3LORA

The crystal structure of a thiol-disulfide isomerase from corynebacterium glutamicum to 2.2a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
154
structure length
154
Chain Sequence
LDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFEHHDVMTPEALKVFIDEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLSET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide isomerase and thioredoxins
publication title The Crystal Structure of a Thiol-disulfide Isomerase from Corynebacterium glutamicum to 2.2A
rcsb
source organism Corynebacterium glutamicum
molecule tags Isomerase
total genus 42
structure length 154
sequence length 154
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lorA00
6GSVA 3KP9A 3K8NA 7GSSA 2H1AA 3ZVJA 1FB0A 5AISA 2OACA 1G0TA 1R4WA 3ZMLA 2ZCTA 4KDYA 1BAYA 4HU7A 2CVDA 1WMJA 1MEKA 1ML6A 5J4UA 4ECBA 1FVJA 2DJ3A 2PGTA 2AUVA 4IJ3A 2TIRA 4Q5RA 1GSFA 3IA1A 1Z6NA 4EF0A 1A2LA 1EV9A 1ERVA 4FH8A 4ZXGA 3TKRA 3WGEA 3LXZA 2R37A 4KE3A 4N0ZA 1CQHA 1ABAA 2YCDA 4H86A 2WZ9A 3MSZA 2HRFA 1MDIA 3EINA 2DC5A 1ZGNA 4MA9A 2PWJA 3MDKA 4J2FA 4MMMA 4HU9A 3FHKA 2I4AA 3VWUA 1OC9A 2FWFA 1UN2A 2VCVA 2JZRA 2PBJA 6GSUA 4YAPA 1S3CA 1M9AA 4POMA 2B1KA 1X9WB 3IXRA 4MABA 5B6MA 3IOSA 3BCKA 2VCZA 3D4MA 4XS6A 1TU7A 4XTSA 4RQRA 3M9KA 3GSSA 3ZVJD 2HE3A 2YZHA 4KCAA 1VF3A 3LGCA 1GLPA 2GT6A 3VWWA 1WPIA 4HQSA 1K3YA 2KP1A 5CP1A 5D9VA 1PSQA 2C0EA 3RAZA 3GYKA 3W8SA 4KX4A 1XFLA 5ECOB 4EVMA 4IP1A 3D21A 5IO0A 11GSA 1FW1A 2C0GA 5AIXA 1UA5A 3RPNA 5L71A 4DVCA 3FK8A 4PQHA 4PXOA 2MZCA 2H1DA 2CX4A 5GAPD 2AYTA 5B6NA 3NIVA 4X1UA 2LNSA 5F06A 3GTUB 2PMTA 4MPGA 2LNTA 3E0UA 5IMCA 2H1BA 2P0GA 6GSSA 2LV3A 1T00A 4GTUA 1K0AA 1ZYEA 1PL1A 3LWAA 2E2MA 4ZB9A 4K7NA 4MCUA 2DJJA 1O85A 4TXVA 4DEJA 5AIVA 5JWOB 2IFQB 5FWGA 2FNOA 2X8GA 5G30A 3QD9A 2XBIA 1GUHA 5IMVA 2B5YA 5A5KA 5HQPA 4G9HA 5CAXA 4OO4A 2EIOA 3KD0A 1ILOA 3GA4A 3ZLPA 2ZNMA 4OWYA 5GZZB 4GSNA 1EOGA 4TR0A 1ERUA 4IN0A 2BTOT 3GKXA 2TRCP 3VI7A 2H74A 4MF6A 3C8EA 1PKWA 2WULA 2VL2A 3FYGA 2CQ9A 3FR3A 3IK7A 1SYRA 1V58A 3HJOA 3EURA 4V2MA 1GH2A 1V2AA 5CREA 1XVWA 4PURA 1Y25A 5DCGA 1M2BA 5ECSA 3KP8A 4X0XA 1X5CA 2LQQA 1QMVA 4K9ZA 1Z7RA 2H0GA 3C71A 4OMVA 1TDIA 3KTBA 2L59A 4V2NA 1SKSB 1ACVA 2MMOA 1JHBA 2IWTA 1GP1A 2FCHA 3HDCA 2GSSA 4O7HA 3J7Yb 3PINA 2H8LA 5E59A 4BA7A 2JSYA 5C04A 5B8AA 1O8WA 2QKEA 1W4VA 4EE0A 5A4VA 2KP2A 4L5LA 3HVVA 1BJXA 2RIIA 1OKTA 3TRXA 2CV4A 2XBQA 3E9JB 2GZYA 3F4TA 5G5FA 1O7UA 1UC7A 1THXA 2QC7A 4PGTA 3L9UA 2I1UA 3A5WA 5IMZA 1OKDA 1WIKA 4JRRA 3F6FA 2IL3A 1G6WA 3IDVA 4J57E 4D73A 4F0CA 2B1LA 4I2TA 4MLYA 2B5EA 2MMZA 2L4CA 3HD5A 1JLWA 3M0FA 4RI7A 2CAQA 1OYJA 4ZBAA 1TK0B 2DJKA 2LUSA 3APQA 1YZXA 4KNDA 3P2AA 2XPDA 4OD7A 2H71A 2DJ0A 4LA1A 4ZB6A 3MAKA 2PPTA 2YOIA 4YQUA 2C80A 4WXTA 1SK1A 4MJAA 3R2QA 3D4TA 5GAND 4NHWA 1XW6A 5F05A 2B3SA 4IQAA 2L57A 2X8HA 4EDZA 2A4VA 2C3QA 1Z5YE 4N0VA 4NMUA 3AY8A 1T1VA 3VK9A 4PX1A 2R5GA 2OBIA 3TJFA 3U5RE 2O89A 4V1Ap 4NV2A 1GULA 4XS4A 2L4QA 6GSWA 2ON7A 2H70A 1T3BA 3QDNA 3ZTLA 3WT2A 3APOA 3FY7A 2HYXA 3GUSA 4EO3A 2YANA 1F3AA 4OFMA 3TJGA 2AB6A 1O6JA 3HY2A 5LCZA 2VCXA 2LTKA 3LEFA 5FT3A 5ENUA 1S3DA 3F6DA 3J7Yk 5DAKB 2O8VB 4HS1A 4TOPA 2BMXA 3Q18A 1K0NA 5DALA 3F3RA 3D0ZA 5GSTA 1K3LA 14GSA 5G1KA 1MDKA 1PMTA 1YEXA 4OCEA 1XOBA 2KHPA 3LXTA 5EY6A 1T7PB 3RHBA 4HUAA 3CMIA 2IN3A 1NHOA 2YJ7A 1QUWA 12GSA 3EMPA 3HZ8A 4LL4B 1K0CA 2CZ2A 3DWVA 2RLIA 3DYRA 3H93A 3QOUA 2ALBA 2I81A 2AHEA 4KA0A 22GSA 2H76A 4IP6A 4IBPA 1SD8A 1Z9HA 5AN1A 1FVKA 1U3IA 1R5PA 3ME8A 4EL1A 1PD21 2GSRA 1URMA 2C8UA 4I5QA 3G7YA 1TW9A 4HJMA 17GSA 3GURA 4ZILA 1WE0A 3GL3A 3UMAA 1AUCA 1GL8A 3EU4A 5F07A 2I9HA 1O8XA 5ECHB 1PA3A 3KGKA 4ZIJA 3C73A 4O32A 1U6TA 1QXHA 5ECKB 20GSA 2IMIA 2N5BA 1XWKA 4PUAA 1PGTA 3KXOA 2H0IA 3ED3A 2HZEA 3TB2A 4I97A 3DKSA 5IQYA 4X43A 4BVYA 4K8MA 5F0GA 1AAZA 3GFKA 1EEJA 3W8JA 2H0HA 2BJXA 4LLRA 3RBTA 5ABRA 4TR1B 2FA8A 5HR2A 1B9YC 1M2AA 1M9BA 2R3XA 1AQXA 1T4YA 2G2QA 5COHA 4O5RA 2WB9A 1KEBA 2DMLA 3LFLA 3U6VA 2YWNA 3O6TA 1K0MA 1JZRA 3HJPA 3F8UA 2JSZA 3GHAA 4ZBBA 18GSA 4TR4A 1ZYQB 5IMDA 1J9BA 1AC1A 4RUVA 5D9WA 1BEDA 3GN3A 4V2LA 1AQWA 2DJ1A 1V9WA 3HA9A 3DXBA 5E4WA 5CRDA 4YQVA 4MJBA 3MWHA 5GSSA 1T8EB 5IOXA 5KN3A 4ECJA 2H6YA 3L9VA 3C1RA 4K6XA 2AV4A 5DJLA 1GTUA 4L0WA 2X8CA 3IHQA 1OE7A 5H5RA 1FHEA 4WF5A 2YV7A 4XRAA 5J41A 2VLVA 2PERA 2GZPA 1ZOFA 5CNWA 3ZIVA 2GSTA 4EXJA 4FYCA 1VGLA 3O76A 3KMOA 3L0HA 4OFTA 3TKQA 1ERWA 2LS5A 5B8BA 2V6KA 2B6MA 1CQGA 3A2XA 3EMXA 3IE3A 3TJKA 2C3TA 4EKZA 3EC3A 3UVHA 3IRAA 2H19A 5IMAA 3FW2A 4JEDA 3UARA 4TRXA 2L6DA 1GNWA 2LEGA 1XPVA 3ZIJA 5LD0A 1A2MA 3ZMKA 3LYPA 3HJMA 1EGRA 1XBSA 2FUG2 2DJ2A 3GTUA 4K2DA 1F9MA 5D93A 1NHYA 4WBJA 2GVPA 1F3BA 5ELAA 5A4UA 4PUFC 2TRXA 2VUPA 4E8EA 5G2ZA 1OC9B 5CO3A 3SWLA 3VPQA 2VLTA 4GQFA 4KB3A 3CXGA 5D96A 4CDOA 5ID2A 3JCML 2M46A 1ERTA 5J5NA 2IFQA 4F2IA 4K7IA 2KUCA 4IKHA 2CAIA 3QCPA 1GWCA 1GNEA 1MD3A 3TOTA 1DE2A 2F8AA 2XHFA 2VD1A 2E2GA 1QGVA 2MYGA 1A8LA 2X99A 1X5DA 5KN2A 1TRUA 4V1Ag 3EWLA 1TKDB 4QL9A 3TDGA 1A24A 2H72A 3A3TA 3UOMA 2H30A 4DSSA 5A4WA 5HFKA 4AJ6A 1I9DA 1GSUA 4GXZA 2PU9C 1T4ZA 2N5FA 3GH6A 3VFIA 4DSQA 3QAWA 3D6IA 3KCMA 2CA8A 2NVLA 1TI1A 3KZQA 1NW2A 1XZOA 4Q5NA 1GUMA 3C7MA 1FOVA 2NDOA 4FYUA 4JBBA 1RW1A 2LJKA 2A2SA 4IGJA 2PVOC 4EUYA 2VCQA 3IPZA 3I6AA 1TRWA 4QL7A 1GSSA 1OC8A 5DDLA 3UL3A 3HVSA 1DBYA 3M3MA 3F4RA 3APSA 3FR9A 1DE1A 1YY7A 4EDYA 3GSTA 3DIEA 3H79A 5ECQB 4K0NA 4MPFA 4NWYA 4WKWA 4NV5A 4HI7A 3PGTA 2HNLA 3HZ4A 4KDXA 5IIZA 1HYUA 4I8BA 2YV9A 4BWQA 3LJRA 3M8NA 4TXOA 4ILFA 4HOJA 1EOHA 4GLTA 3TOUA 5HR1A 1TRSA 5EL8A 2N5AA 2K8VA 2LJRA 2VCTA 4XS1A 2NPBA 3LG6A 3GKKA 4F9ZA 1X5EA 1PX7A 1IYIA 1XCCA 3VLNA 1V98A 1XOAA 4MF5A 3TUEA 3RDWA 3HCZA 3I9V2 1WJKA 4WF4A 3DVXA 1XWAA 8GSSA 2DIYA 4I2UA 5IPGA 1M99A 3G7JA 4FYBA 3HXSA 19GSA 2GLRA 13GSA 2ZUPA 2LRNA 3FZAA 2ES7A 2FHEA 5DQSA 4G19A 1X9SB 4JE1A 2K6VA 3DD3A 3GX0A 1BYEA 1U3AA 1XXUA 1AIUA 1BX9A 3KMNA 2IMKA 4IQ1A 1YQ1A 1EP7A 1WWJA 1R5AA 2V32A 3P90A 3N9JA 2P31A 4GSSA 4WETA 2I3YA 3UVTA 2VM2A 2FWHA 2G0FA 4XIHA 3EU3A 4POKA 4I6XA 2VL2C 1K0BA 4K0GA 4IVFA 1BQ7A 4Q5FA 1HNBA 4ZBDA 1FG4A 2DMMA 3ZZXA 1G6YA 1TRVA 2K18A 2H6ZA 3QAGA 4N30A 3CSIA 3NZNA 3UJ1A 1OC3A 1Z7PA 5LNKe 2JZTA 2VM1A 1EEMA 3DMLA 3GV1A 2FWEA 4MH2A 4AGSA 3UBLA 4HZ2A 1O81A 1S3AA 1H4OA 3L78A 5DBQA 3PH9A 4WR4A 2GS3A 1XW5A 4GWRA 4BVXA 3VWVA 4BL7A 4ML1A 3UIWA 1GRXA 1G7OA 1EP8A 3SBCA 1O73A 2JZSA 3KTLA 4BWSA 2EIQA 1SKRB 2AJQB 5J3RA 1NSWA 5INYA 2DSAA 3HKRA 2OA7A 2H75A 2RUFA 5KEJA 3CSJA 5HR3A 1M0UA 5H5SA 1A23A 5D8IA 3EVIA 2WFCA 3BD2A 3UBKA 3QFBC 4K1FA 3LSZA 3S9FA 4ULXA 4WR5A 2MBTA 4XS4B 2QSIA 3GH9A 1QK8A 1THOA 3IC4A 3IV4A 3GRXA 4GSTA 1FO5A 3TKSC 4EC0A 3A2WA 1XIYA 2O87A 3Q74A 1WP0A 1R7HA 2F8FA 3FZ5A 4HZ4A 2DIZA 1U87A 2MMAA 1B4PA 2O7KA 2FA4A 2IMDA 2H1GA 1PN9A 4O92A 5JWQB 4TN8A 2IJYA 5J9BA 4QQ7A 2A2RA 3WT1A 4MH3A 4K7OA 1A8YA 4JR4A 3RPPA 1AW9A 4ECCA 1GSYA 4ISDA 2JACA 4PQIA 3KEBA 3UEMA 1EZKA 1XWGA 3QAVA 4Q5QA 1SJ6A 2VLUA 10GSA 3IK9A 2E0QA 2X64A 5H5QA 1B9XC 4IW9A 5JCUA 5HFGA 4DSRA 1HD2A 1GUKA 5DJMA 2YWMA 2M80A 1V57A 1SJIA 2L6CA 1K0DA 2C4JA 4FIWA 3DGQA 2PN8A 2CX3A 1TTZA 4CW9A 1SKWB 4ZL9A 1MDJA 1X9MB 4NAXA 2H73A 3CRUA 1V40A 2LRCA 5C00A 2E7PA 6GSYA 1QFNA 3GMFA 3FZ9A 4XRDA 3KM6A 1F6MC 3QPMA 2MMNA 3BOAA 1VRSD 1E2YA 4XCSA 4POBA 2LSTA 2LJAA 4YH2A 1RK4A 1YF1A 2H01A 2HZEB 3BCIA 1B4QA 4J56E 2HI7A 4ECIA 3ZYWA 4LMWA 1JFUA 3HVXA 4JZQA 2VD0A 1SJZA 2EC4A 3FRCA 4MP4A 1HNAA 5CRHA 4MZWA 1YF0A 1ZZYA 5F8BA 1K3OA 1Z3EA 3FZ4A 1Q4JA 5HFIA 4MJCA 3G7IA 3P8WA 3TGZA 3PR8A 3O3TA 4KSOA 1LJRA 2H6XA 4F03A 1R26A 3VWXA 3C1SA 4ID0A 2B7JA 1JLVA 1YDKA 3TRQA 3A2VA 3TCOA 2HSHA 4KH7A 2IIYA 4MZCA 2OE0A 5D73A 2GTUA 4BPYA 2HLSA 4MK3A 2J9HA 1DUGA 4MDCA 5IOWA 2VOCA 2F51A 2R6KA 3LYKA 4IS0A 2JADA 2IMFA 2V1MA 4N11A 4IELA 3ERGA 3GX8A 5ECLB 2YJHA 1AQVA 3KJYA 3TKSE 2XC2A 2NBSA 3KIJA 3IAS2 4CHSA 1AXDA 2VL3A 1EWXA 5ECIB 1TU8A 4YAVA 2KLXA 1XW9A 1F2EA 2C0DA 3Q19A 2WGRA 2F3MA 2FY6A 4PNFA 1XWCA 2K9FA 4OCFA 4ZB8A 2WJUA 1M2DA 2K8SA 4KCEA 2YZUA 3BBYA 3FR6A 2VL9A 1PRXA 3I69A 2XPEA 2RM6A 3GKMA 3VPTA 2KOKA 3CTFA 1J08A 1JZWA 5JWRB 3HHVA 2YWOA 1SL1B 1Z6MA 4KAEA 1USBA 2VCWA 5IMFA 5ID2B 1F37A 2C3NA 2WS2A 3ISOA 2Z9SA 1ZL9A 1TJDA 2GQKA 9GSSA 2FD3A 3F3QA 3W6GA 2VIMA 1W89A 4AF2A 3CYNA 3N5OA 4ZL8A 4KUNA 2YN1A 2HSYA 4P3YB 2OE1A 4IJIA 2FLSA 4JU5A 3EYTA 1SL0B 3G9BA 5JCGA 2GT5A 5G5EA 2GDRA 1WRYA 3DVWA 4GQCA 5J9CA 1TP9A 2JL4A 1SL2B 4DSSB 5G31A 1FAAA 2DLXA 1ZCPA 2C1YA 1GSEA 3BJ5A 1ON4A 1OVNA 3IBHA 1PKZA 3ZRDA 1PQNA 1A2JA 3CBUA 2FWGA 1SYXA 3TJBA 1C72A 2GZZA 4GRFA 1WOUA 1OAZA 5IPHA 4L0UA 3E3EA 3IAM2 2YNXA 5HR0A 3D22A 1SK0A 6GSXA 1NM3A 1Y6EA 2RUEA 3TKPA 3GIXA 2LQOA 2CZ3A 1KNGA 3V1WA 1BG5A 1GTAA 4HJ2A 1GTBA 3LQ7A 3ERWA 2HXKA 4YQMA 1B48A 2ON5A 3ZFBA 3QFAC 2C0FA 3H4KA 2L5OA 4NPBA 3I43A 1H75A 3KH9A 4TW5A 1XWBA 5ELGA 4PQ1A 1ZMAA 2HZFA 4OO5A 1GTIA 4TXOB 2PVQA 4GF0A 3ZL5A 2LRTA 1EGOA 4WEYA 1J0FA 4HEA2 3H1NA 5IO2A 4LMVA 2HT9A 1TI3A 4MZBA 1PX6A 2YPMA 1TXXA 3RHCA 3CSHA 2B5XA 4L5OA 1KTEA 1LU4A 4Z7XA 3TKSA 4FO5A 3IR4A 4HQZA 2F9SA 3L9SA 4ML6A 2EIRA 2WDUA 5D9XA 3ZFLA 5CRGA 3VURA 2CVBA 2LKUA 3ERFA 2DBCA 4TKYA 1MTCA 4D73B 2VAFA 4TR3A 3QMXA 5DAKA 4OFNA 1DSBA 1I5GA 3VI5A 2HFDA 3ZITA 2V6OA 1FB6A 5FHIA 4G2EA 5CYYA 4RQXA 3FEUA 2R2JA 5G1LA 3F63A 3TRPA 2P5QA 1VF4A 3MNGA 4KW6A 5ECRB 5IM9A 3GNJA 5AGYA 1TK8B 4AJ7A 4F0BA 3M9JA 4KGIA 1GSQA 3CRTA 2VO4A 3Q6OA 5ECPB 2IPAA 2YWIA 5D9TA 1JZOA 1N2AA 5DCHA 3US3A 2V2GA 4NHZA 3WD6A 2OADA 3WGXA 2D2ZA 2REMA 1A0FA 2R4VA 3NOFA 2OE3A 2NTOA 2YP6A 4N10A 3H8QA 2CVKA 5KN0A 3TJJA 2OKAA 2O85A 3M1GA 1X0RA 2JU5A 2B7KA 3LORA 3FKFA 4RI6A 3DEXA 5CRWA 3ZREA 1N8JA 1XVQA 1SD9A 3F4SA 4F82A 5DQYA 5ECNB 2QGVA 1SENA 4TVEA 2IMEA 1SK2A 4LL1B 2M72A 1RQMA 2CT6A 4NXIA 1MD4A 1YJ6A 16GSA 1GLQA 1Q98A 2GSQA 5DALB 4WBRD 1TOFA 4E8HA 3DRNA 3QR6A 2OJLA 1E6BA 1A0RP 4JR6A 2J23A 5JCWA 5KN1A 1UVZA 1VF2A 4ZL7A 6GSTA 1LBKA 1U88A 3EE2A 4G10A 4HDEA 1G7EA 1HNCA 4KSMA 2L5LA 2V41A 3CTGA 2HRNA 4L8EA 1QQ2A 3WYWA 2AAWA 2GQLA 4TR1A 3HYPA 5EVOA 4KDUA 1VF1A 1HQOA 2WRTA 1PL2A 5EPFA 1TK5B 3UAPA 2FGXA 3GKNA 3D5JA 2P5RA 1B8XA 1YKAA 3WGDA 3F9UA 3OR5A 5B7CA 4AJ8A 2WCIA 3L4NA 4PNGA 4MF7A 4IHUA 1EV4A 1IYHA 1K0OA 4MJEA 1YEPA 4ACSA 2RM5A 4POLA 2PUKC 1ST9A 5DVBA 3KH7A 1KBNA 2GGTA 2OBKA 1YKCA 3GL5A 3P7XA 1OE8A 2MBSA 1GSDA 4GCIA 2H66A 5ECMB 1JZDA 3F0IA 4XHMA 1SU9A 1M7TA 3ME7A 2GQMA
