3LOXA

Hcv ns3-4a protease domain with a ketoamide inhibitor derivative of boceprevir bound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV NS3 Protease
publication title The introduction of P4 substituted 1-methylcyclohexyl groups into Boceprevir: a change in direction in the search for a second generation HCV NS3 protease inhibitor.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1a
molecule tags Hydrolase/hydrolase inhibitor
total genus 37
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3loxA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3loxA01
1XKBC 4MLFB 4YO9A 3U1IB 1ZYOA 1ZSJA 1YPEH 1DWBH 4UFFH 4H6TA 1DUAA 5DKMA 3SJ9A 4B73A 4I8KA 2FZZA 4Q2KA 3QZQA 5E0JA 2JKHA 2XC5A 1P9SA 4Y79A 1PPBH 1C2EA 1O2OA 1GBKA 2HPPH 3EQ0H 2TIOA 1SGPE 1K1PA 1RTLA 3GY6A 1SC8U 3A88A 2BXTH 5EQRA 1CA0C 4NSVA 4AG1A 1P3CA 5SGAE 1NFWA 2FP7B 4CBOA 1UTNA 3M36A 4MVNA 3QZRA 6CHAC 3IITA 5HMAA 2CF9H 1QRWA 2WV5A 2XBYA 5AF9H 2H5CA 4O9VA 3DHKH 4KELA 1TNIA 4E7RG 5GIBA 2BY9X 3P95A 1Y8TA 2VIPA 1LHEH 2CN0H 2XRCA 1MMJN 2PTNA 2ZDMA 2OBQA 1O2YA 1O5EH 5T6GA 2BMGB 3UOPA 1AB9C 3AAVA 3BTME 3BF6H 3V12A 5A0BA 2TGAA 1BTZA 1LVMA 1Z8GA 1LKBA 3UQOA 3PTNA 2H9EH 1UCYK 2YNBA 3LT3A 1T4UH 5LPRA 2EA3A 3SV8A 4OS6A 4AX9H 1NU9A 1RTFB 3SJIA 2QXGA 2FOMB 4ABDA 3UUZA 1LCYA 1GI3A 3FZZA 4M9FA 2ZU3A 1FY3A 1GMDF 2J4IA 3SOSA 2Y82A 1ELFA 4X2YA 1F0UA 4AORA 2FMJA 1AIXH 1ZPCA 4JZIA 4RKOB 1O3CA 1J17T 4AFUA 1TYNA 2FPZA 2F9VA 2ZGBH 3MU4A 4TY7A 1GI2A 1GJ5H 1N8OB 3OYPA 3ZVDA 3ZZ9A 4KP0A 3BTEE 4E7NA 4FUFA 4I8LA 4OS4A 1UVPA 5L2ZH 1TGSZ 3D62A 3I78A 1S85A 2ZI2H 3U69H 3MH4A 1VITG 5FCRA 5E0GA 1MQ6A 4D9RA 1O2NA 4ISNA 5K7RA 3VPKA 3UIRA 1DT2A 3Q3KA 1RIWB 3HATH 3RUOA 1ZTLA 1GBAA 2ZO3H 1TOMH 2PUXB 2ZNKH 1HXEH 3QTVH 1MUEB 1G2MA 3QGJA 1HJAC 3OTJE 2Z9LA 2NU0E 1AVXA 1TLDA 4CH8B 1O2WA 1PPCE 1C5XB 3E90B 3TIUA 3BG8A 3SV2H 1YM0A 2QYIA 1CSOE 2P3FH 1INCA 1NRSH 4I33A 2FDAA 1GMHF 1ELVA 1J9CH 1Y59T 1LVOA 1A5GH 5HGGA 2VB0A 1Z1JA 1AB9B 1QL7A 1EB1H 1O30A 6LPRA 2YOLA 2PUQH 6ESTA 3P8FA 2H5DA 1ID5H 3UPEA 2BD8A 1J16A 5JBAS 1ELBA 2PGBB 3TH4H 1S0QA 5A2MH 3BSQA 2G5NA 4GHQA 3UTUH 2FOGA 1Z8IB 4ZH8A 2G8TA 1LHCH 4LOYH 4J2YB 5EU8A 4Y0YE 1QL9A 3TJNA 5E2OA 3DFJA 1DSTA 1EJNA 1ETTH 1GDNA 1W10U 2A7HA 1HJ8A 3LPRA 1A4WH 1P06A 1S83A 3GCNA 1QB9A 3GOVB 1DITH 1T7CA 1BIOA 1K9OE 3MH6A 4NA8A 3UR9A 1O3PB 2GGVB 4BAKB 2Y5GA 1C1OA 5GDSH 2LPRA 4I8HA 3SZNA 1EASA 1QJ1B 2Z9GA 1G30B 3HK3B 5FPSA 3A89A 1TIOA 1B7XB 1C9TA 1VJAU 3GISB 1SL3A 5GXPA 1V2ST 4UFDH 3SU2A 5CHAB 1AKSA 4IBLH 1AZ8A 5F6MA 2Y6TA 3ZVGA 4JK5A 2PFEA 3SNBA 2OP9A 2OC0A 1HB0B 3A7TA 4FXGH 3KQDA 3SHCH 5F8XA 1C5MD 1RTKA 4IMZA 2A1DB 3SU6A 1SGTA 1B0FA 5J4SA 1HJAB 1VCPA 3S69A 2FI5E 3Q77A 2WPMS 4WMFA 5BPEA 2ZU1A 4A92A 2ZU4A 2V3OH 5ESTE 1FY5A 1EB2A 1GBTA 4ESTE 3SU0A 1GHZA 4BTTB 1LHDH 4HFPB 4U01A 4WF8A 1C5UA 1YPLH 1C1SA 4ASHA 3RC6A 1Z1IA 4MPWA 4XBCA 3ZZ4A 3SNCA 2GT8A 1WCZA 3P8NA 1VITF 1AE8H 1V2VT 1SR5C 4JK6A 5FXLA 1DUEA 3RM2H 3K6YA 1GBBA 4FUIA 3C27B 5JB9S 2Z6BD 3ZZDA 2C4FH 4B2AA 3FFGA 1VCWA 3NPSA 4IN2A 3KQEA 1TRMA 2Y80A 2PKSC 2QAAA 4U2WA 2J95A 4RI0A 1O3LA 3GCHC 3PO1C 2GV6A 3F1SB 3BTQE 3UNRA 2ZHFH 2TRMA 4ZHAA 4LXBH 5B6OA 1MTNB 4I7YH 2ASUB 5DP4A 3M35A 1BRBE 8LPRA 1O0DH 4DOQA 3PYHA 2QXHA 2BD5A 2ZDKA 3ZZ6A 2TGPZ 2HNTC 1YLDA 1C4Y2 4J1YA 1C5VA 1D3TB 1W11U 2C8YB 3TGIE 2BDCA 2IPHA 1GBFA 1K1LA 1G3EA 1GPZA 2YNAA 2VVCA 3NUMA 3M5OA 1C2MA 2P3UB 4Y6DA 2R9PA 4MNWA 2B7DH 3SHAH 1WOFA 1PFXC 4RN6A 1UTJA 3TJUA 1P09A 1IQLA 2HNTE 3SJOA 4CH2B 1IQNA 1SB1H 5DP6A 1TPOA 1O2KA 4MG3A 5DPAA 1O2ZA 2AIPA 3MO3A 1ETRH 1BB0B 1VR1H 4DG4A 3EYDA 4BAQB 1TNGA 1C2KA 1SLVB 1KXAA 3FZDA 1A61H 1GI8B 2A4RA 2STBE 1QJ7B 3RXQA 3QDZB 2BDAA 2SGDE 1AO5A 5FBIA 3RXGA 3GY7A 3SV9A 1SGCA 1C5YB 2QF3A 1C9PA 3AVZA 4YOGA 4K2YA 1O5BB 6GCHG 1O2GH 2C93B 1C1WH 1ELEE 4SGAE 1O2PA 3BTHE 5JBTA 4Y0ZE 1G32B 5EPYA 3CENA 1CGJE 2VIWA 3TJOA 1P2OA 1XUHA 2VIVA 1EOLA 2KAIB 1QCPA 4BXWA 1ACBE 1YBWA 4XFQA 1SSXA 1GBDA 1A0LA 1D9IA 5GPIB 1P2MA 1G2LA 1YGCH 1HNEE 1PQ5A 1WTHD 1DXWA 1T8NA 2FOCA 2BDGA 1P2QA 1IQKA 3RU4T 1WTGH 1L2EA 4B2CA 1GI1A 1C5PA 1WU1A 3PMHB 3GY5A 3LONA 2QXIA 1WSSH 3RXKA 2F4LA 1N6XA 2FS9A 1UTLM 3H7TA 3M7TA 1QBOA 1O3DA 4UFEH 1FDPA 3LU9B 3SI3H 2B8OH 4O97A 2Y5FA 3MOCA 2C8WB 3OTPA 2CF8H 3L6PA 2ZECA 4RSPA 3H5CB 1A46H 1GJ9B 1K28D 1MH0A 3A80A 2BDBA 1IHSH 3QN7A 2SNVA 4YOJA 3RXUA 1IAUA 1AUTC 1MZDA 1UTMA 1HAIH 1YCPH 2PKAB 1UJ1A 2ZCLP 2ZA5A 1OP8A 2QCYA 3Q3YA 2JETC 2ZHDA 1NTPA 1C2GA 1DWCH 3BIUH 2ODYB 3FP7E 4GCHG 3E16B 1H8IH 4ABGA 3P8GA 2FODA 3KNXA 4MDSA 4X0WU 1M9UA 1S6FA 1C5TA 1DANH 1O5DH 1GGDC 3T27A 4OS7A 2OXSA 1LHGH 1GBCA 4UEHH 1GBMA 4GHTA 1C2IA 1P03A 2XWBI 4R8TB 4NSYA 1IQJA 1LQEA 1AI8H 2XTTB 2BD7A 8GCHG 1UTPA 1LTOA 3EDXB 1ZSKA 3PV5A 1GCTB 2BX3A 1A3BH 1C1UH 1GHBG 1TX7A 2AMPA 1IQMA 3RMOH 1XUJA 1Z6EA 3MU1A 1GJCB 3KCGH 1NFUA 5FHTA 1DDJA 3E0NB 2BY8X 3SU5A 1OYQA 1QR3E 1V2MT 4ZXYH 2FESH 2Z3DA 5LGOA 2Z9IA 3M7UA 2GMTC 1JOUB 1QRXA 2OINA 4AFQA 2XNIA 4XOJA 3B23B 2TGTA 1AFQC 3TNSA 5IYTA 1CVWH 1QL8A 1THRH 1T8LA 4NFEA 5E0HA 1L4DA 5HXFA 1P2NA 2ANWA 3PWCA 1QB6A 3MNBA 4O3UA 1BMNH 1OXGA 3SQEE 1ESTA 