3LP1A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 154
structure length 554
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp1A05
2IC3A 4E89A 2YNFB 4Y34A 4H54A 4KKOB 1EX4A 2IM3A 4J9KA 2IDOA 1S6PA 1RTDB 4NLVA 2DFHA 4JLHA 3AVKA 4CHPA 1VSEA 3NFAA 3P83D 3NAEA 2XC9A 3H5UA 5DGAA 2VWJA 4PQUB 3VQ7A 2WRMA 3KHLA 4B9UA 1RT4A 3TVKA 2FVSA 4X2BA 1S1UB 2IAJA 3LWLA 2DFEA 1JKHA 3SZ2A 3KK3B 4IRDA 1C0TB 5KG3A 4J9QA 4O0IA 1Q8IA 4CHZA 5KG2A 3VQ9A 3CFOA 3KOAA 4KI4A 5HP1B 3HHKA 2W9BB 4DSFA 1TL1B 4AHRA 4G1QB 3NGZA 5HRRA 4O44B 1LWCA 1KVAA 2W9CA 2YHAA 3ZT0A 3U6FA 3VQ4A 1T05A 2OA8A 4DMNA 2DTUA 3U3YA 2D7SA 3U3GA 4DL3A 2C2EA 2YKMA 1LW2A 5KFIA 2HHUA 1ASUA 2OPRA 3AVNA 4IG3A 1SKSA 1RTDA 1YT3A 3C6UB 1S9GB 3CDEA 4TY8B 4ED3A 4ELTA 4MK8A 1EKEA 3LP0B 3MR6A 1QS4A 1DLOB 4NLXA 1S0MA 3CFRA 4Q45A 3K59A 4JV0A 3G6YA 3EPIA 2YNIB 1ZTWA 3M9NB 3K58A 5EDWA 3KHHA 3Q8QB 5KT7A 1BQMB 2ATQA 3O3GA 4R5PB 3PY8A 3MECA 3ISNC 2J6TA 4YQWA 1WSEA 3OJSA 5HP1A 5DQGA 1N6QB 1S9EA 2W7PA 4O3QA 1S1WA 1C6VA 4CE9A 5T14A 1C0UA 3NDKA 4Y2CA 5KFAA 3MEDB 3AO2A 1KVBA 3AVJA 1CZ9A 4I7FA 1VRUB 3OYLA 1X9SA 1U49A 4M41A 3MEEA 2JLEA 5L1LA 4C8NA 2HNYB 1RTIA 1TV6B 3RMBA 5JXSA 4NLGA 4F4KA 2R2RA 3QO9B 5J2MB 2HMIA 4WXWA 4TYAA 5FRMA 1DTTB 2YNHB 3AA5X 3G6XA 3CM6A 2W9AA 4J9NA 2ETJA 4CEZA 3O3FA 3RBDA 4GMJB 4B3OA 4CERA 4KAIA 3SUPA 3BQ1A 1UWBA 2QKKA 1T3NA 1O1WA 1KLMA 3AO5A 4ECXA 2KZZA 1TKTA 4Q44A 1ZBIA 4B9TA 3V9WA 3V6HA 4AHCA 1S0OA 4YMEA 1GX5A 4K4VA 1JX4A 4ZVEA 4KHYA 4CJQA 1LAVA 4FJJA 4FJLA 3HJFA 1DTQB 3UR0A 3O4NA 3QGGA 1S6QB 4LSNA 3QGIA 1IKWB 4HUFA 3BQ2A 1C1BB 4RNHA 2JGUA 3T19A 4MQ3A 3TAMA 1JLAA 3NL0A 3ITHB 1NJYA 4J9RA 4DF4A 4URGA 1D5AA 3KLIA 3NH0A 4ZP7A 1DTTA 1RT3A 2YNHA 4HCCA 2X78A 2HHVA 4RW6A 2OZSA 2IM0A 3T5LA 1SKWA 3AVAA 4IH6A 2IC3B 2I5JA 4DSEA 3N6LA 3V1OA 4MFBA 3D45A 4CJVA 2FJVA 2QKBA 5KG0A 3DI6A 3MECB 5J2MA 2E9TA 4QPXA 1BHLA 4CEOA 3CWJA 3C95A 2BQUA 3MTKA 1S1WB 3AV9A 3T1AA 4O3SA 3QINA 1Z4UA 2Z1JA 4C8OA 5F8HA 2C2RA 1X1PA 1RAJA 2R8IA 3RRGA 4E0DA 4ECQA 3PW5A 3VQBA 4CGFA 2WOMA 5J1EA 4N47A 3NE6A 4YP3A 1NHUA 4CF2A 4MIAA 3ZSWA 3CFPA 1S1XB 4AHSA 1N5YB 4WZQA 2IA6A 4DTXA 2CJQA 1RT5A 4QWCA 4CJTA 5C24B 4M42A 3UIQA 1REVB 4AHVA 3VN5A 5I42A 1L3SA 4RW4A 3PW2A 3TAMB 4M3UA 4B9LA 1I6JA 3ZSXA 4KSEB 2B5JA 1HNIB 3RMCA 1TKXB 1S6QA 1ZBHA 3OYJA 4O4GB 2D3ZA 5SWMA 4Z4IA 4NZ0A 4DEZA 5DG8A 4ECVA 3IS9B 2EX3A 4HHTA 3V9SA 1JIHA 1JLAB 5DLFA 3MXMA 4TQSA 3KLEA 2W8KA 3E01A 3V81A 3AVIA 1RT3B 4Z0UA 1ZYQA 1JLEA 4C8KA 1VRTB 5L1JA 1QAIA 4ED2A 1YTAA 1NK5A 3NAIA 4DL4A 3TI0A 1HMVA 2B6AB 2WB4A 3AA2A 5KFVA 4OGCA 1L5UA 3M8PA 4EP5A 4KE5A 5KFCA 3DYAB 3AVLA 4NLYA 1RDRA 4FJ7A 4LH5A 4BDYA 2HHSA 2IS3A 1VSLA 1RT6A 2RKIA 2XCAA 2IMWP 3BSAA 3S3OA 1C2PA 1NKCA 4KFBA 4KHQA 4ECSA 2YNGB 2UUTA 2YHBA 1J54A 3ALYA 4N5SA 4Y2AA 4BWJA 1LWEA 5KT5A 3MXIA 4I9QA 4FJKA 3I5BA 3QEXA 1C0MA 1EETB 4GC6A 2R8GA 1VRUA 1FK9B 4BE2A 2ZE2B 2IAJB 1CXQA 4KRFA 4N76A 3RB3A 1VK0A 4YNQA 2UVVA 5KFDA 3V9XA 2V4QA 1SH2A 4ZPCA 1TK5A 3QO9A 4ECYA 1TGOA 2F96A 4C8LA 5C42A 5J1EB 1HYSA 4NCGB 3NF6A 1A5WA 1NJWA 1T03B 4KTWA 4NYNA 4EYHB 1NOYA 3V6DA 3LAMA 4RW6B 2WK4A 5KFEA 3OYBA 1IKYA 1TKTB 4CJRA 1C1CA 1S1TA 3JSMA 2HW3A 3KK2B 1JLEB 4RW4B 5HROA 2Q3SA 1IKXB 2VG6A 3QEVA 1TVRB 4KB7A 4HTUA 4E1MA 4KHWA 4WZMA 2YNGA 1LW2B 5C25A 4IFVB 4CJ4A 2ILZA 4OKKA 3D0PA 4YR3A 5F8IA 1UOCA 3DDKA 4OLAA 3KTQA 4KV8B 3KKSA 1JLBB 3QLHA 4E7JA 4E19A 5EU7A 1TL3B 3G10A 1NHVA 3OYNA 4URSA 3OS1A 3IG1A 3T3FA 4C8MA 3RB6A 4KB1A 4KI6A 4NCBA 4DU3A 2VG7A 3RR7A 4CHOA 3OHAA 2V4RA 3H2LA 4ECZA 4FVMA 3IGVA 3OYGA 3BDPA 2FLNA 3ZT4A 5KFFA 3TR8A 3VQEA 1ASWA 4O3OA 1JXBA 1TKZA 1S0NA 2E9RX 3KLGB 4RUCA 3BSNA 3QIOA 2Y1JA 4J9OA 5FDLA 3L2VA 3RR8A 3PZPA 2ALZA 4NLPA 4ICLB 1RBRA 2D3UA 1HQUA 3ZT3A 3LP1B 4H4OB 3OYFA 3HPOA 3AVMA 1WAFA 1N5YA 4IDKB 2OPSA 1KTQA 3OYCA 4KTQA 1WSGA 1S1XA 1WSHA 3OSPA 1N56A 3OYHA 2UUWA 3ZT2A 4E7HA 4F4ZA 4CF9A 4CEEA 1W25A 3MEGA 3ASMA 3GIJA 3CJ4A 2HNDA 4MKAA 1BISA 3SFUA 4OPJA 1GX6A 3BGRA 2IBKA 