1XBSA 1OYJA 2FWHA 5LD0A 4JR4A 1ERVA 1B9YC 4BA7A 1SL2B 4GSTA 3O76A 4IQAA 1SKSB 1O81A 4TN8A 3RAZA 2ZUPA 1Q4JA 4NV5A 2ON7A 2KUCA 2MMAA 5H5QA 2RM6A 5G31A 4G10A 5DAKB 2X64A 4BVYA 1NHOA 1ZCPA 4FYUA 1M99A 2B5YA 3BCKA 4ACSA 3GSTA 1DUGA 5C04A 1G7EA 1JLWA 2MMNA 2B5EA 3LG6A 3VWVA 1TRVA 5G5FA 1OC8A 4MZWA 5ENUA 3H8QA 5AISA 1X5EA 1QFNA 3VURA 1UC7A 5IPGA 5JCWA 2VD1A 5D8IA 2LSTA 2R5GA 3QD9A 5L71A 2BMXA 4TXOA 3FKFA 1AUCA 3F9UA 2LJRA 2XBIA 1AQXA 2F51A 4OCEA 3FY7A 1SK1A 1Z9HA 3TOTA 2GTUA 1XWBA 3GNJA 3VPQA 4L0UA 1GP1A 1C72A 3TGZA 3TJGA 3HXSA 1GSDA 2WULA 3DVXA 3QFBC 1FG4A 4TR4A 2LQQA 4NHWA 4I2TA 3KTBA 2CVDA 3JCML 5CAXA 3MWHA 2K9FA 3GX0A 1QQ2A 1PQNA 2I1UA 4EVMA 3APSA 4TXOB 5KN3A 5FWGA 3R2QA 3TJBA 1YEPA 1YKCA 4BWQA 1PX7A 2L4QA 3UVTA 3ZMKA 1K0AA 1GNEA 1FW1A 1V58A 3ZZXA 4K7NA 2HRFA 2R37A 3IHQA 4QQ7A 1EOHA 1YY7A 3LXTA 2LTKA 2MMZA 2LUSA 2IJYA 4KH7A 2WCIA 4WR5A 1A8LA 3GKKA 3ZL5A 5JWOB 3HJOA 1EP8A 1T1VA 3ZYWA 3GN3A 1MD4A 4IKHA 4WR4A 2O8VB 4TW5A 4V2NA 1VGLA 4TR0A 4RQRA 2BJXA 4RQXA 3U5RE 5IMZA 5JWRB 1S3CA 1WMJA 4EDZA 4I2UA 1N2AA 3H4KA 1SD9A 4MJBA 4XRDA 1TKDB 1PA3A 2LRTA 2H1AA 3E0UA 4Q5RA 2YWOA 5EPFA 3UEMA 2OE0A 1F9MA 3Q18A 18GSA 5G1KA 2R2JA 1XWKA 4G9HA 1EV4A 2B1KA 2EC4A 2H30A 4JRRA 3ERFA 2HSYA 2I3YA 2JACA 4BPYA 1S3AA 2F9SA 5DJMA 3TDGA 2CVBA 1GTBA 3RPPA 3UARA 4YAVA 2HI7A 1GSQA 1RQMA 1F3AA 1TI1A 2FUG2 4KGIA 5B8BA 4HOJA 4POKA 3DKSA 1M7TA 1FB6A 4K7IA 5J41A 3TRPA 4QL7A 3IRAA 3E3EA 1SJIA 3C1RA 4BWSA 5DJLA 2VL9A 3D4TA 2CZ3A 1AC1A 3KTLA 3Q19A 3EE2A 4I8BA 4QL9A 2C1YA 4JBBA 5E4WA 1GWCA 1GLQA 2X8GA 3GFKA 2NDOA 1OC9B 2H0HA 1ABAA 3PGTA 1X9MB 1PL1A 1K0NA 2XPDA 3QOUA 2DIYA 1X5DA 2I81A 1TRWA 1TXXA 3ERWA 2YWMA 2FGXA 2REMA 4K8MA 3WGXA 1BAYA 5CRDA 5IIZA 3ZIVA 2YZUA 1WPIA 2MYGA 5HQPA 3KH9A 1EP7A 3BCIA 1E6BA 3UMAA 1M9BA 1A2LA 2RM5A 4OO5A 4EE0A 2H70A 2DLXA 1T7PB 4OD7A 3DEXA 5B7CA 1EEMA 5ECKB 3QAGA 5JWQB 3S9FA 2VLTA 4E8HA 3ZVJA 2VCWA 3UVHA 4GXZA 2LKUA 5IOXA 3UBLA 3W6GA 1TU8A 4IS0A 3L78A 3ZREA 2G2QA 1HNBA 1T8EB 1R26A 1WOUA 5J5NA 4Q5NA 1VF3A 4ZBBA 3FZAA 4GWRA 3GL5A 4KB3A 4Q5FA 1ZOFA 1W4VA 3BD2A 4IELA 3UL3A 3TRXA 1GSUA 1DE2A 4XS1A 12GSA 4N0VA 3CTFA 3NIVA 2VLUA 3TKPA 4OWYA 2YPMA 4LA1A 2DC5A 2H0GA 2OJLA 2ZNMA 3C71A 4MDCA 3PR8A 3QR6A 5J9CA 3GKNA 2F8FA 2H1GA 6GSSA 3F4TA 2XC2A 2H01A 4N0ZA 4ZL9A 1TU7A 4D73A 4LMWA 2AV4A 2YZHA 1EGOA 1THXA 2JSZA 3VFIA 4G19A 1GSFA 1DSBA 2RIIA 3ZFBA 4PURA 3FYGA 3IK9A 3IPZA 4YQVA 3J7Yb 1K3LA 1GTIA 5A5KA 4F9ZA 1O8XA 2EIQA 1LBKA 1XW5A 2AUVA 1JLVA 3MAKA 2L59A 2CT6A 2ES7A 2H74A 3U6VA 3TKRA 2FCHA 1ZZYA 1GUMA 1OE7A 2F8AA 5J3RA 4D73B 2GQLA 1W89A 1ZMAA 4IJIA 2HT9A 4XS4A 3HA9A 4DSSA 2AYTA 2GZYA 3CSJA 1MDIA 1V40A 3WT2A 1TDIA 2OBIA 2B7JA 3DWVA 3TJKA 3ZITA 5ECQB 4P3YB 2IL3A 2JADA 4HDEA 1ZL9A 2L5LA 4KAEA 1LJRA 4V2MA 1I5GA 2AAWA 3A2VA 1USBA 3TB2A 2ZCTA 2IMIA 2DJ1A 4JE1A 2A4VA 5EL8A 3P90A 2L4CA 2C0EA 2KHPA 4XS4B 5ECIB 4DSSB 1FVJA 1URMA 2HXKA 4HU7A 4IHUA 3A2WA 6GSXA 1YZXA 1EZKA 1XCCA 2YV7A 3KCMA 4ILFA 3I69A 5EVOA 4LMVA 3CTGA 2FY6A 4FH8A 5KN0A 3IR4A 1U88A 3BBYA 2GT6A 1Z6NA 1PGTA 1B4QA 2FNOA 1EV9A 4HZ2A 3F63A 3KXOA 2AJQB 2I4AA 3CXGA 2XBQA 2DIZA 5G5EA 2DMLA 1KBNA 2QSIA 4KSOA 2V1MA 5HR2A 4LL1B 1GSSA 3LEFA 3ERGA 4ZB8A 1ZGNA 1A0FA 4ECBA 1CQGA 2GT5A 1GUHA 1YJ6A 2LV3A 2LJAA 4HUAA 1QK8A 1PKWA 2VCQA 3CYNA 5DVBA 4YH2A 9GSSA 1WWJA 1SK0A 1S3DA 5ECOB 3GSSA 4XIHA 2X99A 2IPAA 1VF2A 2TRCP 4ISDA 4F03A 2IMKA 5DCHA 4KW6A 1YQ1A 3M3MA 2C8UA 5GAPD 4PQIA 2Z9SA
chains in the Genus database with same CATH superfamily
2GS3A 2N5AA 3DGQA 2H72A 2H6YA 1NHYA 2J23A 4KSMA 2DJJA 2C4JA 8GSSA 3M9KA 3BOAA 3IBHA 4IP1A 3KZQA 2R4VA 1TP9A 2LNSA 2C3QA 1UA5A 3VWWA 17GSA 1HQOA 3GYKA 5H5RA 1R4WA 4USSA 4LL4B 3HY2A 2LQOA 1XOAA 1TTZA 1ACVA 3K8NA 2A2SA 1Z3EA 2VL2C 3VI7A 3VI5A 3TKSA 1KTEA 2FA4A 14GSA 4KX4A 5CRHA 3M0FA 1PL2A 1AW9A 1ML6A 2HSHA 3I6AA 4IP6A 4MZCA 3HZ4A 2HFDA 3G7IA 2OKAA 1XWCA 2HLSA 2GSQA 2X49A 1O7UA 3ZVJD 2WB9A 2J9HA 3VWXA 1MTCA 3GL3A 3L9UA 3LYPA 2IMEA 5KN2A 5F8BA 2FWGA 2OACA 3LORA 4XCSA 4Z2UA 2GSRA 4RI6A 1G0TA 4POBA 1U6TA 4ZIJA 5D9VA 5GSSA 1XPVA 2O89A 1MEKA 5A4WA 4K0GA 1GSYA 4E8EA 4I5QA 1VF4A 3HYPA 2WJUA 3D22A 2H71A 1ZYEA 4X43A 5ELAA 2L57A 2FWFA 4DEJA 3DVWA 2L5OA 2CAIA 3ISOA 5DCGA 3VWUA 4K5RA 4PUFC 2B3SA 2M80A 3UIWA 4XTSA 3RBTA 1Y6EA 1K0MA 4X4JA 2V32A 1YDKA 4OO4A 5CREA 2K6VA 2VCZA 4MLYA 1BG5A 3AY8A 3UBKA 3LQ7A 3QFAC 4OMVA 4O7HA 2GZPA 4KDYA 4ML1A 5CO3A 3CRUA 2DJ0A 4GF0A 3UJ1A 5D93A 3VPTA 2CAQA 2A2PA 2R6KA 1EWXA 3C7MA 4ICYA 4KUNA 3RHCA 3FZ9A 4MA9A 2YNXA 3FR3A 3MSZA 4MZBA 4EO3A 1M0UA 3ZTLA 1K0BA 3QAVA 2AB6A 4ML6A 4ZL8A 4HQSA 1RW1A 1WE0A 3G7YA 4RI7A 3HJPA 4AGSA 4MF5A 11GSA 1OC9A 5EY6A 3D4MA 4MMMA 1AIUA 4KCEA 2GGTA 3V1WA 2GQKA 4O32A 4O92A 2YOIA 2JZSA 2WS2A 1M2AA 5IO0A 1YF1A 3PINA 2JZRA 20GSA 2CA8A 5KOWA 2H76A 2R3XA 3PH9A 5COHA 3ED3A 5H5SA 4PX1A 4PNGA 1XIYA 3NOFA 4J57E 1GTAA 5D96A 3HKRA 1EOGA 2V6KA 1K0OA 3VK9A 3FZ4A 1EEJA 5DQSA 1U3IA 1KEBA 3MYDA 3PPUA 2LRCA 3IV4A 2CX4A 4NWYA 4ZXGA 2D2ZA 1MD3A 3APOA 5JCGA 2MBTA 1XOBA 3EC3A 4I6XA 4O5RA 2O85A 2L6DA 2DJ2A 4GRFA 1OAZA 4H86A 1SKWB 3EYTA 4YAPA 4V2LA 1J0FA 3QPMA 2IFQA 2DJKA 4GSNA 1GLPA 4NMUA 2P5QA 5F06A 4IBPA 4FYCA 1NM3A 3GKMA 5DDLA 4WF5A 4AJ8A 1A0RP 3RDWA 1X9SB 3EINA 2IMDA 4Z7XA 3DIEA 1SYRA 4HQZA 2WFCA 2JL4A 2E2MA 1FAAA 3FR9A 4YQMA 7GSSA 1F3BA 2H66A 3WD6A 1K3YA 1BJXA 1SKRB 1ERUA 1K0CA 1N8JA 3G7JA 3TCOA 2LRNA 3KIJA 3DXBA 3Q6OA 4ZBAA 4J2FA 2IFQB 3M9JA 3ME7A 2NPBA 2FD3A 3O3TA 1JZOA 2YV9A 2C0FA 2MBSA 2QKEA 3LWAA 4KE3A 4K6XA 2OADA 2CV4A 1SYXA 2WZ9A 1KNGA 4KA0A 4WKWA 3DRNA 5HR1A 3GKXA 1JZRA 3FMWA 1FB0A 2IIYA 1JZWA 2GDRA 4TVEA 4FO5A 4NV2A 4X1UA 4HS1A 1HYUA 1X5CA 1AAZA 3KEBA 1XVWA 2KP2A 3KP8A 2FWEA 4HI7A 4MJCA 2C3TA 2PMTA 4K2XA 1A24A 2FA8A 2OBKA 2YJHA 2L6CA 5IMDA 1JFUA 5GZZB 4G0LA 1EGRA 2LEGA 4V1Ag 1R7HA 3TRQA 1YF0A 1PMTA 5IPHA 3EMPA 5ECRB 1QGVA 1A2MA 2E7PA 1X0RA 3D21A 5ECNB 4IQ1A 4JU5A 1DBYA 2KOKA 1IYIA 4TOPA 4OFMA 2PVOC 1ERWA 1M2DA 4N11A 4EL1A 3M1GA 5CP1A 5CYYA 2EIOA 1OE8A 2HYXA 4JEDA 4EDYA 4G0KA 4IVFA 2VUPA 3ZIJA 1G7OA 3L9SA 3GUSA 4EXJA 5IM9A 1GH2A 2CZ2A 4EF0A 4WF4A 1Z7RA 4POLA 3FRCA 2H6ZA 4G2EA 5C00A 2JZTA 3KGKA 4BIKA 2V2GA 2LNTA 5B6NA 3VLNA 3NZNA 3TKSE 2RUFA 3R3EA 3OR5A 2C3NA 1BEDA 2H1DA 2CQ9A 5HR0A 5HFIA 4MH3A 1PSQA 5CRWA 2MMOA 3HVSA 3KMOA 2G0FA 2ON5A 3H93A 1UN2A 3O6TA 3C1SA 3IAS2 1OKTA 2PPTA 4IGJA 1T00A 3EVIA 1SL1B 3LFLA 3WGEA 1SJ6A 2H75A 4CW9A 2E2GA 3QDNA 1SK2A 3ME8A 4AJ6A 5KEJA 1F37A 1HNCA 3A5IA 2KLXA 2GZZA 3TJJA 2YANA 3D5JA 4F0BA 1SENA 2H73A 4ULXA 4PXOA 1J9BA 2NTOA 1H4OA 3EURA 5ECSA 3TOUA 3UAPA 1TK0B 2NVLA 2I9HA 4I97A 2LS5A 1M2BA 1V9WA 2N5BA 4MABA 1WP0A 3SWLA 2H1BA 1XW6A 3GURA 2TRXA 2XPEA 2N5FA 3J7Yk 3A5WA 2GSSA 1XFLA 5AN1A 4TKYA 3DYRA 2FLSA 3GTUA 1NSWA 4POMA 1M9AA 5E59A 1FOHA 4MK3A 1Q98A 5A4VA 2F3MA 1WRYA 1WJKA 3DD3A 3F0IA 1XWAA 4MF6A 2V6OA 1GTUA 1SL0B 1M3IA 3KP9A 3IAM2 4HEA2 1O8WA 2K8SA 3EU3A 2WDUA 1DE1A 4ZILA 2GSTA 3HDCA 3MDKA 2YWIA 3HVNA 6GSTA 1XXUA 2M46A 13GSA 2X4AA 3LSZA 1B4PA 3GTUB 5D9WA 2VO4A 2VCTA 1TI3A 2B1LA 2VCXA 3EWLA 2H0IA 5JCUA 4GQFA 3C8EA 5INYA 4MJEA 3KH7A 5IMVA 3HHVA 1TRUA 2GVPA 1XWGA 1JHBA 3DMLA 1A23A 2H19A 4K7OA 4KNDA 2YP6A 2KP1A 4ZB6A 1O6JA 3IE3A 3GH6A 3IXRA 1V98A 5HFKA 4DVCA 3F3RA 3FK8A 3HVXA 3GA4A 2VCVA 3CSHA 4TR1A 4BVXA 3HZ8A 3TKSC 4L8EA 1ON4A 3ZLPA 2EIRA 4AF2A 1SU9A 4CDOA 4MNNA 2HE3A 3L4NA 4ZBDA 4HJ2A 4KDXA 2YJ7A 3CSIA 4MCUA 2PWJA 1T3BA 2A4HA 3HCZA 3QCPA 5ECMB 2QA1A 1MDKA 2C0GA 3N5OA 4L5LA 2VAFA 4TRXA 4ECCA 5ELGA 1THOA 6GSUA 22GSA 3FZ5A 3TUEA 3A2XA 1PX6A 1B9XC 2UZ8A 3GIXA 1TW9A 5ECHB 1K3OA 4TR1B 4BVXB 3P2AA 2K18A 2OA7A 3H1NA 1B48A 3HJMA 4WETA 3LYKA 2X8CA 3IK7A 3L9VA 5ECPB 1X9WB 1XG8A 1PRXA 1Z7PA 3FW2A 3Q74A 1G6YA 5IO2A 2YWNA 4PQHA 5AIVA 1SJZA 2A2RA 4MH2A 4YKFA 3ZRDA 1XZOA 4IN0A 4KDUA 1FVKA 1IYHA 4PQ1A 6GSVA 1ZYQB 1M3JA 2K8VA 4NAXA 5BMUA 1U3AA 1A2JA 1ST9A 1TK5B 5F07A 3FEUA 2PERA 5LNKe 4WBRD 2RUEA 4K9ZA 1Z6MA 1XW9A 3GHAA 1GRXA 4MJAA 3M8NA 1E2YA 2PN8A 2O87A 1HD2A 3F4SA 5IMCA 4FYBA 1AQWA 4K0NA 1PKZA 1R5AA 3I43A 5GSTA 4F82A 3C73A 2CVKA 4A5PA 4XS6A 19GSA 1F6MC 4N10A 3F6FA 2HNLA 3E9JB 5DBQA 1ILOA 1BQ7A 3CBUA 3IC8A 2YCDA 5FT3A 2IN3A 4WEYA 4TXVA 3US3A 1YEXA 2BTOT 1BX9A 1QUWA 4G0IA 2WGRA 1TRSA 1T4YA 3WT1A 3LGCA 5CRGA 1XVQA 1AQVA 2C0DA 2OE3A 4PTSA 4HJMA 3KD0A 5FHIA 1O85A 1Z5YE 1BYEA 4MPGA 2R0PA 3L0HA 4ECJA 2JSYA 3IC4A 4KCAA 4JR6A 3WYWA 3H79A 5IMAA 2JU5A 5CNWA 5HFGA 6GSYA 5ECLB 5D9XA 3RPNA 3IDVA 3I9V2 4HU9A 1QMVA 2P31A 1GUKA 4TR3A 3RHBA 5J9BA 4HSCX 4RUVA 2H8LA 2P5RA 4PGTA 4GCIA 5IQYA 1SD8A 1GSEA 4O5UA 2LJKA 4ECIA 1OKDA 3EMXA 