3R0FA 1GJAB 1TBZH 2ULLA 2GTBA 4ISIH 1SFIA 1O35A 2BDYA 1JXPA 4K8YA 2B9LA 1NPMA 1GJBB 1C1QA 2G5VA 3MU0A 1O2SA 3STIA 4DJZB 3M5NA 1OYTH 1NRQH 1TGNA 2HPQH 5AVDA 1XXFA 2UWPA 1MKWH 4MNVA 1GBJA 1L1GA 1E0FD 1GBIA 1LKAA 3TK9A 2O9QA 1L4ZA 1GG6C 4KGAA 1K1IA 2Q6FA 1V2TT 1UHBB 1FIWA 3HGNA 4CRFA 1V3XA 1HFDA 1ABIH 4CRGA 4AN7A 3EA8A 2ZFPH 3I29A 4X1NU 3VGCC 1KXCA 3KQBA 5B6LA 4MPUA 3GYMA 3ODFA 3GDSA 1FMGA 1MZAA 4CRBA 2ZGHA 2BM2A 3RXJA 1BBRE 1BBRH 2C8ZB 3A87A 3T26A 5EXLA 1SGYE 2F91A 1YLCA 2G55A 2HWLB 3U8RH 1OX1A 3SUFA 3GDUA 1NT1A 2H9TH 4CRCA 1EQ9A 3TGJE 5F8TA 4ABEA 2QC2A 4B6FA 2W7UA 2ZFQH 1AWHB 2D2DA 4GUXA 2BXUH 2QA9E 3CS0A 4Q7XA 1EZSC 1S0RA 4ISLA 1ZGVA 1GHYH 2GCHG 4F4OC 5AHGH 1WQSA 2STAE 1GI5A 3M3VA 5I25A 4M7GA 2OC1A 4E05H 2G00A 1BTHH 3LGWA 3U1JB 2GZ8A 1P01A 4ZXXH 1EJAA 3V0XA 4GCHF 7KMEH 2ZGJA 5JYIA 2TGDA 4DT7B 3RXTA 2WPLS 2OD3B 1ANBA 3SU3A 1UTOA 3GCOA 2W3IA 4IMQA 3T25A 3BV9B 3VB7A 1ZJKA 2ZZUH 2HNTF 4CHAB 1GMHG 1TPAE 3MNSA 2A5AA 2G51A 3T29A 1FXYA 4NWKA 1S6HA 3LH3A 3SBKA 3QGNB 3AW1A 3STJA 8GCHF 4IC6A 4MPXA 5G4BA 1P2IA 3PWBA 4MPVA 1LQDB 2NU4E 3A86A 2BLOA 1NRRH 3A85A 3MO9A 1H9HE 4LK4A 5FPYA 1GHBF 1AVGH 3M5LA 2VH6A 4DW2U 4X6NA 1P8VC 1DOJA 1XKAC 1YPMH 2GZ9A 2ZHEH 3MU5A 4ABHA 4GVUA 3EAJA 4AFSA 1ABJH 1P10A 4JZDH 2CXVA 3LGUA 3VB6A 3E8LA 3VB4A 1P04A 1CHOF 2Z94A 2R0KA 1MTSA 2EI7A 3L33A 3ATKA 1EX3A 1TRNA 2GDDA 3SJKA 2BOKA 1OWKA 4XBDA 3M3SA 1GBEA 4CREA 4YTAA 3KF2A 1TA2A 1GG6B 3TGKE 2BX4A 3S9CA 5A8XA 4D9QA 3NKKA 3KGPA 4D8NA 2OLGA 4Y8XA 1SHYA 2VWOA 4TY6A 1LVYA 1EP5A 2VGCB 3ZVEA 1TALA 3E1XB 3RXFA 2BB4A 1XUFA 2HALA 3ZZ8A 1H1BA 2PSYA 2XCFA 1MAYA 4OS5A 1Y3YA 3SORA 3U9AH 2ZCHP 1TA6A 4DY7B 5T1VA 3M7QA 1NZQH 2A2XH 1V2RT 1O5GH 1E36B 4NA7A 3UNSA 1OWJA 4K1EA 3BTTE 1DY8A 1P9UA 2AMQA 2F9PA 1SGDE 1C1TA 1C5NH 1SGQE 2GDEH 3HKIB 2JH6D 5ABWA 1XUKA 1DXPA 1Y5BT 4X8TH 1YCPM 1HRTH 1W7XH 2QV1A 4ZAEA 1ZZZA 4CBNA 2OTVA 2A5IA 1ANDA 2AGIX 4YLQH 3RU4E 2KAIA 1HIAB 3ZYDA 2F9BH 1AE5A 2P8OC 2SNWA 5ETXA 1EKBB 1O2MA 4BNRA 3SNAA 1CA0B 2BDIA 4X1RU 1E38B 1NS3A 2ZGCA 3T28A 5C67A 1UK2A 4OGYA 5DGJA 1MBMA 5C1XA 5IDKA 3S7HB 6CHAB 1ESAA 5E2PA 3EA9A 2GCHF 3W94A 2FYQA 5J4QA 1NO9H 4K5ZA 5DK1A 1G3BA 2A7CA 1JWTA 1HAYB 1GBLA 1S5SA 2R0LA 3SW2B 1TPPA 1RJXB 1PQ7A 3VB3A 4Y7AA 4X2VA 4A1VA 5GWZA 2GZ7A 4UONA 3ITIA 1U6QA 2SGEE 5GJ4B 5FPTA 1ZSLA 1BOQA 1DX5M 1O3FA 1KXDA 1ZTKA 2AGEX 2PKAA 4JCNA 1XMNB 1FN6A 4F49A 1GI7B 2NU1E 1Y3XA 2FOEA 3K2UA 3Q76A 1ZPZA 1KIGH 1MQ5A 1CE5A 1F0RA 1G3CA 4ISHH 1BITA 1FPCH 4JYTA 2ZDLA 2PLXA 1XVOA 2J34A 2ODQA 1S82A 2ZF0H 3A7VA 3LOXA 2J38A 4ABFA 1FV9A 2D1JA 4INHA 1LVBA 2F83A 3BG4C 3FVFB 5C5OA 3QX5H 2ZPSA 3HGPA 2ZKSA 1MAXA 1XXDA 4CRDA 1FJSA 2RA3A 1HAVB 4X6PA 1EZQA 2ZPRA 1ORFA 1P57B 2ZEBA 1K1JA 5FX5A 1C5SA 3RXRA 1HCGA 4I32A 3SJ8A 1O3NA 1KLJH 3VB5A 2GCTC 4Y8ZA 1SQOA 4NGAH 1WV7H 2WPJS 4AFZA 1GVKB 2IN2A 1CA8B 2PW8H 2CGAA 3AASA 5CMXH 2CJIA 3OX7U 4A6LA 1D3DB 3EGKH 2Y5HA 1SHHB 1BJVA 2P8OB 3M61U 5JBCS 3QTOH 1T31A 1GHXH 1NC6A 4LZ1H 5EODA 1QB1A 3SV6A 1ZTJA 3AW0A 1LHFH 1C2HA 1O5AB 3QK1A 1Q31A 3W95A 1A3EH 3K6ZA 5F8ZA 3SYJA 1ARCA 1KSNA 3M5MA 3GDVA 3PMBB 3MU8A 1W12U 3D49H 4ABAA 1GJ4H 2W5EA 2WUBA 4ZHMU 1UVUH 2WINI 4FUCA 1DWDH 1O2HA 3RDZA 1FIZA 2A4GA 3P92A 2XC0A 1ZMNA 1S84A 2VIOA 1HDTH 3GY4A 1W0ZU 1Y3VA 1F5KU 4Y8YA 4IW4E 3UWJH 2ZG0H 2R3YA 1UHBA 1W8BH 4BXSA 1RXPA 4U30A 2THFB 1H4WA 1OWHA 1JIRA 4A1XA 1EAWA 1P12E 1SQTA 5JDUB 3PV2A 3ZZBA 2XXLA 4WXVA 3Q00A 3DD2H 1SG8B 2XWAA 4DCDA 2XBXA 2BQ7B 4UDWH 2ZGXH 1AUJA 5H4IB 4KKDA 1ZPBA 3LGTA 2BQWB 3KN2A 2BVSH 1AFEH 2UWOA 2WHXA 1MD7A 3RLWH 5LH8A 1RGQA 2IJD1 1SGEE 3GY8A 4ZUHA 2OK5A 2VWMA 1OWIA 4Z0KA 1JRSA 2SGPE 5C1UA 1CT2E 1C1NA 2BY5X 3AK5A 2CMYA 2A31A 2P95A 3SGAE 2RDLA 4WXIA 4OM9A 2A5KA 1GHAF 3F9GA 1F5LA 4Z6AH 2F9UA 5C5NA 1SMFE 4KTCA 1H9IE 2GCTB 4JYVH 1ARBA 3BEUA 1KTSB 1L1JA 1YP9A 1ELAA 3PMAB 1UVOA 2FOAA 1TNHA 2GVFA 3ZZAA 3ATMA 3A8AA 2SFAA 1QHRB 4FUEA 4YESB 1MKXH 2BTCE 4AOQA 2G52A 3QUMP 3QLPH 3TLOA 5T6DA 1QQUA 3IG6B 3F68H 1L0ZA 2GKVE 1AD8H 1CBWC 1J8AA 1EATA 3NWUA 2FI4E 2Q6GA 1Y3UA 2J92A 3TH2H 1CT0E 2G4TA 1MTUA 3UQVA 5HM2A 1V2NT 3EE0B 1Z71A 1AWFH 3TVJB 1O32A 1PYTD 1O3OA 2SGFE 2UUYA 3G01A 2ZFRH 2PR3A 1O5FH 2P93A 1C1VH 4BTIB 1HPGA 1SGFA 3RMLH 2O8UA 3TPIZ 2PGQB 4FU8A 1CGIE 1KDQA 3A7XA 1HBTH 1ZHPA 1OOKB 2GD4B 4K1SA 2H6MA 1V2OT 3FAOA 2PKSB 3GYLB 3H7OA 2ZQ2A 3GCHB 3PO1B 3OU0A 2ZDVH 3GY3A 5C20A 1FLEE 1O2VA 4A1TA 3RXCA 1X7AC 3OY6U 3BTFE 1WQVH 1RRKA 1XUGA 1TQ7B 2ZDNA 4ZROA 4GLYA 1C1RA 1TNLA 2XC4A 5FX6A 3V7TA 3PB1E 3LKWA 3MNXA 3ODDA 1AN1E 2FWWA 4X2WA 1V2KT 2CHAC 2BD3A 1ANCA 1GMCG 1MU6B 4DGJA 2DE8A 3MH5A 1HAHH 3TH3H 1T4VH 1YKTA 2JH5D 2P94A 1D6RA 2BVRH 1HIAA 2W3KA 1NRNH 3RMNH 1ZHMA 1ZR0A 1FZZA 2PV9B 1QNJA 1F5RA 1HLTH 3CP7A 2ANKH 2C3SA 3JZ1B 1V2WT 3A8CA 3SO3A 3VXEH 1LPGB 1NRPH 2ZC9H 1GVZA 4BOHA 5BRRE 4BTUB 5DP8A 1C4V2 2ODPA 1KY9A 4X1SU 2BD4A 3SU4A 1C1MA 5EG4A 2W7SA 1TE0A 1HAOH 1SPJA 2BLWA 3GICB 3ATLA 3HK6B 4DVAU 1C2FA 2FTLE 4RKJB 3A7YA 3DT0H 2OQUA 3LDXH 1F0TA 2WZQA 2PHBA 1CBWB 5CE1A 1NM6A 1FY8E 1UVTH 1THPB 3DA9B 4K60A 1TBQH 2A2QH 4YT6H 4X8VH 1OP0A 2WYJA 1PQAA 1ANEA 1CHOG 2IOTA 1HJ9A 1KXBA 3A7WA 