4ZTJA 4DSJA 5KFOA 2WONA 5KG6A 3QIPA 4HUGA 4ZVFA 4FLWA 4YR2A 4IFYA 3JYTA 2FVCA 4ZVHA 4EYIB 3IS9A 4CIFA 3NBPA 5L9XA 2UVWA 3M8SA 4YFUA 3KLEB 3HSTB 1NK9A 4JRPA 5HLFA 4LD0A 4DL2A 4DTJA 3RB4A 3M8QA 2HMIB 3AVCA 2F8SA 3CDWA 5C25B 1U47A 2HHQA 1TP7A 5KRSA 2E9ZA 3LALA 1I3AA 4Q0BB 1S9FA 2DY4A 2FVRA 5KGXA 4FJ9A 3LP1A 2Z1IA 4JUZA 4RW7A 3DMJB 1HMVB 1Z25A 4CEQA 4CGJA 4PWDA 1TQLA 2X6NA 1NK6A 4IDKA 3ZSYA 1T03A 1MU2B 4W5RA 1GOCA 3PV8A 4ZTFA 4TQRA 2XY7A 5CYQA 3PX0A 4DG1B 3HM9A 4LQ3A 4ECUA 4FJNA 1RT7A 5KFTA 4RNNA 1RT4B 2ILYA 3VQ6A 5KFRA 3CJ3A 3CIZA 1QQCA 3ZCMA 3NH1A 2O4GA 3DLBA 5FRNA 4DL5A 4HYKA 3E51A 4EO6A 3H40A 5KI6A 1XWLA 1WN7A 4BE0A 3LDSA 4M3ZA 3T5JA 2KZMA 3IRXA 1HQEB 2GUIA 4AHUA 3PW4A 1TL3A 3CYMA 4J2EA 1L3TA 4DTOA 2BRKA 5KFJA 4NLOA 4DTPA 2ASDA 3I0SA 4B9NA 4F4XA 3GV5B 1RILA 4RW7B 1U45A 5D3GB 1XC9A 3JSMB 2XGPA 1W0HA 4HUEA 2R2SA 3F73A 3GILA 4M45A 1LW0B 4PUOA 4B8CA 5E41A 2PY5A 1RDAA 4CHYA 4O4GA 1BL3A 1S6PB 5JS2A 2VA2A 1KFSA 1HYZA 3DRRA 4KBIA 4UQGA 2RF2A 4FLVA 1VRTA 4IKFA 3GV7B 2BE2A 2FBXA 2V9WA 3V9UA 4FXDA 1RT2A 4HCBA 3DM2A 5F8NA 3NH2A 1EP4B 4KV8A 5KFKA 3QYYA 1BQNA 3RTVA 4WE1A 2JC0A 1UA0A 3MEEB 5L1KA 5HBMB 5L1IA 4K8XA 3QZ7A 3LZIA 1FKOA 1R0AA 3C6TB 4DFJA 3HVTA 2AQ4A 4OPKA 1WNSA 3L8BA 3NKYA 2KQ2A 4IRKA 3SUQA 2WHOA 4I7FB 4CJFA 4DQSA 2YKNB 5KG4A 2D5RA 2W7OA 5FROA 2E6MA 1SUQB 2RDJA 4ZPDA 4MK7A 1IO2A 2VWKA 3NHGA 4J2BA 3FQKA 3KLGA 5FDLB 1U09A 4NRTA 4FW1A 4FS1A 1RT7B 4CGDA 4O3RA 3MFIA 3I0SB 4TYBA 2EC0A 5HRSA 3H4BA 4ID1A 4Y3CA 1S4FA 3SQ2A 4QOZB 3HP9A 3FFIB 4KHRA 4DLGA 3RAXA 3SCXA 3DLRA 4LSNB 4DFPA 4CK3A 3QEWA 3L3VA 3ZSOA 2HAIA 3QETA 4FK2A 4FJGA 3NGDA 3DLGA 2DPJA 5J2PA 1NK0A 1XR5A 5K14B 4M3WA 2HNDB 4Q5VA 3K5NA 4KFBB 3MEGB 4IRCA 4K8ZA 1IKVA 1RTJB 4WFXA 4F4YA 4CECA 3VQ8A 2JEGA 1RNHA 3MAQA 5CZ1A 4E7KA 5J2NA 4Z4GA 4EEYA 2AJQA 1GOAA 2WOMB 2P5OA 3HVWA 1D1UA 3QGHA 4EO8A 4CFDA 1K6YA 1YVUA 4MH8A 1TAUA 1J53A 2OPQA 2HNZB 4IR9A 2IM2A 1FK9A 1RT5B 1HNVA 4I2QA 5JS1A 1VSFA 4NYFA 1QSSA 1FKOB 1N6QA 4RZRA 2R7YA 3DI6B 3AA3A 1S49A 4CGHA 4PQUA 4LQ9A 3OS2A 1JLBA 4ZPBA 5SZTA 4OL8A 3OSNA 4CJUA 4FS2A 4YR0A 4DQIA 3TAGA 3KK3A 4KTZA 2HNYA 4QW9A 4RNMA 1U48A 2PZSA 2JC1A 2G8HA 3LPUA 3Q8RB 3TQ1A 4FLZA 4PA1A 1KRPA 4EBEA 3ZSQA 2VG5A 1CZBA 2VG6B 3MF5A 2XCPA 3LAKA 4EP4A 2A1SA 4AH9A 3K5LA 4JS5A 2G8VA 4FZZA 3KMSA 3HT3A 3V9ZA 4KHMA 3PO4A 3AVBA 3VA0A 3TAFA 4M94A 4O55A 3HP6A 3M8RA 3Q8SB 3CO9A 3M8PB 5DGBA 2FBTA 1ZETA 3DLGB 4N41A 1RT2B 3VQ5A 5I42B 4ID5A 1JXEA 1U04A 2FBYA 3V4IB 3MXJA 5KFSA 5HRNA 4JV2A 2KFZA 3IG1B 2O4IA 4FM0A 1HQEA 4ZHRA 1Q9XA 2FC0A 4LY7A 1WLJA 1D8YA 3EZ5A 3T5HA 1JL2A 4Q43A 3AVHA 4U7CA 1IKWA 1RBTA 1JKHB 4F3OA 4NYZA 4O4RA 4L8RB 3ICLA 5EWFA 3PVXA 4IR1A 1LV5A 3N6MA 4B9SA 3FDSA 4E3SA 3E01B 3V81B 4GC7A 3KMQA 2R2UA 3AVFA 2OYQA 4QWDA 4TLRA 1QAJA 5DLGA 1HPZB 4LSLA 5KFXA 5F8MA 3BREA 3ISND 4CEFA 2XO7A 4MIBA 4ZP8A 3I5CA 4CFAA 3OHBA 4CESA 3QNNA 4FJXA 2FLLA 3M9MB 5DMRA 1JLFA 1RT1B 5DQHA 4BE1A 3D28A 4KHUA 4EBDA 3SUOA 3N6NA 3H98A 5EWEA 1S1TB 3WNHA 3LP0A 1RDCA 4WE1B 4QCLA 4W5OA 3TWHA 1QSLA 2XY8A 3L3UA 4W5QA 3KHRA 1VSIA 4OKJA 2W9BA 2G8IA 1JLQA 1REVA 4Q8EA 3ULDA 5J2PB 3OLBA 4WYLA 4O44A 2YV0X 2E4LA 2BR0A 4CJPA 4WFZA 3RB0A 3SV3A 4NCGA 1Q9YA 1VSDA 1FKPA 4ZPAA 1D9DA 4F8RA 3JYTB 2BQ3A 4F2RA 3V6KA 4CF0A 4FZYA 4HKQA 3NF8A 4AHTA 3KLFA 1S97A 4ZHRB 3CM5A 3DOKB 3DRSB 4K4TA 3WNGA 4DU4A 3BSCA 2NUBA 3KIOA 2AX0A 1SH0A 5C42B 4ECTA 2JEFA 1SKRA 2VA3A 1QHTA 1Y97A 3VQAA 1S5JA 1LWFB 1YVFA 3IAYA 2ASJA 4CF8A 3OYKA 1QE1B 2QK9A 3OVNA 2HHWA 2OPPA 2P1JA 3EYZA 3H08A 4F4WA 1UWBB 4HVJA 4IOBA 2ZKUA 4R5PA 2XRIA 4DL7A 4QWEA 4J2AA 4CFCA 4K4ZA 1S9EB 1JLQB 4ICLA 3QEPA 1ZBFA 1K1QA 3DLEA 4CGGA 4NCAA 4DQRA 1FKPB 1KCFA 3WNFA 2BANA 5CZ2A 1BI4A 4CIGA 4B9VA 1RT6B 2HHXA 2IM1A 4IQXA 4DTMA 4DTNA 5I3UA 4FZXC 2HWHA 4DL6A 4RG8A 1EP4A 1S48A 3HO1A 3DOKA 3DRSA 1XHZA 2FJWA 3H4DA 2FBVA 3CJ0A 3KJVA 4EZ9A 4TY9A 4F50A 4ELVA 4NLRA 2XGQA 4XPEA 4QW8A 3QZ8A 3SI8A 1VSMA 4IG0B 5EUHA 1WSJA 2A1RA 4ZP6A 2J6UA 1BGXT 