5AIXA 1K0DA 4CHSA 1VF1A 2PBJA 2QA2A 4AJ7A 3QAWA 3MNGA 3ZFLA 1TJDA 2V41A 3FR6A 1RK4A 2HZEA 1JZDA 4GSSA 2E0QA 5F05A 5LCZA 1R5PA 2QC7A 3KMNA 5HR3A 2PGTA 1I9DA 3W8JA 2O7KA 4ZB9A 5ID2A 4IW9A 4XRAA 2C80A 2H6XA 3GX8A 2GQMA 3N9JA 3IA1A 2VD0A 3EU4A 3IHGA 2NBSA 2B7KA 1PN9A 4PUAA 5BRTA 3P7XA 2HZEB 3CMIA 3ZMLA 5ABRA 4JZQA 4ZL7A 1WIKA 1AXDA 2VOCA 5IOWA 1FHEA 4NHZA 3TKQA 1OVNA 2M72A 4OFNA 4BL7A 4FIWA 4EUYA 3APQA 5ID2B 2VM1A 4GQCA 5B8AA 2VLVA 3G9BA 1J08A 1HNAA 4NPBA 3CRTA 1TK8B 4DSQA 3BJ5A 1PD21 4PNFA 5D73A 1OC3A 3A3TA 4EC0A 4LLRA 4Q5QA 3F3QA 2OE1A 2FHEA 1Y25A 2DMMA 2DSAA 2PU9C 4HZ4A 4N30A 10GSA 4K1FA 1FO5A 4BL7B 3GRXA 2CX3A 3P8WA 5D9TA 16GSA 3F6DA 4EKZA 3F4RA 4X0XA 4F2IA 2MZCA 4K2DA 4O5QA 5IMFA 3TJFA 1TOFA 3SBCA 5J4UA 3W8SA 2ALBA 1GNWA 4YKGA 4MPFA 2GLRA 3WGDA 1YKAA 2IWTA 3GMFA 2DBCA 4XHMA 4NXIA 3IOSA 1PN0A 1A8YA 1T4ZA 5B6MA 4YQUA 1FOVA 3D6IA 3UOMA 4J56E 2YN1A 2PUKC 2IMFA 3QMXA 4WBJA 1H75A 2QGVA 4ID0A 3HVVA 1V57A 1V2AA 2AHEA 4V1Ap 3D0ZA 6GSWA 2HRNA 1VRSD 5G1LA 2HRAA 2B5XA 1LU4A 3LXZA 1UVZA 5DALA 1GULA 1O73A 3LJRA 4IJ3A 4GTUA 5DQYA 4MP4A 5G2ZA 3KM6A 2HZFA 4L5OA 3F8UA 1CQHA 3GV1A 2XHFA 1U87A 5AGYA 3FHKA 2TIRA 2DKHA 2VM2A 2X8HA 4GLTA 4OCFA 4OFTA 4WXTA 4DSRA 1NW2A 5A4UA 3KJYA 1G6WA 4L0WA 5GAND 5DAKA 1F2EA 5KN1A 1ERTA 2P0GA 4MF7A 2DJ3A 4F0CA 5DALB 5G30A 3GH9A 1MDJA 2B6MA 2PVQA 2WRTA 1GL8A 3HD5A 1B8XA 5F0GA 2VL3A 2RLIA 2VL2A 2VIMA 1QXHA 1XBSA 1OYJA 2FWHA 5LD0A 4JR4A 1ERVA 1B9YC 4BA7A 1SL2B 4GSTA 3O76A 4IQAA 1SKSB 1O81A 4TN8A 3RAZA 2ZUPA 1Q4JA 4NV5A 2ON7A 2KUCA 2MMAA 5H5QA 2RM6A 5G31A 4G10A 5DAKB 2X64A 4BVYA 1NHOA 1ZCPA 4FYUA 1PFOA 1M99A 2B5YA 3BCKA 4ACSA 3GSTA 1DUGA 5C04A 1G7EA 1JLWA 2MMNA 2B5EA 3LG6A 3VWVA 1TRVA 5G5FA 1OC8A 4MZWA 5ENUA 3H8QA 5AISA 4KF9A 1X5EA 1QFNA 3VURA 1UC7A 4FQUA 5IPGA 5JCWA 2VD1A 5D8IA 2LSTA 2R5GA 3QD9A 5L71A 2BMXA 4TXOA 4BVYB 3FKFA 1AUCA 3F9UA 2LJRA 2XBIA 1AQXA 2F51A 4OCEA 3FY7A 1SK1A 1Z9HA 3TOTA 2GTUA 1XWBA 3GNJA 3VPQA 4L0UA 1GP1A 1C72A 3TGZA 3TJGA 3HXSA 1GSDA 2WULA 3DVXA 3QFBC 1FG4A 4TR4A 2LQQA 4NHWA 4I2TA 3KTBA 2CVDA 3JCML 5CAXA 3MWHA 2K9FA 3GX0A 1QQ2A 1PQNA 2I1UA 4EVMA 3APSA 4TXOB 5KN3A 5FWGA 3R2QA 3TJBA 1YEPA 1YKCA 4BWQA 1PX7A 2L4QA 3UVTA 3ZMKA 4K5SA 1K0AA 1GNEA 1FW1A 1V58A 3ZZXA 1S3RA 4K7NA 2HRFA 2R37A 3IHQA 4QQ7A 1EOHA 1YY7A 3LXTA 3CQFA 2LTKA 2MMZA 2LUSA 2IJYA 4KH7A 2WCIA 4WR5A 1A8LA 3GKKA 3ZL5A 5JWOB 3HJOA 1EP8A 1T1VA 3ZYWA 3GN3A 1MD4A 4IKHA 4WR4A 2O8VB 4TW5A 4V2NA 1VGLA 4TR0A 4RQRA 2BJXA 4RQXA 3U5RE 5IMZA 5JWRB 1S3CA 1WMJA 4EDZA 4I2UA 1N2AA 3H4KA 1SD9A 4MJBA 4XRDA 1TKDB 1PA3A 2LRTA 2H1AA 3E0UA 4Q5RA 2YWOA 5EPFA 3UEMA 2OE0A 1F9MA 3Q18A 18GSA 5G1KA 2R2JA 1XWKA 4G9HA 1EV4A 2B1KA 2EC4A 2H30A 4JRRA 3ERFA 2HSYA 2I3YA 2JACA 4BPYA 1S3AA 2F9SA 5KOXA 5DJMA 3TDGA 2CVBA 1GTBA 3RPPA 3UARA 4YAVA 2HI7A 1GSQA 1RQMA 1F3AA 1TI1A 2FUG2 4KGIA 5B8BA 4HOJA 4POKA 3DKSA 1M7TA 1FB6A 4K7IA 5J41A 3TRPA 4QL7A 3IRAA 3E3EA 1SJIA 3C1RA 4BWSA 5DJLA 2VL9A 3D4TA 2CZ3A 1AC1A 3KTLA 3Q19A 3EE2A 4I8BA 4QL9A 2C1YA 4JBBA 5E4WA 1GWCA 1GLQA 2X8GA 3GFKA 2NDOA 1OC9B 2H0HA 1ABAA 3PGTA 1X9MB 1PL1A 4CY8A 1K0NA 2XPDA 3QOUA 2DIYA 1X5DA 2I81A 1TRWA 1TXXA 3ERWA 2YWMA 2FGXA 2REMA 4K8MA 2DKIA 3WGXA 1BAYA 4CY6A 5CRDA 5IIZA 3ZIVA 2HRKA 2YZUA 1WPIA 2MYGA 5HQPA 3KH9A 1EP7A 3BCIA 1E6BA 3UMAA 1M9BA 1A2LA 2RM5A 4OO5A 4EE0A 2H70A 2DLXA 1T7PB 4OD7A 3DEXA 5B7CA 1EEMA 5ECKB 3QAGA 5JWQB 3S9FA 2VLTA 4E8HA 3ZVJA 2VCWA 3UVHA 4GXZA 2LKUA 5IOXA 3UBLA 3W6GA 1TU8A 4IS0A 3L78A 3ZREA 2G2QA 1HNBA 1T8EB 1R26A 1WOUA 5J5NA 4Q5NA 1VF3A 1ZYPA 4ZBBA 3FZAA 4GWRA 3GL5A 4KB3A 4Q5FA 4IELA 1W4VA 1ZOFA 3BD2A 3UL3A 3TRXA 1GSUA 1DE2A 4XS1A 12GSA 4N0VA 3CTFA 3NIVA 2VLUA 3TKPA 4OWYA 2YPMA 4LA1A 2DC5A 2H0GA 2OJLA 2ZNMA 3C71A 4MDCA 3PR8A 3QR6A 5J9CA 3GKNA 2F8FA 2H1GA 6GSSA 3F4TA 2XC2A 2H01A 4N0ZA 4ZL9A 1TU7A 4D73A 4LMWA 2AV4A 2YZHA 1EGOA 1THXA 2JSZA 3VFIA 4G19A 1GSFA 1DSBA 2RIIA 3ZFBA 4PURA 3FYGA 3IK9A 4EIQA 3IPZA 3MIXA 4YQVA 3J7Yb 1K3LA 1GTIA 5A5KA 4F9ZA 1O8XA 2EIQA 1LBKA 1XW5A 2R0GA 2AUVA 1JLVA 3MAKA 2L59A 2CT6A 2ES7A 2H74A 3U6VA 3TKRA 2FCHA 1ZZYA 1GUMA 1OE7A 2F8AA 5J3RA 4D73B 2GQLA 1W89A 1ZMAA 4IJIA 2HT9A 4XS4A 3HA9A 4DSSA 2AYTA 2GZYA 3CSJA 1MDIA 1V40A 3WT2A 1TDIA 4Z2RA 2OBIA 2B7JA 3DWVA 3TJKA 3ZITA 5ECQB 4P3YB 2IL3A 2JADA 4HDEA 1ZL9A 2L5LA 4KAEA 1LJRA 4V2MA 1I5GA 2AAWA 3A2VA 1USBA 3TB2A 2ZCTA 3LW9A 2IMIA 2DJ1A 4JE1A 2A4VA 5EL8A 3P90A 2L4CA 2C0EA 2KHPA 4XS4B 5ECIB 4DSSB 1FVJA 1URMA 2HXKA 4HU7A 4IHUA 3A2WA 6GSXA 1YZXA 2HSMA 1EZKA 1XCCA 2YV7A 3KCMA 4ILFA 3I69A 5EVOA 4LMVA 3CTGA 2FY6A 4FH8A 5KN0A 3IR4A 1U88A 3BBYA 2GT6A 1Z6NA 1PGTA 1B4QA 2FNOA 1EV9A 4HZ2A 3F63A 3KXOA 2AJQB 2I4AA 3CXGA 2XBQA 2DIZA 5G5EA 2DMLA 1KBNA 2QSIA 4KSOA 2V1MA 5HR2A 4LL1B 1GSSA 3LEFA 3ERGA 4ZB8A 1ZGNA 4EIPA 1A0FA 4ECBA 1CQGA 1ZYNA 2GT5A 1GUHA 1YJ6A 2LV3A 2LJAA 4HUAA 1QK8A 1PKWA 2VCQA 3CYNA 5DVBA 4YH2A 9GSSA 1WWJA 1SK0A 1S3DA 5ECOB 3GSSA 4XIHA 2X99A 2IPAA 1VF2A 2TRCP 4ISDA 4F03A 2IMKA 5DCHA 4KW6A 1YQ1A 2R0CA 4Z2TA 3M3MA 2C8UA 5GAPD 4PQIA 3EPTA 2Z9SA
chains in the Genus database with same CATH topology
2GS3A 2N5AA 3DGQA 2H72A 2H6YA 1NHYA 2J23A 4KSMA 2DJJA 2C4JA 8GSSA 3M9KA 3BOAA 3IBHA 4IP1A 3KZQA 2R4VA 1TP9A 2LNSA 2C3QA 1UA5A 3VWWA 17GSA 1HQOA 3GYKA 5H5RA 1R4WA 4USSA 4LL4B 3HY2A 2LQOA 1XOAA 1TTZA 1ACVA 3K8NA 2A2SA 1Z3EA 2VL2C 3VI7A 3VI5A 3TKSA 1KTEA 2FA4A 14GSA 4KX4A 5CRHA 3M0FA 1PL2A 1AW9A 1ML6A 2HSHA 3I6AA 4IP6A 4MZCA 3HZ4A 2HFDA 3G7IA 2OKAA 1XWCA 2HLSA 2GSQA 2X49A 1O7UA 3ZVJD 2WB9A 2J9HA 3VWXA 1MTCA 3GL3A 3L9UA 3LYPA 2IMEA 5KN2A 5F8BA 2FWGA 2OACA 3LORA 4XCSA 4Z2UA 2GSRA 4RI6A 1G0TA 4POBA 1U6TA 4ZIJA 5D9VA 5GSSA 1XPVA 2O89A 1MEKA 5A4WA 4K0GA 1GSYA 4E8EA 4I5QA 1VF4A 3HYPA 2WJUA 3D22A 2H71A 1ZYEA 4X43A 5ELAA 2L57A 2FWFA 4DEJA 3DVWA 2L5OA 2CAIA 3ISOA 5DCGA 3VWUA 4K5RA 4PUFC 2B3SA 2M80A 3UIWA 4XTSA 3RBTA 1Y6EA 1K0MA 4X4JA 2V32A 1YDKA 4OO4A 5CREA 2K6VA 2VCZA 4MLYA 1BG5A 3AY8A 3UBKA 3LQ7A 3QFAC 4OMVA 4O7HA 2GZPA 4KDYA 4ML1A 5CO3A 3CRUA 2DJ0A 4GF0A 3UJ1A 5D93A 3VPTA 2CAQA 2A2PA 2R6KA 1EWXA 3C7MA 4ICYA 4KUNA 3RHCA 3FZ9A 4MA9A 2YNXA 3FR3A 3MSZA 4MZBA 4EO3A 1M0UA 3ZTLA 1K0BA 3QAVA 2AB6A 4ML6A 4ZL8A 4HQSA 1RW1A 1WE0A 3G7YA 4RI7A 3HJPA 4AGSA 4MF5A 11GSA 1OC9A 5EY6A 3D4MA 4MMMA 1AIUA 4KCEA 2GGTA 3V1WA 2GQKA 4O32A 4O92A 2YOIA 2JZSA 2WS2A 1M2AA 5IO0A 1YF1A 3PINA 2JZRA 20GSA 2CA8A 5KOWA 2H76A 2R3XA 3PH9A 5COHA 3ED3A 5H5SA 4PX1A 4PNGA 1XIYA 3NOFA 4J57E 1GTAA 5D96A 3HKRA 1EOGA 2V6KA 1K0OA 3VK9A 3FZ4A 1EEJA 5DQSA 1U3IA 1KEBA 3MYDA 3PPUA 2LRCA 3IV4A 2CX4A 4NWYA 4ZXGA 2D2ZA 1MD3A 3APOA 5JCGA 2MBTA 1XOBA 3EC3A 4I6XA 4O5RA 2O85A 2L6DA 2DJ2A 4GRFA 1OAZA 4H86A 1SKWB 3EYTA 4YAPA 4V2LA 1J0FA 3QPMA 2IFQA 2DJKA 4GSNA 1GLPA 4NMUA 2P5QA 5F06A 4IBPA 4FYCA 1NM3A 3GKMA 5DDLA 4WF5A 4AJ8A 1A0RP 3RDWA 1X9SB 3EINA 2IMDA 4Z7XA 3DIEA 1SYRA 4HQZA 2WFCA 2JL4A 2E2MA 1FAAA 3FR9A 4YQMA 7GSSA 1F3BA 2H66A 3WD6A 1K3YA 1BJXA 1SKRB 1ERUA 1K0CA 1N8JA 3G7JA 3TCOA 2LRNA 3KIJA 3DXBA 3Q6OA 4ZBAA 4J2FA 2IFQB 3M9JA 3ME7A 2NPBA 2FD3A 3O3TA 1JZOA 2YV9A 2C0FA 2MBSA 2QKEA 3LWAA 4KE3A 4K6XA 2OADA 2CV4A 1SYXA 2WZ9A 1KNGA 4KA0A 4WKWA 3DRNA 5HR1A 3GKXA 1JZRA 3FMWA 1FB0A 2IIYA 1JZWA 2GDRA 4TVEA 4FO5A 4NV2A 4X1UA 4HS1A 1HYUA 1X5CA 1AAZA 3KEBA 1XVWA 2KP2A 3KP8A 2FWEA 4HI7A 4MJCA 2C3TA 2PMTA 4K2XA 1A24A 2FA8A 2OBKA 2YJHA 2L6CA 5IMDA 1JFUA 5GZZB 4G0LA 1EGRA 2LEGA 4V1Ag 1R7HA 3TRQA 1YF0A 1PMTA 5IPHA 3EMPA 5ECRB 1QGVA 1A2MA 2E7PA 1X0RA 3D21A 5ECNB 4IQ1A 4JU5A 1DBYA 2KOKA 1IYIA 4TOPA 4OFMA 2PVOC 1ERWA 1M2DA 4N11A 4EL1A 3M1GA 5CP1A 5CYYA 2EIOA 1OE8A 2HYXA 4JEDA 4EDYA 4G0KA 4IVFA 2VUPA 3ZIJA 1G7OA 3L9SA 3GUSA 4EXJA 5IM9A 1GH2A 2CZ2A 4EF0A 4WF4A 1Z7RA 4POLA 3FRCA 2H6ZA 4G2EA 5C00A 2JZTA 3KGKA 2V2GA 2LNTA 5B6NA 3VLNA 3NZNA 3TKSE 2RUFA 3R3EA 3OR5A 2C3NA 1BEDA 2H1DA 2CQ9A 5HR0A 5HFIA 4MH3A 1PSQA 5CRWA 2MMOA 3HVSA 3KMOA 2G0FA 2ON5A 3H93A 1UN2A 3O6TA 3C1SA 3IAS2 1OKTA 2PPTA 4IGJA 1T00A 3EVIA 1SL1B 3LFLA 3WGEA 1SJ6A 2H75A 4CW9A 2E2GA 3QDNA 1SK2A 3ME8A 4AJ6A 5KEJA 1F37A 1HNCA 3A5IA 2KLXA 2GZZA 3TJJA 2YANA 3D5JA 4F0BA 1SENA 2H73A 4ULXA 4PXOA 1J9BA 2NTOA 1H4OA 3EURA 5ECSA 3TOUA 3UAPA 1TK0B 2NVLA 2I9HA 4I97A 2LS5A 1M2BA 1V9WA 2N5BA 4MABA 1WP0A 3SWLA 2H1BA 1XW6A 3GURA 2TRXA 2XPEA 2N5FA 3J7Yk 3A5WA 2GSSA 1XFLA 5AN1A 4TKYA 3DYRA 2FLSA 3GTUA 1NSWA 4POMA 1M9AA 5E59A 1FOHA 4MK3A 1Q98A 5A4VA 2F3MA 1WRYA 1WJKA 3DD3A 3F0IA 1XWAA 4MF6A 2V6OA 1GTUA 1SL0B 3KP9A 3IAM2 4HEA2 1O8WA 2K8SA 3EU3A 2WDUA 1DE1A 4ZILA 2GSTA 3HDCA 3MDKA 2YWIA 6GSTA 1XXUA 2M46A 13GSA 2X4AA 3LSZA 1B4PA 3GTUB 5D9WA 2VO4A 2VCTA 