chains in the Genus database with same CATH superfamily
6GSVA 3KP9A 3K8NA 7GSSA 2H1AA 3ZVJA 1FB0A 5AISA 2OACA 1G0TA 1R4WA 3ZMLA 2ZCTA 4KDYA 1BAYA 4HU7A 2CVDA 1WMJA 1MEKA 1ML6A 5J4UA 4ECBA 1FVJA 2DJ3A 2PGTA 2AUVA 4IJ3A 2TIRA 4Q5RA 1GSFA 3IA1A 1Z6NA 4EF0A 1A2LA 1EV9A 1ERVA 4FH8A 4ZXGA 3TKRA 3WGEA 2QA2A 3LXZA 2R37A 4KE3A 4N0ZA 1CQHA 1ABAA 2YCDA 4H86A 2WZ9A 3MSZA 2HRFA 1MDIA 3EINA 2DC5A 1ZGNA 4MA9A 4X4JA 2PWJA 3MDKA 4J2FA 4MMMA 4HU9A 3FHKA 2I4AA 3VWUA 1OC9A 2FWFA 1UN2A 2VCVA 2JZRA 2PBJA 6GSUA 4YAPA 1S3CA 1M9AA 4POMA 2B1KA 1X9WB 3IXRA 4MABA 5B6MA 3IOSA 3BCKA 2VCZA 3D4MA 4XS6A 1TU7A 4XTSA 4RQRA 3M9KA 3GSSA 3ZVJD 2HE3A 2YZHA 4KCAA 1VF3A 3LGCA 1GLPA 2GT6A 3VWWA 1WPIA 4HQSA 1K3YA 2KP1A 5CP1A 5D9VA 1PSQA 2C0EA 3RAZA 3GYKA 3W8SA 4KX4A 1XFLA 5ECOB 4EVMA 4IP1A 3D21A 5IO0A 11GSA 1FW1A 2C0GA 5AIXA 1UA5A 3RPNA 5L71A 4DVCA 3FK8A 4PQHA 4PXOA 2MZCA 2H1DA 2CX4A 5GAPD 2AYTA 5B6NA 3NIVA 4X1UA 2LNSA 5F06A 3GTUB 2PMTA 4MPGA 2LNTA 3E0UA 5IMCA 2H1BA 2P0GA 6GSSA 2LV3A 1T00A 4GTUA 1K0AA 1ZYEA 1PL1A 3LWAA 2E2MA 4ZB9A 4K7NA 4MCUA 2DJJA 1O85A 4TXVA 4DEJA 5AIVA 5JWOB 2IFQB 5FWGA 2FNOA 2X8GA 5G30A 3QD9A 2XBIA 1GUHA 1M3JA 5IMVA 2B5YA 5A5KA 5HQPA 4G9HA 5CAXA 4OO4A 2EIOA 3KD0A 1ILOA 3GA4A 3ZLPA 2ZNMA 4OWYA 5GZZB 4GSNA 1EOGA 1PFOA 4TR0A 1ERUA 4IN0A 2BTOT 3GKXA 2TRCP 3VI7A 2H74A 4MF6A 3C8EA 1PKWA 2WULA 2VL2A 3FYGA 2CQ9A 3FR3A 3IK7A 1SYRA 1V58A 3HJOA 3EURA 4V2MA 4A5PA 1GH2A 1V2AA 5CREA 1XVWA 4PURA 1Y25A 5DCGA 1M2BA 5ECSA 3KP8A 4X0XA 1X5CA 2LQQA 1QMVA 4K9ZA 1Z7RA 2H0GA 4PTSA 3C71A 1FOHA 4OMVA 1TDIA 3KTBA 2L59A 4V2NA 1SKSB 1ACVA 2MMOA 1JHBA 2IWTA 1GP1A 2FCHA 3HDCA 2GSSA 4O7HA 3J7Yb 3PINA 2H8LA 5E59A 4BA7A 2JSYA 5C04A 5B8AA 1O8WA 2QKEA 1W4VA 4EE0A 5A4VA 2KP2A 4L5LA 3HVVA 1BJXA 2RIIA 1OKTA 3TRXA 2CV4A 2XBQA 3E9JB 2GZYA 3F4TA 5G5FA 1O7UA 1UC7A 1THXA 2QC7A 4PGTA 3L9UA 2I1UA 3A5WA 5IMZA 1OKDA 4K5RA 1WIKA 4JRRA 3F6FA 2IL3A 1G6WA 3IDVA 4J57E 4D73A 4F0CA 2B1LA 4I2TA 4MLYA 2B5EA 4ICYA 2MMZA 2L4CA 3HD5A 1JLWA 3M0FA 4RI7A 2CAQA 1OYJA 4ZBAA 1TK0B 2DJKA 2LUSA 3HVNA 3APQA 1YZXA 4KNDA 3P2AA 2XPDA 4OD7A 2H71A 2DJ0A 4LA1A 4ZB6A 3MAKA 2PPTA 2YOIA 4YQUA 2C80A 4WXTA 1SK1A 4MJAA 3R2QA 3D4TA 5GAND 4NHWA 1XW6A 5F05A 2B3SA 4IQAA 2L57A 2X8HA 4EDZA 4Z2TA 2A4VA 2C3QA 1Z5YE 4N0VA 4NMUA 3AY8A 1T1VA 3VK9A 4PX1A 2R5GA 2OBIA 3TJFA 3U5RE 2O89A 4V1Ap 4NV2A 1GULA 4XS4A 2L4QA 6GSWA 2ON7A 2H70A 1T3BA 3QDNA 3ZTLA 3WT2A 3APOA 3FY7A 2HYXA 3GUSA 4EO3A 2YANA 1F3AA 4OFMA 3TJGA 2AB6A 1O6JA 3HY2A 5LCZA 2VCXA 4O5QA 2LTKA 3LEFA 5FT3A 5ENUA 1S3DA 3F6DA 3J7Yk 5DAKB 2O8VB 4HS1A 4TOPA 2BMXA 3Q18A 1K0NA 5DALA 3F3RA 3D0ZA 5GSTA 1K3LA 14GSA 5G1KA 1MDKA 1PMTA 3MIXA 1YEXA 4OCEA 1XOBA 2KHPA 3LXTA 1M3IA 5EY6A 1T7PB 3RHBA 4HUAA 3CMIA 2IN3A 1NHOA 2YJ7A 1QUWA 12GSA 3EMPA 3HZ8A 4LL4B 1K0CA 4KF9A 2CZ2A 3DWVA 2RLIA 3DYRA 3H93A 3QOUA 2ALBA 4K2XA 2I81A 2AHEA 4KA0A 22GSA 2H76A 4IP6A 4IBPA 1SD8A 1Z9HA 5AN1A 1FVKA 1U3IA 4CY6A 1R5PA 3ME8A 4EL1A 1PD21 2GSRA 1URMA 2C8UA 4I5QA 3G7YA 1TW9A 4HJMA 17GSA 3GURA 4ZILA 1WE0A 3GL3A 3UMAA 1AUCA 1GL8A 3EU4A 5F07A 2I9HA 1O8XA 5ECHB 1PA3A 3KGKA 4ZIJA 3C73A 4O32A 1U6TA 1QXHA 5ECKB 20GSA 2IMIA 2N5BA 1XWKA 4PUAA 1PGTA 3KXOA 2H0IA 3ED3A 2HZEA 3TB2A 4I97A 3DKSA 5IQYA 4HSCX 4X43A 4BVYA 4K8MA 1ZYNA 5F0GA 1AAZA 3GFKA 1EEJA 3W8JA 1XG8A 2H0HA 2BJXA 4LLRA 3RBTA 5ABRA 4TR1B 2FA8A 5HR2A 1B9YC 1M2AA 1M9BA 2R3XA 1AQXA 1T4YA 2G2QA 5COHA 4O5RA 2WB9A 1KEBA 2DMLA 3LFLA 3U6VA 2YWNA 3O6TA 1K0MA 1JZRA 3HJPA 4YKFA 3F8UA 2JSZA 3GHAA 4ZBBA 18GSA 2R0GA 4TR4A 1ZYQB 5IMDA 1J9BA 1AC1A 4RUVA 5D9WA 1BEDA 3GN3A 4V2LA 1AQWA 2DJ1A 1V9WA 3HA9A 3DXBA 5E4WA 5CRDA 4YQVA 4MJBA 3MWHA 5GSSA 1T8EB 5IOXA 5KN3A 4ECJA 2H6YA 3L9VA 3C1RA 4K6XA 2AV4A 1PN0A 5DJLA 1GTUA 4L0WA 2X8CA 3IHQA 1OE7A 2A4HA 5H5RA 1FHEA 4WF5A 2YV7A 4XRAA 5J41A 2VLVA 2PERA 2GZPA 1ZOFA 5CNWA 3ZIVA 2GSTA 4EXJA 4FYCA 1VGLA 3O76A 3KMOA 3L0HA 4OFTA 3TKQA 1ERWA 2LS5A 5B8BA 2V6KA 2B6MA 1CQGA 3A2XA 3EMXA 3IE3A 3TJKA 2C3TA 4EKZA 3EC3A 3UVHA 3IRAA 2H19A 5IMAA 3FW2A 4JEDA 3UARA 4TRXA 2L6DA 1GNWA 2LEGA 1XPVA 5BRTA 3ZIJA 5LD0A 1A2MA 3ZMKA 3LYPA 3HJMA 1EGRA 1XBSA 2FUG2 2DJ2A 3GTUA 4K2DA 1F9MA 5D93A 1NHYA 2HSMA 4WBJA 2GVPA 1F3BA 5ELAA 5A4UA 4PUFC 2TRXA 2VUPA 4E8EA 5G2ZA 1OC9B 5CO3A 3SWLA 3VPQA 2VLTA 4GQFA 4KB3A 3CXGA 5D96A 4CDOA 5ID2A 3JCML 2M46A 1ERTA 5J5NA 2IFQA 2HRKA 4F2IA 4K7IA 2KUCA 4IKHA 2CAIA 3QCPA 1GWCA 1GNEA 1MD3A 3TOTA 1DE2A 1ZYPA 2F8AA 2XHFA 2VD1A 4K5SA 2E2GA 1QGVA 2MYGA 1A8LA 2X99A 1X5DA 3MYDA 5KN2A 1TRUA 4V1Ag 3EWLA 1TKDB 4QL9A 3TDGA 1A24A 2H72A 3A3TA 3UOMA 2H30A 4DSSA 5A4WA 5HFKA 4AJ6A 4Z2RA 1I9DA 3IHGA 1GSUA 4GXZA 2PU9C 1T4ZA 2N5FA 3GH6A 3VFIA 4DSQA 3QAWA 3D6IA 3KCMA 2CA8A 2NVLA 1TI1A 3KZQA 1NW2A 1XZOA 4Q5NA 1GUMA 3CQFA 3C7MA 1FOVA 2NDOA 4FYUA 4JBBA 1RW1A 2LJKA 2A2SA 4IGJA 2PVOC 4EUYA 2VCQA 3IPZA 3I6AA 1TRWA 4QL7A 1GSSA 1OC8A 5DDLA 3UL3A 3HVSA 1DBYA 3M3MA 3F4RA 3APSA 3FR9A 1DE1A 1YY7A 4EDYA 3GSTA 3DIEA 3A5IA 3H79A 4K0NA 5ECQB 4MPFA 4NWYA 4WKWA 4NV5A 4HI7A 3PGTA 2HNLA 3HZ4A 4KDXA 5IIZA 1HYUA 4I8BA 2YV9A 4BWQA 3LJRA 3M8NA 4TXOA 4ILFA 4HOJA 1EOHA 4GLTA 3TOUA 5HR1A 1TRSA 5EL8A 2N5AA 2K8VA 2LJRA 2VCTA 4XS1A 2NPBA 3LG6A 3GKKA 4F9ZA 1X5EA 1PX7A 1IYIA 1XCCA 3VLNA 1V98A 1XOAA 4MF5A 3TUEA 3RDWA 3HCZA 3I9V2 1WJKA 4WF4A 3DVXA 1XWAA 8GSSA 2DIYA 4I2UA 5IPGA 1M99A 3G7JA 4FYBA 3HXSA 19GSA 2GLRA 13GSA 2ZUPA 2LRNA 3FZAA 2ES7A 2FHEA 5DQSA 4G19A 1X9SB 4JE1A 2K6VA 3DD3A 3GX0A 1BYEA 1U3AA 1XXUA 2X49A 1AIUA 1BX9A 3KMNA 2IMKA 4IQ1A 1YQ1A 1EP7A 1WWJA 1R5AA 2V32A 3LW9A 3P90A 3N9JA 2P31A 4GSSA 4WETA 2I3YA 3UVTA 2VM2A 2FWHA 2G0FA 4XIHA 3EU3A 4POKA 4I6XA 2VL2C 1K0BA 4K0GA 4IVFA 1BQ7A 4Q5FA 1HNBA 4ZBDA 1FG4A 2DMMA 3ZZXA 1G6YA 1TRVA 2K18A 2H6ZA 3QAGA 4N30A 3CSIA 3NZNA 3UJ1A 1OC3A 1Z7PA 5LNKe 2JZTA 2VM1A 1EEMA 3DMLA 3GV1A 4Z2UA 2FWEA 4MH2A 4AGSA 3UBLA 4HZ2A 1O81A 1S3AA 1H4OA 3L78A 5DBQA 3PH9A 4WR4A 2GS3A 1XW5A 4GWRA 4BVXA 3VWVA 4BL7A 4ML1A 3UIWA 1GRXA 1G7OA 1EP8A 3SBCA 1O73A 2JZSA 5KOWA 3KTLA 4BWSA 2EIQA 1SKRB 2AJQB 5J3RA 1NSWA 5INYA 2DSAA 3HKRA 2OA7A 2H75A 2RUFA 5KEJA 5KOXA 3CSJA 5HR3A 1M0UA 5H5SA 2QA1A 1A23A 5D8IA 3EVIA 2WFCA 3BD2A 3UBKA 3QFBC 4K1FA 3LSZA 3S9FA 4ULXA 4WR5A 2MBTA 5BMUA 4XS4B 2QSIA 3GH9A 4G0LA 1QK8A 1THOA 3IC4A 3IV4A 3GRXA 4GSTA 1FO5A 3TKSC 4EC0A 3A2WA 1XIYA 2O87A 3Q74A 1WP0A 1R7HA 2F8FA 2A2PA 3FZ5A 4HZ4A 2DIZA 1U87A 2MMAA 1B4PA 2O7KA 2FA4A 2IMDA 2H1GA 1PN9A 4O92A 5JWQB 4TN8A 2IJYA 5J9BA 4QQ7A 2A2RA 3WT1A 4MH3A 4K7OA 1A8YA 4JR4A 3RPPA 1AW9A 4ECCA 1GSYA 4ISDA 2JACA 4PQIA 3KEBA 3UEMA 1EZKA 1XWGA 3QAVA 3PPUA 4Q5QA 1SJ6A 2VLUA 10GSA 3IK9A 2E0QA 2X64A 5H5QA 1B9XC 4IW9A 5JCUA 5HFGA 4DSRA 1HD2A 1GUKA 5DJMA 2YWMA 2M80A 1V57A 1SJIA 2L6CA 1K0DA 2C4JA 4FIWA 3DGQA 2PN8A 2CX3A 1TTZA 4CW9A 1SKWB 4ZL9A 1MDJA 1X9MB 4NAXA 2H73A 3CRUA 1V40A 2LRCA 5C00A 2E7PA 2DKHA 6GSYA 1QFNA 3GMFA 3FZ9A 4XRDA 3KM6A 1F6MC 3QPMA 2MMNA 3BOAA 1VRSD 1E2YA 4XCSA 4POBA 3EPTA 2LSTA 2LJAA 4YH2A 1RK4A 1YF1A 2H01A 2HZEB 3BCIA 1B4QA 4EIQA 4J56E 2HI7A 4ECIA 3ZYWA 4LMWA 4BVYB 1JFUA 3HVXA 4JZQA 2VD0A 1SJZA 2EC4A 3FRCA 4MP4A 1HNAA 5CRHA 4MZWA 1YF0A 1ZZYA 5F8BA 1K3OA 1Z3EA 3FZ4A 1Q4JA 5HFIA 4MJCA 3G7IA 3P8WA 3TGZA 3PR8A 3O3TA 4KSOA 1LJRA 2H6XA 4F03A 1R26A 3VWXA 3C1SA 4ID0A 2B7JA 1JLVA 1YDKA 3TRQA 3A2VA 3TCOA 2HSHA 4KH7A 2IIYA 4EIPA 4MZCA 2OE0A 5D73A 2GTUA 4BPYA 2HLSA 4MK3A 2J9HA 1DUGA 4MDCA 5IOWA 2VOCA 2F51A 2R6KA 3LYKA 4IS0A 2JADA 2IMFA 2V1MA 4N11A 4IELA 3ERGA 3GX8A 5ECLB 2YJHA 1AQVA 3KJYA 3TKSE 2XC2A 2NBSA 4BIKA 3KIJA 3IAS2 4CHSA 1AXDA 2VL3A 1EWXA 5ECIB 1TU8A 4YAVA 2KLXA 1XW9A 1F2EA 2C0DA 3Q19A 2WGRA 2F3MA 2FY6A 4PNFA 1XWCA 2K9FA 4OCFA 4ZB8A 2WJUA 1M2DA 2K8SA 4KCEA 2YZUA 3BBYA 3FR6A 2VL9A 1PRXA 3I69A 2XPEA 3IC8A 2RM6A 3GKMA 3VPTA 2KOKA 3CTFA 1J08A 1JZWA 5JWRB 3HHVA 2YWOA 1SL1B 1Z6MA 4KAEA 1USBA 2VCWA 5IMFA 5ID2B 1F37A 2C3NA 2WS2A 3ISOA 2Z9SA 1ZL9A 1TJDA 2GQKA 9GSSA 2FD3A 3F3QA 3W6GA 2VIMA 1W89A 4AF2A 3CYNA 3N5OA 4ZL8A 4KUNA 2YN1A 2HSYA 4P3YB 2OE1A 4IJIA 2FLSA 4JU5A 4G0KA 3EYTA 1SL0B 3G9BA 5JCGA 2GT5A 5G5EA 2GDRA 1WRYA 3DVWA 4GQCA 5J9CA 1TP9A 2JL4A 1SL2B 4DSSB 5G31A 1FAAA 2DLXA 1ZCPA 2C1YA 1GSEA 3BJ5A 1ON4A 1OVNA 3IBHA 1PKZA 3ZRDA 1PQNA 2R0CA 3R3EA 1A2JA 3CBUA 2FWGA 1SYXA 3TJBA 1C72A 2GZZA 4GRFA 1WOUA 1OAZA 5IPHA 4L0UA 3E3EA 3IAM2 2YNXA 2HRAA 5HR0A 3D22A 1SK0A 6GSXA 1NM3A 1Y6EA 2RUEA 3TKPA 3GIXA 2LQOA 2CZ3A 1KNGA 3V1WA 1BG5A 1GTAA 4HJ2A 1GTBA 3LQ7A 3ERWA 2HXKA 4YQMA 1B48A 2ON5A 3ZFBA 3QFAC 2C0FA 3H4KA 2L5OA 4NPBA 3I43A 