1QE1A 4DWIA 1XR7A 1SH3A 2O5DA 3H5YA 2I5JB 1TK8A 4QWAA 4FLTA 1WSFA 1T94A 3CVKA 4J9PA 3H5XA 3RAQA 3FRZA 1RBVA 1ZBUA 4Z4EA 3HXMA 1LWFA 4DFKA 3DRRB 2YKNA 3SJJA 4CIEA 4JS4A 4CEAA 3QEIA 4W5TA 3GQCA 4Z4CA 4I2PA 3OYIA 3UDLA 3S3MA 1DTQA 3HVAA 4ED0A 4DS4A 3QERA 1KLNA 3K57A 3FQLA 3TABA 4FCYA 4K4WA 3BQ0A 4CJSA 5KFGA 2WTFA 4GW6A 4K4XA 5I3UB 4CFBA 2V0NA 4R8UB 4ID5B 2AX1A 5HBMA 5DQIA 1NJXA 1R0AB 5HLFB 3IGNA 4NLQA 3CJ2A 4BACA 1J9AA 4M3YA 5KFPA 3KLIB 3FSIA 3IN5A 3LPTA 4O5BA 3B6PA 2RN2A 3KD5E 3K5OA 1BIZA 2R8KA 4DQPA 3QIPB 4KKOA 5KRTA 5KFQA 4M3RA 4IFYB 4WXOA 4JRQA 3GIKA 2DFFA 4FJ8A 1SUQA 1CSJA 3NGIA 4WYWA 3PJWA 3HVRA 4XIUA 2ZQBA 3GIIA 5J2NB 3HPGA 2HVHA 1S1VA 3KHGA 3RMAA 3PO5A 3M9OB 3KLHB 3TAQA 1VSKA 4DG1A 5F9LA 4DTSA 4CJEA 1ASVA 5F9NA 3PW0A 3I8DA 3B6OA 3K5MA 1SL0A 3VA3A 3OL9A 5KFBA 1T7PA 4O3NA 4RW8A 4H4OA 4DSIA 3G0ZA 2FVPA 5KFNA 1VSHA 1S9GA 4TY8A 1W9HA 4ED6A 4IBNA 4DTUA 1WNEA 1HQUB 3RRHA 3TARA 1IKVB 3V1QA 1HYSB 4KB0A 2BGGA 1B9FA 1JLGB 4NLUA 2AU0A 3D5MA 3VQCA 2IOCA 4OVLA 1I39A 1KHVA 3SYZA 1SL1A 1RA7A 1XR6A 3AVGA 5D3GA 3UQSA 1C0TA 3OJUA 3DLKB 5KFHA 2AGQA 3OL6A 2XY6A 2WCXA 1HARA 1DLOA 3LANA 2BDPA 3KD1E 2RPIA 3VQSA 3UPFA 2D0BA 5DG7A 2G8UA 3MFHA 1RBUA 5J2QA 3PW7A 4F3TA 3SQ1A 5T7BA 4ZMMA 4O0JA 3K2PA 4CHQA 4B08A 3ITHA 4RNFA 3Q8PB 4CGIA 2QE5A 3OYAA 5CYMB 3DM2B 2GBZA 3EPGA 4ELUA 1QUVA 4FLXA 2F8EX 5KG7A 4FW2A 5KFLA 4OJRA 5KFWA 1BQNB 3PJXA 4DS5A 3L2WA 1ZBLA 1VSJA 5HROB 1MU2A 4FM1A 4NRUA 4CEBA 4CJKA 1TVRA 4MFBB 3DOLA 3DMJA 3CDUA 3LP2A 3G86A 5C5JA 3NMAA 2QV6A 3V6JA 1UA1A 2CKWA 1L3UA 2PYJA 1IM4A 1C1CB 1RA6A 1RDBA 3AO4A 1U4BA 4IFVA 3G6VA 4K4YA 2FVQA 1TKZB 4URQU 4DSLA 1BQMA 4QWBA 5C24A 3QLHB 1HJRA 4DF8A 2G8KA 3C6TA 3SFGA 3CJ5A 3P5JA 1Z26A 4I9LA 3LWMA 4K4UA 5HRPA 3I0RB 5DK5A 4B3OB 1B9DA 2B5JB 4Z4HA 4FBUA 4KAZA 1KLMB 1NJZA 3LP3A 1NOZA 4RW8B 2KTQA 1J5OB 2OPQB 4N56A 2XWYA 1C1BA 3PR4A 2GIRA 1RTHB 1RTIB 1TV6A 3KK2A 4E7IA 3DRPB 2ITGA 4ED1A 4RUAA 2B4JA 4G1QA 4JV1A 2IGIA 2KW4A 3KKRA 1CLQA 1JLGA 2UVUA 1A5XA 1C1AA 5JUMA 4J2DA 2W9CB 1HRHA 1KSPA 4M3TA 4BDPA 3I5AA 3FFIA 2KFNA 4ECRA 2BRLA 1QSYA 5KGWA 4ZVGA 3SUNA 2RF2B 3SV4A 4BDZA 1RCHA 3DLKA 4CJWA 2GC8A 3RBEA 2HNZA 2OPPB 1IH7A 3BJYA 4R0EA 4Y1CA 4ED7A 4XPCA 5KFMA 4K4SA 2Z1GA 4BWMA 2RKIB 3AO1A 1UAXA 3NGYA 2C22A 3PX4A 1NNDA 2HVIA 2IJFA 2XHBA 1IG9A 4DTRA 5CY4A 5KFYA 3TANA 2JEJA 3AA4A 4EZ6A 5KT6A 2DPIA 3AO3A 4OLBA 4K50A 1EETA 3KLFB 5KT2A 4E7LA 2B43A 1TL1A 5DG9A 2ZD1B 4CEDA 2J6SA 1JLCA 2VG5B 2X74A 2P5GA 1LWEB 4FYDA 4TXSA 3I0RA 3NCIA 2GV9A 3L2QA 4FJ5A 3ZSRA 4CHNA 1T05B 4KO0A 1C0UB 5KG1A 3KLVA 1HNIA 4IH5A 4F2SA 4DQQA 5F8GA 4OGEA 3OYDA 1YTUA 4MKBA 3SQ0A 3KLHA 3VQQA 4CJ3A 1SV5A 4IG3B 4M95A 3NBPB 1SL2A 2D41A 2R2TA 3EZUA 3OYMA 2OPSB 1TAQA 4ED8A 4FLUA 2D0AA 2XY5A 3MR3A 3O4QA 1CXUA 1JXLA 2LSNA 2AWZA 5EWGA 1TK0A 1IKXA 3V6DB 1F21A 1IKYB 3HK2A 1GOBA 4KHSA 3BR9A 1JL1A 4B8AB 3H59A 4FJHA 3BGRB 2UVRA 3SQ4A 1RYSA 2FLPA 4NLTA 1BI4B 1RTHA 3TAPA 3SPZA 4CJ5A 4O3PA 5K14A 4FK4A 3L2RA 1QTMA 3RWUA 1A5VA 4XO0A 1S10A 4Z4FA 2AGPA 2OH2A 4IKAA 4I2PB 2ATLA 3S3NA 1EXQA 3ZT1A 3IRXB 3TAEA 3ZSVA 4RU9A 3HL8A 2G8WA 4Q0BA 4IG0A 3OLAA 3GIMA 3DYAA 1FXXA 5J2QB 3KNAA 2F8TA 5KG5A 1S1UA 2HWIA 1HNVB 2AGOA 4KPYA 4CF1A 3OS0A 4DSKA 5F8JA 4H4MA 3HKWA 4PWDB 1OS5A 5KFUA 1X9WA 3BSOA 1RBSA 3QESA 2HB5A 5CYMA 3O3HA 2IJNA 4RW9A 3MR5A 2OZMA 3HVTB 4EBCA 2W8LA 4M3XA 4KHNA 2R8JA 1LWCB 3QNOA 1K1SA 4PY5A 3PX6A 3HYFA 4QAGA 1RYRA 4CK1A 1KHWA 4Q8FA 4CCHA 1NKEA 3RMDA 3LP2B 4W5NA 1L3VA 2BE2B 4FM2A 3GV8B 3SI6A 2OPRB 1WAJA 1BCOA 3PHEA 3OY9A 4CJLA 1ZTTA 1X9MA 4J9SA 3V1RA 1N48A 1D9FA 4NLWA 3ZSZA 4NLSA 1MMLA 4ZP9A 2G8FA 2C28A 1HYVA 1ITGA 2QXFA 2ASLA 3PUFA 3SNNA 1T8EA 3V4IA 4E1NA 2I1RA 2R8HA 3NF7A 2Z1HA 4CK2A 5F8LA 4AILC 3H5SA 2WONB 4H8KA 4H4MB 1LAWA 4FK0A 2ZE2A 4FJIA 2E6LA 1J5OA 5KT4A 2JEIA 4RNOA 2XI2A 1BIUA 4DLEA 4MK9A 2C2DA 3T5KA 4G3IA 4OKEA 2FJXA 3QIDA 3S9HA 3MEDA 1WSIA 3SPYA 3DLHA 3CQ8A 2X6SA 1KVCA 4LH4A 2YKMB 5KT3A 3OL7A 1HPZA 4LSLB 4GVMA 3THVA 4DU1A 1KFDA 3M8QB 3DLEB 5KTQA 3NAHA 4DFMA 1RDDA 4U6PA 3KK1A 2HHTA 1NK8A 3F9KA 1XI1A 4J9LA 2PYLA 4ECWA 4KREA 3P1GA 3LZJA 5CYQB 3NF9A 2D0CA 2GIQA 2YNIA 3OYEA 1JLFB 1RT1A 3VQPA 4TSXA 3MR2A 4B9MA 2YNFA 2BANB 2XI3A 5KFZA 1TKXA 4FLYA 4WFYA 3A2FA 3DOLB 1TKDA 4NLDA 1RTJA 3C6UA 1JLCB 3L2UA 3KJVB 2ZD1A 3GYNA 3CG7A 3EY1A 2VG7B 3OL8A 2EHGA 4KO0B 4IH7A 3VQDA 2W42A 1N4LA 3C94A 3HPHA 4I2QB 1SV5B 2B6AA 3KK1B 1XHXA 2BQRA 4FBTA 1D0EA 1B92A 1LW0A 4PUOB 1BCMA 1S1VB 2P51A 4R8UA 2Y1IA 1NK7A 2RDIA 3PR5B 3DRPA 4Y1DA 1G15A 4J9MA 4RW9B 4TN2A 1NK4A 4FJMA 3WNEA 1NKBA