1TI3A 2B1LA 2VCXA 3EWLA 2H0IA 5JCUA 4GQFA 3C8EA 5INYA 4MJEA 3KH7A 5IMVA 3HHVA 1TRUA 2GVPA 1XWGA 1JHBA 3DMLA 1A23A 2H19A 4K7OA 4KNDA 2YP6A 2KP1A 4ZB6A 1O6JA 3IE3A 3GH6A 3IXRA 1V98A 5HFKA 4DVCA 3F3RA 3FK8A 3HVXA 3GA4A 2VCVA 3CSHA 4TR1A 4BVXA 3HZ8A 3TKSC 4L8EA 1ON4A 3ZLPA 2EIRA 4AF2A 1SU9A 4CDOA 4MNNA 2HE3A 3L4NA 4ZBDA 4HJ2A 4KDXA 2YJ7A 3CSIA 4MCUA 2PWJA 1T3BA 2A4HA 3HCZA 3QCPA 5ECMB 2QA1A 1MDKA 2C0GA 3N5OA 4L5LA 2VAFA 4TRXA 4ECCA 5ELGA 1THOA 6GSUA 22GSA 3FZ5A 3TUEA 3A2XA 1PX6A 1B9XC 2UZ8A 3GIXA 1TW9A 5ECHB 1K3OA 4TR1B 4BVXB 3P2AA 2K18A 2OA7A 3H1NA 1B48A 3HJMA 4WETA 3LYKA 2X8CA 3IK7A 3L9VA 5ECPB 1X9WB 1PRXA 1Z7PA 3FW2A 3Q74A 1G6YA 5IO2A 2YWNA 4PQHA 5AIVA 1SJZA 2A2RA 4MH2A 4YKFA 3ZRDA 1XZOA 4IN0A 4KDUA 1FVKA 1IYHA 4PQ1A 6GSVA 1ZYQB 2K8VA 4NAXA 5BMUA 1U3AA 1A2JA 1ST9A 1TK5B 5F07A 3FEUA 2PERA 5LNKe 4WBRD 2RUEA 4K9ZA 1Z6MA 1XW9A 3GHAA 1GRXA 4MJAA 3M8NA 1E2YA 2PN8A 2O87A 1HD2A 3F4SA 5IMCA 4FYBA 1AQWA 4K0NA 1PKZA 1R5AA 3I43A 5GSTA 4F82A 3C73A 2CVKA 4A5PA 4XS6A 19GSA 1F6MC 4N10A 3F6FA 2HNLA 3E9JB 5DBQA 1ILOA 1BQ7A 3CBUA 3IC8A 2YCDA 5FT3A 2IN3A 4WEYA 4TXVA 3US3A 1YEXA 2BTOT 1BX9A 1QUWA 4G0IA 2WGRA 1TRSA 1T4YA 3WT1A 3LGCA 5CRGA 1XVQA 1AQVA 2C0DA 2OE3A 4PTSA 4HJMA 3KD0A 5FHIA 1O85A 1Z5YE 1BYEA 4MPGA 2R0PA 3L0HA 4ECJA 2JSYA 3IC4A 4KCAA 4JR6A 3WYWA 3H79A 5IMAA 2JU5A 5CNWA 5HFGA 6GSYA 5ECLB 5D9XA 3RPNA 3IDVA 3I9V2 4HU9A 1QMVA 2P31A 1GUKA 4TR3A 3RHBA 5J9BA 4RUVA 2H8LA 2P5RA 4PGTA 4GCIA 5IQYA 1SD8A 1GSEA 4O5UA 2LJKA 4ECIA 1OKDA 3EMXA 5AIXA 1K0DA 4CHSA 1VF1A 2PBJA 2QA2A 4AJ7A 3QAWA 3MNGA 3ZFLA 1TJDA 2V41A 3FR6A 1RK4A 2HZEA 1JZDA 4GSSA 2E0QA 5F05A 5LCZA 1R5PA 2QC7A 3KMNA 5HR3A 2PGTA 1I9DA 3W8JA 2O7KA 4ZB9A 5ID2A 4IW9A 4XRAA 2C80A 2H6XA 3GX8A 2GQMA 3N9JA 3IA1A 2VD0A 3EU4A 3IHGA 2NBSA 2B7KA 1PN9A 4PUAA 5BRTA 3P7XA 2HZEB 3CMIA 3ZMLA 5ABRA 4JZQA 4ZL7A 1WIKA 1AXDA 2VOCA 5IOWA 1FHEA 4NHZA 3TKQA 1OVNA 2M72A 4OFNA 4BL7A 4FIWA 4EUYA 3APQA 5ID2B 2VM1A 4GQCA 5B8AA 2VLVA 3G9BA 1J08A 1HNAA 4NPBA 3CRTA 1TK8B 4DSQA 3BJ5A 1PD21 4PNFA 5D73A 1OC3A 3A3TA 4EC0A 4LLRA 4Q5QA 3F3QA 2OE1A 2FHEA 1Y25A 2DMMA 2DSAA 2PU9C 4HZ4A 4N30A 10GSA 4K1FA 1FO5A 4BL7B 3GRXA 2CX3A 3P8WA 5D9TA 16GSA 3F6DA 4EKZA 3F4RA 4X0XA 4F2IA 2MZCA 4K2DA 4O5QA 5IMFA 3TJFA 1TOFA 3SBCA 5J4UA 3W8SA 2ALBA 1GNWA 4YKGA 4MPFA 2GLRA 3WGDA 1YKAA 2IWTA 3GMFA 2DBCA 4XHMA 4NXIA 3IOSA 1PN0A 1A8YA 1T4ZA 5B6MA 4YQUA 1FOVA 3D6IA 3UOMA 4J56E 2YN1A 2PUKC 2IMFA 3QMXA 4WBJA 1H75A 2QGVA 4ID0A 3HVVA 1V57A 1V2AA 2AHEA 4V1Ap 3D0ZA 6GSWA 2HRNA 1VRSD 5G1LA 2HRAA 2B5XA 1LU4A 3LXZA 1UVZA 5DALA 1GULA 1O73A 3LJRA 4IJ3A 4GTUA 5DQYA 4MP4A 5G2ZA 3KM6A 2HZFA 4L5OA 3F8UA 1CQHA 3GV1A 2XHFA 1U87A 5AGYA 3FHKA 2TIRA 2DKHA 2VM2A 2X8HA 4GLTA 4OCFA 4OFTA 4WXTA 4DSRA 1NW2A 5A4UA 3KJYA 1G6WA 4L0WA 5GAND 5DAKA 1F2EA 5KN1A 1ERTA 2P0GA 4MF7A 2DJ3A 4F0CA 5DALB 5G30A 3GH9A 1MDJA 2B6MA 2PVQA 2WRTA 1GL8A 3HD5A 1B8XA 5F0GA 2VL3A 2RLIA 2VL2A 2VIMA 1QXHA 1XBSA 1OYJA 2FWHA 5LD0A 4JR4A 1ERVA 1B9YC 4BA7A 1SL2B 4GSTA 3O76A 4IQAA 1SKSB 1O81A 4TN8A 3RAZA 2ZUPA 1Q4JA 4NV5A 2ON7A 2KUCA 2MMAA 5H5QA 2RM6A 5G31A 4G10A 5DAKB 2X64A 4BVYA 1NHOA 1ZCPA 4FYUA 1M99A 2B5YA 3BCKA 4ACSA 3GSTA 1DUGA 5C04A 1G7EA 1JLWA 2MMNA 2B5EA 3LG6A 3VWVA 1TRVA 5G5FA 1OC8A 4MZWA 5ENUA 3H8QA 5AISA 4KF9A 1X5EA 1QFNA 3VURA 1UC7A 4FQUA 5IPGA 5JCWA 2VD1A 5D8IA 2LSTA 2R5GA 3QD9A 5L71A 2BMXA 4TXOA 4BVYB 3FKFA 1AUCA 3F9UA 2LJRA 2XBIA 1AQXA 2F51A 4OCEA 3FY7A 1SK1A 1Z9HA 3TOTA 2GTUA 1XWBA 3GNJA 3VPQA 4L0UA 1GP1A 1C72A 3TGZA 3TJGA 3HXSA 1GSDA 2WULA 3DVXA 3QFBC 1FG4A 4TR4A 2LQQA 4NHWA 4I2TA 3KTBA 2CVDA 3JCML 5CAXA 3MWHA 2K9FA 3GX0A 1QQ2A 1PQNA 2I1UA 4EVMA 3APSA 4TXOB 5KN3A 5FWGA 3R2QA 3TJBA 1YEPA 1YKCA 4BWQA 1PX7A 2L4QA 3UVTA 3ZMKA 4K5SA 1K0AA 1GNEA 1FW1A 1V58A 3ZZXA 4K7NA 2HRFA 2R37A 3IHQA 4QQ7A 1EOHA 1YY7A 3LXTA 2LTKA 2MMZA 2LUSA 2IJYA 4KH7A 2WCIA 4WR5A 1A8LA 3GKKA 3ZL5A 5JWOB 3HJOA 1EP8A 1T1VA 3ZYWA 3GN3A 1MD4A 4IKHA 4WR4A 2O8VB 4TW5A 4V2NA 1VGLA 4TR0A 4RQRA 2BJXA 4RQXA 3U5RE 5IMZA 5JWRB 1S3CA 1WMJA 4EDZA 4I2UA 1N2AA 3H4KA 1SD9A 4MJBA 4XRDA 1TKDB 1PA3A 2LRTA 2H1AA 3E0UA 4Q5RA 2YWOA 5EPFA 3UEMA 2OE0A 1F9MA 3Q18A 18GSA 5G1KA 2R2JA 1XWKA 4G9HA 1EV4A 2B1KA 2EC4A 2H30A 4JRRA 3ERFA 2HSYA 2I3YA 2JACA 4BPYA 1S3AA 2F9SA 5KOXA 5DJMA 3TDGA 2CVBA 1GTBA 3RPPA 3UARA 4YAVA 2HI7A 1GSQA 1RQMA 1F3AA 1TI1A 2FUG2 4KGIA 5B8BA 4HOJA 4POKA 3DKSA 1M7TA 1FB6A 4K7IA 5J41A 3TRPA 4QL7A 3IRAA 3E3EA 1SJIA 3C1RA 4BWSA 5DJLA 2VL9A 3D4TA 2CZ3A 1AC1A 3KTLA 3Q19A 3EE2A 4I8BA 4QL9A 2C1YA 4JBBA 5E4WA 1GWCA 1GLQA 2X8GA 3GFKA 2NDOA 1OC9B 2H0HA 1ABAA 3PGTA 1X9MB 1PL1A 4CY8A 1K0NA 2XPDA 3QOUA 2DIYA 1X5DA 2I81A 1TRWA 1TXXA 3ERWA 2YWMA 2FGXA 2REMA 4K8MA 2DKIA 3WGXA 1BAYA 4CY6A 5CRDA 5IIZA 3ZIVA 2HRKA 2YZUA 1WPIA 2MYGA 5HQPA 3KH9A 1EP7A 3BCIA 1E6BA 3UMAA 1M9BA 1A2LA 2RM5A 4OO5A 4EE0A 2H70A 2DLXA 1T7PB 4OD7A 3DEXA 5B7CA 1EEMA 5ECKB 3QAGA 5JWQB 3S9FA 2VLTA 4E8HA 3ZVJA 2VCWA 3UVHA 4GXZA 2LKUA 5IOXA 3UBLA 3W6GA 1TU8A 4IS0A 3L78A 3ZREA 2G2QA 1HNBA 1T8EB 1R26A 1WOUA 5J5NA 4Q5NA 1VF3A 1ZYPA 4ZBBA 3FZAA 4GWRA 3GL5A 4KB3A 4Q5FA 4IELA 1W4VA 1ZOFA 3BD2A 3UL3A 3TRXA 1GSUA 1DE2A 4XS1A 12GSA 4N0VA 3CTFA 3NIVA 2VLUA 3TKPA 4OWYA 2YPMA 4LA1A 2DC5A 2H0GA 2OJLA 2ZNMA 3C71A 4MDCA 3PR8A 3QR6A 5J9CA 3GKNA 2F8FA 2H1GA 6GSSA 3F4TA 2XC2A 2H01A 4N0ZA 4ZL9A 1TU7A 4D73A 4LMWA 2AV4A 2YZHA 1EGOA 1THXA 2JSZA 3VFIA 4G19A 1GSFA 1DSBA 2RIIA 3ZFBA 4PURA 3FYGA 3IK9A 4EIQA 3IPZA 3MIXA 4YQVA 3J7Yb 1K3LA 1GTIA 5A5KA 4F9ZA 1O8XA 2EIQA 1LBKA 1XW5A 2R0GA 2AUVA 1JLVA 3MAKA 2L59A 2CT6A 2ES7A 2H74A 3U6VA 3TKRA 2FCHA 1ZZYA 1GUMA 1OE7A 2F8AA 5J3RA 4D73B 2GQLA 1W89A 1ZMAA 4IJIA 2HT9A 4XS4A 3HA9A 4DSSA 2AYTA 2GZYA 3CSJA 1MDIA 1V40A 3WT2A 1TDIA 4Z2RA 2OBIA 2B7JA 3DWVA 3TJKA 3ZITA 5ECQB 4P3YB 2IL3A 2JADA 4HDEA 1ZL9A 2L5LA 4KAEA 1LJRA 4V2MA 1I5GA 2AAWA 3A2VA 1USBA 3TB2A 2ZCTA 3LW9A 2IMIA 2DJ1A 4JE1A 2A4VA 5EL8A 3P90A 2L4CA 2C0EA 2KHPA 4XS4B 5ECIB 4DSSB 1FVJA 1URMA 2HXKA 4HU7A 4IHUA 3A2WA 6GSXA 1YZXA 2HSMA 1EZKA 1XCCA 2YV7A 3KCMA 4ILFA 3I69A 5EVOA 4LMVA 3CTGA 2FY6A 4FH8A 5KN0A 3IR4A 1U88A 3BBYA 2GT6A 1Z6NA 1PGTA 1B4QA 2FNOA 1EV9A 4HZ2A 3F63A 3KXOA 2AJQB 2I4AA 3CXGA 2XBQA 2DIZA 5G5EA 2DMLA 1KBNA 2QSIA 4KSOA 2V1MA 5HR2A 4LL1B 1GSSA 3LEFA 3ERGA 4ZB8A 1ZGNA 4EIPA 1A0FA 4ECBA 1CQGA 1ZYNA 2GT5A 1GUHA 1YJ6A 2LV3A 2LJAA 4HUAA 1QK8A 1PKWA 2VCQA 3CYNA 5DVBA 4YH2A 9GSSA 1WWJA 1SK0A 1S3DA 5ECOB 3GSSA 4XIHA 2X99A 2IPAA 1VF2A 2TRCP 4ISDA 4F03A 2IMKA 5DCHA 4KW6A 1YQ1A 2R0CA 4Z2TA 3M3MA 2C8UA 5GAPD 4PQIA 3EPTA 2Z9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GS3 A;  2N5A A;  3DGQ A;  2H72 A;  2H6Y A;  1NHY A;  2J23 A;  4KSM A;  2DJJ A;  2C4J A;  8GSS A;  3M9K A;  3BOA A;  3IBH A;  4IP1 A;  3KZQ A;  2R4V A;  1TP9 A;  2LNS A;  2C3Q A;  1UA5 A;  3VWW A;  17GS A;  1HQO A;  3GYK A;  5H5R A;  1R4W A;  4LL4 B;  3HY2 A;  2LQO A;  1XOA A;  1TTZ A;  1ACV A;  3K8N A;  2A2S A;  1Z3E A;  2VL2 C;  3VI7 A;  3VI5 A;  3TKS A;  1KTE A;  2FA4 A;  14GS A;  4KX4 A;  5CRH A;  3M0F A;  1PL2 A;  1AW9 A;  1ML6 A;  2HSH A;  3I6A A;  4IP6 A;  4MZC A;  3HZ4 A;  2HFD A;  3G7I A;  2OKA A;  1XWC A;  2HLS A;  2GSQ A;  1O7U A;  3ZVJ D;  2WB9 A;  2J9H A;  3VWX A;  1MTC A;  3GL3 A;  3L9U A;  3LYP A;  2IME A;  5KN2 A;  5F8B A;  2FWG A;  2OAC A;  3LOR A;  4XCS A;  2GSR A;  4RI6 A;  1G0T A;  4POB A;  1U6T A;  4ZIJ A;  5D9V A;  5GSS A;  1XPV A;  2O89 A;  1MEK A;  5A4W A;  4K0G A;  1GSY A;  4E8E A;  4I5Q A;  1VF4 A;  3HYP A;  2WJU A;  3D22 A;  2H71 A;  1ZYE A;  4X43 A;  5ELA A;  2L57 A;  2FWF A;  4DEJ A;  3DVW A;  2L5O A;  2CAI A;  3ISO A;  5DCG A;  3VWU A;  4PUF C;  2B3S A;  2M80 A;  3UIW A;  4XTS A;  3RBT A;  1Y6E A;  1K0M A;  2V32 A;  1YDK A;  4OO4 A;  5CRE A;  2K6V A;  2VCZ A;  4MLY A;  1BG5 A;  3AY8 A;  3UBK A;  3LQ7 A;  3QFA C;  4OMV A;  4O7H A;  2GZP A;  4KDY A;  4ML1 A;  5CO3 A;  3CRU A;  2DJ0 A;  4GF0 A;  3UJ1 A;  5D93 A;  3VPT A;  2CAQ A;  2R6K A;  1EWX A;  3C7M A;  4KUN A;  3RHC A;  3FZ9 A;  4MA9 A;  2YNX A;  3FR3 A;  3MSZ A;  4MZB A;  4EO3 A;  1M0U A;  3ZTL A;  1K0B A;  3QAV A;  2AB6 A;  4ML6 A;  4ZL8 A;  4HQS A;  1RW1 A;  1WE0 A;  3G7Y A;  4RI7 A;  3HJP A;  4AGS A;  4MF5 A;  11GS A;  1OC9 A;  5EY6 A;  3D4M A;  4MMM A;  1AIU A;  4KCE A;  2GGT A;  3V1W A;  2GQK A;  4O32 A;  4O92 A;  2YOI A;  2JZS A;  2WS2 A;  1M2A A;  5IO0 A;  1YF1 A;  3PIN A;  2JZR A;  20GS A;  2CA8 A;  2H76 A;  2R3X A;  3PH9 A;  5COH A;  3ED3 A;  5H5S A;  4PX1 A;  4PNG A;  1XIY A;  3NOF A;  4J57 E;  1GTA A;  5D96 A;  3HKR