1SVPA 1O2LA 3WY8A 3BEFB 2V0BA 3UOUA 1EJMA 2WPKS 1AU8A 4WJG2 1O33A 1O36A 1O2JA 1P0SH 4DIHH 2VIQA 3H09A 3MO6A 1MBQA 4HI3A 3OY5U 3E6PH 1EAXA 1ELGA 5DP3A 4AB8A 1TAWA 2FOHA 2XBVA 3RLYH 2Y7XA 2VWNA 4O03A 4Y10E 1HAPH 1E34B 3MWIU 1TGTA 1TRYA 2F9OA 2NU2E 1JMOH 4NA9H 1D4PB 2FS8A 1TX6A 3OSYA 1XVMA 3PLPA 3C1KA 1QBNA 1QURH 1BMLA 1HAVA 1K1NA 5JBBS 3NXPA 3UWIA 1W14U 2ZTYA 4FUBA 3SI4H 4I8JA 2XBWA 1TGBA 3BIVH 3QO6A 3VEQB 4I31A 1GBHA 1HV7A 2Q6DA 1K21H 1YCPK 3K9XB 1YYY1 4CR9A 1DS2E 1SGNE 2HLCA 4Y7BA 1O37A 2WPHS 1TWXB 2ZP0H 2F9NA 2O8WA 1W2KH 4NZQA 1RD3B 2VJ1A 1W7GH 4OGXA 4GPGA 1OKXA 2JETB 1B0EA 1PPGE 2A32A 2XCNA 4X1PU 4Y71A 2J2UA 3SN8A 2DUCA 1BTYA 4YM9A 4B75A 4ABIA 3BTGE 1GL1A 2BDHA 2A45B 1Y5UT 2BYAX 2ZIQH 5AFYH 4BAMB 1GGDB 5ESBA 2ZCKP 1F0SA 5L2YH 2FOBA 1O3GA 2ZTZA 5K0HA 4NIYA 3DUXH 4XSKU 1GI9B 1GMCF 1IHTH 1UCYH 1FY4A 8ESTE 1GDUA 1O38A 1GI0A 1Q3XA 1O2RA 1PYTC 3K65B 1IOEA 1BTXA 3P70B 2C8XB 1EXFA 4JYUH 3RXPA 4IN1A 4IGDA 3SGQE 4NIWA 1GWAA 3NZIA 1IQHA 5L30H 1NESE 4Q7YA 3BTDE 1O34A 2AH4X 1BRUP 1FI8A 1NU7B 3F9HA 4B74A 2AERH 2EI8A 1BUIA 2GMTB 1ZOMA 1GCDA 2BD9A 2FLRH 1AFQB 1N8OC 1VITH 3V3MA 4D7FA 1O3HA 5EXMA 5JPMH 4DIIH 1DLKB 4AGKA 1TNJA 1HYLA 1C5QA 4NIVA 3ZVCA 4QT8C 3ESTA 1SLXB 4TWWA 1RIWC 1PPFE 2OCVB 2H1UA 1MKWK 1W13U 3LJOA 1SGRE 3PV4A 2BVXH 1BTUA 2FX6A 1ELTA 2P59A 1Z8RA 1NY22 2ZQ1A 4CR5A 1BTWA 2ZDAH 3PLKA 1SLUB 1O3EA 4IC5A 2O8TA 1A5HA 1O31A 2SGAA 4ZHLU 1P02A 3MTYA 3N7OA 5A0CA 5JB8S 3P8OA 5C3NA 3URDA 7GCHG 1ESBA 3A82A 1KLIH 1HGTH 3SUEA 1OPHB 1BBRK 1C2JA 2HVXA 1VCQA 3VGCB 1W3CA 4UD9H 2VNTA 1KDQB 1D6WA 2XW9A 2BY7X 1TFXA 5EQSA 1G37A 4HZHA 4JZ1A 2WUCA 1QIXB 4A5TS 1HXFH 1N1LA 4UFGH 1D3PB 3RMMH 5A09A 3D65E 1SI5H 4ABJA 1EAUA 1BQYA 3V13A 2DE9A 4VGCC 1CO7E 2FTMA 4INKA 4R0IA 3RXDA 3HPTB 2GV7A 3ZV8A 3MMGA 4FVDA 1SGFG 1BA8B 2UUJB 1P3EA 3RXBA 1DLEA 1TONA 3U8OH 5GCHG 3SQHE 2OC8A 1A7SA 3UR6A 4BAOB 1XUIA 2H9HA 1GVLA 2AFQB 1QTFA 4MQAA 2H2ZA 3P17H 3ZYEA 2FI3E 2FOFA 1ZLRA 3KQCA 3F9EA 1SOTA 2D26C 1O3BA 1OWEA 2QGRA 4K69A 1Z7KA 1V2JT 1FNIA 2M5TA 2FYRA 3A83A 3LIWA 5EGMA 5TCCA 3RXEA 2V6NA 2G81E 5AFZH 3SGBE 1GI6A 3R3GB 5LPFA 1EOJA 4JZFH 2HGTH 3E91A 1EPTC 4X1QU 1Y5AT 5CHAC 3ELAH 1V2QT 1BTPA 1UTQA 4X6OA 1SLWB 2GT7A 3LGIA 1G36A 1MTWA 4TPIZ 1FPHH 2ZTXA 3KL6A 5EQQA 4JMYA 2UUKB 3TNTA 2ZU2A 1TOCB 5TCAA 3T62A 4NCYA 4ZMAH 1BMAA 4DURA 1AQ7A 4Y11E 3LH1A 3JZ2B 3PTBA 2BLVA 2K1QA 1JBUH 1O3AA 3T2NA 2AMDA 4FUHA 2VH0A 2W26A 4H6SB 1GHAG 3MFJA 3B9FH 2BOHB 4U32A 5DP7A 4B71A 4FUGA 5HYOA 1DSUA 4YOIA 2HRVA 2WV9A 1UK4A 1OS8A 2BZ6H 3O8BA 1HAGE 3A8BA 2BQ6B 4AYYB 3ZZ7A 4MNXA 3TK6A 1QJ6B 2V3HH 2J94A 2VWLA 1Y3WA 3BTWE 3KEEA 5I46H 2RCEA 1CQQA 1ZMLA 5HM9A 1A5IA 1GJ7B 1DM4B 4VGCB 3HKJB 2ZFSA 1O3MA 1FAKH 5EPNA 2IJOB 1O3JA 1J14A 2OC7A 1YC0A 4OS1A 1LPZB 5DG6A 2NU3E 1YPKH 1OSSA 3KHVA 3B8JA 4XDEA 2QXJA 1BHXB 3AAUA 5DP5A 2A4QA 1E35B 7GCHF 1C5WB 2ZFFH 3UFAA 1MTNC 1UO6A 1WXRA 5F03A 1QFKH 1A0HB 2VINA 4ISOA 1O2UA 3URCA 2GP9B 9LPRA 2JH0D 1DFPA 1DPOA 1EAIA 4YT7H 2F3CE 2VBCA 2Z3EA 4O3TA 4FVBA 1A0JA 4D76A 2Z9JA 2V35A 1KXFA 1SBWA 4Q7ZA 1J15A 1FAXA 1TMBH 3DFLA 4INLA 1T32A 4KTUA 2AYWA 1N6YA 4UE7H 2I6QA 2Z7FE 1E37B 1EP6A 4XBBA 1F2SE 1IQFA 2BD2A 3F9FA 1BJUA 2TPIZ 4H4FA 4NG9H 1EPTB 1P05A 3TK5A 2CV3A 4WH6A 1SFQB 1T8OA 3RC5A 1IQIA 5GCHF 2EI6A 3MI4A 2Y81A 1FONA 3S9AA 1VGCC 4IS5A 5DP9A 1RS0A 1O2IA 1TQ0B 1THSH 1TBRH 4HTCH 1K2I1 3PROA 1YPHC 2FEQH 1G9IE 4BANB 1CT4E 2FXRA 3BN9A 2QF0A 3RXAA 1CHGA 1PPHE 1C2LA 1AMHA 4HGCA 3A81A 1WAYB 3SUDA 1D3QB 4X8UH 1V2LT 3MNCA 1YPGH 4OS2A 1C1PA 5EOKA 1F7ZA 2QY0B 1LPKB 1YPHE 4FU9A 3SNDA 3ZVBA 1SOZA 2RA0A 1MCTA 4WMEA 1H8DH 4A7IB 4AZ2B 1FUJA 1GJDB 1LO6A 3BG4B 1ELCA 2P3TB 1OWDA 3RXMA 2PWXA 4ZKOU 3S0NA 1O3KA 3RP2A 1BZXE 1BCUH 1AGJA 2FM2A 5LPEA 3PMJA 4TPYA 3SNEA 1TMTH 2RG3A 2ZPQA 5C1YA 5FBEA 5GNDA 3RXSA 1K22H 7LPRA 1QY6A 1BT7A 2AGGX 3U8TH 4AGJA 1TB6H 2XYAA 1KLTA 2AS9A 4JZEH 1NN6A 4AG2A 4CRAA 1MTVA 1TPSA 2VIDA 2R2MB 1QA0A 2FIRH 4LZ4B 1KTTB 1QRZA 3O8CA 1ZHRA 1MD8A 2ALPA 1C2DA 1QA7A 1ZRKA 2NWNA 3RXVA 1K1OA 4X6MA 5A0AE 1L1NA 2A4OA 2WPIS 2ZFTA 4WH8A 2PSXA 1AZZA 5PTPA 4FUJA 1LMWB 1BDAA 1UTKA 1GL0E 2UUFB 1PPZA 9ESTA 3VXFH 1K1MA 3MH7A 2R2WU 1HAZB 3ATWA 2AEIH 1G3DA 1C5OH 1ZMJA 1SGIB 2LNCA 4NWLA 3M37A 3UNQA 1VGCB 1PJPA 2BZAA 2ILNA 1OP2A 4MNYA 2D8WA 1CU1A 5DJ7A 2ANMH 3Q3XA 1VZQH 2OUAA 1EUFA 4B6EA 3ZZ5A 1T8MA 4NZLA 1SQAA 3E0PB 4WWYA 3FP8E 1DE7H 3BTKE 3BEIB 2AIQA 5EW1H 1GCTC 3RM0H 3FP6E 2A7JA 1EZUC 1BHXF 2P16A 1FN8A 3GCTG 3LGYA 1FY1A 4THNH 2Z9KA 4TWYA 3LJJA 1WUNH 5EXNA 4MTBA 2HOBA 3RC4A 1FQ3A 2VU8E 2ALVA 1KYNA 4ZKRU 1IQGA 1ZJDA 1JRTA 1GHWH 2ESTE 3ZVAA 1IQEA 2O8MA 2SGQE 4K8BA 1AHTH 2BY6X 3GY2A 1A2CH 1MCVA 4ZKSU 1TGCA 3ZZ3A 1B5GH 3UREA 1BMMH 2Z3CA 3LC3A 1V6DA 1QGFA 4XE4A 5EW2H 1AVWA 3SU1A 3S7KB 5T6FA 1V2UT 4PROA 3UY9A 2PTCE 3M3TA 1ZGIA 1MKXK 4X8SH 3E3TA 1BRAA 1XM1A 5C2ZA 1C5LH 3SUGA 3U98H 1QBVH 4B2BA 2EC9H 1GJ8B 1QQ4A 1YPJH 3VFEA 2QN5T 2BLQA 3PLBA 4NFFA 3ZVFA 1XX9A 4D7GA 3TU7H 3SV7A 2J9NA 2QIQA 3P6ZB 2R3UA 3EA7A 3RXOA 4GAWA 2VVVA 2OBOA 5TJXA 1C5ZB 2B0FA 2FX4A 1Q2WA 3ATIA 5E8EH 2I6SA 2BHGA 3ZZCA 3LGVA 4AYVB 1S81A 3ZV9A 4I8GA 4NIXA 