chains in the Genus database with same CATH superfamily
2IC3A 2YNFB 3EGWB 4Y34A 4KKOB 1GMWA 3GZ7A 3NOGA 4J9KA 3CD7A 5DO2A 4NXMK 4V19J 4PQAA 1S22A 1U25A 2CPZA 3BY5A 1HBOA 2V7YA 5ETOA 2BJ3A 2FUG9 1H3DA 3VQ7A 2WRMA 1IJFB 4B9UA 4BG8A 1VQ9N 4L3NA 5AQJA 2MQNA 1T9WA 2GX9A 2IBOA 4KGKA 1X5OA 3LWLA 3SZ2A 1FWKA 1XMOK 2X1BA 4J5OA 1N33F 4IRDA 3BDEA 3UFCX 4CHZA 3VQ9A 3CFOA 4A8SA 2MQ8A 4KI4A 3HHKA 3PDNA 2HFZA 4DSFA 1ESVA 4G1QB 4X65K 3MAAB 4DPTA 5LL6d 3M5RA 4WIIA 2QA2A 4QU7A 3U6FA 1T05A 4FPIA 2ZDOA 2DTUA 4OMFG 4DL3A 5KFIA 5T7LB 4IG3A 1RTZA 3PYEA 1SKSA 2C42A 2O3DA 4DV5K 3ZO7A 1T02A 1PIEA 2Q2RA 2M3DA 1S9GB 4Y2MA 3W2WB 1ZA1B 1FTRA 2O8CB 5AXKA 3QRRA 4OLOA 5B0BA 2GQ2A 2QA4S 2Q3PA 1YZ6A 1JJCB 5JICA 3DXMB 3EICA 3FC9A 1J5EJ 3KHHA 1JCEA 1TUVA 1FT8A 2ZM6J 3CC4N 4YS2A 3O3GA 4R5PB 3PY8A 3MECA 1WSEA 2Q6BA 1C6VA 4KJIA 3NS6A 3OR1A 2YQ3A 2WFBA 2W25A 5AQZA 3QDKA 1YVNA 4F9OA 2IFXA 2O1PA 3J7YI 1SJRA 3R1LA 4CT9A 4C8NA 1RTIA 1TV6B 5HVFA 5JXSA 5EX0A 5J2MB 1N8RO 4UY8T 1G3OA 3F41A 1PYTA 3M7VA 3MM9A 2E44A 4YHHJ 5DM6L 2GIFA 5A8KB 3W9HA 4Y2KA 3SUPA 2CQDA 2MLZA 3FUYA 3WEEA 5BRHA 2XS2A 3FCWA 1IVZA 4B9TA 2FB0A 1HHTP 1CQNA 3MX2A 3A8YA 4LIWA 3J7A1 1LAVA 4FJLA 3I32A 3HJFA 3UR0A 2ASOA 1NJIO 3PSIA 1S6QB 4LSNA 1GQEA 1NBWA 1ZXOA 2P9LA 3BQ2A 4RNHA 5L39A 5CAAA 3VTHA 3TAMA 2FHKA 1KD1T 3LF0A 1V4TA 4ZP7A 1DTTA 3MCOA 4K42A 2RU9A 1YAGA 3T7ZA 3TW0A 5JLHA 3GJTB 4A48A 1F60B 1HNXJ 4FDFA 2O8BA 2JSXA 4DSEA 1PC5A 3N6LA 2HFNA 1RBLA 4JI8K 4MFBA 2GVZA 1UJ5A 2VASA 5HATA 1VK8A 3JSRA 2E9TA 4BRHA 1GEHA 3EVWA 3AOBA 3KDOA 2K06A 2Z1JA 4C8OA 1JB0C 4KIAA 1RAJA 2DHAA 3N28A 4E0DA 4ECQA 2NYHA 3EKSA 4CGFA 5CD4H 2KJVA 1YRTA 4ZK7M 4F7VA 5C2FA 3ZSWA 5GAGI 1PG5B 4AHSA 2IA6A 1RT5A 1WUUA 5C24B 2DH7A 3UIQA 1REVB 1SAZA 1L3SA 3PW2A 2M8HA 2WAQD 4ZITA 5A0YB 1QHAA 1I6JA 2B5JA 1HNIB 1LKZA 2DHXA 1OMSA 3M2VB 4HDGA 4RKUC 1TKXB 4LF8K 1FHTA 1ZBHA 3VGLA 2QTWA 1WOSA 2VQEJ 4YOYA 4O4GB 5SWMA 2AEJA 5CQGA 4NZ0A 4ECVA 3IS9B 3UD3P 1MN7A 3GL1A 5F0UA 1N36J 1JK9B 1FXDA 2W8KA 1R3NA 3E01A 3V81A 2QL5B 3VQTA 1ZYQA 2ZITA 1VRTB 4C6AA 1UCNA 2KM8C 4RPFA 1QAIA 1VHFA 3AFGA 4ATNA 4DL4A 1FKAF 3NGKA 4UTGA 3TI0A 1KAYA 1HMVA 2R4FA 4U8YA 5AE2A 3MOJB 3QJJA 5JVGQ 3MI7X 5KFVA 4X64K 3A5LC 3ENAA 4IO8A 3M8PA 5KFCA 3DAWA 2HIYA 2V8GA 1HWUA 3AARA 1VSLA 3THTA 4JI1K 3T1HF 2X51A 3S3OA 1C2PA 4LF5F 4KFBA 1RHKB 3VAMA 2YHBA 2QLJB 4DX7A 1J54A 5THWA 1KONA 2QI2A 3QEXA 4F25A 4UY8O 4GC6A 2R8GA 3CJQA 2O8FA 4BE2A 4PKIA 3V9XA 1QJHA 3DU6A 3WZ0A 1SH2A 2V4QA 2E5JA 4ECYA 2GFFA 1OKJA 4DPOA 2F96A 4DHYA 2DVIA 5F2RA 4LFBK 3CC7S 3KWMA 5HMXA 4HT5A 4AFFA 4KTWA 4GV6A 1ZM4A 4Z2XA 4QS9A 5KFEA 2B9XA 2DGUA 3KXDA 2ZGYA 3VENA 4FWSA 2BMBA 3LPEA 2ZH1A 1C1CA 1S1TA 3JSMA 2DGSA 4EK2A 4OI0A 2VG6A 1R8BA 1HA1A 3MM5A 1TVRB 3TJAA 4J8FA 2XMTA 4E1MA 1T0TV 2YNGA 1LW2B 3K0SA 1Y7PA 4CJ4A 2ILZA 4GVLA 2MY8A 2GGPA 3KTQA 2FDNA 2BACA 1OY6A 3VF4A 2W01A 1UVJA 3QLHA 3LL3A 5EU7A 5HAOA 1NHVA 2VZ9A 4URSA 4C8MA 1S0VA 4KB1A 4PXBA 4NCBA 4JI7J 3RR7A 3I4HX 5IQQA 2C3OA 4USIA 3BDPA 4OO1J 2YX1A 5KFFA 4FYXB 1ASWA 4LRAA 3AB2B 2CQCA 1VQNS 2LCWA 2GUPA 2DK2A 2OMOA 4ZS6A 5C12A 5FDLA 4AT1B 4LRBA 2OTLN 3AJ1A 2FD2A 2BJ9A 3R3TA 3QSYB 4BG9A 5JVGL 2JX2A 3HPOA 1FE0A 2RUGA 5CYJA 1DHMA 4IDKB 2CUYA 5LOQA 3E9OA 2DCLA 3GIRA 3SDEB 4KTQA 1WSHA 3OSPA 3OYHA 3MCMA 4A4JA 1KD1O 3M8YA 3ZT2A 3MUVP 1EZZB 2IIRA 4WF9Q 1YRUA 1LOTB 1MROA 3C66A 3D54A 2QMWA 4JI5J 3GTYX 