A;  1EOG A;  2V6K A;  1K0O A;  3VK9 A;  3FZ4 A;  1EEJ A;  5DQS A;  1U3I A;  1KEB A;  2LRC A;  3IV4 A;  2CX4 A;  4NWY A;  4ZXG A;  2D2Z A;  1MD3 A;  3APO A;  5JCG A;  2MBT A;  1XOB A;  3EC3 A;  4I6X A;  4O5R A;  2O85 A;  2L6D A;  2DJ2 A;  4GRF A;  1OAZ A;  4H86 A;  1SKW B;  3EYT A;  4YAP A;  4V2L A;  1J0F A;  3QPM A;  2IFQ A;  2DJK A;  4GSN A;  1GLP A;  4NMU A;  2P5Q A;  5F06 A;  4IBP A;  4FYC A;  1NM3 A;  3GKM A;  5DDL A;  4WF5 A;  4AJ8 A;  1A0R P;  3RDW A;  1X9S B;  3EIN A;  2IMD A;  4Z7X A;  3DIE A;  1SYR A;  4HQZ A;  2WFC A;  2JL4 A;  2E2M A;  1FAA A;  3FR9 A;  4YQM A;  7GSS A;  1F3B A;  2H66 A;  3WD6 A;  1K3Y A;  1BJX A;  1SKR B;  1ERU A;  1K0C A;  1N8J A;  3G7J A;  3TCO A;  2LRN A;  3KIJ A;  3DXB A;  3Q6O A;  4ZBA A;  4J2F A;  2IFQ B;  3M9J A;  3ME7 A;  2NPB A;  2FD3 A;  3O3T A;  1JZO A;  2YV9 A;  2C0F A;  2MBS A;  2QKE A;  3LWA A;  4KE3 A;  4K6X A;  2OAD A;  2CV4 A;  1SYX A;  2WZ9 A;  1KNG A;  4KA0 A;  4WKW A;  3DRN A;  5HR1 A;  3GKX A;  1JZR A;  1FB0 A;  2IIY A;  1JZW A;  2GDR A;  4TVE A;  4FO5 A;  4NV2 A;  4X1U A;  4HS1 A;  1HYU A;  1X5C A;  1AAZ A;  3KEB A;  1XVW A;  2KP2 A;  3KP8 A;  2FWE A;  4HI7 A;  4MJC A;  2C3T A;  2PMT A;  1A24 A;  2FA8 A;  2OBK A;  2YJH A;  2L6C A;  5IMD A;  1JFU A;  5GZZ B;  1EGR A;  2LEG A;  4V1A g;  1R7H A;  3TRQ A;  1YF0 A;  1PMT A;  5IPH A;  3EMP A;  5ECR B;  1QGV A;  1A2M A;  2E7P A;  1X0R A;  3D21 A;  5ECN B;  4IQ1 A;  4JU5 A;  1DBY A;  2KOK A;  1IYI A;  4TOP A;  4OFM A;  2PVO C;  1ERW A;  1M2D A;  4N11 A;  4EL1 A;  3M1G A;  5CP1 A;  5CYY A;  2EIO A;  1OE8 A;  2HYX A;  4JED A;  4EDY A;  4IVF A;  2VUP A;  3ZIJ A;  1G7O A;  3L9S A;  3GUS A;  4EXJ A;  5IM9 A;  1GH2 A;  2CZ2 A;  4EF0 A;  4WF4 A;  1Z7R A;  4POL A;  3FRC A;  2H6Z A;  4G2E A;  5C00 A;  2JZT A;  3KGK A;  2V2G A;  2LNT A;  5B6N A;  3VLN A;  3NZN A;  3TKS E;  2RUF A;  3OR5 A;  2C3N A;  1BED A;  2H1D A;  2CQ9 A;  5HR0 A;  5HFI A;  4MH3 A;  1PSQ A;  5CRW A;  2MMO A;  3HVS A;  3KMO A;  2G0F A;  2ON5 A;  3H93 A;  1UN2 A;  3O6T A;  3C1S A;  3IAS 2;  1OKT A;  2PPT A;  4IGJ A;  1T00 A;  3EVI A;  1SL1 B;  3LFL A;  3WGE A;  1SJ6 A;  2H75 A;  4CW9 A;  2E2G A;  3QDN A;  1SK2 A;  3ME8 A;  4AJ6 A;  5KEJ A;  1F37 A;  1HNC A;  2KLX A;  2GZZ A;  3TJJ A;  2YAN A;  3D5J A;  4F0B A;  1SEN A;  2H73 A;  4ULX A;  4PXO A;  1J9B A;  2NTO A;  1H4O A;  3EUR A;  5ECS A;  3TOU A;  3UAP A;  1TK0 B;  2NVL A;  2I9H A;  4I97 A;  2LS5 A;  1M2B A;  1V9W A;  2N5B A;  4MAB A;  1WP0 A;  3SWL A;  2H1B A;  1XW6 A;  3GUR A;  2TRX A;  2XPE A;  2N5F A;  3J7Y k;  3A5W A;  2GSS A;  1XFL A;  5AN1 A;  4TKY A;  3DYR A;  2FLS A;  3GTU A;  1NSW A;  4POM A;  1M9A A;  5E59 A;  4MK3 A;  1Q98 A;  5A4V A;  2F3M A;  1WRY A;  1WJK A;  3DD3 A;  3F0I A;  1XWA A;  4MF6 A;  2V6O A;  1GTU A;  1SL0 B;  3KP9 A;  3IAM 2;  4HEA 2;  1O8W A;  2K8S A;  3EU3 A;  2WDU A;  1DE1 A;  4ZIL A;  2GST A;  3HDC A;  3MDK A;  2YWI A;  6GST A;  1XXU A;  2M46 A;  13GS A;  3LSZ A;  1B4P A;  3GTU B;  5D9W A;  2VO4 A;  2VCT A;  1TI3 A;  2B1L A;  2VCX A;  3EWL A;  2H0I A;  5JCU A;  4GQF A;  3C8E A;  5INY A;  4MJE A;  3KH7 A;  5IMV A;  3HHV A;  1TRU A;  2GVP A;  1XWG A;  1JHB A;  3DML A;  1A23 A;  2H19 A;  4K7O A;  4KND A;  2YP6 A;  2KP1 A;  4ZB6 A;  1O6J A;  3IE3 A;  3GH6 A;  3IXR A;  1V98 A;  5HFK A;  4DVC A;  3F3R A;  3FK8 A;  3HVX A;  3GA4 A;  2VCV A;  3CSH A;  4TR1 A;  4BVX A;  3HZ8 A;  3TKS C;  4L8E A;  1ON4 A;  3ZLP A;  2EIR A;  4AF2 A;  1SU9 A;  4CDO A;  2HE3 A;  3L4N A;  4ZBD A;  4HJ2 A;  4KDX A;  2YJ7 A;  3CSI A;  4MCU A;  2PWJ A;  1T3B A;  3HCZ A;  3QCP A;  5ECM B;  1MDK A;  2C0G A;  3N5O A;  4L5L A;  2VAF A;  4TRX A;  4ECC A;  5ELG A;  1THO A;  6GSU A;  22GS A;  3FZ5 A;  3TUE A;  3A2X A;  1PX6 A;  1B9X C;  3GIX A;  1TW9 A;  5ECH B;  1K3O A;  4TR1 B;  3P2A A;  2K18 A;  2OA7 A;  3H1N A;  1B48 A;  3HJM A;  4WET A;  3LYK A;  2X8C A;  3IK7 A;  3L9V A;  5ECP B;  1X9W B;  1PRX A;  1Z7P A;  3FW2 A;  3Q74 A;  1G6Y A;  5IO2 A;  2YWN A;  4PQH A;  5AIV A;  1SJZ A;  2A2R A;  4MH2 A;  3ZRD A;  1XZO A;  4IN0 A;  4KDU A;  1FVK A;  1IYH A;  4PQ1 A;  6GSV A;  1ZYQ B;  2K8V A;  4NAX A;  1U3A A;  1A2J A;  1ST9 A;  1TK5 B;  5F07 A;  3FEU A;  2PER A;  5LNK e;  4WBR D;  2RUE A;  4K9Z A;  1Z6M A;  1XW9 A;  3GHA A;  1GRX A;  4MJA A;  3M8N A;  1E2Y A;  2PN8 A;  2O87 A;  1HD2 A;  3F4S A;  5IMC A;  4FYB A;  1AQW A;  4K0N A;  1PKZ A;  1R5A A;  3I43 A;  5GST A;  4F82 A;  3C73 A;  2CVK A;  4XS6 A;  19GS A;  1F6M C;  4N10 A;  3F6F A;  2HNL A;  3E9J B;  5DBQ A;  1ILO A;  1BQ7 A;  3CBU A;  2YCD A;  5FT3 A;  2IN3 A;  4WEY A;  4TXV A;  3US3 A;  1YEX A;  2BTO T;  1BX9 A;  1QUW A;  2WGR A;  1TRS A;  1T4Y A;  3WT1 A;  3LGC A;  5CRG A;  1XVQ A;  1AQV A;  2C0D A;  2OE3 A;  4HJM A;  3KD0 A;  5FHI A;  1O85 A;  1Z5Y E;  1BYE A;  4MPG A;  3L0H A;  4ECJ A;  2JSY A;  3IC4 A;  4KCA A;  4JR6 A;  3WYW A;  3H79 A;  5IMA A;  2JU5 A;  5CNW A;  5HFG A;  6GSY A;  5ECL B;  5D9X A;  3RPN A;  3IDV A;  3I9V 2;  4HU9 A;  1QMV A;  2P31 A;  1GUK A;  4TR3 A;  3RHB A;  5J9B A;  4RUV A;  2H8L A;  2P5R A;  4PGT A;  4GCI A;  5IQY A;  1SD8 A;  1GSE A;  2LJK A;  4ECI A;  1OKD A;  3EMX A;  5AIX A;  1K0D A;  4CHS A;  1VF1 A;  2PBJ A;  4AJ7 A;  3QAW A;  3MNG A;  3ZFL A;  1TJD A;  2V41 A;  3FR6 A;  1RK4 A;  2HZE A;  1JZD A;  4GSS A;  2E0Q A;  5F05 A;  5LCZ A;  1R5P A;  2QC7 A;  3KMN A;  5HR3 A;  2PGT A;  1I9D A;  3W8J A;  2O7K A;  4ZB9 A;  5ID2 A;  4IW9 A;  4XRA A;  2C80 A;  2H6X A;  3GX8 A;  2GQM A;  3N9J A;  3IA1 A;  2VD0 A;  3EU4 A;  2NBS A;  2B7K A;  1PN9 A;  4PUA A;  3P7X A;  2HZE B;  3CMI A;  3ZML A;  5ABR A;  4JZQ A;  4ZL7 A;  1WIK A;  1AXD A;  2VOC A;  5IOW A;  1FHE A;  4NHZ A;  3TKQ A;  1OVN A;  2M72 A;  4OFN A;  4BL7 A;  4FIW A;  4EUY A;  3APQ A;  5ID2 B;  2VM1 A;  4GQC A;  5B8A A;  2VLV A;  3G9B A;  1J08 A;  1HNA A;  4NPB A;  3CRT A;  1TK8 B;  4DSQ A;  3BJ5 A;  1PD2 1;  4PNF A;  5D73 A;  1OC3 A;  3A3T A;  4EC0 A;  4LLR A;  4Q5Q A;  3F3Q A;  2OE1 A;  2FHE A;  1Y25 A;  2DMM A;  2DSA A;  2PU9 C;  4HZ4 A;  4N30 A;  10GS A;  4K1F A;  1FO5 A;  3GRX A;  2CX3 A;  3P8W A;  5D9T A;  16GS A;  3F6D A;  4EKZ A;  3F4R A;  4X0X A;  4F2I A;  2MZC A;  4K2D A;  5IMF A;  3TJF A;  1TOF A;  3SBC A;  5J4U A;  3W8S A;  2ALB A;  1GNW A;  4MPF A;  2GLR A;  3WGD A;  1YKA A;  2IWT A;  3GMF A;  2DBC A;  4XHM A;  4NXI A;  3IOS A;  1A8Y A;  1T4Z A;  5B6M A;  4YQU A;  1FOV A;  3D6I A;  3UOM A;  4J56 E;  2YN1 A;  2PUK C;  2IMF A;  3QMX A;  4WBJ A;  1H75 A;  2QGV A;  4ID0 A;  3HVV A;  1V57 A;  1V2A A;  2AHE A;  4V1A p;  3D0Z A;  6GSW A;  2HRN A;  1VRS D;  5G1L A;  2B5X A;  1LU4 A;  3LXZ A;  1UVZ A;  5DAL A;  1GUL A;  1O73 A;  3LJR A;  4IJ3 A;  4GTU A;  5DQY A;  4MP4 A;  5G2Z A;  3KM6 A;  2HZF A;  4L5O A;  3F8U A;  1CQH A;  3GV1 A;  2XHF A;  1U87 A;  5AGY A;  3FHK A;  2TIR A;  2VM2 A;  2X8H A;  4GLT A;  4OCF A;  4OFT A;  4WXT A;  4DSR A;  1NW2 A;  5A4U A;  3KJY A;  1G6W A;  4L0W A;  5GAN D;  5DAK A;  1F2E A;  5KN1 A;  1ERT A;  2P0G A;  4MF7 A;  2DJ3 A;  4F0C A;  5DAL B;  5G30 A;  3GH9 A;  1MDJ A;  2B6M A;  2PVQ A;  2WRT A;  1GL8 A;  3HD5 A;  1B8X A;  5F0G A;  2VL3 A;  2RLI A;  2VL2 A;  2VIM A;  1QXH A;  1XBS A;  1OYJ A;  2FWH A;  5LD0 A;  4JR4 A;  1ERV A;  1B9Y C;  4BA7 A;  1SL2 B;  4GST A;  3O76 A;  4IQA A;  1SKS B;  1O81 A;  4TN8 A;  3RAZ A;  2ZUP A;  1Q4J A;  4NV5 A;  2ON7 A;  2KUC A;  2MMA A;  5H5Q A;  2RM6 A;  5G31 A;  4G10 A;  5DAK B;  2X64 A;  4BVY A;  1NHO A;  1ZCP A;  4FYU A;  1M99 A;  2B5Y A;  3BCK A;  4ACS A;  3GST A;  1DUG A;  5C04 A;  1G7E A;  1JLW A;  2MMN A;  2B5E A;  3LG6 A;  3VWV A;  1TRV A;  5G5F A;  1OC8 A;  4MZW A;  5ENU A;  3H8Q A;  5AIS A;  1X5E A;  1QFN A;  3VUR A;  1UC7 A;  5IPG A;  5JCW A;  2VD1 A;  5D8I A;  2LST A;  2R5G A;  3QD9 A;  5L71 A;  2BMX A;  4TXO A;  3FKF A;  1AUC A;  3F9U A;  2LJR A;  2XBI A;  1AQX A;  2F51 A;  4OCE A;  3FY7 A;  1SK1 A;  1Z9H A;  3TOT A;  2GTU A;  1XWB A;  3GNJ A;  3VPQ A;  4L0U A;  1GP1 A;  1C72 A;  3TGZ A;  3TJG A;  3HXS A;  1GSD A;  2WUL A;  3DVX A;  3QFB C;  1FG4 A;  4TR4 A;  2LQQ A;  4NHW A;  4I2T A;  3KTB A;  2CVD A;  3JCM L;  5CAX A;  3MWH A;  2K9F A;  3GX0 A;  1QQ2 A;  1PQN A;  2I1U A;  4EVM A;  3APS A;  4TXO B;  5KN3 A;  5FWG A;  3R2Q A;  3TJB A;  1YEP A;  1YKC A;  4BWQ A;  1PX7 A;  2L4Q A;  3UVT A;  3ZMK A;  1K0A A;  1GNE A;  1FW1 A;  1V58 A;  3ZZX A;  4K7N A;  2HRF A;  2R37 A;  3IHQ A;  4QQ7 A;  