1H75A 3KH9A 4TW5A 1XWBA 5ELGA 4PQ1A 1ZMAA 2HZFA 4OO5A 1GTIA 4TXOB 2PVQA 4GF0A 3ZL5A 2LRTA 1EGOA 4WEYA 1J0FA 4HEA2 3H1NA 5IO2A 4LMVA 2HT9A 1TI3A 4MZBA 1PX6A 3FMWA 2YPMA 1TXXA 3RHCA 2R0PA 3CSHA 2B5XA 4L5OA 1KTEA 1LU4A 4Z7XA 3TKSA 4FO5A 3IR4A 4HQZA 2F9SA 3L9SA 4ML6A 2EIRA 2WDUA 5D9XA 3ZFLA 5CRGA 3VURA 2CVBA 2LKUA 3ERFA 2DBCA 4TKYA 1MTCA 4D73B 2VAFA 4TR3A 3QMXA 5DAKA 4OFNA 1DSBA 1I5GA 3VI5A 2HFDA 2DKIA 3ZITA 2V6OA 1FB6A 5FHIA 4G2EA 4G0IA 5CYYA 4RQXA 3FEUA 2R2JA 5G1LA 3F63A 2X4AA 3TRPA 2P5QA 1VF4A 3MNGA 4KW6A 5ECRB 5IM9A 3GNJA 5AGYA 1TK8B 4MNNA 4AJ7A 4F0BA 3M9JA 4KGIA 1GSQA 3CRTA 2VO4A 3Q6OA 5ECPB 1S3RA 2IPAA 2YWIA 5D9TA 1JZOA 1N2AA 5DCHA 3US3A 2V2GA 4NHZA 3WD6A 2OADA 4CY8A 3WGXA 2D2ZA 2REMA 1A0FA 2R4VA 3NOFA 2OE3A 2NTOA 2YP6A 4N10A 3H8QA 2CVKA 5KN0A 3TJJA 2OKAA 2O85A 3M1GA 1X0RA 2JU5A 2B7KA 3LORA 3FKFA 4RI6A 3DEXA 5CRWA 3ZREA 1N8JA 1XVQA 1SD9A 4BVXB 3F4SA 4F82A 5DQYA 4BL7B 5ECNB 2QGVA 1SENA 4O5UA 4TVEA 2IMEA 1SK2A 4LL1B 2M72A 1RQMA 2CT6A 4NXIA 1MD4A 1YJ6A 16GSA 1GLQA 4YKGA 1Q98A 2GSQA 5DALB 4WBRD 1TOFA 4E8HA 3DRNA 3QR6A 2OJLA 1E6BA 1A0RP 4JR6A 2J23A 5JCWA 5KN1A 1UVZA 1VF2A 4ZL7A 6GSTA 1LBKA 1U88A 3EE2A 4G10A 4HDEA 1G7EA 1HNCA 4KSMA 2L5LA 2V41A 3CTGA 2HRNA 4L8EA 1QQ2A 3WYWA 2AAWA 2GQLA 4TR1A 3HYPA 5EVOA 4KDUA 1VF1A 1HQOA 2WRTA 1PL2A 5EPFA 1TK5B 3UAPA 4FQUA 2FGXA 3GKNA 3D5JA 2P5RA 1B8XA 1YKAA 3WGDA 3F9UA 3OR5A 5B7CA 4AJ8A 2WCIA 3L4NA 4PNGA 2UZ8A 4IHUA 4MF7A 1EV4A 1IYHA 1K0OA 4MJEA 1YEPA 4ACSA 2RM5A 4POLA 2PUKC 1ST9A 5DVBA 3KH7A 1KBNA 2GGTA 2OBKA 1YKCA 3GL5A 3P7XA 1OE8A 2MBSA 1GSDA 4GCIA 2H66A 5ECMB 1JZDA 3F0IA 4XHMA 1SU9A 1M7TA 3ME7A 2GQMA 4USSA
chains in the Genus database with same CATH topology
6GSVA 3KP9A 3K8NA 7GSSA 2H1AA 3ZVJA 1FB0A 5AISA 2OACA 1G0TA 1R4WA 3ZMLA 2ZCTA 4KDYA 1BAYA 4HU7A 2CVDA 1WMJA 1MEKA 1ML6A 5J4UA 4ECBA 1FVJA 2DJ3A 2PGTA 2AUVA 4IJ3A 2TIRA 4Q5RA 1GSFA 3IA1A 1Z6NA 4EF0A 1A2LA 1EV9A 1ERVA 4FH8A 4ZXGA 3TKRA 3WGEA 2QA2A 3LXZA 2R37A 4KE3A 4N0ZA 1CQHA 1ABAA 2YCDA 4H86A 2WZ9A 3MSZA 2HRFA 1MDIA 3EINA 2DC5A 1ZGNA 4MA9A 4X4JA 2PWJA 3MDKA 4J2FA 4MMMA 4HU9A 3FHKA 2I4AA 3VWUA 1OC9A 2FWFA 1UN2A 2VCVA 2JZRA 2PBJA 6GSUA 4YAPA 1S3CA 1M9AA 4POMA 2B1KA 1X9WB 3IXRA 4MABA 5B6MA 3IOSA 3BCKA 2VCZA 3D4MA 4XS6A 1TU7A 4XTSA 4RQRA 3M9KA 3GSSA 3ZVJD 2HE3A 2YZHA 4KCAA 1VF3A 3LGCA 1GLPA 2GT6A 3VWWA 1WPIA 4HQSA 1K3YA 2KP1A 5CP1A 5D9VA 1PSQA 2C0EA 3RAZA 3GYKA 3W8SA 4KX4A 1XFLA 5ECOB 4EVMA 4IP1A 3D21A 5IO0A 11GSA 1FW1A 2C0GA 5AIXA 1UA5A 3RPNA 5L71A 4DVCA 3FK8A 4PQHA 4PXOA 2MZCA 2H1DA 2CX4A 5GAPD 2AYTA 5B6NA 3NIVA 4X1UA 2LNSA 5F06A 3GTUB 2PMTA 4MPGA 2LNTA 3E0UA 5IMCA 2H1BA 2P0GA 6GSSA 2LV3A 1T00A 4GTUA 1K0AA 1ZYEA 1PL1A 3LWAA 2E2MA 4ZB9A 4K7NA 4MCUA 2DJJA 1O85A 4TXVA 4DEJA 5AIVA 5JWOB 2IFQB 5FWGA 2FNOA 2X8GA 5G30A 3QD9A 2XBIA 1GUHA 5IMVA 2B5YA 5A5KA 5HQPA 4G9HA 5CAXA 4OO4A 2EIOA 3KD0A 1ILOA 3GA4A 3ZLPA 2ZNMA 4OWYA 5GZZB 4GSNA 1EOGA 4TR0A 1ERUA 4IN0A 2BTOT 3GKXA 2TRCP 3VI7A 2H74A 4MF6A 3C8EA 1PKWA 2WULA 2VL2A 3FYGA 2CQ9A 3FR3A 3IK7A 1SYRA 1V58A 3HJOA 3EURA 4V2MA 4A5PA 1GH2A 1V2AA 5CREA 1XVWA 4PURA 1Y25A 5DCGA 1M2BA 5ECSA 3KP8A 4X0XA 1X5CA 2LQQA 1QMVA 4K9ZA 1Z7RA 2H0GA 4PTSA 3C71A 1FOHA 4OMVA 1TDIA 3KTBA 2L59A 4V2NA 1SKSB 1ACVA 2MMOA 1JHBA 2IWTA 1GP1A 2FCHA 3HDCA 2GSSA 4O7HA 3J7Yb 3PINA 2H8LA 5E59A 4BA7A 2JSYA 5C04A 5B8AA 1O8WA 2QKEA 1W4VA 4EE0A 5A4VA 2KP2A 4L5LA 3HVVA 1BJXA 2RIIA 1OKTA 3TRXA 2CV4A 2XBQA 3E9JB 2GZYA 3F4TA 5G5FA 1O7UA 1UC7A 1THXA 2QC7A 4PGTA 3L9UA 2I1UA 3A5WA 5IMZA 1OKDA 4K5RA 1WIKA 4JRRA 3F6FA 2IL3A 1G6WA 3IDVA 4J57E 4D73A 4F0CA 2B1LA 4I2TA 4MLYA 2B5EA 4ICYA 2MMZA 2L4CA 3HD5A 1JLWA 3M0FA 4RI7A 2CAQA 1OYJA 4ZBAA 1TK0B 2DJKA 2LUSA 3APQA 1YZXA 4KNDA 3P2AA 2XPDA 4OD7A 2H71A 2DJ0A 4LA1A 4ZB6A 3MAKA 2PPTA 2YOIA 4YQUA 2C80A 4WXTA 1SK1A 4MJAA 3R2QA 3D4TA 5GAND 4NHWA 1XW6A 5F05A 2B3SA 4IQAA 2L57A 2X8HA 4EDZA 4Z2TA 2A4VA 2C3QA 1Z5YE 4N0VA 4NMUA 3AY8A 1T1VA 3VK9A 4PX1A 2R5GA 2OBIA 3TJFA 3U5RE 2O89A 4V1Ap 4NV2A 1GULA 4XS4A 2L4QA 6GSWA 2ON7A 2H70A 1T3BA 3QDNA 3ZTLA 3WT2A 3APOA 3FY7A 2HYXA 3GUSA 4EO3A 2YANA 1F3AA 4OFMA 3TJGA 2AB6A 1O6JA 3HY2A 5LCZA 2VCXA 4O5QA 2LTKA 3LEFA 5FT3A 5ENUA 1S3DA 3F6DA 3J7Yk 5DAKB 2O8VB 4HS1A 4TOPA 2BMXA 3Q18A 1K0NA 5DALA 3F3RA 3D0ZA 5GSTA 1K3LA 14GSA 5G1KA 1MDKA 1PMTA 3MIXA 1YEXA 4OCEA 1XOBA 2KHPA 3LXTA 5EY6A 1T7PB 3RHBA 4HUAA 3CMIA 2IN3A 1NHOA 2YJ7A 1QUWA 12GSA 3EMPA 3HZ8A 4LL4B 1K0CA 4KF9A 2CZ2A 3DWVA 2RLIA 3DYRA 3H93A 3QOUA 2ALBA 4K2XA 2I81A 2AHEA 4KA0A 22GSA 2H76A 4IP6A 4IBPA 1SD8A 1Z9HA 5AN1A 1FVKA 1U3IA 4CY6A 1R5PA 3ME8A 4EL1A 1PD21 2GSRA 1URMA 2C8UA 4I5QA 3G7YA 1TW9A 4HJMA 17GSA 3GURA 4ZILA 1WE0A 3GL3A 3UMAA 1AUCA 1GL8A 3EU4A 5F07A 2I9HA 1O8XA 5ECHB 1PA3A 3KGKA 4ZIJA 3C73A 4O32A 1U6TA 1QXHA 5ECKB 20GSA 2IMIA 2N5BA 1XWKA 4PUAA 1PGTA 3KXOA 2H0IA 3ED3A 2HZEA 3TB2A 4I97A 3DKSA 5IQYA 4X43A 4BVYA 4K8MA 1ZYNA 5F0GA 1AAZA 3GFKA 1EEJA 3W8JA 2H0HA 2BJXA 4LLRA 3RBTA 5ABRA 4TR1B 2FA8A 5HR2A 1B9YC 1M2AA 1M9BA 2R3XA 1AQXA 1T4YA 2G2QA 5COHA 4O5RA 2WB9A 1KEBA 2DMLA 3LFLA 3U6VA 2YWNA 3O6TA 1K0MA 1JZRA 3HJPA 4YKFA 3F8UA 2JSZA 3GHAA 4ZBBA 18GSA 2R0GA 4TR4A 1ZYQB 5IMDA 1J9BA 1AC1A 4RUVA 5D9WA 1BEDA 3GN3A 4V2LA 1AQWA 2DJ1A 1V9WA 3HA9A 3DXBA 5E4WA 5CRDA 4YQVA 4MJBA 3MWHA 5GSSA 1T8EB 5IOXA 5KN3A 4ECJA 2H6YA 3L9VA 3C1RA 4K6XA 2AV4A 1PN0A 5DJLA 1GTUA 4L0WA 2X8CA 3IHQA 1OE7A 2A4HA 5H5RA 1FHEA 4WF5A 2YV7A 4XRAA 5J41A 2VLVA 2PERA 2GZPA 1ZOFA 5CNWA 3ZIVA 2GSTA 4EXJA 4FYCA 1VGLA 3O76A 3KMOA 3L0HA 4OFTA 3TKQA 1ERWA 2LS5A 5B8BA 2V6KA 2B6MA 1CQGA 3A2XA 3EMXA 3IE3A 3TJKA 2C3TA 4EKZA 3EC3A 3UVHA 3IRAA 2H19A 5IMAA 3FW2A 4JEDA 3UARA 4TRXA 2L6DA 1GNWA 2LEGA 1XPVA 5BRTA 3ZIJA 5LD0A 1A2MA 3ZMKA 3LYPA 3HJMA 1EGRA 1XBSA 2FUG2 2DJ2A 3GTUA 4K2DA 1F9MA 5D93A 1NHYA 2HSMA 4WBJA 2GVPA 1F3BA 5ELAA 5A4UA 4PUFC 2TRXA 2VUPA 4E8EA 5G2ZA 1OC9B 5CO3A 3SWLA 3VPQA 2VLTA 4GQFA 4KB3A 3CXGA 5D96A 4CDOA 5ID2A 3JCML 2M46A 1ERTA 5J5NA 2IFQA 2HRKA 4F2IA 4K7IA 2KUCA 4IKHA 2CAIA 3QCPA 1GWCA 1GNEA 1MD3A 3TOTA 1DE2A 1ZYPA 2F8AA 2XHFA 2VD1A 4K5SA 2E2GA 1QGVA 2MYGA 1A8LA 2X99A 1X5DA 3MYDA 5KN2A 1TRUA 4V1Ag 3EWLA 1TKDB 4QL9A 3TDGA 1A24A 2H72A 3A3TA 3UOMA 2H30A 4DSSA 5A4WA 5HFKA 4AJ6A 4Z2RA 1I9DA 3IHGA 1GSUA 4GXZA 2PU9C 1T4ZA 2N5FA 3GH6A 3VFIA 4DSQA 3QAWA 3D6IA 3KCMA 2CA8A 2NVLA 1TI1A 3KZQA 1NW2A 1XZOA 4Q5NA 1GUMA 3C7MA 1FOVA 2NDOA 4FYUA 4JBBA 1RW1A 2LJKA 2A2SA 4IGJA 2PVOC 4EUYA 2VCQA 3IPZA 3I6AA 1TRWA 4QL7A 1GSSA 1OC8A 5DDLA 3UL3A 3HVSA 1DBYA 3M3MA 3F4RA 3APSA 3FR9A 1DE1A 1YY7A 4EDYA 3GSTA 3DIEA 3A5IA 3H79A 4K0NA 5ECQB 4MPFA 4NWYA 4WKWA 4NV5A 4HI7A 3PGTA 2HNLA 3HZ4A 4KDXA 5IIZA 1HYUA 4I8BA 2YV9A 4BWQA 3LJRA 3M8NA 4TXOA 4ILFA 4HOJA 1EOHA 4GLTA 3TOUA 5HR1A 1TRSA 5EL8A 2N5AA 2K8VA 2LJRA 2VCTA 4XS1A 2NPBA 3LG6A 3GKKA 4F9ZA 1X5EA 1PX7A 1IYIA 1XCCA 3VLNA 1V98A 1XOAA 4MF5A 3TUEA 3RDWA 3HCZA 3I9V2 1WJKA 4WF4A 3DVXA 1XWAA 8GSSA 2DIYA 4I2UA 5IPGA 1M99A 3G7JA 4FYBA 3HXSA 19GSA 2GLRA 13GSA 2ZUPA 2LRNA 3FZAA 2ES7A 2FHEA 5DQSA 4G19A 1X9SB 4JE1A 2K6VA 3DD3A 3GX0A 1BYEA 1U3AA 1XXUA 2X49A 1AIUA 1BX9A 3KMNA 2IMKA 4IQ1A 1YQ1A 1EP7A 1WWJA 1R5AA 2V32A 3LW9A 3P90A 3N9JA 2P31A 4GSSA 4WETA 2I3YA 3UVTA 2VM2A 2FWHA 2G0FA 4XIHA 3EU3A 4POKA 4I6XA 2VL2C 1K0BA 4K0GA 4IVFA 1BQ7A 4Q5FA 1HNBA 4ZBDA 1FG4A 2DMMA 3ZZXA 1G6YA 1TRVA 2K18A 2H6ZA 3QAGA 4N30A 3CSIA 3NZNA 3UJ1A 1OC3A 1Z7PA 5LNKe 2JZTA 2VM1A 1EEMA 3DMLA 3GV1A 4Z2UA 2FWEA 4MH2A 4AGSA 3UBLA 4HZ2A 1O81A 1S3AA 1H4OA 3L78A 5DBQA 3PH9A 4WR4A 2GS3A 1XW5A 4GWRA 4BVXA 3VWVA 4BL7A 4ML1A 3UIWA 1GRXA 1G7OA 1EP8A 3SBCA 1O73A 2JZSA 5KOWA 3KTLA 4BWSA 2EIQA 1SKRB 2AJQB 5J3RA 1NSWA 5INYA 2DSAA 3HKRA 2OA7A 2H75A 2RUFA 5KEJA 5KOXA 3CSJA 5HR3A 1M0UA 5H5SA 2QA1A 1A23A 5D8IA 3EVIA 2WFCA 3BD2A 3UBKA 3QFBC 4K1FA 3LSZA 3S9FA 4ULXA 4WR5A 2MBTA 5BMUA 4XS4B 2QSIA 3GH9A 4G0LA 1QK8A 1THOA 3IC4A 3IV4A 3GRXA 4GSTA 1FO5A 3TKSC 4EC0A 3A2WA 1XIYA 2O87A 3Q74A 1WP0A 1R7HA 2F8FA 2A2PA 3FZ5A 4HZ4A 2DIZA 1U87A 2MMAA 1B4PA 2O7KA 2FA4A 2IMDA 2H1GA 1PN9A 4O92A 5JWQB 4TN8A 2IJYA 5J9BA 4QQ7A 2A2RA 3WT1A 4MH3A 4K7OA 1A8YA 4JR4A 3RPPA 1AW9A 4ECCA 1GSYA 4ISDA 2JACA 4PQIA 3KEBA 3UEMA 1EZKA 1XWGA 3QAVA 3PPUA 4Q5QA 1SJ6A 2VLUA 10GSA 3IK9A 2E0QA 2X64A 5H5QA 1B9XC 4IW9A 5JCUA 5HFGA 4DSRA 1HD2A 1GUKA 5DJMA 2YWMA 2M80A 1V57A 1SJIA 2L6CA 1K0DA 2C4JA 4FIWA 3DGQA 2PN8A 2CX3A 1TTZA 4CW9A 1SKWB 4ZL9A 1MDJA 1X9MB 4NAXA 2H73A 3CRUA 1V40A 2LRCA 5C00A 2E7PA 2DKHA 6GSYA 1QFNA 3GMFA 3FZ9A 4XRDA 3KM6A 1F6MC 3QPMA 2MMNA 3BOAA 1VRSD 1E2YA 4XCSA 4POBA 3EPTA 2LSTA 2LJAA 4YH2A 1RK4A 1YF1A 2H01A 2HZEB 3BCIA 1B4QA 4EIQA 4J56E 2HI7A 4ECIA 3ZYWA 4LMWA 4BVYB 1JFUA 3HVXA 4JZQA 2VD0A 1SJZA 2EC4A 3FRCA 4MP4A 1HNAA 5CRHA 4MZWA 1YF0A 1ZZYA 5F8BA 1K3OA 1Z3EA 3FZ4A 1Q4JA 5HFIA 4MJCA 3G7IA 3P8WA 3TGZA 3PR8A 3O3TA 4KSOA 1LJRA 2H6XA 4F03A 1R26A 3VWXA 3C1SA 4ID0A 2B7JA 1JLVA 1YDKA 3TRQA 3A2VA 3TCOA 2HSHA 4KH7A 2IIYA 4EIPA 4MZCA 2OE0A 5D73A 2GTUA 4BPYA 2HLSA 4MK3A 2J9HA 1DUGA 4MDCA 5IOWA 2VOCA 2F51A 2R6KA 3LYKA 4IS0A 2JADA 2IMFA 2V1MA 4N11A 4IELA 3ERGA 3GX8A 5ECLB 2YJHA 1AQVA 3KJYA 3TKSE 2XC2A 2NBSA 3KIJA 3IAS2 4CHSA 1AXDA 2VL3A 1EWXA 5ECIB 1TU8A 4YAVA 2KLXA 1XW9A 1F2EA 2C0DA 3Q19A 2WGRA 2F3MA 2FY6A 4PNFA 1XWCA 2K9FA 4OCFA 4ZB8A 2WJUA 1M2DA 2K8SA 4KCEA 2YZUA 3BBYA 3FR6A 2VL9A 1PRXA 3I69A 2XPEA 3IC8A 2RM6A 3GKMA 3VPTA 2KOKA 3CTFA 1J08A 1JZWA 5JWRB 3HHVA 2YWOA 1SL1B 1Z6MA 4KAEA 1USBA 2VCWA 5IMFA 5ID2B 