1YITN 3SFUA 3FZMA 2EFOA 4DOZA 1GX6A 1RAOA 3BGRA 4DSJA 4ZTJA 1Q8KA 1NG9A 1VBXA 5KG6A 4LRCA 2P9UA 3A3PB 3HHLD 1SZ2A 1GXTA 1BWFO 4YR2A 3JYTA 2FVCA 4EYIB 1CJVB 3QJPA 4QYRA 5GAGU 3FZKA 3HSTB 2IVYA 3HD1A 1UW4A 4YHHK 3OR2B 3M2UB 2HF3A 3LALA 2FVRA 5KGXA 2BV3A 4HL9A 4FJ9A 1BUPA 1HMVB 4GKJJ 4CGJA 4PWDA 4U8VA 3EM1A 4IDKA 9RUBA 2XULA 3O9QA 3PV8A 1RISA 4TQRA 2VICA 3RJMB 3R5AA 5CA5A 3HM9A 3CO0P 3EE8A 5KFTA 2W1BA 1RAEB 4ANEA 2QYGA 3L7UA 1DARA 2ITMA 3CMAN 5KFRA 1QQCA 1U7LA 4DV2K 3G96A 1K73T 4YOVA 3NH1A 2O4GA 4BC5A 3BPSP 3TYTA 2KM8B 1JNRB 1OQ3A 2I9SA 3ENWA 4BE0A 4M3ZA 2W24A 3T5JA 3CIPA 3IRXA 2GUIA 4J2EA 2L9WA 1L3TA 1UVMA 3WHIA 2Y1LB 5KFJA 4LF9F 1WF2A 2IPOB 4NLOA 2EG1A 5A2QO 2W2NP 3GV5B 4DV5J 5IOLA 3M6XA 4FO0A 2R2SA 2IMOA 3GYXB 1LW0B 3MUMP 4WQ4A 4MLHA 3U1MA 1ZC6A 2JNJA 1KFSA 3KG1A 5F3TA 1YJWN 2RF2A 1IG8A 4U7BA 3E8OA 3I4PA 4ZVTB 4O8UA 4FXDA 1RT2A 3V9UA 4FNHA 2RQ4A 5KFKA 4F0MA 1AUSL 4YB7A 2LDIA 4Z94A 4UQTA 4BRGA 2BKPA 4OZ2A 4DUTA 4MLEA 3MEEB 4K8XA 1MN9A 4IYQA 3C6TB 3KVGA 1RGIA 3HVTA 3CCES 1WNSA 3L8BA 3NWRA 2VBZA 2F40A 4DUYJ 4BRDA 2D5RA 4NX9A 2IA0A 2E6MA 3C65A 2VOOA 3O3LA 5JVHQ 2RDJA 4ZPDA 3EKUA 3TOQA 3LM2A 4MK7A 1IO2A 3JXUA 4J2BA 1P9YA 1U09A 1X5PA 2JH3A 1KQKA 4P2SA 3BN4A 1HHQA 3CC2S 5HRSA 3OTDA 1NDPA 2HZVA 3F0NA 4LSNB 4DV4K 3QETA 1MMDA 1QVFR 2CPIA 2QX0A 2CVIA 2L08A 3NGDA 2K8GA 4OJ3A 1NNEA 2HGLA 1XR5A 5K14B 1MROB 4QS8A 4IRCA 3PIOL 5CR4A 4CECA 2BJEA 2AJQA 4EEYA 2WOMB 3OXFA 2DNNA 2P5OA 2LU2A 4ZCMA 4CFDA 3FEYB 1P8GA 1YVUA 5J1NA 1FK9A 1HNVA 3P8BB 3HLUA 5D6GA 3C6HA 1WJ9A 3THXA 3DI6B 1Q82T 2N7CA 4LBIA 4UY85 3OR2A 2R7UA 3CQYA 1YBAA 2VUGA 2KH9A 4X4TA 1U1MA 4OL8A 2FY1A 1RAAB 3LDNA 4N7TA 3Q8VA 3LGNA 4DQIA 3O1LA 1RKJA 3TAGA 3KK3A 2HNYA 2PZSA 3LPUA 1Y9OA 1KRPA 4PA1A 3JS9A 2Y0BB 3TUPA 3VV2B 4U67L 2A1SA 4NLCA 1U6BA 1SQGA 4ID8A 4I6MA 3VEYA 4RUHA 4UOHA 4M94A 3S7RA 1FNOA 4LF4J 3Q8SB 2RE1A 4DCPB 3KFWX 4N41A 3VQ5A 2CQ4A 2CQ3A 4IEEA 3IG1B 2O4IA 1K44A 1HQEA 4PG6A 2C2KB 4ZHRA 2H3GX 1D8YA 3T5HA 5IXUA 4NI2B 1B64A 7FD1A 4DV0F 2LA4A 3O1BA 3AVHA 2AMCB 2XM3A 1RBTA 5GADP 4ETZA 2QWRA 3SSQA 1QUPA 2DTJA 4JB8B 4IR1A 4M5IA 4EU0A 1QAXA 3N6MA 4C97A 2HGNA 1LCUA 3QQCD 4TLRA 5DLGA 4LSLA 2QIFA 2H4YB 3IKMA 1P90A 5AQIA 2VQFF 1CULA 3AA9A 1T11A 4U67Q 4EHTA 2YWHA 5C15A 4CLYA 4M1KA 3OHBA 2CNLB 3QNNA 3QBWA 2YPZA 3B4MA 4S0MA 5AQKA 2G4BA 1RT1B 5DQHA 3Q86A 4WU3A 3SUOA 3N6NA 3OTOJ 3H98A 3HBTA 3WNHA 1WOOA 3CW2C 4GKKK 4M5KA 4YHHF 3L3UA 1UW9A 4W5QA 3EDQB 1VQ6N 3O9SA 2JOQA 2W9BA 4DXLA 3W64A 5DDRC 3ULHA 3MAHA 2LYVA 4RO0A 3FCHA 4CJPA 1F9HA 4WFZA 1DGKN 3SV3A 5AQVA 1Q9YA 4UT4A 4ZPAA 3NNHA 5KOWA 4P74A 2VPYB 4CLUA 3GCWP 5LJVA 2UU9J 4FYYB 1MWQA 3FEXB 1S97A 1HNWF 1XMQJ 3CM5A 3HD2A 5ETMA 4CLLA 4DU4A 2Q0UA 2NUBA 3CMES 2A3ZA 2F4VJ 5GIOA 4FWOA 4CD3A 2VA3A 1Q82O 2HAFA 2AJ0A 1NSAA 3Q83A 3E9LA 4WFAL 1CJKA 3B82A 2E5LF 1DY3A 3GFYA 5IWAF 3IAYA 3OYKA 2O01C 2QK9A 3OVNA 1F0XA 2UV8A 4M7YA 2DD8S 3H08A 5FLXO 1XN9A 4ISFA 3O44A 4IOBA 1NRKA 3R5JB 2XRIA 3IRWP 4QWEA 4MKYA 4BRIA 1P1TA 3U1LA 4KHPK 2OFGX 1K1QA 4CGGA 2FLOA 4BRKA 2HRUA 3IAS9 5BYSA 3K7RA 4H0VB 4JKGA 4A8YA 1BI4A 1RT6B 4X4RA 4IQXA 2F4FA 2HWHA 5ETSA 4JI3F 4RG8A 4B3RJ 4EHUA 3DOKA 3DRSA 3CJ0A 4Y28C 3EL2A 2AKWB 3OPKA 4ELVA 2XGQA 4ZVUB 4QW8A 1NO8A 3SI8A 4IG0B 5EUHA 3GFXA 4RJVA 4ZP6A 3BGUA 3WQUA 4DWIA 1XR7A 1BA0A 2O5DA 3H5YA 4B1VA 5ETTA 4WP9A 1TK8A 4QWAA 4M5DA 2PDAA 1HIYA 2ZOFA 1YJUA 3H5XA 2UUAK 3RAQA 3R2DJ 3VGMA 3HXMA 4DFKA 1E6YA 4CEAA 3UE5A 5F0WA 1SB6A 1YQHA 4ILHA 5DM6Q 3S3MA 4WQ5A 4B1ZA 4P52A 3GG0A 5JMVA 4ES1A 3TABA 4ANDA 3BQ0A 5AXNA 1HBNB 2PC6A 3SQOP 4K4XA 1Y5IB 3PSFA 1BO5O 2MHNA 3TA1A 1C0FA 5HBMA 3N5BA 1I94J 1PJ7A 1NJXA 3BV8A 5HLFB 4BACA 2F7TA 1J9AA 4B3TK 5KFPA 3B6PA 3KD5E 2EWSA 1BIZA 4DQPA 1SC4B 2CPDA 4WXOA 3GIKA 2F3JA 5BPNA 1CSJA 2DB1A 3HVRA 5CCMA 1K9MO 4WYBA 2WW4A 3TWZA 4UUXA 1BDGA 2HVHA 1SBRA 2MJUA 3M9OB 1OPIA 3TAQA 4BC2A 4DG1A 3VVTA 5F9LA 4CJEA 2XZWA 4DQ8A 1TMMA 3K5MA 1HHSA 4L72B 2LQ5A 4MIWA 3VEVA 4IQMA 4RW8A 