1EOH A;  1YY7 A;  3LXT A;  2LTK A;  2MMZ A;  2LUS A;  2IJY A;  4KH7 A;  2WCI A;  4WR5 A;  1A8L A;  3GKK A;  3ZL5 A;  5JWO B;  3HJO A;  1EP8 A;  1T1V A;  3ZYW A;  3GN3 A;  1MD4 A;  4IKH A;  4WR4 A;  2O8V B;  4TW5 A;  4V2N A;  1VGL A;  4TR0 A;  4RQR A;  2BJX A;  4RQX A;  3U5R E;  5IMZ A;  5JWR B;  1S3C A;  1WMJ A;  4EDZ A;  4I2U A;  1N2A A;  3H4K A;  1SD9 A;  4MJB A;  4XRD A;  1TKD B;  1PA3 A;  2LRT A;  2H1A A;  3E0U A;  4Q5R A;  2YWO A;  5EPF A;  3UEM A;  2OE0 A;  1F9M A;  3Q18 A;  18GS A;  5G1K A;  2R2J A;  1XWK A;  4G9H A;  1EV4 A;  2B1K A;  2EC4 A;  2H30 A;  4JRR A;  3ERF A;  2HSY A;  2I3Y A;  2JAC A;  4BPY A;  1S3A A;  2F9S A;  5DJM A;  3TDG A;  2CVB A;  1GTB A;  3RPP A;  3UAR A;  4YAV A;  2HI7 A;  1GSQ A;  1RQM A;  1F3A A;  1TI1 A;  2FUG 2;  4KGI A;  5B8B A;  4HOJ A;  4POK A;  3DKS A;  1M7T A;  1FB6 A;  4K7I A;  5J41 A;  3TRP A;  4QL7 A;  3IRA A;  3E3E A;  1SJI A;  3C1R A;  4BWS A;  5DJL A;  2VL9 A;  3D4T A;  2CZ3 A;  1AC1 A;  3KTL A;  3Q19 A;  3EE2 A;  4I8B A;  4QL9 A;  2C1Y A;  4JBB A;  5E4W A;  1GWC A;  1GLQ A;  2X8G A;  3GFK A;  2NDO A;  1OC9 B;  2H0H A;  1ABA A;  3PGT A;  1X9M B;  1PL1 A;  1K0N A;  2XPD A;  3QOU A;  2DIY A;  1X5D A;  2I81 A;  1TRW A;  1TXX A;  3ERW A;  2YWM A;  2FGX A;  2REM A;  4K8M A;  3WGX A;  1BAY A;  5CRD A;  5IIZ A;  3ZIV A;  2YZU A;  1WPI A;  2MYG A;  5HQP A;  3KH9 A;  1EP7 A;  3BCI A;  1E6B A;  3UMA A;  1M9B A;  1A2L A;  2RM5 A;  4OO5 A;  4EE0 A;  2H70 A;  2DLX A;  1T7P B;  4OD7 A;  3DEX A;  5B7C A;  1EEM A;  5ECK B;  3QAG A;  5JWQ B;  3S9F A;  2VLT A;  4E8H A;  3ZVJ A;  2VCW A;  3UVH A;  4GXZ A;  2LKU A;  5IOX A;  3UBL A;  3W6G A;  1TU8 A;  4IS0 A;  3L78 A;  3ZRE A;  2G2Q A;  1HNB A;  1T8E B;  1R26 A;  1WOU A;  5J5N A;  4Q5N A;  1VF3 A;  4ZBB A;  3FZA A;  4GWR A;  3GL5 A;  4KB3 A;  4Q5F A;  1ZOF A;  1W4V A;  3BD2 A;  4IEL A;  3UL3 A;  3TRX A;  1GSU A;  1DE2 A;  4XS1 A;  12GS A;  4N0V A;  3CTF A;  3NIV A;  2VLU A;  3TKP A;  4OWY A;  2YPM A;  4LA1 A;  2DC5 A;  2H0G A;  2OJL A;  2ZNM A;  3C71 A;  4MDC A;  3PR8 A;  3QR6 A;  5J9C A;  3GKN A;  2F8F A;  2H1G A;  6GSS A;  3F4T A;  2XC2 A;  2H01 A;  4N0Z A;  4ZL9 A;  1TU7 A;  4D73 A;  4LMW A;  2AV4 A;  2YZH A;  1EGO A;  1THX A;  2JSZ A;  3VFI A;  4G19 A;  1GSF A;  1DSB A;  2RII A;  3ZFB A;  4PUR A;  3FYG A;  3IK9 A;  3IPZ A;  4YQV A;  3J7Y b;  1K3L A;  1GTI A;  5A5K A;  4F9Z A;  1O8X A;  2EIQ A;  1LBK A;  1XW5 A;  2AUV A;  1JLV A;  3MAK A;  2L59 A;  2CT6 A;  2ES7 A;  2H74 A;  3U6V A;  3TKR A;  2FCH A;  1ZZY A;  1GUM A;  1OE7 A;  2F8A A;  5J3R A;  4D73 B;  2GQL A;  1W89 A;  1ZMA A;  4IJI A;  2HT9 A;  4XS4 A;  3HA9 A;  4DSS A;  2AYT A;  2GZY A;  3CSJ A;  1MDI A;  1V40 A;  3WT2 A;  1TDI A;  2OBI A;  2B7J A;  3DWV A;  3TJK A;  3ZIT A;  5ECQ B;  4P3Y B;  2IL3 A;  2JAD A;  4HDE A;  1ZL9 A;  2L5L A;  4KAE A;  1LJR A;  4V2M A;  1I5G A;  2AAW A;  3A2V A;  1USB A;  3TB2 A;  2ZCT A;  2IMI A;  2DJ1 A;  4JE1 A;  2A4V A;  5EL8 A;  3P90 A;  2L4C A;  2C0E A;  2KHP A;  4XS4 B;  5ECI B;  4DSS B;  1FVJ A;  1URM A;  2HXK A;  4HU7 A;  4IHU A;  3A2W A;  6GSX A;  1YZX A;  1EZK A;  1XCC A;  2YV7 A;  3KCM A;  4ILF A;  3I69 A;  5EVO A;  4LMV A;  3CTG A;  2FY6 A;  4FH8 A;  5KN0 A;  3IR4 A;  1U88 A;  3BBY A;  2GT6 A;  1Z6N A;  1PGT A;  1B4Q A;  2FNO A;  1EV9 A;  4HZ2 A;  3F63 A;  3KXO A;  2AJQ B;  2I4A A;  3CXG A;  2XBQ A;  2DIZ A;  5G5E A;  2DML A;  1KBN A;  2QSI A;  4KSO A;  2V1M A;  5HR2 A;  4LL1 B;  1GSS A;  3LEF A;  3ERG A;  4ZB8 A;  1ZGN A;  1A0F A;  4ECB A;  1CQG A;  2GT5 A;  1GUH A;  1YJ6 A;  2LV3 A;  2LJA A;  4HUA A;  1QK8 A;  1PKW A;  2VCQ A;  3CYN A;  5DVB A;  4YH2 A;  9GSS A;  1WWJ A;  1SK0 A;  1S3D A;  5ECO B;  3GSS A;  4XIH A;  2X99 A;  2IPA A;  1VF2 A;  2TRC P;  4ISD A;  4F03 A;  2IMK A;  5DCH A;  4KW6 A;  1YQ1 A;  3M3M A;  2C8U A;  5GAP D;  4PQI A;  2Z9S A; 
#chains in the Genus database with same CATH topology
 2GS3 A;  2N5A A;  3DGQ A;  2H72 A;  2H6Y A;  1NHY A;  2J23 A;  4KSM A;  2DJJ A;  2C4J A;  8GSS A;  3M9K A;  3BOA A;  3IBH A;  4IP1 A;  3KZQ A;  2R4V A;  1TP9 A;  2LNS A;  2C3Q A;  1UA5 A;  3VWW A;  17GS A;  1HQO A;  3GYK A;  5H5R A;  1R4W A;  4USS A;  4LL4 B;  3HY2 A;  2LQO A;  1XOA A;  1TTZ A;  1ACV A;  3K8N A;  2A2S A;  1Z3E A;  2VL2 C;  3VI7 A;  3VI5 A;  3TKS A;  1KTE A;  2FA4 A;  14GS A;  4KX4 A;  5CRH A;  3M0F A;  1PL2 A;  1AW9 A;  1ML6 A;  2HSH A;  3I6A A;  4IP6 A;  4MZC A;  3HZ4 A;  2HFD A;  3G7I A;  2OKA A;  1XWC A;  2HLS A;  2GSQ A;  2X49 A;  1O7U A;  3ZVJ D;  2WB9 A;  2J9H A;  3VWX A;  1MTC A;  3GL3 A;  3L9U A;  3LYP A;  2IME A;  5KN2 A;  5F8B A;  2FWG A;  2OAC A;  3LOR A;  4XCS A;  4Z2U A;  2GSR A;  4RI6 A;  1G0T A;  4POB A;  1U6T A;  4ZIJ A;  5D9V A;  5GSS A;  1XPV A;  2O89 A;  1MEK A;  5A4W A;  4K0G A;  1GSY A;  4E8E A;  4I5Q A;  1VF4 A;  3HYP A;  2WJU A;  3D22 A;  2H71 A;  1ZYE A;  4X43 A;  5ELA A;  2L57 A;  2FWF A;  4DEJ A;  3DVW A;  2L5O A;  2CAI A;  3ISO A;  5DCG A;  3VWU A;  4K5R A;  4PUF C;  2B3S A;  2M80 A;  3UIW A;  4XTS A;  3RBT A;  1Y6E A;  1K0M A;  4X4J A;  2V32 A;  1YDK A;  4OO4 A;  5CRE A;  2K6V A;  2VCZ A;  4MLY A;  1BG5 A;  3AY8 A;  3UBK A;  3LQ7 A;  3QFA C;  4OMV A;  4O7H A;  2GZP A;  4KDY A;  4ML1 A;  5CO3 A;  3CRU A;  2DJ0 A;  4GF0 A;  3UJ1 A;  5D93 A;  3VPT A;  2CAQ A;  2A2P A;  2R6K A;  1EWX A;  3C7M A;  4ICY A;  4KUN A;  3RHC A;  3FZ9 A;  4MA9 A;  2YNX A;  3FR3 A;  3MSZ A;  4MZB A;  4EO3 A;  1M0U A;  3ZTL A;  1K0B A;  3QAV A;  2AB6 A;  4ML6 A;  4ZL8 A;  4HQS A;  1RW1 A;  1WE0 A;  3G7Y A;  4RI7 A;  3HJP A;  4AGS A;  4MF5 A;  11GS A;  1OC9 A;  5EY6 A;  3D4M A;  4MMM A;  1AIU A;  4KCE A;  2GGT A;  3V1W A;  2GQK A;  4O32 A;  4O92 A;  2YOI A;  2JZS A;  2WS2 A;  1M2A A;  5IO0 A;  1YF1 A;  3PIN A;  2JZR A;  20GS A;  2CA8 A;  5KOW A;  2H76 A;  2R3X A;  3PH9 A;  5COH A;  3ED3 A;  5H5S A;  4PX1 A;  4PNG A;  1XIY A;  3NOF A;  4J57 E;  1GTA A;  5D96 A;  3HKR A;  1EOG A;  2V6K A;  1K0O A;  3VK9 A;  3FZ4 A;  1EEJ A;  5DQS A;  1U3I A;  1KEB A;  3MYD A;  3PPU A;  2LRC A;  3IV4 A;  2CX4 A;  4NWY A;  4ZXG A;  2D2Z A;  1MD3 A;  3APO A;  5JCG A;  2MBT A;  1XOB A;  3EC3 A;  4I6X A;  4O5R A;  2O85 A;  2L6D A;  2DJ2 A;  4GRF A;  1OAZ A;  4H86 A;  1SKW B;  3EYT A;  4YAP A;  4V2L A;  1J0F A;  3QPM A;  2IFQ A;  2DJK A;  4GSN A;  1GLP A;  4NMU A;  2P5Q A;  5F06 A;  4IBP A;  4FYC A;  1NM3 A;  3GKM A;  5DDL A;  4WF5 A;  4AJ8 A;  1A0R P;  3RDW A;  1X9S B;  3EIN A;  2IMD A;  4Z7X A;  3DIE A;  1SYR A;  4HQZ A;  2WFC A;  2JL4 A;  2E2M A;  1FAA A;  3FR9 A;  4YQM A;  7GSS A;  1F3B A;  2H66 A;  3WD6 A;  1K3Y A;  1BJX A;  1SKR B;  1ERU A;  1K0C A;  1N8J A;  3G7J A;  3TCO A;  2LRN A;  3KIJ A;  3DXB A;  3Q6O A;  4ZBA A;  4J2F A;  2IFQ B;  3M9J A;  3ME7 A;  2NPB A;  2FD3 A;  3O3T A;  1JZO A;  2YV9 A;  2C0F A;  2MBS A;  2QKE A;  3LWA A;  4KE3 A;  4K6X A;  2OAD A;  2CV4 A;  1SYX A;  2WZ9 A;  1KNG A;  4KA0 A;  4WKW A;  3DRN A;  5HR1 A;  3GKX A;  1JZR A;  3FMW A;  1FB0 A;  2IIY A;  1JZW A;  2GDR A;  4TVE A;  4FO5 A;  4NV2 A;  4X1U A;  4HS1 A;  1HYU A;  1X5C A;  1AAZ A;  3KEB A;  1XVW A;  2KP2 A;  3KP8 A;  2FWE A;  4HI7 A;  4MJC A;  2C3T A;  2PMT A;  4K2X A;  1A24 A;  2FA8 A;  2OBK A;  2YJH A;  2L6C A;  5IMD A;  1JFU A;  5GZZ B;  4G0L A;  1EGR A;  2LEG A;  4V1A g;  1R7H A;  3TRQ A;  1YF0 A;  1PMT A;  5IPH A;  3EMP A;  5ECR B;  1QGV A;  1A2M A;  2E7P A;  1X0R A;  3D21 A;  5ECN B;  4IQ1 A;  4JU5 A;  1DBY A;  2KOK A;  1IYI A;  4TOP A;  4OFM A;  2PVO C;  1ERW A;  1M2D A;  4N11 A;  4EL1 A;  3M1G A;  5CP1 A;  5CYY A;  2EIO A;  1OE8 A;  2HYX A;  4JED A;  4EDY A;  4G0K A;  4IVF A;  2VUP A;  3ZIJ A;  1G7O A;  3L9S A;  3GUS A;  4EXJ A;  5IM9 A;  1GH2 A;  2CZ2 A;  4EF0 A;  4WF4 A;  1Z7R A;  4POL A;  3FRC A;  2H6Z A;  4G2E A;  5C00 A;  2JZT A;  3KGK A;  4BIK A;  2V2G A;  2LNT A;  5B6N A;  3VLN A;  3NZN A;  3TKS E;  2RUF A;  3R3E A;  3OR5 A;  2C3N A;  1BED A;  2H1D A;  2CQ9 A;  5HR0 A;  5HFI A;  4MH3 A;  1PSQ A;  5CRW A;  2MMO A;  3HVS A;  3KMO A;  2G0F A;  2ON5 A;  3H93 A;  1UN2 A;  3O6T A;  3C1S A;  3IAS 2;  1OKT A;  2PPT A;  4IGJ A;  1T00 A;  3EVI A;  1SL1 B;  3LFL A;  3WGE A;  1SJ6 A;  2H75 A;  4CW9 A;  2E2G A;  3QDN A;  1SK2 A;  3ME8 A;  4AJ6 A;  5KEJ A;  1F37 A;  1HNC A;  3A5I A;  2KLX A;  2GZZ A;  3TJJ A;  2YAN A;  3D5J A;  4F0B A;  1SEN A;  2H73 A;  4ULX A;  4PXO A;  1J9B A;  2NTO A;  1H4O A;  3EUR A;  5ECS A;  3TOU A;  3UAP A;  1TK0 B;  