1F37A 2C3NA 2WS2A 3ISOA 2Z9SA 1ZL9A 1TJDA 2GQKA 9GSSA 2FD3A 3F3QA 3W6GA 2VIMA 1W89A 4AF2A 3CYNA 3N5OA 4ZL8A 4KUNA 2YN1A 2HSYA 4P3YB 2OE1A 4IJIA 2FLSA 4JU5A 4G0KA 3EYTA 1SL0B 3G9BA 5JCGA 2GT5A 5G5EA 2GDRA 1WRYA 3DVWA 4GQCA 5J9CA 1TP9A 2JL4A 1SL2B 4DSSB 5G31A 1FAAA 2DLXA 1ZCPA 2C1YA 1GSEA 3BJ5A 1ON4A 1OVNA 3IBHA 1PKZA 3ZRDA 1PQNA 2R0CA 3R3EA 1A2JA 3CBUA 2FWGA 1SYXA 3TJBA 1C72A 2GZZA 4GRFA 1WOUA 1OAZA 5IPHA 4L0UA 3E3EA 3IAM2 2YNXA 2HRAA 5HR0A 3D22A 1SK0A 6GSXA 1NM3A 1Y6EA 2RUEA 3TKPA 3GIXA 2LQOA 2CZ3A 1KNGA 3V1WA 1BG5A 1GTAA 4HJ2A 1GTBA 3LQ7A 3ERWA 2HXKA 4YQMA 1B48A 2ON5A 3ZFBA 3QFAC 2C0FA 3H4KA 2L5OA 4NPBA 3I43A 1H75A 3KH9A 4TW5A 1XWBA 5ELGA 4PQ1A 1ZMAA 2HZFA 4OO5A 1GTIA 4TXOB 2PVQA 4GF0A 3ZL5A 2LRTA 1EGOA 4WEYA 1J0FA 4HEA2 3H1NA 5IO2A 4LMVA 2HT9A 1TI3A 4MZBA 1PX6A 3FMWA 2YPMA 1TXXA 3RHCA 2R0PA 3CSHA 2B5XA 4L5OA 1KTEA 1LU4A 4Z7XA 3TKSA 4FO5A 3IR4A 4HQZA 2F9SA 3L9SA 4ML6A 2EIRA 2WDUA 5D9XA 3ZFLA 5CRGA 3VURA 2CVBA 2LKUA 3ERFA 2DBCA 4TKYA 1MTCA 4D73B 2VAFA 4TR3A 3QMXA 5DAKA 4OFNA 1DSBA 1I5GA 3VI5A 2HFDA 2DKIA 3ZITA 2V6OA 1FB6A 5FHIA 4G2EA 4G0IA 5CYYA 4RQXA 3FEUA 2R2JA 5G1LA 3F63A 2X4AA 3TRPA 2P5QA 1VF4A 3MNGA 4KW6A 5ECRB 5IM9A 3GNJA 5AGYA 1TK8B 4MNNA 4AJ7A 4F0BA 3M9JA 4KGIA 1GSQA 3CRTA 2VO4A 3Q6OA 5ECPB 2IPAA 2YWIA 5D9TA 1JZOA 1N2AA 5DCHA 3US3A 2V2GA 4NHZA 3WD6A 2OADA 4CY8A 3WGXA 2D2ZA 2REMA 1A0FA 2R4VA 3NOFA 2OE3A 2NTOA 2YP6A 4N10A 3H8QA 2CVKA 5KN0A 3TJJA 2OKAA 2O85A 3M1GA 1X0RA 2JU5A 2B7KA 3LORA 3FKFA 4RI6A 3DEXA 5CRWA 3ZREA 1N8JA 1XVQA 1SD9A 4BVXB 3F4SA 4F82A 5DQYA 4BL7B 5ECNB 2QGVA 1SENA 4O5UA 4TVEA 2IMEA 1SK2A 4LL1B 2M72A 1RQMA 2CT6A 4NXIA 1MD4A 1YJ6A 16GSA 1GLQA 4YKGA 1Q98A 2GSQA 5DALB 4WBRD 1TOFA 4E8HA 3DRNA 3QR6A 2OJLA 1E6BA 1A0RP 4JR6A 2J23A 5JCWA 5KN1A 1UVZA 1VF2A 4ZL7A 6GSTA 1LBKA 1U88A 3EE2A 4G10A 4HDEA 1G7EA 1HNCA 4KSMA 2L5LA 2V41A 3CTGA 2HRNA 4L8EA 1QQ2A 3WYWA 2AAWA 2GQLA 4TR1A 3HYPA 5EVOA 4KDUA 1VF1A 1HQOA 2WRTA 1PL2A 5EPFA 1TK5B 3UAPA 4FQUA 2FGXA 3GKNA 3D5JA 2P5RA 1B8XA 1YKAA 3WGDA 3F9UA 3OR5A 5B7CA 4AJ8A 2WCIA 3L4NA 4PNGA 2UZ8A 4IHUA 4MF7A 1EV4A 1IYHA 1K0OA 4MJEA 1YEPA 4ACSA 2RM5A 4POLA 2PUKC 1ST9A 5DVBA 3KH7A 1KBNA 2GGTA 2OBKA 1YKCA 3GL5A 3P7XA 1OE8A 2MBSA 1GSDA 4GCIA 2H66A 5ECMB 1JZDA 3F0IA 4XHMA 1SU9A 1M7TA 3ME7A 2GQMA 4USSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSV A;  3KP9 A;  3K8N A;  7GSS A;  2H1A A;  3ZVJ A;  1FB0 A;  5AIS A;  2OAC A;  1G0T A;  1R4W A;  3ZML A;  2ZCT A;  4KDY A;  1BAY A;  4HU7 A;  2CVD A;  1WMJ A;  1MEK A;  1ML6 A;  5J4U A;  4ECB A;  1FVJ A;  2DJ3 A;  2PGT A;  2AUV A;  4IJ3 A;  2TIR A;  4Q5R A;  1GSF A;  3IA1 A;  1Z6N A;  4EF0 A;  1A2L A;  1EV9 A;  1ERV A;  4FH8 A;  4ZXG A;  3TKR A;  3WGE A;  3LXZ A;  2R37 A;  4KE3 A;  4N0Z A;  1CQH A;  1ABA A;  2YCD A;  4H86 A;  2WZ9 A;  3MSZ A;  2HRF A;  1MDI A;  3EIN A;  2DC5 A;  1ZGN A;  4MA9 A;  2PWJ A;  3MDK A;  4J2F A;  4MMM A;  4HU9 A;  3FHK A;  2I4A A;  3VWU A;  1OC9 A;  2FWF A;  1UN2 A;  2VCV A;  2JZR A;  2PBJ A;  6GSU A;  4YAP A;  1S3C A;  1M9A A;  4POM A;  2B1K A;  1X9W B;  3IXR A;  4MAB A;  5B6M A;  3IOS A;  3BCK A;  2VCZ A;  3D4M A;  4XS6 A;  1TU7 A;  4XTS A;  4RQR A;  3M9K A;  3GSS A;  3ZVJ D;  2HE3 A;  2YZH A;  4KCA A;  1VF3 A;  3LGC A;  1GLP A;  2GT6 A;  3VWW A;  1WPI A;  4HQS A;  1K3Y A;  2KP1 A;  5CP1 A;  5D9V A;  1PSQ A;  2C0E A;  3RAZ A;  3GYK A;  3W8S A;  4KX4 A;  1XFL A;  5ECO B;  4EVM A;  4IP1 A;  3D21 A;  5IO0 A;  11GS A;  1FW1 A;  2C0G A;  5AIX A;  1UA5 A;  3RPN A;  5L71 A;  4DVC A;  3FK8 A;  4PQH A;  4PXO A;  2MZC A;  2H1D A;  2CX4 A;  5GAP D;  2AYT A;  5B6N A;  3NIV A;  4X1U A;  2LNS A;  5F06 A;  3GTU B;  2PMT A;  4MPG A;  2LNT A;  3E0U A;  5IMC A;  2H1B A;  2P0G A;  6GSS A;  2LV3 A;  1T00 A;  4GTU A;  1K0A A;  1ZYE A;  1PL1 A;  3LWA A;  2E2M A;  4ZB9 A;  4K7N A;  4MCU A;  2DJJ A;  1O85 A;  4TXV A;  4DEJ A;  5AIV A;  5JWO B;  2IFQ B;  5FWG A;  2FNO A;  2X8G A;  5G30 A;  3QD9 A;  2XBI A;  1GUH A;  5IMV A;  2B5Y A;  5A5K A;  5HQP A;  4G9H A;  5CAX A;  4OO4 A;  2EIO A;  3KD0 A;  1ILO A;  3GA4 A;  3ZLP A;  2ZNM A;  4OWY A;  5GZZ B;  4GSN A;  1EOG A;  4TR0 A;  1ERU A;  4IN0 A;  2BTO T;  3GKX A;  2TRC P;  3VI7 A;  2H74 A;  4MF6 A;  3C8E A;  1PKW A;  2WUL A;  2VL2 A;  3FYG A;  2CQ9 A;  3FR3 A;  3IK7 A;  1SYR A;  1V58 A;  3HJO A;  3EUR A;  4V2M A;  1GH2 A;  1V2A A;  5CRE A;  1XVW A;  4PUR A;  1Y25 A;  5DCG A;  1M2B A;  5ECS A;  3KP8 A;  4X0X A;  1X5C A;  2LQQ A;  1QMV A;  4K9Z A;  1Z7R A;  2H0G A;  3C71 A;  4OMV A;  1TDI A;  3KTB A;  2L59 A;  4V2N A;  1SKS B;  1ACV A;  2MMO A;  1JHB A;  2IWT A;  1GP1 A;  2FCH A;  3HDC A;  2GSS A;  4O7H A;  3J7Y b;  3PIN A;  2H8L A;  5E59 A;  4BA7 A;  2JSY A;  5C04 A;  5B8A A;  1O8W A;  2QKE A;  1W4V A;  4EE0 A;  5A4V A;  2KP2 A;  4L5L A;  3HVV A;  1BJX A;  2RII A;  1OKT A;  3TRX A;  2CV4 A;  2XBQ A;  3E9J B;  2GZY A;  3F4T A;  5G5F A;  1O7U A;  1UC7 A;  1THX A;  2QC7 A;  4PGT A;  3L9U A;  2I1U A;  3A5W A;  5IMZ A;  1OKD A;  1WIK A;  4JRR A;  3F6F A;  2IL3 A;  1G6W A;  3IDV A;  4J57 E;  4D73 A;  4F0C A;  2B1L A;  4I2T A;  4MLY A;  2B5E A;  2MMZ A;  2L4C A;  3HD5 A;  1JLW A;  3M0F A;  4RI7 A;  2CAQ A;  1OYJ A;  4ZBA A;  1TK0 B;  2DJK A;  2LUS A;  3APQ A;  1YZX A;  4KND A;  3P2A A;  2XPD A;  4OD7 A;  2H71 A;  2DJ0 A;  4LA1 A;  4ZB6 A;  3MAK A;  2PPT A;  2YOI A;  4YQU A;  2C80 A;  4WXT A;  1SK1 A;  4MJA A;  3R2Q A;  3D4T A;  5GAN D;  4NHW A;  1XW6 A;  5F05 A;  2B3S A;  4IQA A;  2L57 A;  2X8H A;  4EDZ A;  2A4V A;  2C3Q A;  1Z5Y E;  4N0V A;  4NMU A;  3AY8 A;  1T1V A;  3VK9 A;  4PX1 A;  2R5G A;  2OBI A;  3TJF A;  3U5R E;  2O89 A;  4V1A p;  4NV2 A;  1GUL A;  4XS4 A;  2L4Q A;  6GSW A;  2ON7 A;  2H70 A;  1T3B A;  3QDN A;  3ZTL A;  3WT2 A;  3APO A;  3FY7 A;  2HYX A;  3GUS A;  4EO3 A;  2YAN A;  1F3A A;  4OFM A;  3TJG A;  2AB6 A;  1O6J A;  3HY2 A;  5LCZ A;  2VCX A;  2LTK A;  3LEF A;  5FT3 A;  5ENU A;  1S3D A;  3F6D A;  3J7Y k;  5DAK B;  2O8V B;  4HS1 A;  4TOP A;  2BMX A;  3Q18 A;  1K0N A;  5DAL A;  3F3R A;  3D0Z A;  5GST A;  1K3L A;  14GS A;  5G1K A;  1MDK A;  1PMT A;  1YEX A;  4OCE A;  1XOB A;  2KHP A;  3LXT A;  5EY6 A;  1T7P B;  3RHB A;  4HUA A;  3CMI A;  2IN3 A;  1NHO A;  2YJ7 A;  1QUW A;  12GS A;  3EMP A;  3HZ8 A;  4LL4 B;  1K0C A;  2CZ2 A;  3DWV A;  2RLI A;  3DYR A;  3H93 A;  3QOU A;  2ALB A;  2I81 A;  2AHE A;  4KA0 A;  22GS A;  2H76 A;  4IP6 A;  4IBP A;  1SD8 A;  1Z9H A;  5AN1 A;  1FVK A;  1U3I A;  1R5P A;  3ME8 A;  4EL1 A;  1PD2 1;  2GSR A;  1URM A;  2C8U A;  4I5Q A;  3G7Y A;  1TW9 A;  4HJM A;  17GS A;  3GUR A;  4ZIL A;  1WE0 A;  3GL3 A;  3UMA A;  1AUC A;  1GL8 A;  3EU4 A;  5F07 A;  2I9H A;  1O8X A;  5ECH B;  1PA3 A;  3KGK A;  4ZIJ A;  3C73 A;  4O32 A;  1U6T A;  1QXH A;  5ECK B;  20GS A;  2IMI A;  2N5B A;  1XWK A;  4PUA A;  1PGT A;  3KXO A;  2H0I A;  3ED3 A;  2HZE A;  3TB2 A;  4I97 A;  3DKS A;  5IQY A;  4X43 A;  4BVY A;  4K8M A;  5F0G A;  1AAZ A;  3GFK A;  1EEJ A;  3W8J A;  2H0H A;  2BJX A;  4LLR A;  3RBT A;  5ABR A;  4TR1 B;  2FA8 A;  5HR2 A;  1B9Y C;  1M2A A;  1M9B A;  2R3X A;  1AQX A;  1T4Y A;  2G2Q A;  5COH A;  4O5R A;  2WB9 A;  1KEB A;  2DML A;  3LFL A;  3U6V A;  2YWN A;  3O6T A;  1K0M A;  1JZR A;  3HJP A;  3F8U A;  2JSZ A;  3GHA A;  4ZBB A;  18GS A;  4TR4 A;  1ZYQ B;  5IMD A;  1J9B A;  1AC1 A;  4RUV A;  5D9W A;  1BED A;  3GN3 A;  4V2L A;  1AQW A;  2DJ1 A;  1V9W A;  3HA9 A;  3DXB A;  5E4W A;  5CRD A;  4YQV A;  4MJB A;  3MWH A;  5GSS A;  1T8E B;  5IOX A;  5KN3 A;  4ECJ A;  2H6Y A;  3L9V A;  3C1R A;  4K6X A;  2AV4 A;  5DJL A;  1GTU A;  4L0W A;  2X8C A;  3IHQ A;  1OE7 A;  5H5R A;  1FHE A;  4WF5 A;  2YV7 A;  4XRA A;  5J41 A;  2VLV A;  2PER A;  2GZP A;  1ZOF A;  5CNW A;  3ZIV A;  2GST A;  4EXJ A;  4FYC A;  1VGL A;  3O76 A;  3KMO A;  3L0H A;  4OFT A;  3TKQ A;  1ERW A;  2LS5 A;  5B8B A;  2V6K A;  2B6M A;  1CQG A;  3A2X A;  3EMX A;  3IE3 A;  3TJK A;  2C3T A;  4EKZ A;  3EC3 A;  3UVH A;  3IRA A;  2H19 A;  5IMA A;  3FW2 A;  4JED A;  3UAR A;  4TRX A;  2L6D A;  1GNW A;  2LEG A;  1XPV A;  3ZIJ A;  5LD0 A;  1A2M A;  3ZMK A;  3LYP A;  3HJM A;  1EGR A;  1XBS A;  2FUG 2;  2DJ2 A;  3GTU A;  4K2D A;  1F9M A;  5D93 A;  1NHY A;  4WBJ A;  2GVP A;  1F3B A;  5ELA A;  5A4U A;  4PUF C;  2TRX A;  2VUP A;  4E8E A;  5G2Z A;  1OC9 B;  5CO3 A;  3SWL A;  3VPQ A;  2VLT A;  4GQF A;  4KB3 A;  3CXG A;  5D96 A;  4CDO A;  5ID2 A;  3JCM L;  2M46 A;  1ERT A;  5J5N A;  2IFQ A;  4F2I A;  4K7I A;  2KUC A;  4IKH A;  2CAI A;  3QCP A;  1GWC A;  1GNE A;  1MD3 A;  3TOT A;  1DE2 A;  2F8A A;  2XHF A;  2VD1 A;  2E2G A;  1QGV A;  2MYG A;  1A8L A;  2X99 A;  1X5D A;  5KN2 A;  1TRU A;  4V1A g;  3EWL A;  1TKD B;  4QL9 A;  3TDG A;  1A24 A;  2H72 A;  3A3T A;  3UOM A;  2H30 A;  4DSS A;  5A4W A;  5HFK A;  4AJ6 A;  1I9D A;  1GSU A;  4GXZ A;  2PU9 C;  1T4Z A;  2N5F A;  3GH6 A;  3VFI A;  4DSQ A;  3QAW A;  3D6I A;  3KCM A;  2CA8 A;  2NVL A;  1TI1 A;  3KZQ A;  1NW2 A;  1XZO A;  4Q5N A;  1GUM A;  3C7M A;  1FOV A;  2NDO A;  4FYU A;  4JBB A;  1RW1 A;  2LJK A;  2A2S A;  4IGJ A;  2PVO C;  4EUY A;  2VCQ A;  3IPZ A;  3I6A A;  1TRW A;  4QL7 A;  1GSS A;  1OC8 A;  5DDL A;  3UL3 A;  3HVS A;  1DBY A;  3M3M A;  3F4R A;  3APS A;  3FR9 A;  1DE1 A;  1YY7 A;  4EDY A;  3GST A;  3DIE A;  3H79 A;  5ECQ B;  4K0N A;  4MPF A;  4NWY A;  4WKW