3QT5A 5ETKA 3KDNA 3C16A 1W9HA 4TY8A 3D6RA 3OTEA 4ED6A 4B02A 3GJRB 4DTUA 1WNEA 1HQUB 3RRHA 3CUNA 3TARA 5IT9U 3FZBA 3V1QA 1JLGB 3K0JA 3LDPA 4OVLA 4BHQA 3A5NC 2P9IB 2E1YA 1KHVA 3SYZA 2EG2A 3PLAA 4ED4A 2WVFA 1SL1A 3CF5Q 2F8MA 4DV6F 1CQMA 5D3GA 2NYIA 1M1KT 3DLKB 5GAEP 3ZZZA 2XY6A 3TUJC 1ZOTA 1XQIA 2RPIA 1UZDA 1KXPA 2CG8A 1VIOA 4M5LA 3PW7A 1Z1ZA 1Q95G 2B56A 2WSFC 4ZMMA 1CJKB 1SS6A 3K2PA 4B08A 3NGSA 4USTA 4U7UK 5KG7A 4GNIA 5KFWA 3CIMA 4Q2LA 4DS5A 2RDDA 3FGUA 1ZBLA 1VSJA 1MU2A 4NRUA 2E7WA 5H9FK 1TVRA 4MFBB 4IFEA 3POTA 4LFBF 3CDUA 2QV6A 2CKWA 3V2UC 2Q31A 4CJ7A 3SXLA 3AO4A 4IFVA 3VAJA 2QSFA 2CWKA 1SJ3P 1JJ2R 3U9DA 4LFCJ 4IEIA 5C24A 3QLHB 2R42A 1X31C 3SFGA 3OFGA 3P5JA 3LWMA 4P75A 3DHWC 1YJRA 1WOQA 2B5JB 3OW2M 3WC0A 3Q23A 3LP3A 3BYRA 1UFKA 1J5OB 3PR4A 2GIRA 1RTHB 1XNQF 2ZNYA 3KK2A 4M5MA 3CULA 3DRPB 1GMVA 2EFQA 3WQPA 3M6GA 4EMDA 3WX4A 4V1Ak 2O8EA 2J7UA 4G1QA 4JV1A 2W6LA 4LBHA 3KKRA 4HT7A 1C1AA 1RAFB 4JHDB 4QBUA 1KSPA 1TYQB 4P73A 4BDPA 3I5AA 1HR0J 3FFIA 2HVEA 4A47A 1N0UA 3IWXA 4DZ6A 2M9KA 5E33A 2J76E 4EFHA 4ZVGA 1SPBP 4DR5J 2FJAB 3SV4A 3D2EA 1MW7A 2GJFA 2OPPB 3TX0A 1IH7A 4R0EA 4BR7A 3AAWB 4Y1CA 1WHWA 2A18A 5KFMA 4K4SA 1XERA 3L0QA 3M2UA 3AO1A 2GWJA 1RJJA 3R6LB 1HBUB 3BYPA 1EX8A 4NASA 2DGWA 1NHKL 2IJFA 1FXLA 3BKTA 2LLZA 3DXSX 2F9DA 5IT4A 5L46A 3CD6S 5GMDA 3AA4A 3AO3A 5H1SQ 4OLBA 1SXLA 3HZGA 4LF8F 4OI6A 1IJJA 1GLLO 2B43A 1S12A 1UTAA 2ZD1B 4JV5K 3CCVN 1WC4A 5D78A 3LOUA 4FYDA 3I0RA 4DR3F 1DEJA 4JKFA 4CHNA 1VLYA 1T05B 1RAGB 2XWXA 4F2SA 1G7CB 4M5NA 2KXFA 4LF8J 1SL2A 2D41A 2A6AA 4BRPA 3N4PA 3EZUA 3J81Y 3O4WA 2YH1A 4DDFA 1TAQA 3OVBA 1QD1A 2D0AA 1TL5A 1AFIA 4IOAL 5KOXA 1S7HA 5LM7E 2AWZA 5EWGA 3V6DB 2J9DA 3OTCA 3O9RA 4BQLA 3DXKA 3CCUN 1JL1A 3P4UB 3H2VE 2UVRA 4MAKA 4FF4A 4OYAA 2PSZA 3E2EA 4ZN1A 4ISGA 2X7IA 1BLUA 2DHSA 4XO0A 4Z4FA 2OH2A 3W0LA 4AXIA 2WC9A 3GP9A 2XMVA 4I2PB 4USVA 2E1RA 3S3NA 3MCNA 3I6PA 2NUHA 4MDAA 3TX8A 3IRXB 1IBLF 4BVPA 1F9EB 1J5EK 4RU9A 3H42A 2B4PA 3OLAA 3DYAA 4RBUA 1FXXA 1IBKF 4UZBA 1HUXA 2P9PB 1S1UA 1HQ2A 2HWIA 4CF1A 4JI5K 3QBCA 4DV7F 1OWXA 5H9EJ 2JJ4D 3L9ZA 1H6KX 3QAEA 2UUCF 3G8QA 1FESA 2UV8G 2OZMA 1EQMA 1RWPB 2G0IA 3D0GE 2UU9K 4KHNA 1NM1A 4PY5A 1K1SA 3PX6A 3B4DA 1R31A 2E1CA 3ZC4A 2U1AA 3JAMY 4OI3A 3R97A 5AQLA 2B9EA 1BMQB 1BCOA 3PHEA 3DWLA 3K89A 1FX2A 3G4SS 3K8VA 3IDHA 4J9SA 3CPEA 3CJ1A 4NLWA 2IIHA 3ZSZA 2Z2YB 1MMLA 4NLSA 4AM6A 1VDHA 2ZEJA 2AP6A 3CCUS 4IO1A 2KVIA 2HBKA 3FK4A 1JCGA 2WONB 1EJ7L 1O0PA 4FK0A 3H6EA 2JEIA 2LDYA 2XI2A 4DLEA 4B1YB 2HFVA 2BJDA 3OXGA 3VGTA 3CD6N 2K2PA 4OKEA 2FJXA 1WSIA 1KBRA 1IR2A 3EXCX 4CO0A 1KC8T 4IWVA 3DLHA 2X6SA 4H0YB 3OL7A 1HPZA 3IBWA 4PHTX 1KFDA 2AYMA 1S99A 5AZIA 5KPRA 1JWWA 1NK8A 1NGJA 4LR9A 3LDQA 1VGYA 1VBZA 3TQEA 4J9LA 4LC9B 1R8AA 4ECWA 4WQ5C 1RHJB 5AQSA 3PRVA 3DNCA 5M1QA 3CC4S 3MR2A 4YEAA 4DR7F 4AUKA 1H2TZ 2CZVC 4TU8A 1YLXA 3KYLA 1W7WA 2FGCA 1TKXA 1WELA 3IAM9 3W8PA 2F1FA 3J80Y 4K0KK 3UW1A 4QR1A 3DOLB 3ATUA 1JLCB 2HBZB 2J0XA 3FJ2A 1LXNA 4K0KJ 3ZNJ1 2VG7B 3R5CA 3T1HK 1VQPS 3VQDA 1N4LA 2DHHA 2DYAA 4QZVB 3C94A 4I2QB 2V63A 4M63A 2BQRA 5HI7A 2C2OB 3W62A 2KG1A 1CS4A 4PUOB 3OHRA 1SVDA 1NK7A 2KXNB 4ILGB 1D9AA 5AQUA 4FYWB 3OBWA 1G15A 4RW9B 4TN2A 1OSCA 2B4OA 5JLFA 3AXKA 4X64F 2VONA 3TJ9A 2CDRB 4H54A 3MDFA 5E3CA 1EX4A 4A8FA 2G9OA 2W40A 3GB0A 1S6PA 1Q7LB 1N5VA 2UZAA 1N34F 4JLHA 3QFHA 5DDPC 3AVKA 3EGNA 3R7SB 3HOSA 4DV1F 4F0KA 3NFAA 5K8OA 4BC4A 5DGAA 1RWWB 2VWJA 4DV4J 1XIQA 4FPAA 1TU0B 2P9LB 2ACYA 1RT4A 2CZ9A 2G1DA 1I51B 4DCHA 4ANCA 4MO4A 1S1UB 2CRLA 2DFEA 1WACA 1OIAA 1SKUB 1EKSA 3N4WA 3CJAA 4DV2J 3I9V9 1Q4RA 2FHOB 3MCPA 2YBVA 5HP1B 1GTHA 1Z6RA 1TL1B 3T69A 3NGZA 3ZZPA 3WXJA 3GE1A 2LXFA 2YKOA 5CE3A 2O8BB 3A8JA 1NUEA 5E2QA 2CJKA 2W7AA 2OA8A 3VAHA 4OPHA 3DRXA 2GO9A 2HLTA 3CDAA 1WEXA 3Q0AA 1ASUA 4WCEL 2O66A 4PABA 2EFGA 1RTDA 4CZMA 3WEEB 1YT3A 4ELTA 3E1YA 2RAQA 4QIEA 3J7YU 3BGLA 2IRXA 3MR6A 4CLPA 1X4HA 1QS4A 1DLOB 2OI2A 2QWQA 4NXNF 4Q45A 2DO0A 2HOEA 1EB0A 3G6YA 2KLAA 