2OQ5A 1UVSH 8KME2 1HAXB 1ELDE 1Z6JH 2FLBH 4K1TA 1PPEE 3MHWU 4E06H 1P2JA 4K3JA 1ETSH 1V2PT 3F6UH 2C90B 3LC5A 3RXHA 2ZWLH 2VVUA 3I77A 1O2QA 1O5CB 3NCLA 1F92A 3RU4D 1EZXC 1GJ6A 1DVAH 2UWLA 4FUDA 4SGBE 3KIDU 1BRCE 3O8RA 3ENSB 2ANYA 4WVPE 4GSOA 4ZKNU 4CHAC 1Z8JB 1AY6H 2WYGA 7ESTE 4BAHB 1MU8B 1PQ8A 5L6NH 1AKSB 3TJVA 4X2XA 3MYWA 1LDTT 3A8DA 4FU7A 3RXLA 4ABBA 2WV4A 1GHVH 4WY3A 3TITA 1UK3A 1O39A 2CHAB 4Q80A 2G4UA 1P11E 3GCTF 6GCHF 1JIMA 3L3TA 1H9LB 1W0YH 1WYKA 3A7ZA 3IWMA 1C4U2 3O8DA 1A1RA 3NK8A 1VJ9U 1P2KA 5FCKA 1DICA 5A8ZA 1GMDG 2ZU5A 4Y76A 4WMDA 1ZRBA 1WBGB 3RXIA 3PM3A 4KTSA 3SZEA 4B1TA 3D23A 3T5FH 4TYDA 1C5RA 5T3HA 1O3IA 1TMUH 1EPTA 5A8YA 1GI4A 1NFXA 4YLUA 3A84A 1NFYA 5FAHA 1O2XA 3FANA 1UMAH 1TABE 1UCYE 2VGCC 2EEKA 2FO9A 4B76A 1TNKA 1YF4A 3S9BA 1O2TA 1NROH 2Q1JA 1KXEA 1HUTH 1DY9A 3CS7A 2A0QB 2TBSA 2GX4A 1CGHA 2ZHQH 4AB9A 1TX8A 2B5TB 2Y7ZA 3QWCH 1DWEH 5DO4H 4YZUA 2ZHWH 2O8LA 4H42U 1GDQA 1RFNA
chains in the Genus database with same CATH superfamily
1XKBC 4MLFB 4YO9A 3U1IB 1ZYOA 1ZSJA 1YPEH 1DWBH 4UFFH 4H6TA 1DUAA 5DKMA 3SJ9A 4B73A 4I8KA 2FZZA 2KR7A 4Q2KA 3QZQA 5E0JA 2JKHA 2XC5A 1P9SA 4Y79A 1PPBH 1C2EA 1O2OA 1GBKA 2HPPH 3EQ0H 2TIOA 1SGPE 1K1PA 1RTLA 3GY6A 1SC8U 4RT1A 3A88A 2BXTH 5EQRA 1CA0C 4NSVA 4AG1A 1P3CA 5SGAE 1NFWA 2FP7B 4CBOA 1UTNA 3M36A 4MVNA 3QZRA 6CHAC 1YY3A 3IITA 5HMAA 2CF9H 1QRWA 2WV5A 2XBYA 5AF9H 3FKSD 2H5CA 3EE7A 3OEED 4O9VA 3DHKH 3KYGA 4KELA 1TNIA 4E7RG 2YMSD 5GIBA 2BY9X 3P95A 1Y8TA 2VIPA 1LHEH 2KCYA 2CN0H 2XRCA 1MMJN 2PTNA 2ZDMA 2OBQA 1O2YA 1O5EH 5T6GA 2BMGB 3UOPA 1AB9C 3AAVA 3BTME 2LELA 3BF6H 3V12A 5A0BA 2TGAA 1BTZA 1LVMA 1Z8GA 1LKBA 3UQOA 3PTNA 2H9EH 1UCYK 2YNBA 3LT3A 1T4UH 5LPRA 2EA3A 3SV8A 4OS6A 4AX9H 1NU9A 1RTFB 3SJIA 2QXGA 2FOMB 3PRBA 4ABDA 3UUZA 1WDIA 1LCYA 1GI3A 3FZZA 4M9FA 2ZU3A 5EJZA 1FY3A 2K0QA 1GMDF 2J4IA 4ZCNA 3SOSA 2Y82A 1E79D 1ELFA 4X2YA 1F0UA 4AORA 2LP6A 2FMJA 1AIXH 1ZPCA 4JZIA 4F55A 4RKOB 1O3CA 1J17T 4AFUA 1TYNA 2FPZA 2F9VA 2ZGBH 3MU4A 4TY7A 1GI2A 1GJ5H 1N8OB 3OYPA 3ZVDA 3ZZ9A 4KP0A 3BTEE 4E7NA 4FUFA 4I8LA 4OS4A 1UVPA 5L2ZH 1TGSZ 3D62A 3I78A 1S85A 2ZI2H 3U69H 3MH4A 1VITG 5FCRA 5E0GA 1MQ6A 4D9RA 1O2NA 4ISNA 5K7RA 3VPKA 3UIRA 1DT2A 3Q3KA 1RIWB 3HATH 3RUOA 1ZTLA 1GBAA 2ZO3H 1TOMH 2PUXB 2ZNKH 1HXEH 3QTVH 1MUEB 1G2MA 3QGJA 1HJAC 3OTJE 2Z9LA 2NU0E 1AVXA 1TLDA 4CH8B 1O2WA 1PPCE 1C5XB 3E90B 3TIUA 3BG8A 3SV2H 1YM0A 2QYIA 1CSOE 2P3FH 1INCA 1NRSH 4I33A 2FDAA 1GMHF 1ELVA 1J9CH 1Y59T 1LVOA 1A5GH 2M2AA 5HGGA 2VB0A 1Z1JA 4DT4A 1AB9B 1QL7A 1EB1H 1O30A 6LPRA 2YOLA 2PUQH 6ESTA 3P8FA 2H5DA 1ID5H 3UPEA 2BD8A 1J16A 5JBAS 1ELBA 2PGBB 3TH4H 1S0QA 5A2MH 3BSQA 2G5NA 4GHQA 3UTUH 2FOGA 1Z8IB 4ZH8A 2G8TA 1LHCH 4LOYH 4J2YB 5EU8A 4Y0YE 1QL9A 3TJNA 5E2OA 3DFJA 1DSTA 1EJNA 1ETTH 1GDNA 1W10U 2A7HA 1HJ8A 3LPRA 1A4WH 1P06A 1S83A 3GCNA 1QB9A 3GOVB 1DITH 1T7CA 1BIOA 1K9OE 3MH6A 4NA8A 3UR9A 1E1QD 1O3PB 2GGVB 2Y5GA 4BAKB 1C1OA 5GDSH 2LPRA 4I8HA 3SZNA 1EASA 1QJ1B 2Z9GA 1G30B 3HK3B 5FPSA 3A89A 1TIOA 1B7XB 1C9TA 1YWUA 1VJAU 3GISB 1SL3A 5GXPA 1V2ST 4UFDH 3SU2A 5CHAB 1AKSA 4IBLH 1AZ8A 5F6MA 2Y6TA 3ZVGA 2KM0A 4JK5A 2PFEA 3SNBA 2OP9A 2OC0A 1HB0B 3A7TA 4FXGH 3KQDA 3SHCH 5F8XA 1C5MD 1RTKA 4IMZA 2A1DB 3SU6A 1SGTA 1B0FA 5J4SA 1HJAB 1VCPA 3S69A 2FI5E 3Q77A 2WPMS 4WMFA 5BPEA 2ZU1A 4A92A 2ZU4A 2V3OH 2YMSC 5ESTE 1FY5A 1EB2A 1GBTA 4ESTE 3SU0A 1GHZA 4BTTB 1LHDH 4HFPB 4U01A 4WF8A 1C5UA 1YPLH 1C1SA 4ASHA 3RC6A 1Z1IA 4MPWA 4XBCA 3ZZ4A 3SNCA 2GT8A 1WCZA 3P8NA 1VITF 1AE8H 1V2VT 1SR5C 4JK6A 5FXLA 1DUEA 3RM2H 3K6YA 1GBBA 4FUIA 3C27B 5JB9S 2Z6BD 3ZZDA 2C4FH 4B2AA 3FFGA 1VCWA 3NPSA 4IN2A 3KQEA 1TRMA 2Y80A 2PKSC 3WWBA 4AC9A 2QAAA 4U2WA 2J95A 4RI0A 1O3LA 3GCHC 3PO1C 2GV6A 3DSOA 3F1SB 3BTQE 3UNRA 2ZHFH 2TRMA 4ZHAA 4LXBH 5B6OA 1MTNB 4I7YH 2ASUB 5DP4A 3KQ5A 2F43B 3M35A 1BRBE 8LPRA 1O0DH 4DOQA 3PYHA 2QXHA 2BD5A 2ZDKA 3ZZ6A 2TGPZ 4Z1MD 2HNTC 1YLDA 1C4Y2 4J1YA 1C5VA 3F2GA 1D3TB 1W11U 2C8YB 3TGIE 2BDCA 2IPHA 1GBFA 1K1LA 1G3EA 1GPZA 2YNAA 2VVCA 3NUMA 3M5OA 1C2MA 2P3UB 4Y6DA 2R9PA 4MNWA 2B7DH 4P02A 3SHAH 1WOFA 1PFXC 4RN6A 1UTJA 3TJUA 1P09A 1IQLA 2HNTE 3SJOA 4CH2B 1IQNA 1SB1H 5DP6A 1TPOA 1O2KA 4MG3A 5DPAA 2V3MA 1O2ZA 2AIPA 3MO3A 1ETRH 1BB0B 1VR1H 4DG4A 3EYDA 4BAQB 1TNGA 1C2KA 1SLVB 1KXAA 3FZDA 1A61H 2A4RA 1GI8B 1KMHB 1QJ7B 2STBE 3QDZB 3RXQA 2BDAA 2SGDE 1AO5A 5FBIA 3RXGA 1S6LA 3GY7A 3SV9A 1SGCA 1C5YB 2QF3A 1C9PA 3AVZA 4YOGA 4K2YA 1O5BB 6GCHG 1O2GH 2C93B 1C1WH 1ELEE 4SGAE 1O2PA 3BTHE 5JBTA 4Y0ZE 1G32B 5EPYA 3CENA 1CGJE 2VIWA 3TJOA 1P2OA 1XUHA 2VIVA 1EOLA 2KAIB 1QCPA 4BXWA 1ACBE 1YBWA 4XFQA 1SSXA 5C17A 1GBDA 1A0LA 1D9IA 5GPIB 1P2MA 1G2LA 1YGCH 1HNEE 1PQ5A 1WTHD 1DXWA 1T8NA 2FOCA 2BDGA 1P2QA 1IQKA 3RU4T 1WTGH 1L2EA 4B2CA 1GI1A 1C5PA 1WU1A 2WPDD 3PMHB 3GY5A 3LONA 2QXIA 1WSSH 3RXKA 2F4LA 1N6XA 2FS9A 1UTLM 3H7TA 3M7TA 1QBOA 1O3DA 4UFEH 1FDPA 3LU9B 3SI3H 2B8OH 4O97A 2Y5FA 3MOCA 2C8WB 3OTPA 2CF8H 3L6PA 2ZECA 4FETA 4RSPA 3H5CB 1A46H 1GJ9B 1K28D 1MH0A 3A80A 2BDBA 1IHSH 3QN7A 2SNVA 4YOJA 3MQKC 3RXUA 1IAUA 1AUTC 1MZDA 1UTMA 1HAIH 1YCPH 2PKAB 1UJ1A 2ZCLP 2ZA5A 1OP8A 2QCYA 3Q3YA 2RFKC 2JETC 2ZHDA 1NTPA 