A;  4NV5 A;  4HI7 A;  3PGT A;  2HNL A;  3HZ4 A;  4KDX A;  5IIZ A;  1HYU A;  4I8B A;  2YV9 A;  4BWQ A;  3LJR A;  3M8N A;  4TXO A;  4ILF A;  4HOJ A;  1EOH A;  4GLT A;  3TOU A;  5HR1 A;  1TRS A;  5EL8 A;  2N5A A;  2K8V A;  2LJR A;  2VCT A;  4XS1 A;  2NPB A;  3LG6 A;  3GKK A;  4F9Z A;  1X5E A;  1PX7 A;  1IYI A;  1XCC A;  3VLN A;  1V98 A;  1XOA A;  4MF5 A;  3TUE A;  3RDW A;  3HCZ A;  3I9V 2;  1WJK A;  4WF4 A;  3DVX A;  1XWA A;  8GSS A;  2DIY A;  4I2U A;  5IPG A;  1M99 A;  3G7J A;  4FYB A;  3HXS A;  19GS A;  2GLR A;  13GS A;  2ZUP A;  2LRN A;  3FZA A;  2ES7 A;  2FHE A;  5DQS A;  4G19 A;  1X9S B;  4JE1 A;  2K6V A;  3DD3 A;  3GX0 A;  1BYE A;  1U3A A;  1XXU A;  1AIU A;  1BX9 A;  3KMN A;  2IMK A;  4IQ1 A;  1YQ1 A;  1EP7 A;  1WWJ A;  1R5A A;  2V32 A;  3P90 A;  3N9J A;  2P31 A;  4GSS A;  4WET A;  2I3Y A;  3UVT A;  2VM2 A;  2FWH A;  2G0F A;  4XIH A;  3EU3 A;  4POK A;  4I6X A;  2VL2 C;  1K0B A;  4K0G A;  4IVF A;  1BQ7 A;  4Q5F A;  1HNB A;  4ZBD A;  1FG4 A;  2DMM A;  3ZZX A;  1G6Y A;  1TRV A;  2K18 A;  2H6Z A;  3QAG A;  4N30 A;  3CSI A;  3NZN A;  3UJ1 A;  1OC3 A;  1Z7P A;  5LNK e;  2JZT A;  2VM1 A;  1EEM A;  3DML A;  3GV1 A;  2FWE A;  4MH2 A;  4AGS A;  3UBL A;  4HZ2 A;  1O81 A;  1S3A A;  1H4O A;  3L78 A;  5DBQ A;  3PH9 A;  4WR4 A;  2GS3 A;  1XW5 A;  4GWR A;  4BVX A;  3VWV A;  4BL7 A;  4ML1 A;  3UIW A;  1GRX A;  1G7O A;  1EP8 A;  3SBC A;  1O73 A;  2JZS A;  3KTL A;  4BWS A;  2EIQ A;  1SKR B;  2AJQ B;  5J3R A;  1NSW A;  5INY A;  2DSA A;  3HKR A;  2OA7 A;  2H75 A;  2RUF A;  5KEJ A;  3CSJ A;  5HR3 A;  1M0U A;  5H5S A;  1A23 A;  5D8I A;  3EVI A;  2WFC A;  3BD2 A;  3UBK A;  3QFB C;  4K1F A;  3LSZ A;  3S9F A;  4ULX A;  4WR5 A;  2MBT A;  4XS4 B;  2QSI A;  3GH9 A;  1QK8 A;  1THO A;  3IC4 A;  3IV4 A;  3GRX A;  4GST A;  1FO5 A;  3TKS C;  4EC0 A;  3A2W A;  1XIY A;  2O87 A;  3Q74 A;  1WP0 A;  1R7H A;  2F8F A;  3FZ5 A;  4HZ4 A;  2DIZ A;  1U87 A;  2MMA A;  1B4P A;  2O7K A;  2FA4 A;  2IMD A;  2H1G A;  1PN9 A;  4O92 A;  5JWQ B;  4TN8 A;  2IJY A;  5J9B A;  4QQ7 A;  2A2R A;  3WT1 A;  4MH3 A;  4K7O A;  1A8Y A;  4JR4 A;  3RPP A;  1AW9 A;  4ECC A;  1GSY A;  4ISD A;  2JAC A;  4PQI A;  3KEB A;  3UEM A;  1EZK A;  1XWG A;  3QAV A;  4Q5Q A;  1SJ6 A;  2VLU A;  10GS A;  3IK9 A;  2E0Q A;  2X64 A;  5H5Q A;  1B9X C;  4IW9 A;  5JCU A;  5HFG A;  4DSR A;  1HD2 A;  1GUK A;  5DJM A;  2YWM A;  2M80 A;  1V57 A;  1SJI A;  2L6C A;  1K0D A;  2C4J A;  4FIW A;  3DGQ A;  2PN8 A;  2CX3 A;  1TTZ A;  4CW9 A;  1SKW B;  4ZL9 A;  1MDJ A;  1X9M B;  4NAX A;  2H73 A;  3CRU A;  1V40 A;  2LRC A;  5C00 A;  2E7P A;  6GSY A;  1QFN A;  3GMF A;  3FZ9 A;  4XRD A;  3KM6 A;  1F6M C;  3QPM A;  2MMN A;  3BOA A;  1VRS D;  1E2Y A;  4XCS A;  4POB A;  2LST A;  2LJA A;  4YH2 A;  1RK4 A;  1YF1 A;  2H01 A;  2HZE B;  3BCI A;  1B4Q A;  4J56 E;  2HI7 A;  4ECI A;  3ZYW A;  4LMW A;  1JFU A;  3HVX A;  4JZQ A;  2VD0 A;  1SJZ A;  2EC4 A;  3FRC A;  4MP4 A;  1HNA A;  5CRH A;  4MZW A;  1YF0 A;  1ZZY A;  5F8B A;  1K3O A;  1Z3E A;  3FZ4 A;  1Q4J A;  5HFI A;  4MJC A;  3G7I A;  3P8W A;  3TGZ A;  3PR8 A;  3O3T A;  4KSO A;  1LJR A;  2H6X A;  4F03 A;  1R26 A;  3VWX A;  3C1S A;  4ID0 A;  2B7J A;  1JLV A;  1YDK A;  3TRQ A;  3A2V A;  3TCO A;  2HSH A;  4KH7 A;  2IIY A;  4MZC A;  2OE0 A;  5D73 A;  2GTU A;  4BPY A;  2HLS A;  4MK3 A;  2J9H A;  1DUG A;  4MDC A;  5IOW A;  2VOC A;  2F51 A;  2R6K A;  3LYK A;  4IS0 A;  2JAD A;  2IMF A;  2V1M A;  4N11 A;  4IEL A;  3ERG A;  3GX8 A;  5ECL B;  2YJH A;  1AQV A;  3KJY A;  3TKS E;  2XC2 A;  2NBS A;  3KIJ A;  3IAS 2;  4CHS A;  1AXD A;  2VL3 A;  1EWX A;  5ECI B;  1TU8 A;  4YAV A;  2KLX A;  1XW9 A;  1F2E A;  2C0D A;  3Q19 A;  2WGR A;  2F3M A;  2FY6 A;  4PNF A;  1XWC A;  2K9F A;  4OCF A;  4ZB8 A;  2WJU A;  1M2D A;  2K8S A;  4KCE A;  2YZU A;  3BBY A;  3FR6 A;  2VL9 A;  1PRX A;  3I69 A;  2XPE A;  2RM6 A;  3GKM A;  3VPT A;  2KOK A;  3CTF A;  1J08 A;  1JZW A;  5JWR B;  3HHV A;  2YWO A;  1SL1 B;  1Z6M A;  4KAE A;  1USB A;  2VCW A;  5IMF A;  5ID2 B;  1F37 A;  2C3N A;  2WS2 A;  3ISO A;  2Z9S A;  1ZL9 A;  1TJD A;  2GQK A;  9GSS A;  2FD3 A;  3F3Q A;  3W6G A;  2VIM A;  1W89 A;  4AF2 A;  3CYN A;  3N5O A;  4ZL8 A;  4KUN A;  2YN1 A;  2HSY A;  4P3Y B;  2OE1 A;  4IJI A;  2FLS A;  4JU5 A;  3EYT A;  1SL0 B;  3G9B A;  5JCG A;  2GT5 A;  5G5E A;  2GDR A;  1WRY A;  3DVW A;  4GQC A;  5J9C A;  1TP9 A;  2JL4 A;  1SL2 B;  4DSS B;  5G31 A;  1FAA A;  2DLX A;  1ZCP A;  2C1Y A;  1GSE A;  3BJ5 A;  1ON4 A;  1OVN A;  3IBH A;  1PKZ A;  3ZRD A;  1PQN A;  1A2J A;  3CBU A;  2FWG A;  1SYX A;  3TJB A;  1C72 A;  2GZZ A;  4GRF A;  1WOU A;  1OAZ A;  5IPH A;  4L0U A;  3E3E A;  3IAM 2;  2YNX A;  5HR0 A;  3D22 A;  1SK0 A;  6GSX A;  1NM3 A;  1Y6E A;  2RUE A;  3TKP A;  3GIX A;  2LQO A;  2CZ3 A;  1KNG A;  3V1W A;  1BG5 A;  1GTA A;  4HJ2 A;  1GTB A;  3LQ7 A;  3ERW A;  2HXK A;  4YQM A;  1B48 A;  2ON5 A;  3ZFB A;  3QFA C;  2C0F A;  3H4K A;  2L5O A;  4NPB A;  3I43 A;  1H75 A;  3KH9 A;  4TW5 A;  1XWB A;  5ELG A;  4PQ1 A;  1ZMA A;  2HZF A;  4OO5 A;  1GTI A;  4TXO B;  2PVQ A;  4GF0 A;  3ZL5 A;  2LRT A;  1EGO A;  4WEY A;  1J0F A;  4HEA 2;  3H1N A;  5IO2 A;  4LMV A;  2HT9 A;  1TI3 A;  4MZB A;  1PX6 A;  2YPM A;  1TXX A;  3RHC A;  3CSH A;  2B5X A;  4L5O A;  1KTE A;  1LU4 A;  4Z7X A;  3TKS A;  4FO5 A;  3IR4 A;  4HQZ A;  2F9S A;  3L9S A;  4ML6 A;  2EIR A;  2WDU A;  5D9X A;  3ZFL A;  5CRG A;  3VUR A;  2CVB A;  2LKU A;  3ERF A;  2DBC A;  4TKY A;  1MTC A;  4D73 B;  2VAF A;  4TR3 A;  3QMX A;  5DAK A;  4OFN A;  1DSB A;  1I5G A;  3VI5 A;  2HFD A;  3ZIT A;  2V6O A;  1FB6 A;  5FHI A;  4G2E A;  5CYY A;  4RQX A;  3FEU A;  2R2J A;  5G1L A;  3F63 A;  3TRP A;  2P5Q A;  1VF4 A;  3MNG A;  4KW6 A;  5ECR B;  5IM9 A;  3GNJ A;  5AGY A;  1TK8 B;  4AJ7 A;  4F0B A;  3M9J A;  4KGI A;  1GSQ A;  3CRT A;  2VO4 A;  3Q6O A;  5ECP B;  2IPA A;  2YWI A;  5D9T A;  1JZO A;  1N2A A;  5DCH A;  3US3 A;  2V2G A;  4NHZ A;  3WD6 A;  2OAD A;  3WGX A;  2D2Z A;  2REM A;  1A0F A;  2R4V A;  3NOF A;  2OE3 A;  2NTO A;  2YP6 A;  4N10 A;  3H8Q A;  2CVK A;  5KN0 A;  3TJJ A;  2OKA A;  2O85 A;  3M1G A;  1X0R A;  2JU5 A;  2B7K A;  3LOR A;  3FKF A;  4RI6 A;  3DEX A;  5CRW A;  3ZRE A;  1N8J A;  1XVQ A;  1SD9 A;  3F4S A;  4F82 A;  5DQY A;  5ECN B;  2QGV A;  1SEN A;  4TVE A;  2IME A;  1SK2 A;  4LL1 B;  2M72 A;  1RQM A;  2CT6 A;  4NXI A;  1MD4 A;  1YJ6 A;  16GS A;  1GLQ A;  1Q98 A;  2GSQ A;  5DAL B;  4WBR D;  1TOF A;  4E8H A;  3DRN A;  3QR6 A;  2OJL A;  1E6B A;  1A0R P;  4JR6 A;  2J23 A;  5JCW A;  5KN1 A;  1UVZ A;  1VF2 A;  4ZL7 A;  6GST A;  1LBK A;  1U88 A;  3EE2 A;  4G10 A;  4HDE A;  1G7E A;  1HNC A;  4KSM A;  2L5L A;  2V41 A;  3CTG A;  2HRN A;  4L8E A;  1QQ2 A;  3WYW A;  2AAW A;  2GQL A;  4TR1 A;  3HYP A;  5EVO A;  4KDU A;  1VF1 A;  1HQO A;  2WRT A;  1PL2 A;  5EPF A;  1TK5 B;  3UAP A;  2FGX A;  3GKN A;  3D5J A;  2P5R A;  1B8X A;  1YKA A;  3WGD A;  3F9U A;  3OR5 A;  5B7C A;  4AJ8 A;  2WCI A;  3L4N A;  4PNG A;  4MF7 A;  4IHU A;  1EV4 A;  1IYH A;  1K0O A;  4MJE A;  1YEP A;  4ACS A;  2RM5 A;  4POL A;  2PUK C;  1ST9 A;  5DVB A;  3KH7 A;  1KBN A;  2GGT A;  2OBK A;  1YKC A;  3GL5 A;  3P7X A;  1OE8 A;  2MBS A;  1GSD A;  4GCI A;  2H66 A;  5ECM B;  1JZD A;  3F0I A;  4XHM A;  1SU9 A;  1M7T A;  3ME7 A;  2GQM A; 
#chains in the Genus database with same CATH topology
 6GSV A;  3KP9 A;  3K8N A;  7GSS A;  2H1A A;  3ZVJ A;  1FB0 A;  5AIS A;  2OAC A;  1G0T A;  1R4W A;  3ZML A;  2ZCT A;  4KDY A;  1BAY A;  4HU7 A;  2CVD A;  1WMJ A;  1MEK A;  1ML6 A;  5J4U A;  4ECB A;  1FVJ A;  2DJ3 A;  2PGT A;  2AUV A;  4IJ3 A;  2TIR A;  4Q5R A;  1GSF A;  3IA1 A;  1Z6N A;  4EF0 A;  1A2L A;  1EV9 A;  1ERV A;  4FH8 A;  4ZXG A;  3TKR A;  3WGE A;  2QA2 A;  3LXZ A;  2R37 A;  4KE3 A;  4N0Z A;  1CQH A;  1ABA A;  2YCD A;  4H86 A;  2WZ9 A;  3MSZ A;  2HRF A;  1MDI A;  3EIN A;  2DC5 A;  1ZGN A;  4MA9 A;  4X4J A;  2PWJ A;  3MDK A;  4J2F A;  4MMM A;  4HU9 A;  3FHK A;  2I4A A;  3VWU A;  1OC9 A;  2FWF A;  1UN2 A;  2VCV A;  2JZR A;  2PBJ A;  6GSU A;  4YAP A;  1S3C A;  1M9A A;  4POM A;  2B1K A;  1X9W B;  3IXR A;  4MAB A;  5B6M A;  3IOS A;  3BCK A;  2VCZ A;  3D4M A;  4XS6 A;  1TU7 A;  4XTS A;  4RQR A;  3M9K A;  3GSS A;  3ZVJ D;  2HE3 A;  2YZH A;  4KCA A;  1VF3 A;  3LGC A;  1GLP A;  2GT6 A;  3VWW A;  1WPI A;  4HQS A;  1K3Y A;  2KP1 A;  5CP1 A;  5D9V A;  1PSQ A;  2C0E A;  3RAZ A;  3GYK A;  3W8S A;  4KX4 A;  1XFL A;  5ECO B;  4EVM A;  4IP1 A;  3D21 A;  5IO0 A;  11GS A;  1FW1 A;  2C0G A;  5AIX A;  1UA5 A;  3RPN A;  5L71 A;  4DVC A;  3FK8 A;  4PQH A;  4PXO A;  2MZC A;  2H1D A;  2CX4 A;  5GAP D;  2AYT A;  5B6N A;  3NIV A;  4X1U A;  2LNS A;  5F06 A;  3GTU B;  2PMT A;  4MPG A;  2LNT A;  3E0U A;  5IMC A;  2H1B A;  2P0G A;  6GSS A;  2LV3 A;  1T00 A;  4GTU A;  1K0A A;  1ZYE A;  1PL1 A;  3LWA A;  2E2M A;  4ZB9 A;  4K7N A;  4MCU A;  2DJJ A;  1O85 A;  4TXV A;  4DEJ A;  5AIV A;  5JWO B;  2IFQ B;  5FWG A;  2FNO A;  2X8G A;  5G30 A;  3QD9 A;  2XBI A;  1GUH A;  1M3J A;  5IMV A;  2B5Y A;  5A5K A;  5HQP A;  4G9H A;  5CAX A;  4OO4 A;  2EIO A;  3KD0 A;  1ILO A;  3GA4 A;  3ZLP A;  2ZNM A;  4OWY A;  5GZZ B;  4GSN A;  1EOG A;  1PFO A;  4TR0 A;  1ERU A;  4IN0 A;  2BTO T;  3GKX A;  2TRC P;  3VI7 A;  2H74 A;  4MF6 A;  3C8E A;  1PKW A;  2WUL A;  2VL2 A;  3FYG