2NVL A;  2I9H A;  4I97 A;  2LS5 A;  1M2B A;  1V9W A;  2N5B A;  4MAB A;  1WP0 A;  3SWL A;  2H1B A;  1XW6 A;  3GUR A;  2TRX A;  2XPE A;  2N5F A;  3J7Y k;  3A5W A;  2GSS A;  1XFL A;  5AN1 A;  4TKY A;  3DYR A;  2FLS A;  3GTU A;  1NSW A;  4POM A;  1M9A A;  5E59 A;  1FOH A;  4MK3 A;  1Q98 A;  5A4V A;  2F3M A;  1WRY A;  1WJK A;  3DD3 A;  3F0I A;  1XWA A;  4MF6 A;  2V6O A;  1GTU A;  1SL0 B;  1M3I A;  3KP9 A;  3IAM 2;  4HEA 2;  1O8W A;  2K8S A;  3EU3 A;  2WDU A;  1DE1 A;  4ZIL A;  2GST A;  3HDC A;  3MDK A;  2YWI A;  3HVN A;  6GST A;  1XXU A;  2M46 A;  13GS A;  2X4A A;  3LSZ A;  1B4P A;  3GTU B;  5D9W A;  2VO4 A;  2VCT A;  1TI3 A;  2B1L A;  2VCX A;  3EWL A;  2H0I A;  5JCU A;  4GQF A;  3C8E A;  5INY A;  4MJE A;  3KH7 A;  5IMV A;  3HHV A;  1TRU A;  2GVP A;  1XWG A;  1JHB A;  3DML A;  1A23 A;  2H19 A;  4K7O A;  4KND A;  2YP6 A;  2KP1 A;  4ZB6 A;  1O6J A;  3IE3 A;  3GH6 A;  3IXR A;  1V98 A;  5HFK A;  4DVC A;  3F3R A;  3FK8 A;  3HVX A;  3GA4 A;  2VCV A;  3CSH A;  4TR1 A;  4BVX A;  3HZ8 A;  3TKS C;  4L8E A;  1ON4 A;  3ZLP A;  2EIR A;  4AF2 A;  1SU9 A;  4CDO A;  4MNN A;  2HE3 A;  3L4N A;  4ZBD A;  4HJ2 A;  4KDX A;  2YJ7 A;  3CSI A;  4MCU A;  2PWJ A;  1T3B A;  2A4H A;  3HCZ A;  3QCP A;  5ECM B;  2QA1 A;  1MDK A;  2C0G A;  3N5O A;  4L5L A;  2VAF A;  4TRX A;  4ECC A;  5ELG A;  1THO A;  6GSU A;  22GS A;  3FZ5 A;  3TUE A;  3A2X A;  1PX6 A;  1B9X C;  2UZ8 A;  3GIX A;  1TW9 A;  5ECH B;  1K3O A;  4TR1 B;  4BVX B;  3P2A A;  2K18 A;  2OA7 A;  3H1N A;  1B48 A;  3HJM A;  4WET A;  3LYK A;  2X8C A;  3IK7 A;  3L9V A;  5ECP B;  1X9W B;  1XG8 A;  1PRX A;  1Z7P A;  3FW2 A;  3Q74 A;  1G6Y A;  5IO2 A;  2YWN A;  4PQH A;  5AIV A;  1SJZ A;  2A2R A;  4MH2 A;  4YKF A;  3ZRD A;  1XZO A;  4IN0 A;  4KDU A;  1FVK A;  1IYH A;  4PQ1 A;  6GSV A;  1ZYQ B;  1M3J A;  2K8V A;  4NAX A;  5BMU A;  1U3A A;  1A2J A;  1ST9 A;  1TK5 B;  5F07 A;  3FEU A;  2PER A;  5LNK e;  4WBR D;  2RUE A;  4K9Z A;  1Z6M A;  1XW9 A;  3GHA A;  1GRX A;  4MJA A;  3M8N A;  1E2Y A;  2PN8 A;  2O87 A;  1HD2 A;  3F4S A;  5IMC A;  4FYB A;  1AQW A;  4K0N A;  1PKZ A;  1R5A A;  3I43 A;  5GST A;  4F82 A;  3C73 A;  2CVK A;  4A5P A;  4XS6 A;  19GS A;  1F6M C;  4N10 A;  3F6F A;  2HNL A;  3E9J B;  5DBQ A;  1ILO A;  1BQ7 A;  3CBU A;  3IC8 A;  2YCD A;  5FT3 A;  2IN3 A;  4WEY A;  4TXV A;  3US3 A;  1YEX A;  2BTO T;  1BX9 A;  1QUW A;  4G0I A;  2WGR A;  1TRS A;  1T4Y A;  3WT1 A;  3LGC A;  5CRG A;  1XVQ A;  1AQV A;  2C0D A;  2OE3 A;  4PTS A;  4HJM A;  3KD0 A;  5FHI A;  1O85 A;  1Z5Y E;  1BYE A;  4MPG A;  2R0P A;  3L0H A;  4ECJ A;  2JSY A;  3IC4 A;  4KCA A;  4JR6 A;  3WYW A;  3H79 A;  5IMA A;  2JU5 A;  5CNW A;  5HFG A;  6GSY A;  5ECL B;  5D9X A;  3RPN A;  3IDV A;  3I9V 2;  4HU9 A;  1QMV A;  2P31 A;  1GUK A;  4TR3 A;  3RHB A;  5J9B A;  4HSC X;  4RUV A;  2H8L A;  2P5R A;  4PGT A;  4GCI A;  5IQY A;  1SD8 A;  1GSE A;  4O5U A;  2LJK A;  4ECI A;  1OKD A;  3EMX A;  5AIX A;  1K0D A;  4CHS A;  1VF1 A;  2PBJ A;  2QA2 A;  4AJ7 A;  3QAW A;  3MNG A;  3ZFL A;  1TJD A;  2V41 A;  3FR6 A;  1RK4 A;  2HZE A;  1JZD A;  4GSS A;  2E0Q A;  5F05 A;  5LCZ A;  1R5P A;  2QC7 A;  3KMN A;  5HR3 A;  2PGT A;  1I9D A;  3W8J A;  2O7K A;  4ZB9 A;  5ID2 A;  4IW9 A;  4XRA A;  2C80 A;  2H6X A;  3GX8 A;  2GQM A;  3N9J A;  3IA1 A;  2VD0 A;  3EU4 A;  3IHG A;  2NBS A;  2B7K A;  1PN9 A;  4PUA A;  5BRT A;  3P7X A;  2HZE B;  3CMI A;  3ZML A;  5ABR A;  4JZQ A;  4ZL7 A;  1WIK A;  1AXD A;  2VOC A;  5IOW A;  1FHE A;  4NHZ A;  3TKQ A;  1OVN A;  2M72 A;  4OFN A;  4BL7 A;  4FIW A;  4EUY A;  3APQ A;  5ID2 B;  2VM1 A;  4GQC A;  5B8A A;  2VLV A;  3G9B A;  1J08 A;  1HNA A;  4NPB A;  3CRT A;  1TK8 B;  4DSQ A;  3BJ5 A;  1PD2 1;  4PNF A;  5D73 A;  1OC3 A;  3A3T A;  4EC0 A;  4LLR A;  4Q5Q A;  3F3Q A;  2OE1 A;  2FHE A;  1Y25 A;  2DMM A;  2DSA A;  2PU9 C;  4HZ4 A;  4N30 A;  10GS A;  4K1F A;  1FO5 A;  4BL7 B;  3GRX A;  2CX3 A;  3P8W A;  5D9T A;  16GS A;  3F6D A;  4EKZ A;  3F4R A;  4X0X A;  4F2I A;  2MZC A;  4K2D A;  4O5Q A;  5IMF A;  3TJF A;  1TOF A;  3SBC A;  5J4U A;  3W8S A;  2ALB A;  1GNW A;  4YKG A;  4MPF A;  2GLR A;  3WGD A;  1YKA A;  2IWT A;  3GMF A;  2DBC A;  4XHM A;  4NXI A;  3IOS A;  1PN0 A;  1A8Y A;  1T4Z A;  5B6M A;  4YQU A;  1FOV A;  3D6I A;  3UOM A;  4J56 E;  2YN1 A;  2PUK C;  2IMF A;  3QMX A;  4WBJ A;  1H75 A;  2QGV A;  4ID0 A;  3HVV A;  1V57 A;  1V2A A;  2AHE A;  4V1A p;  3D0Z A;  6GSW A;  2HRN A;  1VRS D;  5G1L A;  2HRA A;  2B5X A;  1LU4 A;  3LXZ A;  1UVZ A;  5DAL A;  1GUL A;  1O73 A;  3LJR A;  4IJ3 A;  4GTU A;  5DQY A;  4MP4 A;  5G2Z A;  3KM6 A;  2HZF A;  4L5O A;  3F8U A;  1CQH A;  3GV1 A;  2XHF A;  1U87 A;  5AGY A;  3FHK A;  2TIR A;  2DKH A;  2VM2 A;  2X8H A;  4GLT A;  4OCF A;  4OFT A;  4WXT A;  4DSR A;  1NW2 A;  5A4U A;  3KJY A;  1G6W A;  4L0W A;  5GAN D;  5DAK A;  1F2E A;  5KN1 A;  1ERT A;  2P0G A;  4MF7 A;  2DJ3 A;  4F0C A;  5DAL B;  5G30 A;  3GH9 A;  1MDJ A;  2B6M A;  2PVQ A;  2WRT A;  1GL8 A;  3HD5 A;  1B8X A;  5F0G A;  2VL3 A;  2RLI A;  2VL2 A;  2VIM A;  1QXH A;  1XBS A;  1OYJ A;  2FWH A;  5LD0 A;  4JR4 A;  1ERV A;  1B9Y C;  4BA7 A;  1SL2 B;  4GST A;  3O76 A;  4IQA A;  1SKS B;  1O81 A;  4TN8 A;  3RAZ A;  2ZUP A;  1Q4J A;  4NV5 A;  2ON7 A;  2KUC A;  2MMA A;  5H5Q A;  2RM6 A;  5G31 A;  4G10 A;  5DAK B;  2X64 A;  4BVY A;  1NHO A;  1ZCP A;  4FYU A;  1PFO A;  1M99 A;  2B5Y A;  3BCK A;  4ACS A;  3GST A;  1DUG A;  5C04 A;  1G7E A;  1JLW A;  2MMN A;  2B5E A;  3LG6 A;  3VWV A;  1TRV A;  5G5F A;  1OC8 A;  4MZW A;  5ENU A;  3H8Q A;  5AIS A;  4KF9 A;  1X5E A;  1QFN A;  3VUR A;  1UC7 A;  4FQU A;  5IPG A;  5JCW A;  2VD1 A;  5D8I A;  2LST A;  2R5G A;  3QD9 A;  5L71 A;  2BMX A;  4TXO A;  4BVY B;  3FKF A;  1AUC A;  3F9U A;  2LJR A;  2XBI A;  1AQX A;  2F51 A;  4OCE A;  3FY7 A;  1SK1 A;  1Z9H A;  3TOT A;  2GTU A;  1XWB A;  3GNJ A;  3VPQ A;  4L0U A;  1GP1 A;  1C72 A;  3TGZ A;  3TJG A;  3HXS A;  1GSD A;  2WUL A;  3DVX A;  3QFB C;  1FG4 A;  4TR4 A;  2LQQ A;  4NHW A;  4I2T A;  3KTB A;  2CVD A;  3JCM L;  5CAX A;  3MWH A;  2K9F A;  3GX0 A;  1QQ2 A;  1PQN A;  2I1U A;  4EVM A;  3APS A;  4TXO B;  5KN3 A;  5FWG A;  3R2Q A;  3TJB A;  1YEP A;  1YKC A;  4BWQ A;  1PX7 A;  2L4Q A;  3UVT A;  3ZMK A;  4K5S A;  1K0A A;  1GNE A;  1FW1 A;  1V58 A;  3ZZX A;  1S3R A;  4K7N A;  2HRF A;  2R37 A;  3IHQ A;  4QQ7 A;  1EOH A;  1YY7 A;  3LXT A;  3CQF A;  2LTK A;  2MMZ A;  2LUS A;  2IJY A;  4KH7 A;  2WCI A;  4WR5 A;  1A8L A;  3GKK A;  3ZL5 A;  5JWO B;  3HJO A;  1EP8 A;  1T1V A;  3ZYW A;  3GN3 A;  1MD4 A;  4IKH A;  4WR4 A;  2O8V B;  4TW5 A;  4V2N A;  1VGL A;  4TR0 A;  4RQR A;  2BJX A;  4RQX A;  3U5R E;  5IMZ A;  5JWR B;  1S3C A;  1WMJ A;  4EDZ A;  4I2U A;  1N2A A;  3H4K A;  1SD9 A;  4MJB A;  4XRD A;  1TKD B;  1PA3 A;  2LRT A;  2H1A A;  3E0U A;  4Q5R A;  2YWO A;  5EPF A;  3UEM A;  2OE0 A;  1F9M A;  3Q18 A;  18GS A;  5G1K A;  2R2J A;  1XWK A;  4G9H A;  1EV4 A;  2B1K A;  2EC4 A;  2H30 A;  4JRR A;  3ERF A;  2HSY A;  2I3Y A;  2JAC A;  4BPY A;  1S3A A;  2F9S A;  5KOX A;  5DJM A;  3TDG A;  2CVB A;  1GTB A;  3RPP A;  3UAR A;  4YAV A;  2HI7 A;  1GSQ A;  1RQM A;  1F3A A;  1TI1 A;  2FUG 2;  4KGI A;  5B8B A;  4HOJ A;  4POK A;  3DKS A;  1M7T A;  1FB6 A;  4K7I A;  5J41 A;  3TRP A;  4QL7 A;  3IRA A;  3E3E A;  1SJI A;  3C1R A;  4BWS A;  5DJL A;  2VL9 A;  3D4T A;  2CZ3 A;  1AC1 A;  3KTL A;  3Q19 A;  3EE2 A;  4I8B A;  4QL9 A;  2C1Y A;  4JBB A;  5E4W A;  1GWC A;  1GLQ A;  2X8G A;  3GFK A;  2NDO A;  1OC9 B;  2H0H A;  1ABA A;  3PGT A;  1X9M B;  1PL1 A;  4CY8 A;  1K0N A;  2XPD A;  3QOU A;  2DIY A;  1X5D A;  2I81 A;  1TRW A;  1TXX A;  3ERW A;  2YWM A;  2FGX A;  2REM A;  4K8M A;  2DKI A;  3WGX A;  1BAY A;  4CY6 A;  5CRD A;  5IIZ A;  3ZIV A;  2HRK A;  2YZU A;  1WPI A;  2MYG A;  5HQP A;  3KH9 A;  1EP7 A;  3BCI A;  1E6B A;  3UMA A;  1M9B A;  1A2L A;  2RM5 A;  4OO5 A;  4EE0 A;  2H70 A;  2DLX A;  1T7P B;  4OD7 A;  3DEX A;  5B7C A;  1EEM A;  5ECK B;  3QAG A;  5JWQ B;  3S9F A;  2VLT A;  4E8H A;  3ZVJ A;  2VCW A;  3UVH A;  4GXZ A;  2LKU A;  5IOX A;  3UBL A;  3W6G A;  1TU8 A;  4IS0 A;  3L78 A;  3ZRE A;  2G2Q A;  1HNB A;  1T8E B;  1R26 A;  1WOU A;  5J5N A;  4Q5N A;  1VF3 A;  1ZYP A;  4ZBB A;  3FZA A;  4GWR A;  3GL5 A;  4KB3 A;  4Q5F A;  4IEL A;  1W4V A;  1ZOF A;  3BD2 A;  3UL3 A;  3TRX A;  1GSU A;  1DE2 A;  4XS1 A;  12GS A;  4N0V A;  3CTF A;  3NIV A;  2VLU A;  3TKP A;  4OWY A;  2YPM A;  4LA1 A;  2DC5 A;  2H0G