1C2GA 2JIZD 1DWCH 3BIUH 2ODYB 3FP7E 4GCHG 3E16B 1H8IH 4ABGA 3P8GA 2FODA 3KNXA 4MDSA 4X0WU 1M9UA 1S6FA 1C5TA 1DANH 1O5DH 1GGDC 3T27A 4OS7A 2OXSA 1LHGH 1GBCA 4UEHH 1GBMA 4GHTA 1C2IA 1P03A 2XWBI 4R8TB 4NSYA 1IQJA 1LQEA 5C94A 1AI8H 2XTTB 2BD7A 8GCHG 1UTPA 1LTOA 3EDXB 2HLDD 1ZSKA 3PV5A 1GCTB 2BX3A 1A3BH 1C1UH 1GHBG 1TX7A 2AMPA 1IQMA 3RMOH 1XUJA 1Z6EA 3MU1A 1GJCB 1K0HA 3KCGH 1NFUA 5FHTA 1DDJA 3E0NB 2BY8X 3SU5A 1OYQA 1QR3E 1V2MT 2J5UA 4ZXYH 2FESH 2Z3DA 5LGOA 2Z9IA 3M7UA 2GMTC 1JOUB 1QRXA 2OINA 4AFQA 2XNIA 4XOJA 3B23B 2TGTA 1AFQC 3TNSA 5FL7D 1CVWH 5IYTA 1QL8A 1THRH 1T8LA 4NFEA 5E0HA 5C0UA 5CHBA 1L4DA 5HXFA 1P2NA 2ANWA 3PWCA 1QB6A 3MNBA 4O3UA 1BMNH 1OXGA 3SQEE 1ESTA 3R0FA 1GJAB 1TBZH 2ULLA 2GTBA 4ISIH 1SFIA 1O35A 2BDYA 1JXPA 4K8YA 2B9LA 2L6OA 1NPMA 1GJBB 1C1QA 2G5VA 3MU0A 1O2SA 3STIA 4DJZB 3M5NA 1OYTH 1NRQH 1TGNA 2HPQH 5AVDA 1XXFA 2UWPA 1MKWH 4MNVA 1GBJA 1L1GA 1E0FD 1GBIA 1LKAA 3TK9A 2O9QA 1L4ZA 1GG6C 4FOUC 4KGAA 1K1IA 2Q6FA 1V2TT 1UHBB 1FIWA 3HGNA 4CRFA 1V3XA 1HFDA 1ABIH 4CRGA 4AN7A 3EA8A 2ZFPH 3I29A 4X1NU 3VGCC 1KXCA 3KQBA 4XD7D 5B6LA 4MPUA 3GYMA 3ODFA 3GDSA 1FMGA 1MZAA 4CRBA 2ZGHA 2BM2A 3RXJA 1BBRE 1BBRH 2C8ZB 3A87A 3T26A 5EXLA 1SGYE 2F91A 1YLCA 2G55A 2HWLB 3U8RH 1OX1A 3SUFA 3GDUA 1NT1A 2H9TH 4CRCA 1EQ9A 3TGJE 5F8TA 4ABEA 2QC2A 4B6FA 2W7UA 2ZFQH 1AWHB 2D2DA 4GUXA 2BXUH 2QA9E 3CS0A 4Q7XA 1EZSC 1S0RA 1E1RD 4ISLA 1ZGVA 1GHYH 2GCHG 4F4OC 5AHGH 1WQSA 2STAE 1GI5A 3M3VA 5I25A 4M7GA 2OC1A 4E05H 2G00A 1BTHH 3LGWA 3U1JB 2GZ8A 1P01A 2KCPA 4ZXXH 1EJAA 3V0XA 4GCHF 3U28C 7KMEH 2ZGJA 5JYIA 2TGDA 4DT7B 3RXTA 2WPLS 2OD3B 1ANBA 3SU3A 1UTOA 3GCOA 2W3IA 4IMQA 3T25A 3BV9B 3VB7A 1ZJKA 2ZZUH 2HNTF 4CHAB 1GMHG 1TPAE 3MNSA 2A5AA 2G51A 3T29A 1FXYA 4NWKA 2W6ID 1S6HA 2J97A 3LH3A 3SBKA 3QGNB 3AW1A 3STJA 8GCHF 4IC6A 4MPXA 5G4BA 1P2IA 3PWBA 4MPVA 1LQDB 2NU4E 3A86A 2BLOA 1NRRH 3A85A 3MO9A 1H9HE 4LK4A 5FPYA 1GHBF 1AVGH 3M5LA 2VH6A 4DW2U 4X6NA 1P8VC 1DOJA 1XKAC 1YPMH 2GZ9A 2ZHEH 3MU5A 4ABHA 4GVUA 3EAJA 4AFSA 1ABJH 1P10A 4JZDH 2CXVA 3LGUA 5CDFE 3VB6A 3E8LA 3VB4A 1P04A 1CHOF 2Z94A 2R0KA 1MTSA 2EI7A 3L33A 2PP6A 3ATKA 1EX3A 1TRNA 2GDDA 3SJKA 2BOKA 1OWKA 4XBDA 3M3SA 1GBEA 4CREA 4YTAA 3KF2A 1TA2A 1GG6B 3TGKE 2BX4A 3S9CA 5A8XA 4D9QA 3NKKA 3KGPA 4D8NA 2OLGA 4Y8XA 1SHYA 2K8IA 2VWOA 2HVYB 4TY6A 1W0KD 1LVYA 1EP5A 2VGCB 3ZVEA 1TALA 3E1XB 3RXFA 2BB4A 1XUFA 2HALA 3ZZ8A 1H1BA 2PSYA 2XCFA 1MAYA 4OS5A 1Y3YA 3SORA 3U9AH 2ZCHP 1TA6A 4DY7B 5T1VA 3M7QA 1NZQH 2A2XH 1V2RT 1O5GH 1E36B 4NA7A 3UNSA 1OWJA 4K1EA 3BTTE 1DY8A 1P9UA 2AMQA 2F9PA 1SGDE 1C1TA 1C5NH 1SGQE 2GDEH 3HKIB 2JH6D 5ABWA 1H8HD 1XUKA 1DXPA 1Y5BT 4X8TH 1YCPM 1HRTH 1W7XH 2QV1A 4ZAEA 1ZZZA 4I86A 4CBNA 2OTVA 2A5IA 1ANDA 2AGIX 4YLQH 3RU4E 2KAIA 1HIAB 3ZYDA 2F9BH 1AE5A 2P8OC 2SNWA 5ETXA 1EKBB 1O2MA 4BNRA 3SNAA 1CA0B 3WW7A 2BDIA 4X1RU 1E38B 1NS3A 2ZGCA 3T28A 5C67A 1UK2A 4OGYA 5DGJA 1MBMA 5C1XA 5IDKA 3S7HB 6CHAB 1ESAA 5E2PA 3EA9A 2GCHF 3W94A 2FYQA 5J4QA 1NO9H 2IPQX 4K5ZA 5DK1A 1G3BA 2A7CA 1JWTA 1HAYB 1GBLA 1S5SA 2R0LA 3SW2B 1TPPA 1RJXB 1PQ7A 3VB3A 4Y7AA 4X2VA 4A1VA 5GWZA 2GZ7A 4UONA 3ITIA 1U6QA 2SGEE 4ASUD 5GJ4B 5FPTA 1ZSLA 1BOQA 1DX5M 1O3FA 1KXDA 1ZTKA 2AGEX 2PKAA 4JCNA 1XMNB 1FN6A 4F49A 1GI7B 2NU1E 1Y3XA 2FOEA 3K2UA 3Q76A 1ZPZA 1KIGH 1MQ5A 1CE5A 1F0RA 1G3CA 4ISHH 4ACBA 1BITA 1FPCH 4JYTA 2ZDLA 2PLXA 1XVOA 2J34A 2ODQA 1S82A 2ZF0H 3A7VA 3LOXA 2J38A 4ABFA 1FV9A 2D1JA 4INHA 1LVBA 2F83A 2QE7D 3BG4C 3FVFB 5C5OA 3QX5H 5DSFA 2ZPSA 3HGPA 2ZKSA 1MAXA 1XXDA 4CRDA 3N7DA 1FJSA 1MABB 2RA3A 1HAVB 4X6PA 1EZQA 2ZPRA 1ORFA 1P57B 2ZEBA 1K1JA 5FX5A 1C5SA 2V7QD 3RXRA 1HCGA 4I32A 3SJ8A 1O3NA 1KLJH 3VB5A 2GCTC 4Y8ZA 1SQOA 4NGAH 1WV7H 2WPJS 4AFZA 1GVKB 2IN2A 1CA8B 2PW8H 2CGAA 3AASA 5CMXH 2CJIA 3OX7U 3WWFA 1D3DB 4A6LA 3EGKH 1H8ED 2Y5HA 1SHHB 1BJVA 2P8OB 3M61U 5JBCS 3QTOH 1T31A 1GHXH 1NC6A 4LZ1H 5EODA 1QB1A 3SV6A 1ZTJA 3AW0A 1LHFH 1C2HA 1O5AB 3QK1A 1Q31A 3W95A 1A3EH 3K6ZA 5F8ZA 3SYJA 1NBMD 2W6JD 1ARCA 1KSNA 3M5MA 3GDVA 3PMBB 3MU8A 1W12U 3D49H 4ABAA 1GJ4H 2W5EA 2WUBA 4ZHMU 1UVUH 2L74A 2WINI 4FUCA 1DWDH 1O2HA 3RDZA 1FIZA 2A4GA 3P92A 2XC0A 1ZMNA 1S84A 2VIOA 1HDTH 3GY4A 1W0ZU 1Y3VA 1F5KU 4Y8YA 4IW4E 3UWJH 2ZG0H 2R3YA 1UHBA 1W8BH 4BXSA 1RXPA 4U30A 2THFB 1H4WA 1OWHA 1JIRA 4A1XA 1EAWA 1P12E 1SQTA 3PV2A 5JDUB 3ZZBA 2XXLA 4WXVA 3Q00A 3DD2H 1SG8B 2XWAA 4DCDA 2XBXA 2BQ7B 1UW7A 4UDWH 2ZGXH 1AUJA 5H4IB 4KKDA 1ZPBA 3LGTA 2BQWB 3KN2A 2BVSH 1AFEH 2UWOA 2WHXA 1MD7A 3RLWH 5LH8A 1RGQA 2IJD1 1SGEE 3GY8A 4ZUHA 2OK5A 2VWMA 1OWIA 4Z0KA 1JRSA 2SGPE 3DCLA 5C1UA 1CT2E 1C1NA 2BY5X 3AK5A 2CMYA 2A31A 2P95A 3SGAE 2RDLA 4WXIA 4OM9A 2A5KA 1GHAF 3F9GA 1F5LA 4Z6AH 2F9UA 5C5NA 1SMFE 4KTCA 1H9IE 2GCTB 4JYVH 1ARBA 2GJGA 2KFWA 3BEUA 1KTSB 1L1JA 1YP9A 1ELAA 3PMAB 1UVOA 2FOAA 1TNHA 2GVFA 3ZZAA 3ATMA 2KZ4A 3A8AA 2SFAA 1QHRB 4FUEA 4YESB 1MKXH 1W0JD 2BTCE 4AOQA 2G52A 3QUMP 1YLNA 3QLPH 3TLOA 5T6DA 1QQUA 3OE7D 3IG6B 3F68H 2YMSB 5HKKD 1L0ZA 2GKVE 1AD8H 1CBWC 1J8AA 1EATA 3NWUA 2FI4E 2Q6GA 1Y3UA 2J92A 3TH2H 1CT0E 2G4TA 1MTUA 3UQVA 5HM2A 1V2NT 3EE0B 1Z71A 1AWFH 3TVJB 1O32A 1PYTD 1O3OA 2SGFE 2UUYA 3G01A 2ZFRH 2PR3A 