A;  2CQ9 A;  3FR3 A;  3IK7 A;  1SYR A;  1V58 A;  3HJO A;  3EUR A;  4V2M A;  4A5P A;  1GH2 A;  1V2A A;  5CRE A;  1XVW A;  4PUR A;  1Y25 A;  5DCG A;  1M2B A;  5ECS A;  3KP8 A;  4X0X A;  1X5C A;  2LQQ A;  1QMV A;  4K9Z A;  1Z7R A;  2H0G A;  4PTS A;  3C71 A;  1FOH A;  4OMV A;  1TDI A;  3KTB A;  2L59 A;  4V2N A;  1SKS B;  1ACV A;  2MMO A;  1JHB A;  2IWT A;  1GP1 A;  2FCH A;  3HDC A;  2GSS A;  4O7H A;  3J7Y b;  3PIN A;  2H8L A;  5E59 A;  4BA7 A;  2JSY A;  5C04 A;  5B8A A;  1O8W A;  2QKE A;  1W4V A;  4EE0 A;  5A4V A;  2KP2 A;  4L5L A;  3HVV A;  1BJX A;  2RII A;  1OKT A;  3TRX A;  2CV4 A;  2XBQ A;  3E9J B;  2GZY A;  3F4T A;  5G5F A;  1O7U A;  1UC7 A;  1THX A;  2QC7 A;  4PGT A;  3L9U A;  2I1U A;  3A5W A;  5IMZ A;  1OKD A;  4K5R A;  1WIK A;  4JRR A;  3F6F A;  2IL3 A;  1G6W A;  3IDV A;  4J57 E;  4D73 A;  4F0C A;  2B1L A;  4I2T A;  4MLY A;  2B5E A;  4ICY A;  2MMZ A;  2L4C A;  3HD5 A;  1JLW A;  3M0F A;  4RI7 A;  2CAQ A;  1OYJ A;  4ZBA A;  1TK0 B;  2DJK A;  2LUS A;  3HVN A;  3APQ A;  1YZX A;  4KND A;  3P2A A;  2XPD A;  4OD7 A;  2H71 A;  2DJ0 A;  4LA1 A;  4ZB6 A;  3MAK A;  2PPT A;  2YOI A;  4YQU A;  2C80 A;  4WXT A;  1SK1 A;  4MJA A;  3R2Q A;  3D4T A;  5GAN D;  4NHW A;  1XW6 A;  5F05 A;  2B3S A;  4IQA A;  2L57 A;  2X8H A;  4EDZ A;  4Z2T A;  2A4V A;  2C3Q A;  1Z5Y E;  4N0V A;  4NMU A;  3AY8 A;  1T1V A;  3VK9 A;  4PX1 A;  2R5G A;  2OBI A;  3TJF A;  3U5R E;  2O89 A;  4V1A p;  4NV2 A;  1GUL A;  4XS4 A;  2L4Q A;  6GSW A;  2ON7 A;  2H70 A;  1T3B A;  3QDN A;  3ZTL A;  3WT2 A;  3APO A;  3FY7 A;  2HYX A;  3GUS A;  4EO3 A;  2YAN A;  1F3A A;  4OFM A;  3TJG A;  2AB6 A;  1O6J A;  3HY2 A;  5LCZ A;  2VCX A;  4O5Q A;  2LTK A;  3LEF A;  5FT3 A;  5ENU A;  1S3D A;  3F6D A;  3J7Y k;  5DAK B;  2O8V B;  4HS1 A;  4TOP A;  2BMX A;  3Q18 A;  1K0N A;  5DAL A;  3F3R A;  3D0Z A;  5GST A;  1K3L A;  14GS A;  5G1K A;  1MDK A;  1PMT A;  3MIX A;  1YEX A;  4OCE A;  1XOB A;  2KHP A;  3LXT A;  1M3I A;  5EY6 A;  1T7P B;  3RHB A;  4HUA A;  3CMI A;  2IN3 A;  1NHO A;  2YJ7 A;  1QUW A;  12GS A;  3EMP A;  3HZ8 A;  4LL4 B;  1K0C A;  4KF9 A;  2CZ2 A;  3DWV A;  2RLI A;  3DYR A;  3H93 A;  3QOU A;  2ALB A;  4K2X A;  2I81 A;  2AHE A;  4KA0 A;  22GS A;  2H76 A;  4IP6 A;  4IBP A;  1SD8 A;  1Z9H A;  5AN1 A;  1FVK A;  1U3I A;  4CY6 A;  1R5P A;  3ME8 A;  4EL1 A;  1PD2 1;  2GSR A;  1URM A;  2C8U A;  4I5Q A;  3G7Y A;  1TW9 A;  4HJM A;  17GS A;  3GUR A;  4ZIL A;  1WE0 A;  3GL3 A;  3UMA A;  1AUC A;  1GL8 A;  3EU4 A;  5F07 A;  2I9H A;  1O8X A;  5ECH B;  1PA3 A;  3KGK A;  4ZIJ A;  3C73 A;  4O32 A;  1U6T A;  1QXH A;  5ECK B;  20GS A;  2IMI A;  2N5B A;  1XWK A;  4PUA A;  1PGT A;  3KXO A;  2H0I A;  3ED3 A;  2HZE A;  3TB2 A;  4I97 A;  3DKS A;  5IQY A;  4HSC X;  4X43 A;  4BVY A;  4K8M A;  1ZYN A;  5F0G A;  1AAZ A;  3GFK A;  1EEJ A;  3W8J A;  1XG8 A;  2H0H A;  2BJX A;  4LLR A;  3RBT A;  5ABR A;  4TR1 B;  2FA8 A;  5HR2 A;  1B9Y C;  1M2A A;  1M9B A;  2R3X A;  1AQX A;  1T4Y A;  2G2Q A;  5COH A;  4O5R A;  2WB9 A;  1KEB A;  2DML A;  3LFL A;  3U6V A;  2YWN A;  3O6T A;  1K0M A;  1JZR A;  3HJP A;  4YKF A;  3F8U A;  2JSZ A;  3GHA A;  4ZBB A;  18GS A;  2R0G A;  4TR4 A;  1ZYQ B;  5IMD A;  1J9B A;  1AC1 A;  4RUV A;  5D9W A;  1BED A;  3GN3 A;  4V2L A;  1AQW A;  2DJ1 A;  1V9W A;  3HA9 A;  3DXB A;  5E4W A;  5CRD A;  4YQV A;  4MJB A;  3MWH A;  5GSS A;  1T8E B;  5IOX A;  5KN3 A;  4ECJ A;  2H6Y A;  3L9V A;  3C1R A;  4K6X A;  2AV4 A;  1PN0 A;  5DJL A;  1GTU A;  4L0W A;  2X8C A;  3IHQ A;  1OE7 A;  2A4H A;  5H5R A;  1FHE A;  4WF5 A;  2YV7 A;  4XRA A;  5J41 A;  2VLV A;  2PER A;  2GZP A;  1ZOF A;  5CNW A;  3ZIV A;  2GST A;  4EXJ A;  4FYC A;  1VGL A;  3O76 A;  3KMO A;  3L0H A;  4OFT A;  3TKQ A;  1ERW A;  2LS5 A;  5B8B A;  2V6K A;  2B6M A;  1CQG A;  3A2X A;  3EMX A;  3IE3 A;  3TJK A;  2C3T A;  4EKZ A;  3EC3 A;  3UVH A;  3IRA A;  2H19 A;  5IMA A;  3FW2 A;  4JED A;  3UAR A;  4TRX A;  2L6D A;  1GNW A;  2LEG A;  1XPV A;  5BRT A;  3ZIJ A;  5LD0 A;  1A2M A;  3ZMK A;  3LYP A;  3HJM A;  1EGR A;  1XBS A;  2FUG 2;  2DJ2 A;  3GTU A;  4K2D A;  1F9M A;  5D93 A;  1NHY A;  2HSM A;  4WBJ A;  2GVP A;  1F3B A;  5ELA A;  5A4U A;  4PUF C;  2TRX A;  2VUP A;  4E8E A;  5G2Z A;  1OC9 B;  5CO3 A;  3SWL A;  3VPQ A;  2VLT A;  4GQF A;  4KB3 A;  3CXG A;  5D96 A;  4CDO A;  5ID2 A;  3JCM L;  2M46 A;  1ERT A;  5J5N A;  2IFQ A;  2HRK A;  4F2I A;  4K7I A;  2KUC A;  4IKH A;  2CAI A;  3QCP A;  1GWC A;  1GNE A;  1MD3 A;  3TOT A;  1DE2 A;  1ZYP A;  2F8A A;  2XHF A;  2VD1 A;  4K5S A;  2E2G A;  1QGV A;  2MYG A;  1A8L A;  2X99 A;  1X5D A;  3MYD A;  5KN2 A;  1TRU A;  4V1A g;  3EWL A;  1TKD B;  4QL9 A;  3TDG A;  1A24 A;  2H72 A;  3A3T A;  3UOM A;  2H30 A;  4DSS A;  5A4W A;  5HFK A;  4AJ6 A;  4Z2R A;  1I9D A;  3IHG A;  1GSU A;  4GXZ A;  2PU9 C;  1T4Z A;  2N5F A;  3GH6 A;  3VFI A;  4DSQ A;  3QAW A;  3D6I A;  3KCM A;  2CA8 A;  2NVL A;  1TI1 A;  3KZQ A;  1NW2 A;  1XZO A;  4Q5N A;  1GUM A;  3CQF A;  3C7M A;  1FOV A;  2NDO A;  4FYU A;  4JBB A;  1RW1 A;  2LJK A;  2A2S A;  4IGJ A;  2PVO C;  4EUY A;  2VCQ A;  3IPZ A;  3I6A A;  1TRW A;  4QL7 A;  1GSS A;  1OC8 A;  5DDL A;  3UL3 A;  3HVS A;  1DBY A;  3M3M A;  3F4R A;  3APS A;  3FR9 A;  1DE1 A;  1YY7 A;  4EDY A;  3GST A;  3DIE A;  3A5I A;  3H79 A;  4K0N A;  5ECQ B;  4MPF A;  4NWY A;  4WKW A;  4NV5 A;  4HI7 A;  3PGT A;  2HNL A;  3HZ4 A;  4KDX A;  5IIZ A;  1HYU A;  4I8B A;  2YV9 A;  4BWQ A;  3LJR A;  3M8N A;  4TXO A;  4ILF A;  4HOJ A;  1EOH A;  4GLT A;  3TOU A;  5HR1 A;  1TRS A;  5EL8 A;  2N5A A;  2K8V A;  2LJR A;  2VCT A;  4XS1 A;  2NPB A;  3LG6 A;  3GKK A;  4F9Z A;  1X5E A;  1PX7 A;  1IYI A;  1XCC A;  3VLN A;  1V98 A;  1XOA A;  4MF5 A;  3TUE A;  3RDW A;  3HCZ A;  3I9V 2;  1WJK A;  4WF4 A;  3DVX A;  1XWA A;  8GSS A;  2DIY A;  4I2U A;  5IPG A;  1M99 A;  3G7J A;  4FYB A;  3HXS A;  19GS A;  2GLR A;  13GS A;  2ZUP A;  2LRN A;  3FZA A;  2ES7 A;  2FHE A;  5DQS A;  4G19 A;  1X9S B;  4JE1 A;  2K6V A;  3DD3 A;  3GX0 A;  1BYE A;  1U3A A;  1XXU A;  2X49 A;  1AIU A;  1BX9 A;  3KMN A;  2IMK A;  4IQ1 A;  1YQ1 A;  1EP7 A;  1WWJ A;  1R5A A;  2V32 A;  3LW9 A;  3P90 A;  3N9J A;  2P31 A;  4GSS A;  4WET A;  2I3Y A;  3UVT A;  2VM2 A;  2FWH A;  2G0F A;  4XIH A;  3EU3 A;  4POK A;  4I6X A;  2VL2 C;  1K0B A;  4K0G A;  4IVF A;  1BQ7 A;  4Q5F A;  1HNB A;  4ZBD A;  1FG4 A;  2DMM A;  3ZZX A;  1G6Y A;  1TRV A;  2K18 A;  2H6Z A;  3QAG A;  4N30 A;  3CSI A;  3NZN A;  3UJ1 A;  1OC3 A;  1Z7P A;  5LNK e;  2JZT A;  2VM1 A;  1EEM A;  3DML A;  3GV1 A;  4Z2U A;  2FWE A;  4MH2 A;  4AGS A;  3UBL A;  4HZ2 A;  1O81 A;  1S3A A;  1H4O A;  3L78 A;  5DBQ A;  3PH9 A;  4WR4 A;  2GS3 A;  1XW5 A;  4GWR A;  4BVX A;  3VWV A;  4BL7 A;  4ML1 A;  3UIW A;  1GRX A;  1G7O A;  1EP8 A;  3SBC A;  1O73 A;  2JZS A;  5KOW A;  3KTL A;  4BWS A;  2EIQ A;  1SKR B;  2AJQ B;  5J3R A;  1NSW A;  5INY A;  2DSA A;  3HKR A;  2OA7 A;  2H75 A;  2RUF A;  5KEJ A;  5KOX A;  3CSJ A;  5HR3 A;  1M0U A;  5H5S A;  2QA1 A;  1A23 A;  5D8I A;  3EVI A;  2WFC A;  3BD2 A;  3UBK A;  3QFB C;  4K1F A;  3LSZ A;  3S9F A;  4ULX A;  4WR5 A;  2MBT A;  5BMU A;  4XS4 B;  2QSI A;  3GH9 A;  4G0L A;  1QK8 A;  1THO A;  3IC4 A;  3IV4 A;  3GRX A;  4GST A;  1FO5 A;  3TKS C;  4EC0 A;  3A2W A;  1XIY A;  2O87 A;  3Q74 A;  1WP0 A;  1R7H A;  2F8F A;  2A2P A;  3FZ5 A;  4HZ4 A;  2DIZ A;  1U87 A;  2MMA A;  1B4P A;  2O7K A;  2FA4 A;  2IMD A;  2H1G A;  1PN9 A;  4O92 A;  5JWQ B;  4TN8 A;  2IJY A;  5J9B A;  4QQ7 A;  2A2R A;  3WT1 A;  4MH3 A;  4K7O A;  1A8Y A;  4JR4 A;  3RPP A;  1AW9 A;  4ECC A;  1GSY A;  4ISD A;  2JAC A;  4PQI A;  3KEB A;  3UEM A;  1EZK A;  1XWG A;  3QAV A;  3PPU A;  4Q5Q A;  1SJ6 A;  2VLU A;  10GS A;  3IK9 A;  2E0Q A;  2X64 A;  5H5Q A;  1B9X C;  4IW9 A;  5JCU A;  5HFG A;  4DSR A;  1HD2 A;  1GUK A;  5DJM A;  2YWM A;  2M80 A;  1V57 A;  1SJI A;  2L6C A;  1K0D A;  2C4J A;  4FIW A;  3DGQ A;  2PN8 A;  2CX3 A;  1TTZ A;  4CW9 A;  1SKW B;  4ZL9 A;  1MDJ A;  1X9M B;  4NAX A;  2H73 A;  3CRU A;  1V40 A;  2LRC A;  5C00 A;  2E7P A;  2DKH A;  6GSY A;  1QFN A;  3GMF A;  3FZ9 A;  4XRD A;  3KM6 A;  1F6M C;  3QPM A;  2MMN A;  3BOA A;  1VRS D;  1E2Y A;  4XCS A;  4POB A;  3EPT A;  2LST A;  2LJA A;  4YH2 A;  1RK4 A;  1YF1 A;  2H01 A;  2HZE B;  3BCI A;  1B4Q A;  4EIQ A;  4J56 E;  2HI7 A;  4ECI A;  3ZYW A;  4LMW A;  4BVY B;  1JFU A;  3HVX A;  4JZQ A;  2VD0 A;  1SJZ A;  2EC4 A;  3FRC A;  4MP4 A;  1HNA A;  5CRH A;  4MZW A;  1YF0 A;  1ZZY A;  5F8B A;  1K3O A;  1Z3E A;  3FZ4 A;  1Q4J A;  5HFI A;  4MJC A;  3G7I A;  3P8W A;  3TGZ A;  3PR8 A;  3O3T A;  4KSO A;  1LJR A;  2H6X A;  4F03 A;  1R26 A;  3VWX A;  3C1S A;  4ID0 A;  2B7J A;  1JLV A;  1YDK A;  3TRQ A;  3A2V A;  3TCO A;  2HSH A;  4KH7 A;  2IIY A;  4EIP A;  4MZC A;  2OE0 A;  5D73 A;  2GTU A;  4BPY A;  2HLS A;  4MK3 A;  2J9H A;  1DUG A;  4MDC A;  5IOW A;  2VOC A;  2F51 A;  2R6K A;  3LYK A;  4IS0 A;  2JAD A;  2IMF A;  2V1M A;  4N11 A;  4IEL A;  3ERG A;  3GX8 A;  5ECL B;  2YJH A;  1AQV A;  3KJY A;  3TKS E;  2XC2 A;  2NBS A;  4BIK A;  3KIJ A;  3IAS 2;  4CHS A;  1AXD A;  2VL3 A;  1EWX A;  5ECI B;  1TU8 A;  4YAV A;  2KLX A;  1XW9 A;  1F2E A;  2C0D A;  3Q19 A;  2WGR A;  2F3M A;  2FY6 A;  4PNF A;  1XWC A;  2K9F A;  4OCF A;  4ZB8 A;  2WJU A;  1M2D A;  2K8S A;  4KCE A;  2YZU A;  3BBY