A;  2OJL A;  2ZNM A;  3C71 A;  4MDC A;  3PR8 A;  3QR6 A;  5J9C A;  3GKN A;  2F8F A;  2H1G A;  6GSS A;  3F4T A;  2XC2 A;  2H01 A;  4N0Z A;  4ZL9 A;  1TU7 A;  4D73 A;  4LMW A;  2AV4 A;  2YZH A;  1EGO A;  1THX A;  2JSZ A;  3VFI A;  4G19 A;  1GSF A;  1DSB A;  2RII A;  3ZFB A;  4PUR A;  3FYG A;  3IK9 A;  4EIQ A;  3IPZ A;  3MIX A;  4YQV A;  3J7Y b;  1K3L A;  1GTI A;  5A5K A;  4F9Z A;  1O8X A;  2EIQ A;  1LBK A;  1XW5 A;  2R0G A;  2AUV A;  1JLV A;  3MAK A;  2L59 A;  2CT6 A;  2ES7 A;  2H74 A;  3U6V A;  3TKR A;  2FCH A;  1ZZY A;  1GUM A;  1OE7 A;  2F8A A;  5J3R A;  4D73 B;  2GQL A;  1W89 A;  1ZMA A;  4IJI A;  2HT9 A;  4XS4 A;  3HA9 A;  4DSS A;  2AYT A;  2GZY A;  3CSJ A;  1MDI A;  1V40 A;  3WT2 A;  1TDI A;  4Z2R A;  2OBI A;  2B7J A;  3DWV A;  3TJK A;  3ZIT A;  5ECQ B;  4P3Y B;  2IL3 A;  2JAD A;  4HDE A;  1ZL9 A;  2L5L A;  4KAE A;  1LJR A;  4V2M A;  1I5G A;  2AAW A;  3A2V A;  1USB A;  3TB2 A;  2ZCT A;  3LW9 A;  2IMI A;  2DJ1 A;  4JE1 A;  2A4V A;  5EL8 A;  3P90 A;  2L4C A;  2C0E A;  2KHP A;  4XS4 B;  5ECI B;  4DSS B;  1FVJ A;  1URM A;  2HXK A;  4HU7 A;  4IHU A;  3A2W A;  6GSX A;  1YZX A;  2HSM A;  1EZK A;  1XCC A;  2YV7 A;  3KCM A;  4ILF A;  3I69 A;  5EVO A;  4LMV A;  3CTG A;  2FY6 A;  4FH8 A;  5KN0 A;  3IR4 A;  1U88 A;  3BBY A;  2GT6 A;  1Z6N A;  1PGT A;  1B4Q A;  2FNO A;  1EV9 A;  4HZ2 A;  3F63 A;  3KXO A;  2AJQ B;  2I4A A;  3CXG A;  2XBQ A;  2DIZ A;  5G5E A;  2DML A;  1KBN A;  2QSI A;  4KSO A;  2V1M A;  5HR2 A;  4LL1 B;  1GSS A;  3LEF A;  3ERG A;  4ZB8 A;  1ZGN A;  4EIP A;  1A0F A;  4ECB A;  1CQG A;  1ZYN A;  2GT5 A;  1GUH A;  1YJ6 A;  2LV3 A;  2LJA A;  4HUA A;  1QK8 A;  1PKW A;  2VCQ A;  3CYN A;  5DVB A;  4YH2 A;  9GSS A;  1WWJ A;  1SK0 A;  1S3D A;  5ECO B;  3GSS A;  4XIH A;  2X99 A;  2IPA A;  1VF2 A;  2TRC P;  4ISD A;  4F03 A;  2IMK A;  5DCH A;  4KW6 A;  1YQ1 A;  2R0C A;  4Z2T A;  3M3M A;  2C8U A;  5GAP D;  4PQI A;  3EPT A;  2Z9S A; 
#chains in the Genus database with same CATH homology
 2GS3 A;  2N5A A;  3DGQ A;  2H72 A;  2H6Y A;  1NHY A;  2J23 A;  4KSM A;  2DJJ A;  2C4J A;  8GSS A;  3M9K A;  3BOA A;  3IBH A;  4IP1 A;  3KZQ A;  2R4V A;  1TP9 A;  2LNS A;  2C3Q A;  1UA5 A;  3VWW A;  17GS A;  1HQO A;  3GYK A;  5H5R A;  1R4W A;  4USS A;  4LL4 B;  3HY2 A;  2LQO A;  1XOA A;  1TTZ A;  1ACV A;  3K8N A;  2A2S A;  1Z3E A;  2VL2 C;  3VI7 A;  3VI5 A;  3TKS A;  1KTE A;  2FA4 A;  14GS A;  4KX4 A;  5CRH A;  3M0F A;  1PL2 A;  1AW9 A;  1ML6 A;  2HSH A;  3I6A A;  4IP6 A;  4MZC A;  3HZ4 A;  2HFD A;  3G7I A;  2OKA A;  1XWC A;  2HLS A;  2GSQ A;  2X49 A;  1O7U A;  3ZVJ D;  2WB9 A;  2J9H A;  3VWX A;  1MTC A;  3GL3 A;  3L9U A;  3LYP A;  2IME A;  5KN2 A;  5F8B A;  2FWG A;  2OAC A;  3LOR A;  4XCS A;  4Z2U A;  2GSR A;  4RI6 A;  1G0T A;  4POB A;  1U6T A;  4ZIJ A;  5D9V A;  5GSS A;  1XPV A;  2O89 A;  1MEK A;  5A4W A;  4K0G A;  1GSY A;  4E8E A;  4I5Q A;  1VF4 A;  3HYP A;  2WJU A;  3D22 A;  2H71 A;  1ZYE A;  4X43 A;  5ELA A;  2L57 A;  2FWF A;  4DEJ A;  3DVW A;  2L5O A;  2CAI A;  3ISO A;  5DCG A;  3VWU A;  4K5R A;  4PUF C;  2B3S A;  2M80 A;  3UIW A;  4XTS A;  3RBT A;  1Y6E A;  1K0M A;  4X4J A;  2V32 A;  1YDK A;  4OO4 A;  5CRE A;  2K6V A;  2VCZ A;  4MLY A;  1BG5 A;  3AY8 A;  3UBK A;  3LQ7 A;  3QFA C;  4OMV A;  4O7H A;  2GZP A;  4KDY A;  4ML1 A;  5CO3 A;  3CRU A;  2DJ0 A;  4GF0 A;  3UJ1 A;  5D93 A;  3VPT A;  2CAQ A;  2A2P A;  2R6K A;  1EWX A;  3C7M A;  4ICY A;  4KUN A;  3RHC A;  3FZ9 A;  4MA9 A;  2YNX A;  3FR3 A;  3MSZ A;  4MZB A;  4EO3 A;  1M0U A;  3ZTL A;  1K0B A;  3QAV A;  2AB6 A;  4ML6 A;  4ZL8 A;  4HQS A;  1RW1 A;  1WE0 A;  3G7Y A;  4RI7 A;  3HJP A;  4AGS A;  4MF5 A;  11GS A;  1OC9 A;  5EY6 A;  3D4M A;  4MMM A;  1AIU A;  4KCE A;  2GGT A;  3V1W A;  2GQK A;  4O32 A;  4O92 A;  2YOI A;  2JZS A;  2WS2 A;  1M2A A;  5IO0 A;  1YF1 A;  3PIN A;  2JZR A;  20GS A;  2CA8 A;  5KOW A;  2H76 A;  2R3X A;  3PH9 A;  5COH A;  3ED3 A;  5H5S A;  4PX1 A;  4PNG A;  1XIY A;  3NOF A;  4J57 E;  1GTA A;  5D96 A;  3HKR A;  1EOG A;  2V6K A;  1K0O A;  3VK9 A;  3FZ4 A;  1EEJ A;  5DQS A;  1U3I A;  1KEB A;  3MYD A;  3PPU A;  2LRC A;  3IV4 A;  2CX4 A;  4NWY A;  4ZXG A;  2D2Z A;  1MD3 A;  3APO A;  5JCG A;  2MBT A;  1XOB A;  3EC3 A;  4I6X A;  4O5R A;  2O85 A;  2L6D A;  2DJ2 A;  4GRF A;  1OAZ A;  4H86 A;  1SKW B;  3EYT A;  4YAP A;  4V2L A;  1J0F A;  3QPM A;  2IFQ A;  2DJK A;  4GSN A;  1GLP A;  4NMU A;  2P5Q A;  5F06 A;  4IBP A;  4FYC A;  1NM3 A;  3GKM A;  5DDL A;  4WF5 A;  4AJ8 A;  1A0R P;  3RDW A;  1X9S B;  3EIN A;  2IMD A;  4Z7X A;  3DIE A;  1SYR A;  4HQZ A;  2WFC A;  2JL4 A;  2E2M A;  1FAA A;  3FR9 A;  4YQM A;  7GSS A;  1F3B A;  2H66 A;  3WD6 A;  1K3Y A;  1BJX A;  1SKR B;  1ERU A;  1K0C A;  1N8J A;  3G7J A;  3TCO A;  2LRN A;  3KIJ A;  3DXB A;  3Q6O A;  4ZBA A;  4J2F A;  2IFQ B;  3M9J A;  3ME7 A;  2NPB A;  2FD3 A;  3O3T A;  1JZO A;  2YV9 A;  2C0F A;  2MBS A;  2QKE A;  3LWA A;  4KE3 A;  4K6X A;  2OAD A;  2CV4 A;  1SYX A;  2WZ9 A;  1KNG A;  4KA0 A;  4WKW A;  3DRN A;  5HR1 A;  3GKX A;  1JZR A;  3FMW A;  1FB0 A;  2IIY A;  1JZW A;  2GDR A;  4TVE A;  4FO5 A;  4NV2 A;  4X1U A;  4HS1 A;  1HYU A;  1X5C A;  1AAZ A;  3KEB A;  1XVW A;  2KP2 A;  3KP8 A;  2FWE A;  4HI7 A;  4MJC A;  2C3T A;  2PMT A;  4K2X A;  1A24 A;  2FA8 A;  2OBK A;  2YJH A;  2L6C A;  5IMD A;  1JFU A;  5GZZ B;  4G0L A;  1EGR A;  2LEG A;  4V1A g;  1R7H A;  3TRQ A;  1YF0 A;  1PMT A;  5IPH A;  3EMP A;  5ECR B;  1QGV A;  1A2M A;  2E7P A;  1X0R A;  3D21 A;  5ECN B;  4IQ1 A;  4JU5 A;  1DBY A;  2KOK A;  1IYI A;  4TOP A;  4OFM A;  2PVO C;  1ERW A;  1M2D A;  4N11 A;  4EL1 A;  3M1G A;  5CP1 A;  5CYY A;  2EIO A;  1OE8 A;  2HYX A;  4JED A;  4EDY A;  4G0K A;  4IVF A;  2VUP A;  3ZIJ A;  1G7O A;  3L9S A;  3GUS A;  4EXJ A;  5IM9 A;  1GH2 A;  2CZ2 A;  4EF0 A;  4WF4 A;  1Z7R A;  4POL A;  3FRC A;  2H6Z A;  4G2E A;  5C00 A;  2JZT A;  3KGK A;  2V2G A;  2LNT A;  5B6N A;  3VLN A;  3NZN A;  3TKS E;  2RUF A;  3R3E A;  3OR5 A;  2C3N A;  1BED A;  2H1D A;  2CQ9 A;  5HR0 A;  5HFI A;  4MH3 A;  1PSQ A;  5CRW A;  2MMO A;  3HVS A;  3KMO A;  2G0F A;  2ON5 A;  3H93 A;  1UN2 A;  3O6T A;  3C1S A;  3IAS 2;  1OKT A;  2PPT A;  4IGJ A;  1T00 A;  3EVI A;  1SL1 B;  3LFL A;  3WGE A;  1SJ6 A;  2H75 A;  4CW9 A;  2E2G A;  3QDN A;  1SK2 A;  3ME8 A;  4AJ6 A;  5KEJ A;  1F37 A;  1HNC A;  3A5I A;  2KLX A;  2GZZ A;  3TJJ A;  2YAN A;  3D5J A;  4F0B A;  1SEN A;  2H73 A;  4ULX A;  4PXO A;  1J9B A;  2NTO A;  1H4O A;  3EUR A;  5ECS A;  3TOU A;  3UAP A;  1TK0 B;  2NVL A;  2I9H A;  4I97 A;  2LS5 A;  1M2B A;  1V9W A;  2N5B A;  4MAB A;  1WP0 A;  3SWL A;  2H1B A;  1XW6 A;  3GUR A;  2TRX A;  2XPE A;  2N5F A;  3J7Y k;  3A5W A;  2GSS A;  1XFL A;  5AN1 A;  4TKY A;  3DYR A;  2FLS A;  3GTU A;  1NSW A;  4POM A;  1M9A A;  5E59 A;  1FOH A;  4MK3 A;  1Q98 A;  5A4V A;  2F3M A;  1WRY A;  1WJK A;  3DD3 A;  3F0I A;  1XWA A;  4MF6 A;  2V6O A;  1GTU A;  1SL0 B;  3KP9 A;  3IAM 2;  4HEA 2;  1O8W A;  2K8S A;  3EU3 A;  2WDU A;  1DE1 A;  4ZIL A;  2GST A;  3HDC A;  3MDK A;  2YWI A;  6GST A;  1XXU A;  2M46 A;  13GS A;  2X4A A;  3LSZ A;  1B4P A;  3GTU B;  5D9W A;  2VO4 A;  2VCT A;  1TI3 A;  2B1L A;  2VCX A;  3EWL A;  2H0I A;  5JCU A;  4GQF A;  3C8E A;  5INY A;  4MJE A;  3KH7 A;  5IMV A;  3HHV A;  1TRU A;  2GVP A;  1XWG A;  1JHB A;  3DML A;  1A23 A;  2H19 A;  4K7O A;  4KND A;  2YP6 A;  2KP1 A;  4ZB6 A;  1O6J A;  3IE3 A;  3GH6 A;  3IXR A;  1V98 A;  5HFK A;  4DVC A;  3F3R A;  3FK8 A;  3HVX A;  3GA4 A;  2VCV A;  3CSH A;  4TR1 A;  4BVX A;  3HZ8 A;  3TKS C;  4L8E A;  1ON4 A;  3ZLP A;  2EIR A;  4AF2 A;  1SU9 A;  4CDO A;  4MNN A;  2HE3 A;  3L4N A;  4ZBD A;  4HJ2 A;  4KDX A;  2YJ7 A;  3CSI A;  4MCU A;  2PWJ A;  1T3B A;  2A4H A;  3HCZ A;  3QCP A;  5ECM B;  2QA1 A;  1MDK A;  2C0G A;  3N5O A;  4L5L A;  2VAF A;  4TRX A;  4ECC A;  5ELG A;  1THO A;  6GSU A;  22GS A;  3FZ5 A;  3TUE A;  3A2X A;  1PX6 A;  1B9X C;  2UZ8 A;  3GIX A;  1TW9 A;  5ECH B;  1K3O A;  4TR1 B;  4BVX B;  3P2A A;  2K18 A;  2OA7 A;  3H1N A;  1B48 A;  3HJM A;  4WET A;  3LYK A;  2X8C A;  3IK7 A;  3L9V A;  5ECP B;  1X9W B;  1PRX A;  1Z7P A;  3FW2 A;  3Q74 A;  1G6Y A;  5IO2 A;  2YWN A;  4PQH A;  5AIV A;  1SJZ A;  2A2R A;  4MH2 A;  4YKF A;  3ZRD A;  1XZO A;  4IN0 A;  4KDU A;  1FVK A;  1IYH A;  4PQ1 A;  6GSV A;  1ZYQ B;  2K8V A;  4NAX A;  5BMU A;  1U3A A;  1A2J A;  1ST9 A;  1TK5 B;  5F07 A;  3FEU A;  2PER A;  5LNK e;  4WBR D;  2RUE A;  4K9Z A;  