3NRLA 1O5FH 1C1VH 2P93A 4BTIB 1HPGA 2XNDD 1SGFA 3RMLH 2O8UA 3TPIZ 2PGQB 4FU8A 1CGIE 1KDQA 3A7XA 1HBTH 1ZHPA 1OOKB 2GD4B 4K1SA 2H6MA 1V2OT 3FAOA 2PKSB 3GYLB 3H7OA 2ZQ2A 3GCHB 3PO1B 3OU0A 2ZDVH 3GY3A 5C20A 1FLEE 1O2VA 4A1TA 3RXCA 1X7AC 3OY6U 3BTFE 1WQVH 1RRKA 1XUGA 1TQ7B 2ZDNA 4ZROA 4GLYA 1C1RA 1TNLA 2XC4A 5FX6A 3V7TA 3PB1E 3LKWA 3MNXA 3ODDA 1AN1E 2FWWA 4X2WA 1V2KT 2CHAC 2BD3A 1ANCA 1GMCG 1MU6B 4DGJA 2DE8A 3GS9A 3MH5A 1HAHH 3TH3H 1T4VH 1YKTA 2JH5D 2P94A 1D6RA 2BVRH 1HIAA 2W3KA 1NRNH 3RMNH 1SKYE 1ZHMA 1ZR0A 1FZZA 2PV9B 1QNJA 1F5RA 1HLTH 3CP7A 1VKYA 2ANKH 3KYFA 2C3SA 3JZ1B 1V2WT 3A8CA 3SO3A 3VXEH 1LPGB 1NRPH 2ZC9H 1GVZA 4BOHA 5BRRE 4BTUB 5DP8A 1C4V2 2ODPA 1KY9A 4X1SU 2BD4A 3SU4A 1C1MA 5EG4A 2W7SA 1TE0A 1HAOH 1SPJA 2BLWA 3GICB 3ATLA 3HK6B 4DVAU 1C2FA 2FTLE 4RKJB 3A7YA 3DT0H 2OQUA 3LDXH 1F0TA 2WZQA 2PHBA 5KGOA 1CBWB 5CE1A 2AHME 1NM6A 1FY8E 1UVTH 1THPB 3DA9B 4K60A 1TBQH 2A2QH 4YT6H 4X8VH 1OP0A 2WYJA 1PQAA 1ANEA 1CHOG 2IOTA 1HJ9A 1KXBA 3A7WA 1SVPA 1O2LA 3F0OA 3BEFB 3WY8A 2V0BA 3UOUA 1EJMA 2WPKS 5EJLA 1AU8A 4WJG2 1O33A 1O36A 1O2JA 1P0SH 4DIHH 2VIQA 3H09A 3MO6A 1MBQA 4HI3A 3OY5U 3E6PH 1EAXA 1ELGA 5DP3A 1EFRD 4AB8A 1TAWA 2FOHA 2XBVA 3RLYH 2Y7XA 5C0TA 2VWNA 4O03A 2EY4C 4Y10E 1HAPH 1E34B 3MWIU 1TGTA 1TRYA 2F9OA 2NU2E 1JMOH 4NA9H 1D4PB 2FS8A 1TX6A 3OSYA 1XVMA 3PLPA 1COWD 1QBNA 3C1KA 1QURH 1BMLA 1HAVA 1K1NA 5JBBS 3NXPA 3UWIA 1W14U 2ZTYA 4FUBA 3SI4H 4I8JA 2XBWA 2J98B 1TGBA 3BIVH 3QO6A 3VEQB 4I31A 1GBHA 1HV7A 2Q6DA 1K21H 1YCPK 3K9XB 1YYY1 4CR9A 1DS2E 1SGNE 2HLCA 4Y7BA 1O37A 2WPHS 1TWXB 2ZP0H 2F9NA 2O8WA 1W2KH 4NZQA 4YXWD 1RD3B 2VJ1A 1W7GH 4OGXA 4GPGA 1OKXA 2JETB 1B0EA 1PPGE 2A32A 2XCNA 4X1PU 4Y71A 2J2UA 3SN8A 2DUCA 1BTYA 4YM9A 4B75A 4ABIA 3BTGE 2JJ1D 1GL1A 2BDHA 2A45B 2KCAA 1Y5UT 2BYAX 2ZIQH 5AFYH 3F3BA 4BAMB 1GGDB 5ESBA 2ZCKP 1F0SA 5L2YH 3N99A 2FOBA 1O3GA 2ZTZA 5K0HA 4NIYA 3DUXH 4XSKU 1GI9B 1GMCF 1IHTH 1UCYH 1FY4A 8ESTE 1GDUA 5F53A 1O38A 1GI0A 3FN8A 1Q3XA 1O2RA 1PYTC 3K65B 1IOEA 1BTXA 3P70B 2C8XB 1EXFA 4JYUH 3RXPA 4IN1A 4IGDA 3SGQE 4NIWA 1GWAA 3NZIA 1IQHA 5L30H 1NESE 4Q7YA 3BTDE 4HG6A 1O34A 2AH4X 1OHHD 1BRUP 1FI8A 1NU7B 3F9HA 4B74A 2AERH 2EI8A 1BUIA 2GMTB 1ZOMA 1GCDA 2BD9A 2FLRH 1AFQB 1N8OC 1VITH 3V3MA 4D7FA 1O3HA 5EXMA 5JPMH 4DIIH 1DLKB 4AGKA 1TNJA 1HYLA 1C5QA 4NIVA 3ZVCA 4QT8C 3ESTA 1SLXB 4TWWA 1RIWC 1PPFE 2OCVB 2H1UA 1MKWK 1W13U 3LJOA 1SGRE 3PV4A 2BVXH 1BTUA 2FX6A 1ELTA 1Z8RA 2P59A 1NY22 2ZQ1A 4CR5A 1BTWA 2ZDAH 3PLKA 1SLUB 1O3EA 4IC5A 2O8TA 3ZIAD 1A5HA 1O31A 2SGAA 4ZHLU 1P02A 3MTYA 3N7OA 5A0CA 5JB8S 3P8OA 5C3NA 3URDA 7GCHG 1ESBA 3A82A 1KLIH 1HGTH 3SUEA 1OPHB 1BBRK 1C2JA 2HVXA 1VCQA 3VGCB 1W3CA 4UD9H 2VNTA 1KDQB 1D6WA 2XW9A 2BY7X 1TFXA 5EQSA 1G37A 4HZHA 4JZ1A 2WUCA 1QIXB 4A5TS 1HXFH 1N1LA 4UFGH 1D3PB 3RMMH 4ACAA 5A09A 3D65E 1SI5H 4ABJA 3DSPA 1EAUA 1BQYA 3V13A 2DE9A 4VGCC 1CO7E 3F0PA 2FTMA 4INKA 4R0IA 3RXDA 5DN6D 3HPTB 2GV7A 3ZV8A 3MMGA 4FVDA 1SGFG 1BA8B 2UUJB 1P3EA 3RXBA 1DLEA 1TONA 3U8OH 5GCHG 3SQHE 5HIZA 2OC8A 1A7SA 3UR6A 4BAOB 1XUIA 2H9HA 1GVLA 2AFQB 1QTFA 4MQAA 2H2ZA 3P17H 3ZYEA 2FI3E 2FOFA 1ZLRA 4P00A 3KQCA 3F9EA 5EIYA 1SOTA 2EQNA 2D26C 1O3BA 1OWEA 2QGRA 4K69A 1Z7KA 1V2JT 1FNIA 2M5TA 2FYRA 3A83A 3LIWA 5EGMA 5TCCA 3RXEA 2V6NA 2G81E 5AFZH 3SGBE 1BMFD 1GI6A 3R3GB 5LPFA 1EOJA 4JZFH 2HGTH 3E91A 1EPTC 4X1QU 1Y5AT 5CHAC 3ELAH 1V2QT 1BTPA 1UTQA 4X6OA 1SLWB 2GT7A 3LGIA 4Q63A 1G36A 3W1EA 1MTWA 4TPIZ 1FPHH 2ZTXA 3KL6A 5EQQA 4JMYA 2UUKB 3TNTA 2ZU2A 1TOCB 5TCAA 3T62A 3FO8D 4NCYA 4ZMAH 1BMAA 4DURA 1AQ7A 4Y11E 3LH1A 3JZ2B 3PTBA 2BLVA 2JDID 2K1QA 1JBUH 1O3AA 3T2NA 2AMDA 4FUHA 2VH0A 2W26A 4H6SB 1GHAG 3MFJA 3B9FH 2BOHB 4U32A 5DP7A 4B71A 4FUGA 5HYOA 1DSUA 4YOIA 2HRVA 2WV9A 1UK4A 1OS8A 2BZ6H 3O8BA 1HAGE 3A8BA 2BQ6B 4AYYB 3ZZ7A 4MNXA 3TK6A 1QJ6B 2V3HH 2J94A 2VWLA 1Y3WA 3BTWE 3KEEA 5I46H 2RCEA 4Q4LA 1CQQA 1ZMLA 5HM9A 1A5IA 1GJ7B 1DM4B 4VGCB 4TT3D 3HKJB 2ZFSA 1O3MA 1FAKH 5EPNA 2IJOB 1O3JA 1J14A 2OC7A 1YC0A 4OS1A 4TSFD 1LPZB 5DG6A 2NU3E 1YPKH 1OSSA 3KHVA 3B8JA 4XDEA 2QXJA 1BHXB 3AAUA 3F2FA 5DP5A 2A4QA 1E35B 7GCHF 1C5WB 2ZFFH 3UFAA 1MTNC 1UO6A 1WXRA 5F03A 1QFKH 1A0HB 2VINA 4ISOA 1O2UA 3URCA 2GP9B 9LPRA 2JH0D 1DFPA 1DPOA 1EAIA 4YT7H 2F3CE 2VBCA 2Z3EA 4O3TA 4FVBA 1A0JA 4D76A 2Z9JA 2V35A 1KXFA 1SBWA 4Q7ZA 1J15A 1FAXA 1TMBH 3DFLA 4INLA 1T32A 4KTUA 5KEDA 2AYWA 1N6YA 4UE7H 2I6QA 2Z7FE 1E37B 1EP6A 4XBBA 1F2SE 1IQFA 2BD2A 3F9FA 1BJUA 2TPIZ 4H4FA 4NG9H 1EPTB 1P05A 3TK5A 2CV3A 4WH6A 1SFQB 1T8OA 3RC5A 1IQIA 5GCHF 2EI6A 3MI4A 2Y81A 1FONA 3S9AA 1VGCC 4IS5A 2J98A 5DP9A 1RS0A 1O2IA 1TQ0B 1THSH 1TBRH 4HTCH 1K2I1 3PROA 1YPHC 2FEQH 1G9IE 4BANB 1CT4E 2FXRA 3BN9A 2QF0A 3RXAA 1CHGA 1PPHE 1C2LA 1AMHA 4HGCA 3A81A 3N7EA 1WAYB 3SUDA 1D3QB 4X8UH 1V2LT 3MNCA 2XOKD 1YPGH 4OS2A 1C1PA 5EOKA 1F7ZA 2QY0B 3VG8A 1LPKB 1YPHE 4FU9A 3SNDA 3ZVBA 1SOZA 2RA0A 1MCTA 4WMEA 1H8DH 4RT0A 4A7IB 4AZ2B 1FUJA 1GJDB 1LO6A 3BG4B 1ELCA 2P3TB 1OWDA 3RXMA 2PWXA 4ZKOU 3S0NA 1O3KA 3RP2A 1BZXE 1BCUH 1AGJA 2FM2A 2CK3D 5LPEA 3PMJA 4TPYA 3SNEA 1TMTH 2RG3A 2ZPQA 4XRNA 5C1YA 5FBEA 5GNDA 3RXSA 1K22H 7LPRA 1QY6A 3DSGA 1BT7A 2AGGX 