2YNIB 3UCZP 2VQEK 5BR8K 1NXIA 5KT7A 1W2BR 4LFAF 2F9JA 2XLJA 2J6TA 3OJSA 2ROGA 5HP1A 1N6QB 1S9EA 2W7PA 5FPMA 1C0UA 3NDKA 4Z7CA 5KFAA 2QC3A 4BLGA 2DY1A 3QGPA 2VHGA 5E3RA 4JYAK 1R6VA 1S76D 5AZIB 2DKOB 2DNOA 4OX8A 2K7KA 3OYLA 3AAQA 2HNYB 1RCXB 4I67A 1HW9A 1KWMA 2N3LA 2RNEA 4OZ1A 2OFHX 3G87A 1YWXA 4ILJA 2HMIA 4WXWA 3FBBA 2YNHB 2D69A 3JSBA 4CEZA 2NXJA 5BN9A 3M2VA 3W8GA 3O3FA 4WQ4C 2XQCA 2LECA 1D3WA 1UWBA 3BQ1A 4C11B 1T3NA 4P7TA 1O1WA 1KLMA 4Q44A 1ZBIA 3ZTOA 4M5DB 3V6HA 3C8YA 4AHCA 1YHQN 4A8WA 1VQ6S 4K4VA 4NXNJ 1NDLA 3T1YF 2MKJA 1NGCA 1V6HA 2F4VK 3OTOF 2P9GA 1Q5YA 1HBUA 2WVEA 2BUPA 3HULA 3MK6A 2O8FB 1UWAA 4CZHA 4NMXA 2JGUA 2XO6A 1Y64A 3GSIA 3EWGA 3D2EB 2OKQA 3CMQA 3EGVA 2MGZA 1HPMA 3ITHB 3ULEA 4J9RA 4IOCL 1D5AA 3NH0A 2YNHA 4CW7B 2ZBQA 3G9CA 1SKWA 4DU7A 3TPQA 1TFYA 4BROA 4J7CA 2E8AA 2I5JA 3IC1A 4DBQA 2HQCA 2M70A 3VF6A 2PEHA 3V1OA 3D45A 2C2ZB 5J2MA 2UXDF 2GZOA 4QPXA 1BHLA 4IDHA 1HBNA 3MTKA 3AV9A 1QQOA 2EKNA 1Z4UA 2GQQA 3GU0A 3BO2A 5KQDA 4Z37A 5DM7L 5EHHA 3CJBA 1SJ1A 1R8HA 5HQLA 4DR1J 1K73O 3CCMS 3CFPA 1S1XB 2ZWOA 2JFKA 4X65J 2F5GA 4DTXA 4CJTA 4M42A 2HQGA 4AHVA 3T9NA 3VN5A 5I42A 1FNMA 2HBJA 3CTRA 3Q89A 4M3UA 2MGZB 2UXBK 3NGRA 4NEZA 5AT1B 4B9LA 4B17A 5HQMA 3ZSXA 3RMCA 5AJ3J 2BKOA 1GLBG 3M1FA 4QIFA 1RGVA 4B3SJ 2CNNB 3GFZA 2RRNA 3CCLN 4HHTA 1GLCG 1FERA 3HCXA 1JLAB 2V9KA 3MXMA 4B3TJ 1RT3B 2X3GA 3GJSB 1URNA 1AZSB 2APOA 2E5IA 1UFWA 1I1GA 3PIOQ 3C16B 3T1YJ 2ASYA 3LDLA 2QWMA 3VF2A 1VHXA 2NS1B 3UO0A 3KK7A 4P72A 3I55N 4YDXA 2VDHA 3CNQP 4K7QA 5GAHU 2D0OA 4EP5A 1EQ0A 3GJQB 3QRPA 3IR7B 3DYAB 1GH8A 1E6VB 1RDRA 4FJ7A 5D0HA 4LH5A 5C2GA 1RT6A 5D4LA 4ZVSB 3BSAA 2M0GB 2CXEA 4KHQA 4A59A 2UUTA 5DZ7A 3L09A 4QS7A 4N5SA 5HK4A 5A6WA 3R6MA 1W26A 4FJKA 1CC8A 1GLFO 4ES3A 2CGKA 4P2MA 2MQMA 2ZE2B 3Q8YA 2A40A 1G99A 4X4OA 1VK0A 1VISA 2FC9A 2UVVA 4YNQA 1TK5A 4C9DA 3H3NO 5JVHL 3M32B 4DR6J 4C8LA 3DLLL 5A2QY 2YHXA 3GMGA 1T03B 1NOYA 4RW6B 3UDEA 3R5BA 1TKTB 4DUZJ 4C8YA 4RW4B 2HK3A 4OX9J 5HROA 2Q3SA 1ATNA 2MQPA 4ZPWR 2MZSA 3ZNUA 1LEOA 2CA9A 1ZBSA 2ZVIA 4UZCA 4OKKA 2XHCA 3H20A 3DDKA 4OLAA 3CCZA 4USHA 1F5AA 1WF0A 2DEIA 4KV8B 2YKQA 5HOOA 3KKSA 1JLBB 1JJHA 2LQ8A 3THXB 3DJCA 3ZTQA 2DNYA 1YZ7A 4Y6IA 1P9QC 3OS1A 2VV5A 3T3FA 2VJVA 3RB6A 3QT6A 4WP3A 2VG7A 1AFJA 2GCFA 5M2UA 2F65A 3SQGB 3H2LA 1D8ZA 1OPZA 3GSDA 3DLJA 3OYGA 3IP0A 3I82A 2FLNA 4LSZB 3VQEA 1JXBA 4LUBA 2OJ3A 1VQ5N 1IBKJ 5U47A 4J9OA 1RBOB 3A3OB 1R59O 2AYGA 3L2VA 1C0GA 3PZPA 2ALZA 2PN6A 4NLPA 4ICLB 2KYZA 3V5RA 1J2VA 3HMJG 3G2XA 3GPAA 3P4IA 1UETA 2GHPA 3LP1B 3QBXA 3OYFA 1SJQA 3AVMA 1WAFA 4JYAJ 1KTQA 3RZAA 1S1XA 1PBUA 2N3OA 5C7PA 2AT1B 5ETRA 3MOZA 4L6V3 3TJ8A 3MEGA 2RH3A 4GKKF 1R43A 3ASMA 1TTHB 3GIJA 2RILA 2QA4G 1FJGK 2ZC4A 3CJ4A 1PAUB 4BR4A 1JQGA 2ZJRQ 4IOXA 4JD2A 2RU3A 3UWTA 2Q1NA 5KFOA 4O23A 3QIPA 4ZVFA 2SXLA 2NRXA 4DR3J 1VQ9S 1U1LA 2D4WA 3NBPA 3M8SA 4YFUA 4JRPA 2Q1LA 4LD0A 2E2PA 3PEHA 4DTJA 3M8QA 2MQQA 4Q0BB 1AYEA 1NH8A 2Z1IA 3EO3A 4JUZA 1DRZA 3DMJB 4CEQA 2E5LK 2YTCA 2X6NA 1TQLA 1NK6A 2MXYA 2GVDA 3VMFB 4ZTFA 2BTFA 2XY7A 3R7BB 1F9FA 2QW9A 5B0GA 3PX0A 3QICA 3I96A 2KDOA 3OFHA 4ECUA 4FJNA 4FKYA 2CGLA 3RSEA 3KUEA 4K25A 3IM9A 2ILYA 1FD8A 2CPYA 3R5GA 1LWXA 3CIZA 3ZCMA 4GKJF 5FRNA 4DL5A 2QGFB 4EO6A 3H40A 5B0CA 1J6ZA 1XWLA 3EE3A 4U7UD 1HJOA 1F2HA 2QG9B 5HMYA 1Q78A 1HL6A 3TUZC 1Q53A 2GMJA 4YOXA 4FWMA 4PCQA 3PYGA 2BRKA 1VQON 4I1TA 3E9PA 4CO3A 4B9NA 4BR5A 4F4XA 1CJVA 3W65A 5C0YA 1WG1A 2X1FA 2O8EB 2J0SD 4ETXA 3F73A 4M45A 5B0AA 2NNWA 1FE4A 2PY5A 1RDAA 4O4GA 2E66A 1KAZA 2FPHX 5JS2A 1PYSB 4JAXA 4C8ZA 5IC4B 2QEXN 1VRTA 4IKFA 3GV7B 2QEXS 2I38A 2BE2A 5EY4A 3VETA 4HCBA 2XMUA 4WK3A 3IFRA 2G0JA 5F8NA 3QT7A 4KV8A 4DB3A 3QYYA 3OBIA 1BQNA 2LXIA 2A3JA 4WE1A 1UA0A 3R27A 3SDEA 2BJ1A 2V7ZA 5L1KA 4DR5F 1WHVA 3QZ7A 1FKOA 4DFJA 4KT0C 2OELA 3AAPA 2J9CA 3B54A 3MD3A 3SUQA 3PM9A 1DBDA 4NB4A 1LXJA 4CJFA 1NPRA 2K1RA 1U6FA 5FROA 2VPXB 5EGYA 3FQKA 3KLGA 3M3ZA 5B8HA 2CQPA 2GELA 4CGDA 2J9DE 3IUCA 4TYBA 2EC0A 1B0PA 