A;  3FR6 A;  2VL9 A;  1PRX A;  3I69 A;  2XPE A;  3IC8 A;  2RM6 A;  3GKM A;  3VPT A;  2KOK A;  3CTF A;  1J08 A;  1JZW A;  5JWR B;  3HHV A;  2YWO A;  1SL1 B;  1Z6M A;  4KAE A;  1USB A;  2VCW A;  5IMF A;  5ID2 B;  1F37 A;  2C3N A;  2WS2 A;  3ISO A;  2Z9S A;  1ZL9 A;  1TJD A;  2GQK A;  9GSS A;  2FD3 A;  3F3Q A;  3W6G A;  2VIM A;  1W89 A;  4AF2 A;  3CYN A;  3N5O A;  4ZL8 A;  4KUN A;  2YN1 A;  2HSY A;  4P3Y B;  2OE1 A;  4IJI A;  2FLS A;  4JU5 A;  4G0K A;  3EYT A;  1SL0 B;  3G9B A;  5JCG A;  2GT5 A;  5G5E A;  2GDR A;  1WRY A;  3DVW A;  4GQC A;  5J9C A;  1TP9 A;  2JL4 A;  1SL2 B;  4DSS B;  5G31 A;  1FAA A;  2DLX A;  1ZCP A;  2C1Y A;  1GSE A;  3BJ5 A;  1ON4 A;  1OVN A;  3IBH A;  1PKZ A;  3ZRD A;  1PQN A;  2R0C A;  3R3E A;  1A2J A;  3CBU A;  2FWG A;  1SYX A;  3TJB A;  1C72 A;  2GZZ A;  4GRF A;  1WOU A;  1OAZ A;  5IPH A;  4L0U A;  3E3E A;  3IAM 2;  2YNX A;  2HRA A;  5HR0 A;  3D22 A;  1SK0 A;  6GSX A;  1NM3 A;  1Y6E A;  2RUE A;  3TKP A;  3GIX A;  2LQO A;  2CZ3 A;  1KNG A;  3V1W A;  1BG5 A;  1GTA A;  4HJ2 A;  1GTB A;  3LQ7 A;  3ERW A;  2HXK A;  4YQM A;  1B48 A;  2ON5 A;  3ZFB A;  3QFA C;  2C0F A;  3H4K A;  2L5O A;  4NPB A;  3I43 A;  1H75 A;  3KH9 A;  4TW5 A;  1XWB A;  5ELG A;  4PQ1 A;  1ZMA A;  2HZF A;  4OO5 A;  1GTI A;  4TXO B;  2PVQ A;  4GF0 A;  3ZL5 A;  2LRT A;  1EGO A;  4WEY A;  1J0F A;  4HEA 2;  3H1N A;  5IO2 A;  4LMV A;  2HT9 A;  1TI3 A;  4MZB A;  1PX6 A;  3FMW A;  2YPM A;  1TXX A;  3RHC A;  2R0P A;  3CSH A;  2B5X A;  4L5O A;  1KTE A;  1LU4 A;  4Z7X A;  3TKS A;  4FO5 A;  3IR4 A;  4HQZ A;  2F9S A;  3L9S A;  4ML6 A;  2EIR A;  2WDU A;  5D9X A;  3ZFL A;  5CRG A;  3VUR A;  2CVB A;  2LKU A;  3ERF A;  2DBC A;  4TKY A;  1MTC A;  4D73 B;  2VAF A;  4TR3 A;  3QMX A;  5DAK A;  4OFN A;  1DSB A;  1I5G A;  3VI5 A;  2HFD A;  2DKI A;  3ZIT A;  2V6O A;  1FB6 A;  5FHI A;  4G2E A;  4G0I A;  5CYY A;  4RQX A;  3FEU A;  2R2J A;  5G1L A;  3F63 A;  2X4A A;  3TRP A;  2P5Q A;  1VF4 A;  3MNG A;  4KW6 A;  5ECR B;  5IM9 A;  3GNJ A;  5AGY A;  1TK8 B;  4MNN A;  4AJ7 A;  4F0B A;  3M9J A;  4KGI A;  1GSQ A;  3CRT A;  2VO4 A;  3Q6O A;  5ECP B;  1S3R A;  2IPA A;  2YWI A;  5D9T A;  1JZO A;  1N2A A;  5DCH A;  3US3 A;  2V2G A;  4NHZ A;  3WD6 A;  2OAD A;  4CY8 A;  3WGX A;  2D2Z A;  2REM A;  1A0F A;  2R4V A;  3NOF A;  2OE3 A;  2NTO A;  2YP6 A;  4N10 A;  3H8Q A;  2CVK A;  5KN0 A;  3TJJ A;  2OKA A;  2O85 A;  3M1G A;  1X0R A;  2JU5 A;  2B7K A;  3LOR A;  3FKF A;  4RI6 A;  3DEX A;  5CRW A;  3ZRE A;  1N8J A;  1XVQ A;  1SD9 A;  4BVX B;  3F4S A;  4F82 A;  5DQY A;  4BL7 B;  5ECN B;  2QGV A;  1SEN A;  4O5U A;  4TVE A;  2IME A;  1SK2 A;  4LL1 B;  2M72 A;  1RQM A;  2CT6 A;  4NXI A;  1MD4 A;  1YJ6 A;  16GS A;  1GLQ A;  4YKG A;  1Q98 A;  2GSQ A;  5DAL B;  4WBR D;  1TOF A;  4E8H A;  3DRN A;  3QR6 A;  2OJL A;  1E6B A;  1A0R P;  4JR6 A;  2J23 A;  5JCW A;  5KN1 A;  1UVZ A;  1VF2 A;  4ZL7 A;  6GST A;  1LBK A;  1U88 A;  3EE2 A;  4G10 A;  4HDE A;  1G7E A;  1HNC A;  4KSM A;  2L5L A;  2V41 A;  3CTG A;  2HRN A;  4L8E A;  1QQ2 A;  3WYW A;  2AAW A;  2GQL A;  4TR1 A;  3HYP A;  5EVO A;  4KDU A;  1VF1 A;  1HQO A;  2WRT A;  1PL2 A;  5EPF A;  1TK5 B;  3UAP A;  4FQU A;  2FGX A;  3GKN A;  3D5J A;  2P5R A;  1B8X A;  1YKA A;  3WGD A;  3F9U A;  3OR5 A;  5B7C A;  4AJ8 A;  2WCI A;  3L4N A;  4PNG A;  2UZ8 A;  4IHU A;  4MF7 A;  1EV4 A;  1IYH A;  1K0O A;  4MJE A;  1YEP A;  4ACS A;  2RM5 A;  4POL A;  2PUK C;  1ST9 A;  5DVB A;  3KH7 A;  1KBN A;  2GGT A;  2OBK A;  1YKC A;  3GL5 A;  3P7X A;  1OE8 A;  2MBS A;  1GSD A;  4GCI A;  2H66 A;  5ECM B;  1JZD A;  3F0I A;  4XHM A;  1SU9 A;  1M7T A;  3ME7 A;  2GQM A;  4USS A; 
#chains in the Genus database with same CATH homology
 6GSV A;  3KP9 A;  3K8N A;  7GSS A;  2H1A A;  3ZVJ A;  1FB0 A;  5AIS A;  2OAC A;  1G0T A;  1R4W A;  3ZML A;  2ZCT A;  4KDY A;  1BAY A;  4HU7 A;  2CVD A;  1WMJ A;  1MEK A;  1ML6 A;  5J4U A;  4ECB A;  1FVJ A;  2DJ3 A;  2PGT A;  2AUV A;  4IJ3 A;  2TIR A;  4Q5R A;  1GSF A;  3IA1 A;  1Z6N A;  4EF0 A;  1A2L A;  1EV9 A;  1ERV A;  4FH8 A;  4ZXG A;  3TKR A;  3WGE A;  2QA2 A;  3LXZ A;  2R37 A;  4KE3 A;  4N0Z A;  1CQH A;  1ABA A;  2YCD A;  4H86 A;  2WZ9 A;  3MSZ A;  2HRF A;  1MDI A;  3EIN A;  2DC5 A;  1ZGN A;  4MA9 A;  4X4J A;  2PWJ A;  3MDK A;  4J2F A;  4MMM A;  4HU9 A;  3FHK A;  2I4A A;  3VWU A;  1OC9 A;  2FWF A;  1UN2 A;  2VCV A;  2JZR A;  2PBJ A;  6GSU A;  4YAP A;  1S3C A;  1M9A A;  4POM A;  2B1K A;  1X9W B;  3IXR A;  4MAB A;  5B6M A;  3IOS A;  3BCK A;  2VCZ A;  3D4M A;  4XS6 A;  1TU7 A;  4XTS A;  4RQR A;  3M9K A;  3GSS A;  3ZVJ D;  2HE3 A;  2YZH A;  4KCA A;  1VF3 A;  3LGC A;  1GLP A;  2GT6 A;  3VWW A;  1WPI A;  4HQS A;  1K3Y A;  2KP1 A;  5CP1 A;  5D9V A;  1PSQ A;  2C0E A;  3RAZ A;  3GYK A;  3W8S A;  4KX4 A;  1XFL A;  5ECO B;  4EVM A;  4IP1 A;  3D21 A;  5IO0 A;  11GS A;  1FW1 A;  2C0G A;  5AIX A;  1UA5 A;  3RPN A;  5L71 A;  4DVC A;  3FK8 A;  4PQH A;  4PXO A;  2MZC A;  2H1D A;  2CX4 A;  5GAP D;  2AYT A;  5B6N A;  3NIV A;  4X1U A;  2LNS A;  5F06 A;  3GTU B;  2PMT A;  4MPG A;  2LNT A;  3E0U A;  5IMC A;  2H1B A;  2P0G A;  6GSS A;  2LV3 A;  1T00 A;  4GTU A;  1K0A A;  1ZYE A;  1PL1 A;  3LWA A;  2E2M A;  4ZB9 A;  4K7N A;  4MCU A;  2DJJ A;  1O85 A;  4TXV A;  4DEJ A;  5AIV A;  5JWO B;  2IFQ B;  5FWG A;  2FNO A;  2X8G A;  5G30 A;  3QD9 A;  2XBI A;  1GUH A;  5IMV A;  2B5Y A;  5A5K A;  5HQP A;  4G9H A;  5CAX A;  4OO4 A;  2EIO A;  3KD0 A;  1ILO A;  3GA4 A;  3ZLP A;  2ZNM A;  4OWY A;  5GZZ B;  4GSN A;  1EOG A;  4TR0 A;  1ERU A;  4IN0 A;  2BTO T;  3GKX A;  2TRC P;  3VI7 A;  2H74 A;  4MF6 A;  3C8E A;  1PKW A;  2WUL A;  2VL2 A;  3FYG A;  2CQ9 A;  3FR3 A;  3IK7 A;  1SYR A;  1V58 A;  3HJO A;  3EUR A;  4V2M A;  4A5P A;  1GH2 A;  1V2A A;  5CRE A;  1XVW A;  4PUR A;  1Y25 A;  5DCG A;  1M2B A;  5ECS A;  3KP8 A;  4X0X A;  1X5C A;  2LQQ A;  1QMV A;  4K9Z A;  1Z7R A;  2H0G A;  4PTS A;  3C71 A;  1FOH A;  4OMV A;  1TDI A;  3KTB A;  2L59 A;  4V2N A;  1SKS B;  1ACV A;  2MMO A;  1JHB A;  2IWT A;  1GP1 A;  2FCH A;  3HDC A;  2GSS A;  4O7H A;  3J7Y b;  3PIN A;  2H8L A;  5E59 A;  4BA7 A;  2JSY A;  5C04 A;  5B8A A;  1O8W A;  2QKE A;  1W4V A;  4EE0 A;  5A4V A;  2KP2 A;  4L5L A;  3HVV A;  1BJX A;  2RII A;  1OKT A;  3TRX A;  2CV4 A;  2XBQ A;  3E9J B;  2GZY A;  3F4T A;  5G5F A;  1O7U A;  1UC7 A;  1THX A;  2QC7 A;  4PGT A;  3L9U A;  2I1U A;  3A5W A;  5IMZ A;  1OKD A;  4K5R A;  1WIK A;  4JRR A;  3F6F A;  2IL3 A;  1G6W A;  3IDV A;  4J57 E;  4D73 A;  4F0C A;  2B1L A;  4I2T A;  4MLY A;  2B5E A;  4ICY A;  2MMZ A;  2L4C A;  3HD5 A;  1JLW A;  3M0F A;  4RI7 A;  2CAQ A;  1OYJ A;  4ZBA A;  1TK0 B;  2DJK A;  2LUS A;  3APQ A;  1YZX A;  4KND A;  3P2A A;  2XPD A;  4OD7 A;  2H71 A;  2DJ0 A;  4LA1 A;  4ZB6 A;  3MAK A;  2PPT A;  2YOI A;  4YQU A;  2C80 A;  4WXT A;  1SK1 A;  4MJA A;  3R2Q A;  3D4T A;  5GAN D;  4NHW A;  1XW6 A;  5F05 A;  2B3S A;  4IQA A;  2L57 A;  2X8H A;  4EDZ A;  4Z2T A;  2A4V A;  2C3Q A;  1Z5Y E;  4N0V A;  4NMU A;  3AY8 A;  1T1V A;  3VK9 A;  4PX1 A;  2R5G A;  2OBI A;  3TJF A;  3U5R E;  2O89 A;  4V1A p;  4NV2 A;  1GUL A;  4XS4 A;  2L4Q A;  6GSW A;  2ON7 A;  2H70 A;  1T3B A;  3QDN A;  3ZTL A;  3WT2 A;  3APO A;  3FY7 A;  2HYX A;  3GUS A;  4EO3 A;  2YAN A;  1F3A A;  4OFM A;  3TJG A;  2AB6 A;  1O6J A;  3HY2 A;  5LCZ A;  2VCX A;  4O5Q A;  2LTK A;  3LEF A;  5FT3 A;  5ENU A;  1S3D A;  3F6D A;  3J7Y k;  5DAK B;  2O8V B;  4HS1 A;  4TOP A;  2BMX A;  3Q18 A;  1K0N A;  5DAL A;  3F3R A;  3D0Z A;  5GST A;  1K3L A;  14GS A;  5G1K A;  1MDK A;  1PMT A;  3MIX A;  1YEX A;  4OCE A;  1XOB A;  2KHP A;  3LXT A;  5EY6 A;  1T7P B;  3RHB A;  4HUA A;  3CMI A;  2IN3 A;  1NHO A;  2YJ7 A;  1QUW A;  12GS A;  3EMP A;  3HZ8 A;  4LL4 B;  1K0C A;  4KF9 A;  2CZ2 A;  3DWV A;  2RLI A;  3DYR A;  3H93 A;  3QOU A;  2ALB A;  4K2X A;  2I81 A;  2AHE A;  4KA0 A;  22GS A;  2H76 A;  4IP6 A;  4IBP A;  1SD8 A;  1Z9H A;  5AN1 A;  1FVK A;  1U3I A;  4CY6 A;  1R5P A;  3ME8 A;  4EL1 A;  1PD2 1;  2GSR A;  1URM A;  2C8U A;  4I5Q A;  3G7Y A;  1TW9 A;  4HJM A;  17GS A;  3GUR A;  4ZIL A;  1WE0 A;  3GL3 A;  3UMA A;  1AUC A;  1GL8 A;  3EU4 A;  5F07 A;  2I9H A;  1O8X A;  5ECH B;  1PA3 A;  3KGK A;  4ZIJ A;  3C73 A;  4O32 A;  1U6T A;  1QXH A;  5ECK B;  20GS A;  2IMI A;  2N5B A;  1XWK A;  4PUA A;  1PGT A;  3KXO A;  2H0I A;  3ED3 A;  2HZE A;  3TB2 A;  4I97 A;  3DKS A;  5IQY A;  4X43 A;  4BVY A;  4K8M A;  1ZYN A;  5F0G A;  1AAZ A;  3GFK A;  1EEJ A;  3W8J A;  2H0H A;  2BJX A;  4LLR A;  3RBT A;  5ABR A;  4TR1 B;  2FA8 A;  5HR2 A;  1B9Y C;  1M2A A;  1M9B A;  2R3X A;  1AQX A;  1T4Y A;  2G2Q A;  5COH A;  4O5R A;  2WB9 A;  1KEB A;  2DML A;  3LFL A;  3U6V A;  2YWN A;  3O6T A;  1K0M A;  1JZR A;  3HJP A;  4YKF A;  3F8U A;  2JSZ A;  3GHA A;  4ZBB A;  18GS A;  2R0G A;  4TR4 A;  1ZYQ B;  5IMD A;  1J9B A;  1AC1 A;  4RUV A;  5D9W A;  1BED A;  3GN3 A;  4V2L A;  1AQW A;  2DJ1 A;  1V9W A;  3HA9 A;  3DXB A;  5E4W A;  5CRD A;  4YQV A;  4MJB A;  3MWH A;  5GSS A;  1T8E B;  5IOX A;  5KN3 A;  4ECJ A;  2H6Y A;  3L9V A;  3C1R A;  4K6X A;  2AV4 A;  1PN0 A;  5DJL A;  1GTU A;  4L0W A;  2X8C A;  3IHQ A;  1OE7 A;  2A4H A;  5H5R A;  1FHE A;  4WF5 A;  2YV7 A;  4XRA A;  5J41 A;  2VLV A;  2PER A;  2GZP A;  1ZOF A;  5CNW A;  3ZIV A;  2GST A;  4EXJ A;  4FYC A;  1VGL