3U8TH 4AGJA 1TB6H 2QF4A 2XYAA 1KLTA 2AS9A 4JZEH 1NN6A 4AG2A 4CRAA 1MTVA 1TPSA 2VIDA 2R2MB 1QA0A 2FIRH 4LZ4B 1KTTB 1QRZA 3O8CA 1ZHRA 1MD8A 2ALPA 1C2DA 1FX0B 1QA7A 1ZRKA 2NWNA 3RXVA 1K1OA 5EJ1A 4X6MA 5A0AE 1L1NA 2A4OA 2WPIS 2ZFTA 4WH8A 2PSXA 1AZZA 5PTPA 4FUJA 1LMWB 1BDAA 1UTKA 1GL0E 2UUFB 1PPZA 9ESTA 3VXFH 1K1MA 3MH7A 2R2WU 1HAZB 3ATWA 2AEIH 1G3DA 1C5OH 1ZMJA 1SGIB 2LNCA 5KECA 4NWLA 3M37A 3UNQA 1VGCB 1PJPA 2BZAA 2ILNA 1OP2A 4MNYA 2D8WA 1CU1A 5DJ7A 2ANMH 3Q3XA 1VZQH 2OUAA 1EUFA 4B6EA 3ZZ5A 1T8MA 4NZLA 1SQAA 3E0PB 4WWYA 3FP8E 1DE7H 3BTKE 3BEIB 2AIQA 5EW1H 1GCTC 3RM0H 3FP6E 2A7JA 1EZUC 1BHXF 2P16A 1FN8A 3GCTG 3LGYA 1FY1A 4THNH 2Z9KA 4TWYA 3LJJA 1WUNH 5EXNA 4MTBA 2HOBA 3RC4A 1FQ3A 2VU8E 2ALVA 1KYNA 4ZKRU 1IQGA 1ZJDA 1JRTA 1GHWH 2ESTE 3ZVAA 1IQEA 2O8MA 2SGQE 4K8BA 1AHTH 2BY6X 3GY2A 1A2CH 1MCVA 4ZKSU 1TGCA 3ZZ3A 1B5GH 3UREA 1BMMH 2Z3CA 3LC3A 1V6DA 1QGFA 4XE4A 5EW2H 1AVWA 3SU1A 3S7KB 2QF5A 5T6FA 1V2UT 4PROA 3UY9A 2PTCE 3M3TA 1ZGIA 1MKXK 4X8SH 3OFND 3E3TA 1BRAA 1XM1A 5C2ZA 1C5LH 3SUGA 3U98H 1QBVH 4B2BA 2EC9H 1GJ8B 1QQ4A 1YPJH 1QZ8A 3VFEA 2QN5T 2BLQA 3PLBA 4NFFA 3ZVFA 1XX9A 4D7GA 3TU7H 3SV7A 2J9NA 2QIQA 3P6ZB 4F48B 2R3UA 3EA7A 3RXOA 4GAWA 2VVVA 2OBOA 5TJXA 1C5ZB 2B0FA 2FX4A 3UB0A 1Q2WA 3ATIA 3OAAD 5E8EH 2I6SA 2BHGA 3ZZCA 3LGVA 3F2HA 4AYVB 1NBME 3UAIC 1S81A 2WSSD 3ZV9A 4I8GA 4NIXA 2OQ5A 1UVSH 8KME2 2JJ2D 1HAXB 1ELDE 1Z6JH 2FLBH 4K1TA 1PPEE 3OEHD 3MHWU 4E06H 1P2JA 4K3JA 1ETSH 1V2PT 3F6UH 2C90B 3LC5A 3RXHA 2ZWLH 2RDEA 2VVUA 3I77A 1O2QA 1O5CB 3NCLA 1F92A 3RU4D 1EZXC 1GJ6A 1DVAH 2UWLA 4FUDA 4SGBE 3KIDU 1BRCE 3O8RA 3ENSB 2ANYA 4WVPE 4GSOA 4ZKNU 4CHAC 1Z8JB 1AY6H 2WYGA 7ESTE 4BAHB 1MU8B 1PQ8A 3CNRA 1AKSB 3FOAA 5L6NH 3TJVA 4X2XA 3MYWA 1LDTT 3A8DA 4FU7A 2KCOA 3RXLA 5HIYA 4ABBA 2WV4A 1GHVH 4WY3A 3TITA 1UK3A 1O39A 3PRDA 2CHAB 4Q80A 2G4UA 1P11E 3GCTF 6GCHF 1JIMA 3L3TA 1H9LB 1W0YH 1WYKA 3A7ZA 3IWMA 1C4U2 3O8DA 1A1RA 3NK8A 1VJ9U 1P2KA 5FCKA 1DICA 5A8ZA 1GMDG 2ZU5A 4Y76A 4WMDA 1ZRBA 1WBGB 3RXIA 3PM3A 4KTSA 3SZEA 4B1TA 3D23A 3T5FH 4TYDA 1C5RA 5IK2D 5T3HA 1O3IA 1TMUH 1EPTA 5A8YA 1GI4A 1NFXA 4YLUA 3A84A 1NFYA 5FAHA 1O2XA 3FANA 1UMAH 1TABE 1UCYE 2VGCC 2EEKA 2FO9A 2KX4A 4B76A 1TNKA 1YF4A 3S9BA 1O2TA 1NROH 2Q1JA 1KXEA 1HUTH 1DY9A 3CS7A 1SQRA 2A0QB 2TBSA 2GX4A 1CGHA 2ZHQH 4AB9A 1TX8A 2B5TB 2Y7ZA 3QWCH 1DWEH 5DO4H 4YZUA 2ZHWH 2O8LA 4H42U 1GDQA 1RFNA
chains in the Genus database with same CATH topology
1XKBC 4MLFB 4YO9A 3U1IB 1ZYOA 1ZSJA 1YPEH 1DWBH 4UFFH 4H6TA 1DUAA 5DKMA 3SJ9A 4B73A 4I8KA 2FZZA 2KR7A 4Q2KA 3QZQA 5E0JA 2JKHA 2XC5A 1P9SA 4Y79A 1PPBH 1C2EA 1O2OA 1GBKA 2HPPH 3EQ0H 2TIOA 1SGPE 1K1PA 1RTLA 3GY6A 1SC8U 3A88A 2BXTH 5EQRA 1CA0C 4NSVA 4AG1A 1P3CA 5SGAE 1NFWA 2FP7B 4CBOA 1UTNA 3M36A 4MVNA 3QZRA 6CHAC 3IITA 5HMAA 2CF9H 1QRWA 2WV5A 2XBYA 5AF9H 3FKSD 2H5CA 3OEED 4O9VA 3DHKH 4KELA 1TNIA 4E7RG 2YMSD 5GIBA 2BY9X 3P95A 1Y8TA 2VIPA 1LHEH 2KCYA 2CN0H 2XRCA 1MMJN 2PTNA 2ZDMA 2OBQA 1O2YA 1O5EH 5T6GA 2BMGB 3UOPA 1AB9C 3AAVA 3BTME 3BF6H 2LELA 3V12A 5A0BA 2TGAA 1BTZA 1LVMA 1Z8GA 1LKBA 3UQOA 3PTNA 2H9EH 1UCYK 2YNBA 3LT3A 1T4UH 5LPRA 2EA3A 3SV8A 4OS6A 4AX9H 1NU9A 1RTFB 3SJIA 2QXGA 2FOMB 4ABDA 3PRBA 3UUZA 1LCYA 1GI3A 3FZZA 4M9FA 2ZU3A 1FY3A 2K0QA 1GMDF 2J4IA 4ZCNA 3SOSA 2Y82A 1ELFA 1E79D 4X2YA 1F0UA 4AORA 2FMJA 1AIXH 1ZPCA 4JZIA 4F55A 4RKOB 1O3CA 1J17T 4AFUA 1TYNA 2FPZA 2F9VA 2ZGBH 3MU4A 4TY7A 1GI2A 1GJ5H 1N8OB 3OYPA 3ZVDA 3ZZ9A 4KP0A 3BTEE 4E7NA 4FUFA 4I8LA 4OS4A 1UVPA 5L2ZH 1TGSZ 3D62A 3I78A 1S85A 2ZI2H 3U69H 3MH4A 1VITG 5FCRA 5E0GA 1MQ6A 4D9RA 1O2NA 4ISNA 5K7RA 3VPKA 3UIRA 1DT2A 3Q3KA 1RIWB 3HATH 3RUOA 1ZTLA 1GBAA 2ZO3H 1TOMH 2PUXB 2ZNKH 1HXEH 3QTVH 1MUEB 1G2MA 3QGJA 1HJAC 3OTJE 2Z9LA 2NU0E 1AVXA 1TLDA 4CH8B 1O2WA 1PPCE 1C5XB 3E90B 3TIUA 3BG8A 3SV2H 1YM0A 2QYIA 1CSOE 2P3FH 1INCA 1NRSH 4I33A 2FDAA 1GMHF 1ELVA 1J9CH 1Y59T 1LVOA 1A5GH 2M2AA 5HGGA 2VB0A 1Z1JA 4DT4A 1AB9B 1QL7A 1EB1H 1O30A 6LPRA 2YOLA 2PUQH 6ESTA 3P8FA 2H5DA 1ID5H 3UPEA 2BD8A 1J16A 5JBAS 1ELBA 2PGBB 3TH4H 1S0QA 5A2MH 3BSQA 2G5NA 4GHQA 3UTUH 2FOGA 1Z8IB 4ZH8A 2G8TA 1LHCH 4LOYH 4J2YB 5EU8A 4Y0YE 1QL9A 3TJNA 5E2OA 3DFJA 1DSTA 1EJNA 1ETTH 1GDNA 1W10U 2A7HA 1HJ8A 3LPRA 1A4WH 1P06A 1S83A 3GCNA 1QB9A 3GOVB 1DITH 1T7CA 1BIOA 1K9OE 3MH6A 4NA8A 3UR9A 1O3PB 2GGVB 4BAKB 2Y5GA 1E1QD 1C1OA 5GDSH 2LPRA 4I8HA 3SZNA 1EASA 1QJ1B 2Z9GA 1G30B 3HK3B 5FPSA 3A89A 1TIOA 1B7XB 1C9TA 1VJAU 3GISB 1SL3A 5GXPA 1V2ST 4UFDH 3SU2A 5CHAB 1AKSA 4IBLH 1AZ8A 5F6MA 2Y6TA 3ZVGA 2KM0A 4JK5A 2PFEA 3SNBA 2OP9A 2OC0A 1HB0B 3A7TA 4FXGH 3KQDA 3SHCH 5F8XA 1C5MD 1RTKA 4IMZA 2A1DB 3SU6A 1SGTA 1B0FA 5J4SA 1HJAB 1VCPA 3S69A 2FI5E 3Q77A 2WPMS 4WMFA 5BPEA 2ZU1A 4A92A 2ZU4A 2V3OH 2YMSC 5ESTE 1FY5A 1EB2A 1GBTA 4ESTE 3SU0A 1GHZA 4BTTB 1LHDH 4HFPB 4U01A 4WF8A 1C5UA 1YPLH 1C1SA 4ASHA 3RC6A 1Z1IA 4MPWA 4XBCA 3ZZ4A 3SNCA 2GT8A 1WCZA 3P8NA 1VITF 1AE8H 1V2VT 1SR5C 4JK6A 5FXLA 1DUEA 3RM2H 3K6YA 1GBBA 4FUIA 3C27B 5JB9S 2Z6BD 3ZZDA 2C4FH 4B2AA 3FFGA 1VCWA 3NPSA 4IN2A 3KQEA 1TRMA 2Y80A 2PKSC 3WWBA 2QAAA 4U2WA 2J95A 4RI0A 1O3LA 3GCHC 3PO1C 2GV6A 3DSOA 3F1SB 3BTQE 3UNRA 2ZHFH 2TRMA 