1Z6M A;  1XW9 A;  3GHA A;  1GRX A;  4MJA A;  3M8N A;  1E2Y A;  2PN8 A;  2O87 A;  1HD2 A;  3F4S A;  5IMC A;  4FYB A;  1AQW A;  4K0N A;  1PKZ A;  1R5A A;  3I43 A;  5GST A;  4F82 A;  3C73 A;  2CVK A;  4A5P A;  4XS6 A;  19GS A;  1F6M C;  4N10 A;  3F6F A;  2HNL A;  3E9J B;  5DBQ A;  1ILO A;  1BQ7 A;  3CBU A;  3IC8 A;  2YCD A;  5FT3 A;  2IN3 A;  4WEY A;  4TXV A;  3US3 A;  1YEX A;  2BTO T;  1BX9 A;  1QUW A;  4G0I A;  2WGR A;  1TRS A;  1T4Y A;  3WT1 A;  3LGC A;  5CRG A;  1XVQ A;  1AQV A;  2C0D A;  2OE3 A;  4PTS A;  4HJM A;  3KD0 A;  5FHI A;  1O85 A;  1Z5Y E;  1BYE A;  4MPG A;  2R0P A;  3L0H A;  4ECJ A;  2JSY A;  3IC4 A;  4KCA A;  4JR6 A;  3WYW A;  3H79 A;  5IMA A;  2JU5 A;  5CNW A;  5HFG A;  6GSY A;  5ECL B;  5D9X A;  3RPN A;  3IDV A;  3I9V 2;  4HU9 A;  1QMV A;  2P31 A;  1GUK A;  4TR3 A;  3RHB A;  5J9B A;  4RUV A;  2H8L A;  2P5R A;  4PGT A;  4GCI A;  5IQY A;  1SD8 A;  1GSE A;  4O5U A;  2LJK A;  4ECI A;  1OKD A;  3EMX A;  5AIX A;  1K0D A;  4CHS A;  1VF1 A;  2PBJ A;  2QA2 A;  4AJ7 A;  3QAW A;  3MNG A;  3ZFL A;  1TJD A;  2V41 A;  3FR6 A;  1RK4 A;  2HZE A;  1JZD A;  4GSS A;  2E0Q A;  5F05 A;  5LCZ A;  1R5P A;  2QC7 A;  3KMN A;  5HR3 A;  2PGT A;  1I9D A;  3W8J A;  2O7K A;  4ZB9 A;  5ID2 A;  4IW9 A;  4XRA A;  2C80 A;  2H6X A;  3GX8 A;  2GQM A;  3N9J A;  3IA1 A;  2VD0 A;  3EU4 A;  3IHG A;  2NBS A;  2B7K A;  1PN9 A;  4PUA A;  5BRT A;  3P7X A;  2HZE B;  3CMI A;  3ZML A;  5ABR A;  4JZQ A;  4ZL7 A;  1WIK A;  1AXD A;  2VOC A;  5IOW A;  1FHE A;  4NHZ A;  3TKQ A;  1OVN A;  2M72 A;  4OFN A;  4BL7 A;  4FIW A;  4EUY A;  3APQ A;  5ID2 B;  2VM1 A;  4GQC A;  5B8A A;  2VLV A;  3G9B A;  1J08 A;  1HNA A;  4NPB A;  3CRT A;  1TK8 B;  4DSQ A;  3BJ5 A;  1PD2 1;  4PNF A;  5D73 A;  1OC3 A;  3A3T A;  4EC0 A;  4LLR A;  4Q5Q A;  3F3Q A;  2OE1 A;  2FHE A;  1Y25 A;  2DMM A;  2DSA A;  2PU9 C;  4HZ4 A;  4N30 A;  10GS A;  4K1F A;  1FO5 A;  4BL7 B;  3GRX A;  2CX3 A;  3P8W A;  5D9T A;  16GS A;  3F6D A;  4EKZ A;  3F4R A;  4X0X A;  4F2I A;  2MZC A;  4K2D A;  4O5Q A;  5IMF A;  3TJF A;  1TOF A;  3SBC A;  5J4U A;  3W8S A;  2ALB A;  1GNW A;  4YKG A;  4MPF A;  2GLR A;  3WGD A;  1YKA A;  2IWT A;  3GMF A;  2DBC A;  4XHM A;  4NXI A;  3IOS A;  1PN0 A;  1A8Y A;  1T4Z A;  5B6M A;  4YQU A;  1FOV A;  3D6I A;  3UOM A;  4J56 E;  2YN1 A;  2PUK C;  2IMF A;  3QMX A;  4WBJ A;  1H75 A;  2QGV A;  4ID0 A;  3HVV A;  1V57 A;  1V2A A;  2AHE A;  4V1A p;  3D0Z A;  6GSW A;  2HRN A;  1VRS D;  5G1L A;  2HRA A;  2B5X A;  1LU4 A;  3LXZ A;  1UVZ A;  5DAL A;  1GUL A;  1O73 A;  3LJR A;  4IJ3 A;  4GTU A;  5DQY A;  4MP4 A;  5G2Z A;  3KM6 A;  2HZF A;  4L5O A;  3F8U A;  1CQH A;  3GV1 A;  2XHF A;  1U87 A;  5AGY A;  3FHK A;  2TIR A;  2DKH A;  2VM2 A;  2X8H A;  4GLT A;  4OCF A;  4OFT A;  4WXT A;  4DSR A;  1NW2 A;  5A4U A;  3KJY A;  1G6W A;  4L0W A;  5GAN D;  5DAK A;  1F2E A;  5KN1 A;  1ERT A;  2P0G A;  4MF7 A;  2DJ3 A;  4F0C A;  5DAL B;  5G30 A;  3GH9 A;  1MDJ A;  2B6M A;  2PVQ A;  2WRT A;  1GL8 A;  3HD5 A;  1B8X A;  5F0G A;  2VL3 A;  2RLI A;  2VL2 A;  2VIM A;  1QXH A;  1XBS A;  1OYJ A;  2FWH A;  5LD0 A;  4JR4 A;  1ERV A;  1B9Y C;  4BA7 A;  1SL2 B;  4GST A;  3O76 A;  4IQA A;  1SKS B;  1O81 A;  4TN8 A;  3RAZ A;  2ZUP A;  1Q4J A;  4NV5 A;  2ON7 A;  2KUC A;  2MMA A;  5H5Q A;  2RM6 A;  5G31 A;  4G10 A;  5DAK B;  2X64 A;  4BVY A;  1NHO A;  1ZCP A;  4FYU A;  1M99 A;  2B5Y A;  3BCK A;  4ACS A;  3GST A;  1DUG A;  5C04 A;  1G7E A;  1JLW A;  2MMN A;  2B5E A;  3LG6 A;  3VWV A;  1TRV A;  5G5F A;  1OC8 A;  4MZW A;  5ENU A;  3H8Q A;  5AIS A;  4KF9 A;  1X5E A;  1QFN A;  3VUR A;  1UC7 A;  4FQU A;  5IPG A;  5JCW A;  2VD1 A;  5D8I A;  2LST A;  2R5G A;  3QD9 A;  5L71 A;  2BMX A;  4TXO A;  4BVY B;  3FKF A;  1AUC A;  3F9U A;  2LJR A;  2XBI A;  1AQX A;  2F51 A;  4OCE A;  3FY7 A;  1SK1 A;  1Z9H A;  3TOT A;  2GTU A;  1XWB A;  3GNJ A;  3VPQ A;  4L0U A;  1GP1 A;  1C72 A;  3TGZ A;  3TJG A;  3HXS A;  1GSD A;  2WUL A;  3DVX A;  3QFB C;  1FG4 A;  4TR4 A;  2LQQ A;  4NHW A;  4I2T A;  3KTB A;  2CVD A;  3JCM L;  5CAX A;  3MWH A;  2K9F A;  3GX0 A;  1QQ2 A;  1PQN A;  2I1U A;  4EVM A;  3APS A;  4TXO B;  5KN3 A;  5FWG A;  3R2Q A;  3TJB A;  1YEP A;  1YKC A;  4BWQ A;  1PX7 A;  2L4Q A;  3UVT A;  3ZMK A;  4K5S A;  1K0A A;  1GNE A;  1FW1 A;  1V58 A;  3ZZX A;  4K7N A;  2HRF A;  2R37 A;  3IHQ A;  4QQ7 A;  1EOH A;  1YY7 A;  3LXT A;  2LTK A;  2MMZ A;  2LUS A;  2IJY A;  4KH7 A;  2WCI A;  4WR5 A;  1A8L A;  3GKK A;  3ZL5 A;  5JWO B;  3HJO A;  1EP8 A;  1T1V A;  3ZYW A;  3GN3 A;  1MD4 A;  4IKH A;  4WR4 A;  2O8V B;  4TW5 A;  4V2N A;  1VGL A;  4TR0 A;  4RQR A;  2BJX A;  4RQX A;  3U5R E;  5IMZ A;  5JWR B;  1S3C A;  1WMJ A;  4EDZ A;  4I2U A;  1N2A A;  3H4K A;  1SD9 A;  4MJB A;  4XRD A;  1TKD B;  1PA3 A;  2LRT A;  2H1A A;  3E0U A;  4Q5R A;  2YWO A;  5EPF A;  3UEM A;  2OE0 A;  1F9M A;  3Q18 A;  18GS A;  5G1K A;  2R2J A;  1XWK A;  4G9H A;  1EV4 A;  2B1K A;  2EC4 A;  2H30 A;  4JRR A;  3ERF A;  2HSY A;  2I3Y A;  2JAC A;  4BPY A;  1S3A A;  2F9S A;  5KOX A;  5DJM A;  3TDG A;  2CVB A;  1GTB A;  3RPP A;  3UAR A;  4YAV A;  2HI7 A;  1GSQ A;  1RQM A;  1F3A A;  1TI1 A;  2FUG 2;  4KGI A;  5B8B A;  4HOJ A;  4POK A;  3DKS A;  1M7T A;  1FB6 A;  4K7I A;  5J41 A;  3TRP A;  4QL7 A;  3IRA A;  3E3E A;  1SJI A;  3C1R A;  4BWS A;  5DJL A;  2VL9 A;  3D4T A;  2CZ3 A;  1AC1 A;  3KTL A;  3Q19 A;  3EE2 A;  4I8B A;  4QL9 A;  2C1Y A;  4JBB A;  5E4W A;  1GWC A;  1GLQ A;  2X8G A;  3GFK A;  2NDO A;  1OC9 B;  2H0H A;  1ABA A;  3PGT A;  1X9M B;  1PL1 A;  4CY8 A;  1K0N A;  2XPD A;  3QOU A;  2DIY A;  1X5D A;  2I81 A;  1TRW A;  1TXX A;  3ERW A;  2YWM A;  2FGX A;  2REM A;  4K8M A;  2DKI A;  3WGX A;  1BAY A;  4CY6 A;  5CRD A;  5IIZ A;  3ZIV A;  2HRK A;  2YZU A;  1WPI A;  2MYG A;  5HQP A;  3KH9 A;  1EP7 A;  3BCI A;  1E6B A;  3UMA A;  1M9B A;  1A2L A;  2RM5 A;  4OO5 A;  4EE0 A;  2H70 A;  2DLX A;  1T7P B;  4OD7 A;  3DEX A;  5B7C A;  1EEM A;  5ECK B;  3QAG A;  5JWQ B;  3S9F A;  2VLT A;  4E8H A;  3ZVJ A;  2VCW A;  3UVH A;  4GXZ A;  2LKU A;  5IOX A;  3UBL A;  3W6G A;  1TU8 A;  4IS0 A;  3L78 A;  3ZRE A;  2G2Q A;  1HNB A;  1T8E B;  1R26 A;  1WOU A;  5J5N A;  4Q5N A;  1VF3 A;  1ZYP A;  4ZBB A;  3FZA A;  4GWR A;  3GL5 A;  4KB3 A;  4Q5F A;  4IEL A;  1W4V A;  1ZOF A;  3BD2 A;  3UL3 A;  3TRX A;  1GSU A;  1DE2 A;  4XS1 A;  12GS A;  4N0V A;  3CTF A;  3NIV A;  2VLU A;  3TKP A;  4OWY A;  2YPM A;  4LA1 A;  2DC5 A;  2H0G A;  2OJL A;  2ZNM A;  3C71 A;  4MDC A;  3PR8 A;  3QR6 A;  5J9C A;  3GKN A;  2F8F A;  2H1G A;  6GSS A;  3F4T A;  2XC2 A;  2H01 A;  4N0Z A;  4ZL9 A;  1TU7 A;  4D73 A;  4LMW A;  2AV4 A;  2YZH A;  1EGO A;  1THX A;  2JSZ A;  3VFI A;  4G19 A;  1GSF A;  1DSB A;  2RII A;  3ZFB A;  4PUR A;  3FYG A;  3IK9 A;  4EIQ A;  3IPZ A;  3MIX A;  4YQV A;  3J7Y b;  1K3L A;  1GTI A;  5A5K A;  4F9Z A;  1O8X A;  2EIQ A;  1LBK A;  1XW5 A;  2R0G A;  2AUV A;  1JLV A;  3MAK A;  2L59 A;  2CT6 A;  2ES7 A;  2H74 A;  3U6V A;  3TKR A;  2FCH A;  1ZZY A;  1GUM A;  1OE7 A;  2F8A A;  5J3R A;  4D73 B;  2GQL A;  1W89 A;  1ZMA A;  4IJI A;  2HT9 A;  4XS4 A;  3HA9 A;  4DSS A;  2AYT A;  2GZY A;  3CSJ A;  1MDI A;  1V40 A;  3WT2 A;  1TDI A;  4Z2R A;  2OBI A;  2B7J A;  3DWV A;  3TJK A;  3ZIT A;  5ECQ B;  4P3Y B;  2IL3 A;  2JAD A;  4HDE A;  1ZL9 A;  2L5L A;  4KAE A;  1LJR A;  4V2M A;  1I5G A;  2AAW A;  3A2V A;  1USB A;  3TB2 A;  2ZCT A;  3LW9 A;  2IMI A;  2DJ1 A;  4JE1 A;  2A4V A;  5EL8 A;  3P90 A;  2L4C A;  2C0E A;  2KHP A;  4XS4 B;  5ECI B;  4DSS B;  1FVJ A;  1URM A;  2HXK A;  4HU7 A;  4IHU A;  3A2W A;  6GSX A;  1YZX A;  2HSM A;  1EZK A;  1XCC A;  2YV7 A;  3KCM A;  4ILF A;  3I69 A;  5EVO A;  4LMV A;  3CTG A;  2FY6 A;  4FH8 A;  5KN0 A;  3IR4 A;  1U88 A;  3BBY A;  2GT6 A;  1Z6N A;  1PGT A;  1B4Q A;  2FNO A;  1EV9 A;  4HZ2 A;  3F63 A;  3KXO A;  2AJQ B;  2I4A A;  3CXG A;  2XBQ A;  2DIZ A;  5G5E A;  2DML A;  1KBN A;  2QSI A;  4KSO A;  2V1M A;  5HR2 A;  4LL1 B;  1GSS A;  3LEF A;  3ERG A;  4ZB8 A;  1ZGN A;  4EIP A;  1A0F A;  4ECB A;  1CQG A;  1ZYN A;  2GT5 A;  1GUH A;  1YJ6 A;  2LV3 A;  2LJA A;  4HUA A;  1QK8 A;  1PKW A;  2VCQ A;  3CYN A;  5DVB A;  4YH2 A;  9GSS A;  1WWJ A;  1SK0 A;  1S3D A;  5ECO B;  3GSS A;  4XIH A;  2X99 A;  2IPA A;  1VF2 A;  2TRC P;  4ISD A;  4F03 A;  2IMK A;  5DCH A;  4KW6 A;  1YQ1 A;  2R0C A;  4Z2T A;  3M3M A;  2C8U A;  5GAP D;  4PQI A;  3EPT A;  2Z9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...