A;  3O76 A;  3KMO A;  3L0H A;  4OFT A;  3TKQ A;  1ERW A;  2LS5 A;  5B8B A;  2V6K A;  2B6M A;  1CQG A;  3A2X A;  3EMX A;  3IE3 A;  3TJK A;  2C3T A;  4EKZ A;  3EC3 A;  3UVH A;  3IRA A;  2H19 A;  5IMA A;  3FW2 A;  4JED A;  3UAR A;  4TRX A;  2L6D A;  1GNW A;  2LEG A;  1XPV A;  5BRT A;  3ZIJ A;  5LD0 A;  1A2M A;  3ZMK A;  3LYP A;  3HJM A;  1EGR A;  1XBS A;  2FUG 2;  2DJ2 A;  3GTU A;  4K2D A;  1F9M A;  5D93 A;  1NHY A;  2HSM A;  4WBJ A;  2GVP A;  1F3B A;  5ELA A;  5A4U A;  4PUF C;  2TRX A;  2VUP A;  4E8E A;  5G2Z A;  1OC9 B;  5CO3 A;  3SWL A;  3VPQ A;  2VLT A;  4GQF A;  4KB3 A;  3CXG A;  5D96 A;  4CDO A;  5ID2 A;  3JCM L;  2M46 A;  1ERT A;  5J5N A;  2IFQ A;  2HRK A;  4F2I A;  4K7I A;  2KUC A;  4IKH A;  2CAI A;  3QCP A;  1GWC A;  1GNE A;  1MD3 A;  3TOT A;  1DE2 A;  1ZYP A;  2F8A A;  2XHF A;  2VD1 A;  4K5S A;  2E2G A;  1QGV A;  2MYG A;  1A8L A;  2X99 A;  1X5D A;  3MYD A;  5KN2 A;  1TRU A;  4V1A g;  3EWL A;  1TKD B;  4QL9 A;  3TDG A;  1A24 A;  2H72 A;  3A3T A;  3UOM A;  2H30 A;  4DSS A;  5A4W A;  5HFK A;  4AJ6 A;  4Z2R A;  1I9D A;  3IHG A;  1GSU A;  4GXZ A;  2PU9 C;  1T4Z A;  2N5F A;  3GH6 A;  3VFI A;  4DSQ A;  3QAW A;  3D6I A;  3KCM A;  2CA8 A;  2NVL A;  1TI1 A;  3KZQ A;  1NW2 A;  1XZO A;  4Q5N A;  1GUM A;  3C7M A;  1FOV A;  2NDO A;  4FYU A;  4JBB A;  1RW1 A;  2LJK A;  2A2S A;  4IGJ A;  2PVO C;  4EUY A;  2VCQ A;  3IPZ A;  3I6A A;  1TRW A;  4QL7 A;  1GSS A;  1OC8 A;  5DDL A;  3UL3 A;  3HVS A;  1DBY A;  3M3M A;  3F4R A;  3APS A;  3FR9 A;  1DE1 A;  1YY7 A;  4EDY A;  3GST A;  3DIE A;  3A5I A;  3H79 A;  4K0N A;  5ECQ B;  4MPF A;  4NWY A;  4WKW A;  4NV5 A;  4HI7 A;  3PGT A;  2HNL A;  3HZ4 A;  4KDX A;  5IIZ A;  1HYU A;  4I8B A;  2YV9 A;  4BWQ A;  3LJR A;  3M8N A;  4TXO A;  4ILF A;  4HOJ A;  1EOH A;  4GLT A;  3TOU A;  5HR1 A;  1TRS A;  5EL8 A;  2N5A A;  2K8V A;  2LJR A;  2VCT A;  4XS1 A;  2NPB A;  3LG6 A;  3GKK A;  4F9Z A;  1X5E A;  1PX7 A;  1IYI A;  1XCC A;  3VLN A;  1V98 A;  1XOA A;  4MF5 A;  3TUE A;  3RDW A;  3HCZ A;  3I9V 2;  1WJK A;  4WF4 A;  3DVX A;  1XWA A;  8GSS A;  2DIY A;  4I2U A;  5IPG A;  1M99 A;  3G7J A;  4FYB A;  3HXS A;  19GS A;  2GLR A;  13GS A;  2ZUP A;  2LRN A;  3FZA A;  2ES7 A;  2FHE A;  5DQS A;  4G19 A;  1X9S B;  4JE1 A;  2K6V A;  3DD3 A;  3GX0 A;  1BYE A;  1U3A A;  1XXU A;  2X49 A;  1AIU A;  1BX9 A;  3KMN A;  2IMK A;  4IQ1 A;  1YQ1 A;  1EP7 A;  1WWJ A;  1R5A A;  2V32 A;  3LW9 A;  3P90 A;  3N9J A;  2P31 A;  4GSS A;  4WET A;  2I3Y A;  3UVT A;  2VM2 A;  2FWH A;  2G0F A;  4XIH A;  3EU3 A;  4POK A;  4I6X A;  2VL2 C;  1K0B A;  4K0G A;  4IVF A;  1BQ7 A;  4Q5F A;  1HNB A;  4ZBD A;  1FG4 A;  2DMM A;  3ZZX A;  1G6Y A;  1TRV A;  2K18 A;  2H6Z A;  3QAG A;  4N30 A;  3CSI A;  3NZN A;  3UJ1 A;  1OC3 A;  1Z7P A;  5LNK e;  2JZT A;  2VM1 A;  1EEM A;  3DML A;  3GV1 A;  4Z2U A;  2FWE A;  4MH2 A;  4AGS A;  3UBL A;  4HZ2 A;  1O81 A;  1S3A A;  1H4O A;  3L78 A;  5DBQ A;  3PH9 A;  4WR4 A;  2GS3 A;  1XW5 A;  4GWR A;  4BVX A;  3VWV A;  4BL7 A;  4ML1 A;  3UIW A;  1GRX A;  1G7O A;  1EP8 A;  3SBC A;  1O73 A;  2JZS A;  5KOW A;  3KTL A;  4BWS A;  2EIQ A;  1SKR B;  2AJQ B;  5J3R A;  1NSW A;  5INY A;  2DSA A;  3HKR A;  2OA7 A;  2H75 A;  2RUF A;  5KEJ A;  5KOX A;  3CSJ A;  5HR3 A;  1M0U A;  5H5S A;  2QA1 A;  1A23 A;  5D8I A;  3EVI A;  2WFC A;  3BD2 A;  3UBK A;  3QFB C;  4K1F A;  3LSZ A;  3S9F A;  4ULX A;  4WR5 A;  2MBT A;  5BMU A;  4XS4 B;  2QSI A;  3GH9 A;  4G0L A;  1QK8 A;  1THO A;  3IC4 A;  3IV4 A;  3GRX A;  4GST A;  1FO5 A;  3TKS C;  4EC0 A;  3A2W A;  1XIY A;  2O87 A;  3Q74 A;  1WP0 A;  1R7H A;  2F8F A;  2A2P A;  3FZ5 A;  4HZ4 A;  2DIZ A;  1U87 A;  2MMA A;  1B4P A;  2O7K A;  2FA4 A;  2IMD A;  2H1G A;  1PN9 A;  4O92 A;  5JWQ B;  4TN8 A;  2IJY A;  5J9B A;  4QQ7 A;  2A2R A;  3WT1 A;  4MH3 A;  4K7O A;  1A8Y A;  4JR4 A;  3RPP A;  1AW9 A;  4ECC A;  1GSY A;  4ISD A;  2JAC A;  4PQI A;  3KEB A;  3UEM A;  1EZK A;  1XWG A;  3QAV A;  3PPU A;  4Q5Q A;  1SJ6 A;  2VLU A;  10GS A;  3IK9 A;  2E0Q A;  2X64 A;  5H5Q A;  1B9X C;  4IW9 A;  5JCU A;  5HFG A;  4DSR A;  1HD2 A;  1GUK A;  5DJM A;  2YWM A;  2M80 A;  1V57 A;  1SJI A;  2L6C A;  1K0D A;  2C4J A;  4FIW A;  3DGQ A;  2PN8 A;  2CX3 A;  1TTZ A;  4CW9 A;  1SKW B;  4ZL9 A;  1MDJ A;  1X9M B;  4NAX A;  2H73 A;  3CRU A;  1V40 A;  2LRC A;  5C00 A;  2E7P A;  2DKH A;  6GSY A;  1QFN A;  3GMF A;  3FZ9 A;  4XRD A;  3KM6 A;  1F6M C;  3QPM A;  2MMN A;  3BOA A;  1VRS D;  1E2Y A;  4XCS A;  4POB A;  3EPT A;  2LST A;  2LJA A;  4YH2 A;  1RK4 A;  1YF1 A;  2H01 A;  2HZE B;  3BCI A;  1B4Q A;  4EIQ A;  4J56 E;  2HI7 A;  4ECI A;  3ZYW A;  4LMW A;  4BVY B;  1JFU A;  3HVX A;  4JZQ A;  2VD0 A;  1SJZ A;  2EC4 A;  3FRC A;  4MP4 A;  1HNA A;  5CRH A;  4MZW A;  1YF0 A;  1ZZY A;  5F8B A;  1K3O A;  1Z3E A;  3FZ4 A;  1Q4J A;  5HFI A;  4MJC A;  3G7I A;  3P8W A;  3TGZ A;  3PR8 A;  3O3T A;  4KSO A;  1LJR A;  2H6X A;  4F03 A;  1R26 A;  3VWX A;  3C1S A;  4ID0 A;  2B7J A;  1JLV A;  1YDK A;  3TRQ A;  3A2V A;  3TCO A;  2HSH A;  4KH7 A;  2IIY A;  4EIP A;  4MZC A;  2OE0 A;  5D73 A;  2GTU A;  4BPY A;  2HLS A;  4MK3 A;  2J9H A;  1DUG A;  4MDC A;  5IOW A;  2VOC A;  2F51 A;  2R6K A;  3LYK A;  4IS0 A;  2JAD A;  2IMF A;  2V1M A;  4N11 A;  4IEL A;  3ERG A;  3GX8 A;  5ECL B;  2YJH A;  1AQV A;  3KJY A;  3TKS E;  2XC2 A;  2NBS A;  3KIJ A;  3IAS 2;  4CHS A;  1AXD A;  2VL3 A;  1EWX A;  5ECI B;  1TU8 A;  4YAV A;  2KLX A;  1XW9 A;  1F2E A;  2C0D A;  3Q19 A;  2WGR A;  2F3M A;  2FY6 A;  4PNF A;  1XWC A;  2K9F A;  4OCF A;  4ZB8 A;  2WJU A;  1M2D A;  2K8S A;  4KCE A;  2YZU A;  3BBY A;  3FR6 A;  2VL9 A;  1PRX A;  3I69 A;  2XPE A;  3IC8 A;  2RM6 A;  3GKM A;  3VPT A;  2KOK A;  3CTF A;  1J08 A;  1JZW A;  5JWR B;  3HHV A;  2YWO A;  1SL1 B;  1Z6M A;  4KAE A;  1USB A;  2VCW A;  5IMF A;  5ID2 B;  1F37 A;  2C3N A;  2WS2 A;  3ISO A;  2Z9S A;  1ZL9 A;  1TJD A;  2GQK A;  9GSS A;  2FD3 A;  3F3Q A;  3W6G A;  2VIM A;  1W89 A;  4AF2 A;  3CYN A;  3N5O A;  4ZL8 A;  4KUN A;  2YN1 A;  2HSY A;  4P3Y B;  2OE1 A;  4IJI A;  2FLS A;  4JU5 A;  4G0K A;  3EYT A;  1SL0 B;  3G9B A;  5JCG A;  2GT5 A;  5G5E A;  2GDR A;  1WRY A;  3DVW A;  4GQC A;  5J9C A;  1TP9 A;  2JL4 A;  1SL2 B;  4DSS B;  5G31 A;  1FAA A;  2DLX A;  1ZCP A;  2C1Y A;  1GSE A;  3BJ5 A;  1ON4 A;  1OVN A;  3IBH A;  1PKZ A;  3ZRD A;  1PQN A;  2R0C A;  3R3E A;  1A2J A;  3CBU A;  2FWG A;  1SYX A;  3TJB A;  1C72 A;  2GZZ A;  4GRF A;  1WOU A;  1OAZ A;  5IPH A;  4L0U A;  3E3E A;  3IAM 2;  2YNX A;  2HRA A;  5HR0 A;  3D22 A;  1SK0 A;  6GSX A;  1NM3 A;  1Y6E A;  2RUE A;  3TKP A;  3GIX A;  2LQO A;  2CZ3 A;  1KNG A;  3V1W A;  1BG5 A;  1GTA A;  4HJ2 A;  1GTB A;  3LQ7 A;  3ERW A;  2HXK A;  4YQM A;  1B48 A;  2ON5 A;  3ZFB A;  3QFA C;  2C0F A;  3H4K A;  2L5O A;  4NPB A;  3I43 A;  1H75 A;  3KH9 A;  4TW5 A;  1XWB A;  5ELG A;  4PQ1 A;  1ZMA A;  2HZF A;  4OO5 A;  1GTI A;  4TXO B;  2PVQ A;  4GF0 A;  3ZL5 A;  2LRT A;  1EGO A;  4WEY A;  1J0F A;  4HEA 2;  3H1N A;  5IO2 A;  4LMV A;  2HT9 A;  1TI3 A;  4MZB A;  1PX6 A;  3FMW A;  2YPM A;  1TXX A;  3RHC A;  2R0P A;  3CSH A;  2B5X A;  4L5O A;  1KTE A;  1LU4 A;  4Z7X A;  3TKS A;  4FO5 A;  3IR4 A;  4HQZ A;  2F9S A;  3L9S A;  4ML6 A;  2EIR A;  2WDU A;  5D9X A;  3ZFL A;  5CRG A;  3VUR A;  2CVB A;  2LKU A;  3ERF A;  2DBC A;  4TKY A;  1MTC A;  4D73 B;  2VAF A;  4TR3 A;  3QMX A;  5DAK A;  4OFN A;  1DSB A;  1I5G A;  3VI5 A;  2HFD A;  2DKI A;  3ZIT A;  2V6O A;  1FB6 A;  5FHI A;  4G2E A;  4G0I A;  5CYY A;  4RQX A;  3FEU A;  2R2J A;  5G1L A;  3F63 A;  2X4A A;  3TRP A;  2P5Q A;  1VF4 A;  3MNG A;  4KW6 A;  5ECR B;  5IM9 A;  3GNJ A;  5AGY A;  1TK8 B;  4MNN A;  4AJ7 A;  4F0B A;  3M9J A;  4KGI A;  1GSQ A;  3CRT A;  2VO4 A;  3Q6O A;  5ECP B;  2IPA A;  2YWI A;  5D9T A;  1JZO A;  1N2A A;  5DCH A;  3US3 A;  2V2G A;  4NHZ A;  3WD6 A;  2OAD A;  4CY8 A;  3WGX A;  2D2Z A;  2REM A;  1A0F A;  2R4V A;  3NOF A;  2OE3 A;  2NTO A;  2YP6 A;  4N10 A;  3H8Q A;  2CVK A;  5KN0 A;  3TJJ A;  2OKA A;  2O85 A;  3M1G A;  1X0R A;  2JU5 A;  2B7K A;  3LOR A;  3FKF A;  4RI6 A;  3DEX A;  5CRW A;  3ZRE A;  1N8J A;  1XVQ A;  1SD9 A;  4BVX B;  3F4S A;  4F82 A;  5DQY A;  4BL7 B;  5ECN B;  2QGV A;  1SEN A;  4O5U A;  4TVE A;  2IME A;  1SK2 A;  4LL1 B;  2M72 A;  1RQM A;  2CT6 A;  4NXI A;  1MD4 A;  1YJ6 A;  16GS A;  1GLQ A;  4YKG A;  1Q98 A;  2GSQ A;  5DAL B;  4WBR D;  1TOF A;  4E8H A;  3DRN A;  3QR6 A;  2OJL A;  1E6B A;  1A0R P;  4JR6 A;  2J23 A;  5JCW A;  5KN1 A;  1UVZ A;  1VF2 A;  4ZL7 A;  6GST A;  1LBK A;  1U88 A;  3EE2 A;  4G10 A;  4HDE A;  1G7E A;  1HNC A;  4KSM A;  2L5L A;  2V41 A;  3CTG A;  2HRN A;  4L8E A;  1QQ2 A;  3WYW A;  2AAW A;  2GQL A;  4TR1 A;  3HYP A;  5EVO A;  4KDU A;  1VF1 A;  1HQO A;  2WRT A;  1PL2 A;  5EPF A;  1TK5 B;  3UAP A;  4FQU A;  2FGX A;  3GKN A;  3D5J A;  2P5R A;  1B8X A;  1YKA A;  3WGD A;  3F9U A;  3OR5 A;  5B7C A;  4AJ8 A;  2WCI A;  3L4N A;  4PNG A;  2UZ8 A;  4IHU A;  4MF7 A;  1EV4 A;  1IYH A;  1K0O A;  4MJE A;  1YEP A;  4ACS A;  2RM5 A;  4POL A;  2PUK C;  1ST9 A;  5DVB A;  3KH7 A;  1KBN A;  2GGT A;  2OBK A;  1YKC A;  3GL5 A;  3P7X A;  1OE8 A;  2MBS A;  1GSD A;  4GCI A;  2H66 A;  5ECM B;  1JZD A;  3F0I A;  4XHM A;  1SU9 A;  1M7T A;  3ME7 A;  2GQM A;  4USS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...