4ZHAA 4LXBH 5B6OA 1MTNB 4I7YH 2ASUB 5DP4A 2F43B 3M35A 1BRBE 8LPRA 1O0DH 4DOQA 3PYHA 2QXHA 2BD5A 2ZDKA 3ZZ6A 2TGPZ 4Z1MD 2HNTC 1YLDA 1C4Y2 4J1YA 1C5VA 3F2GA 1D3TB 1W11U 2C8YB 3TGIE 2BDCA 2IPHA 1GBFA 1K1LA 1G3EA 1GPZA 2YNAA 2VVCA 3NUMA 3M5OA 1C2MA 2P3UB 4Y6DA 2R9PA 4MNWA 2B7DH 3SHAH 1WOFA 1PFXC 4RN6A 1UTJA 3TJUA 1P09A 1IQLA 2HNTE 3SJOA 4CH2B 1IQNA 1SB1H 5DP6A 1TPOA 1O2KA 4MG3A 5DPAA 1O2ZA 2AIPA 3MO3A 1ETRH 1BB0B 1VR1H 4DG4A 3EYDA 4BAQB 1TNGA 1C2KA 1SLVB 1KXAA 3FZDA 1A61H 1GI8B 2A4RA 2STBE 1QJ7B 3RXQA 3QDZB 1KMHB 2BDAA 2SGDE 1AO5A 5FBIA 3RXGA 1S6LA 3GY7A 3SV9A 1SGCA 1C5YB 2QF3A 1C9PA 3AVZA 4YOGA 4K2YA 1O5BB 6GCHG 1O2GH 2C93B 1C1WH 1ELEE 4SGAE 1O2PA 3BTHE 5JBTA 4Y0ZE 1G32B 5EPYA 3CENA 1CGJE 2VIWA 3TJOA 1P2OA 1XUHA 2VIVA 1EOLA 2KAIB 1QCPA 4BXWA 1ACBE 1YBWA 4XFQA 1SSXA 5C17A 1GBDA 1A0LA 1D9IA 5GPIB 1P2MA 1G2LA 1YGCH 1HNEE 1PQ5A 1WTHD 1DXWA 1T8NA 2FOCA 2BDGA 1P2QA 1IQKA 3RU4T 1WTGH 1L2EA 4B2CA 1GI1A 1C5PA 1WU1A 2WPDD 3PMHB 3GY5A 3LONA 2QXIA 1WSSH 3RXKA 2F4LA 1N6XA 2FS9A 1UTLM 3H7TA 3M7TA 1QBOA 1O3DA 4UFEH 1FDPA 3LU9B 3SI3H 2B8OH 4O97A 2Y5FA 3MOCA 2C8WB 3OTPA 2CF8H 3L6PA 2ZECA 4RSPA 4FETA 3H5CB 1A46H 1GJ9B 1K28D 1MH0A 3A80A 2BDBA 1IHSH 3QN7A 2SNVA 4YOJA 3RXUA 1IAUA 1AUTC 1MZDA 1UTMA 1HAIH 1YCPH 2PKAB 1UJ1A 2ZCLP 2ZA5A 1OP8A 2QCYA 3Q3YA 2JETC 2ZHDA 1NTPA 1C2GA 2JIZD 1DWCH 3BIUH 2ODYB 3FP7E 4GCHG 3E16B 1H8IH 4ABGA 3P8GA 2FODA 3KNXA 4MDSA 4X0WU 1M9UA 1S6FA 1C5TA 1DANH 1O5DH 1GGDC 3T27A 4OS7A 2OXSA 1LHGH 1GBCA 4UEHH 1GBMA 4GHTA 1C2IA 1P03A 2XWBI 4R8TB 4NSYA 1IQJA 1LQEA 1AI8H 2XTTB 2BD7A 8GCHG 1UTPA 1LTOA 3EDXB 2HLDD 1ZSKA 3PV5A 1GCTB 2BX3A 1A3BH 1C1UH 1GHBG 1TX7A 2AMPA 1IQMA 3RMOH 1XUJA 1Z6EA 3MU1A 1GJCB 3KCGH 1NFUA 5FHTA 1DDJA 3E0NB 2BY8X 3SU5A 1OYQA 1QR3E 1V2MT 4ZXYH 2J5UA 2FESH 2Z3DA 5LGOA 2Z9IA 3M7UA 2GMTC 1JOUB 1QRXA 2OINA 4AFQA 2XNIA 4XOJA 3B23B 2TGTA 1AFQC 3TNSA 5IYTA 1CVWH 5FL7D 1QL8A 1THRH 1T8LA 4NFEA 5E0HA 5C0UA 5CHBA 1L4DA 5HXFA 1P2NA 2ANWA 3PWCA 1QB6A 3MNBA 4O3UA 1BMNH 1OXGA 3SQEE 1ESTA 3R0FA 1GJAB 1TBZH 2ULLA 2GTBA 4ISIH 1SFIA 1O35A 2BDYA 1JXPA 4K8YA 2B9LA 2L6OA 1NPMA 1GJBB 1C1QA 2G5VA 3MU0A 1O2SA 3STIA 4DJZB 3M5NA 1OYTH 1NRQH 1TGNA 2HPQH 5AVDA 1XXFA 2UWPA 1MKWH 4MNVA 1GBJA 1L1GA 1E0FD 1GBIA 1LKAA 3TK9A 2O9QA 1L4ZA 1GG6C 4KGAA 1K1IA 2Q6FA 1V2TT 1UHBB 1FIWA 3HGNA 4CRFA 1V3XA 1HFDA 1ABIH 4CRGA 4AN7A 3EA8A 2ZFPH 3I29A 4X1NU 3VGCC 1KXCA 3KQBA 4XD7D 5B6LA 4MPUA 3GYMA 3ODFA 3GDSA 1FMGA 1MZAA 4CRBA 2ZGHA 2BM2A 3RXJA 1BBRE 1BBRH 2C8ZB 3A87A 3T26A 5EXLA 1SGYE 2F91A 1YLCA 2G55A 2HWLB 3U8RH 1OX1A 3SUFA 3GDUA 1NT1A 2H9TH 4CRCA 1EQ9A 3TGJE 5F8TA 4ABEA 2QC2A 4B6FA 2W7UA 2ZFQH 1AWHB 2D2DA 4GUXA 2BXUH 2QA9E 3CS0A 4Q7XA 1EZSC 1S0RA 1E1RD 4ISLA 1ZGVA 1GHYH 2GCHG 4F4OC 5AHGH 1WQSA 2STAE 1GI5A 3M3VA 5I25A 4M7GA 2OC1A 4E05H 2G00A 1BTHH 3LGWA 3U1JB 2GZ8A 1P01A 4ZXXH 2KCPA 1EJAA 3V0XA 4GCHF 7KMEH 2ZGJA 5JYIA 2TGDA 4DT7B 3RXTA 2WPLS 2OD3B 1ANBA 3SU3A 1UTOA 3GCOA 2W3IA 4IMQA 3T25A 3BV9B 3VB7A 1ZJKA 2ZZUH 2HNTF 4CHAB 1GMHG 1TPAE 3MNSA 2A5AA 2G51A 3T29A 1FXYA 4NWKA 2W6ID 1S6HA 3LH3A 3SBKA 3QGNB 3AW1A 3STJA 8GCHF 4IC6A 4MPXA 5G4BA 1P2IA 3PWBA 4MPVA 1LQDB 2NU4E 3A86A 2BLOA 1NRRH 3A85A 3MO9A 1H9HE 4LK4A 5FPYA 1GHBF 1AVGH 3M5LA 2VH6A 4DW2U 4X6NA 1P8VC 1DOJA 1XKAC 1YPMH 2GZ9A 2ZHEH 3MU5A 4ABHA 4GVUA 3EAJA 4AFSA 1ABJH 1P10A 4JZDH 2CXVA 3LGUA 5CDFE 3VB6A 3E8LA 3VB4A 1P04A 1CHOF 2Z94A 2R0KA 1MTSA 2EI7A 3L33A 3ATKA 1EX3A 1TRNA 2GDDA 3SJKA 2BOKA 1OWKA 4XBDA 3M3SA 1GBEA 4CREA 4YTAA 3KF2A 1TA2A 1GG6B 3TGKE 2BX4A 3S9CA 5A8XA 4D9QA 3NKKA 3KGPA 4D8NA 2OLGA 4Y8XA 1SHYA 2K8IA 2VWOA 4TY6A 1W0KD 1LVYA 1EP5A 2VGCB 3ZVEA 1TALA 3E1XB 3RXFA 2BB4A 1XUFA 2HALA 3ZZ8A 1H1BA 2PSYA 2XCFA 1MAYA 4OS5A 1Y3YA 3SORA 3U9AH 2ZCHP 1TA6A 4DY7B 5T1VA 3M7QA 1NZQH 2A2XH 1V2RT 1O5GH 1E36B 4NA7A 3UNSA 1OWJA 4K1EA 3BTTE 1DY8A 1P9UA 2AMQA 2F9PA 1SGDE 1C1TA 1C5NH 1SGQE 2GDEH 3HKIB 2JH6D 5ABWA 1H8HD 1XUKA 1DXPA 1Y5BT 4X8TH 1YCPM 1HRTH 1W7XH 2QV1A 4ZAEA 1ZZZA 4CBNA 2OTVA 2A5IA 1ANDA 2AGIX 4YLQH 3RU4E 2KAIA 1HIAB 3ZYDA 2F9BH 1AE5A 2P8OC 2SNWA 5ETXA 1EKBB 1O2MA 4BNRA 3SNAA 1CA0B 3WW7A 2BDIA 4X1RU 1E38B 1NS3A 2ZGCA 3T28A 5C67A 1UK2A 4OGYA 5DGJA 1MBMA 5C1XA 5IDKA 3S7HB 6CHAB 1ESAA 5E2PA 3EA9A 2GCHF 3W94A 2FYQA 5J4QA 1NO9H 4K5ZA 5DK1A 1G3BA 2A7CA 1JWTA 1HAYB 1GBLA 1S5SA 2R0LA 3SW2B 1TPPA 1RJXB 1PQ7A 3VB3A 4Y7AA 4X2VA 4A1VA 5GWZA 2GZ7A 4UONA 3ITIA 1U6QA 2SGEE 4ASUD 5GJ4B 5FPTA 1ZSLA 1BOQA 1DX5M 1O3FA 1KXDA 1ZTKA 2AGEX 2PKAA 4JCNA 1XMNB 1FN6A 4F49A 1GI7B 2NU1E 1Y3XA 2FOEA 3K2UA 3Q76A 1ZPZA 1KIGH 1MQ5A 1CE5A 1F0RA 1G3CA 4ISHH 1BITA 1FPCH 4JYTA 2ZDLA 2PLXA 1XVOA 2J34A 2ODQA 1S82A 2ZF0H 3A7VA 3LOXA 2J38A 4ABFA 1FV9A 2D1JA 4INHA 1LVBA 2F83A 3BG4C 3FVFB 2QE7D 5C5OA 3QX5H 5DSFA 2ZPSA 3HGPA 2ZKSA 1MAXA 1XXDA 4CRDA 3N7DA 1FJSA 1MABB 2RA3A 1HAVB 4X6PA 1EZQA 2ZPRA 1ORFA 1P57B 2ZEBA 1K1JA 5FX5A 1C5SA 3RXRA 2V7QD 1HCGA 4I32A 3SJ8A 1O3NA 1KLJH 3VB5A 2GCTC 4Y8ZA 1SQOA 4NGAH 1WV7H 2WPJS 4AFZA 1GVKB 2IN2A 1CA8B 2PW8H 2CGAA 3AASA 5CMXH 2CJIA 3OX7U 4A6LA 1D3DB 3WWFA 3EGKH 2Y5HA 1H8ED 1SHHB 1BJVA 2P8OB 3M61U 5JBCS 3QTOH 1T31A 1GHXH