1H2UX 4L73A 4I6AA 3DC2A 3H4BA 4ID1A 4Y3CA 3ZFVA 1LOUA 1R8PA 5C10A 2QYCA 3SCXA 4DFPA 2MQLA 4CK3A 1LFWA 3ZZUA 2HEKA 3L3VA 3ZSOA 2KI2A 1EWRA 1WBDA 6FDRA 5J2PA 1NK0A 3LTOA 1YX2A 3K5NA 1SIZA 1WC6A 2EFNA 4CH1A 3MM5B 1KR4A 2YJEA 3TZYA 3QGHA 4EO8A 1KP6A 2OPQA 2HNZB 1GTEA 1NH7A 5F3ZA 1FI4A 4IR9A 2IM2A 4DPUA 1CVJA 1NMDA 2ASMA 4J90A 2PFDA 1QSSA 1HKCA 2ZH6A 2WBRA 3ILIA 1RWUA 2GGPB 4U95A 2GMHA 2WTUA 4CGHA 4LQ9A 5AR0A 1S57A 1HNXK 3DN9A 1AB8A 3KJNB 3VESA 3RYLA 4FS2A 1NGEA 3O1WA 2PA3A 4NA1A 2YWFA 2KRBA 5LMNF 3NOCA 4RNMA 1GLJO 4OX9K 1WKLA 2G8HA 3Q8RB 4EBEA 1ICEB 2VL1A 1CZBA 3BR8A 3JXOA 4LF5J 2XCPA 3LAKA 4EP4A 3FGVA 3DOMB 3K5LA 4JS5A 1APSA 2YKPA 1MG7A 4ED5A 4RBVA 4DV1J 1WB9A 1IV0A 3HT3A 3S6EA 3AVBA 4CZJA 3TAFA 3HP6A 3M8RA 3LH2S 2VBWA 1FFGB 1NU0A 1BHNA 3CO9A 4ENOA 4FVCA 2HHHF 4EI2A 1JXEA 3MXJA 2R7SA 5HRNA 3BBBA 2AEFA 1WLJA 1XTZA 3MM7A 3BM7A 2GA7A 2UUCK 4U7CA 4WCEQ 4F3OA 4FWNA 2QN6B 1PCAA 1HNWJ 4CTAA 5EWFA 1FF2A 4ZA1A 1LV5A 3EMTA 3E01B 3V81B 2DRAA 3KMQA 3AVFA 2OYQA 4IXCA 1HPZB 2E1PA 3NMRA 3BREA 4CEFA 2ZBIA 1FNXH 4J9VA 1FVSA 2NSBA 3FE1A 5EXWA 1V9OA 5DMRA 3JTOA 2VBYA 4KHUA 1A6LA 3SLCA 4WE1B 1WC0A 2J0QD 4QCLA 2HK2A 2MYFA 1M5SA 1VSIA 1Y3KA 5JMNA 5D15A 3MD1A 2Z30B 3MAAA 4OI4A 4Q8EA 4X66J 4USWA 1M90T 3ULDA 3OLBA 2GV1A 2YV0X 2J4RA 2BR0A 2KG0A 1UMJA 5CD4A 4NCGA 2A41A 1VSDA 1FKPA 1D9DA 2BQ3A 5CH7B 4FZYA 3NF8A 2FIUA 2OLWA 5K8PA 1VQ8S 2R7VA 4ZHRB 4K4TA 1GMUA 1FDDA 3WNGA 4J9UE 2ZJPL 1KS2A 5C42B 2JEFA 4DV2F 3VQAA 4CNZA 4OYIA 3BEXA 1YVFA 4CF8A 4PWWA 2OPPA 4ZVRB 2F7VA 4F4WA 2IVMA 2OO4A 1VQPN 4HVJA 3VAGA 2QA4N 4J2AA 1NSPA 4MKVA 4OJHA 2RE2A 2QWPA 4K4ZA 2NXUA 2JLFA 1VI7A 3QEPA 3OT9A 1XNRF 4LIRA 3ZZYA 5HVGA 3ENQA 3WT0A 3DLEA 4BRNA 4DQRA 5BR8F 1WTBA 1VQ7N 3GG1A 4CIGA 4X4QA 2HHXA 4DTMA 4DTNA 5I3UA 3KG0A 4DL6A 3M2RA 1EP4A 3HO1A 2FQQB 2MEWA 4EZ9A 4TY9A 4F50A 4NLRA 3KNGA 3MPYA 2XSJA 4XPEA 1YUWA 4ES2A 1VSMA 2YHWA 1NM2A 3CC2N 4PG7A 1QE1A 1WI8A 1DT9A 4DPYA 2HYIB 2I5JB 2BOAA 4FLTA 4CO2A 1WSFA 1VQ4S 2CPFA 3FRZA 3UB5A 2WVDA 2UXCK 1LWFA 1FWLA 3SJJA 4CIEA 4ZCIA 4JD2B 3GQCA 1HI8A 2AV5A 2EVZA 3UDLA 3ISZA 2NSCA 2V52B 3D66A 4ITSA 1KLNA 1VC5A 3QERA 4MYTA 4MT1A 4CJSA 3HTVA 4CH7A 4GW6A 2MKSA 3A12A 1XMBA 4CFBA 2UXDK 3WQTA 4ID5B 2FHMA 2QWOA 3IN5A 2KU7A 3LPTA 4O5BA 2J8AA 3TTDA 4OV6A 2XYHB 1RU2A 4KKOA 4KBOA 1Z2ZA 4X4NA 2POKA 2DFFA 4JI8J 1SUQA 3NGIA 4ZLLA 4WYWA 5HJXA 1N0VC 3AY0A 4RWWA 5A8WB 4XIUA 5A0YA 3VR1A 4PZVA 2IDEA 1O8BA 3GIIA 5I3QA 1S1VA 4OJ1A 4UF4A 3JQJA 4JHDA 1XMQF 5ETLA 2CNOB 3K8WA 2VGNA 2UU9F 1VSKA 1NB7A 5B08A 4WJBA 2NZ4A 1OH6A 2RQCA 3MPVA 3PW0A 3SEOA 1SL0A 4FXVA 3D0HE 3VA3A 3CB4A 5KFBA 4OJGA 4PKHA 4K2XA 4O3NA 5EX5A 2H4WB 4DSIA 3DGPA 3G0ZA 3CE8A 3NVMA 4LF4F 1IKVB 1B9FA 5IQ6A 5LMNK 5IV3A 1EAYC 2C3MA 3VQCA 3FMWA 1R6YA 1A9NB 3VAIA 3MX5A 3D1HA 4C1NK 1X5TA 1RA7A 3LGMA 2HURA 4ALZA 2C3YA 4I64A 2P9UB 1MSWD 1HARA 4KH6A 3AODA 4BRLA 3VQSA 3UPFA 1AW0A 2D0BA 3HSZA 4KQZA 2G8UA 3IFEA 1RBUA 4OFZA 3SQ1A 3NRBA 1KQFB 1IBMK 2EC2A 3CCRS 3SIPB 4F3QA 2VFRA 4Q2MA 4PYDA 3ITHA 3ULEB 4RNFA 2QE5A 3W7BA 2N7YA 3FMBA 4ELUA 1QUVA 4FLXA 2ZHAA 2F8EX 3TP2A 4OJRA 4BRAA 1BQNB 3G6EN 3VOVA 2HZCA 2AIRB 2MB0B 5AQQA 4WTOB 1M90O 5HROB 2PA8D 4FM1A 2ZBRA 4CO5A 4IO9L 3HM8A 3DOLA 3P49B 5C5JA 3LP2A 1CULB 3NMAA 3X1LB 1VQSA 3VGVA 2PYJA 1IM4A 1C1CB 1RDBA 2CPHA 1YITS 3SSRA 2FVQA 4B9QA 4DR4K 3CETA 5CZXA 3D9BA 2MZRA 3TSQA 3C6TA 4I9LA 3FNNA 1SQEA 2RD5C 3I0RB 4B3OB 4Z4HA 3IBFB 3DXKB 4FBUA 4KAZA 1V5IB 1N8RT 2OCEA 2ZWPA 3B8HA 3CCMN 3AQPA 3J81j 2AJ1A 3KZBA 4RW8B 3DXBA 4FXWA 2ASPA 2LP4A 4CLKA 4LJMA 5GAEU 1WKJA 2IGIA 5JUMA 2HFUA 1HRHA 4M3TA 1RUSA 2KFNA 1FCAA 1QSYA 1H7XA 5ETQA 4ZCKA 3EGZA 4BDZA 4LF6K 2GC8A 3D6FB 2HNZA 1DURA 1HWIA 5GAEI 2EEYA 7AT1B 2M4MA 3K9JA 2Q97A 5AQYA 3Q8UA 1YG0A 4BWMA 2RKIB 4XDDA 1YIJN 1M5KC 2YQ1A 1NNDA 1HLWA 2DY9A 3MWPA 2AZ1A 1IM6A 3CC7N 2MPUA 4EZ6A 3SCLE 2DPIA 4LFCK 4ZPVR 3RBXA 1CJTB 2GJIA 3KLFB 5KT2A 1TL1A 1FXRA 4WWSA 1GLAG 2PGCA 2QLXA 4PPDA 4UW2A 3K2YA 1HX1A 2Z2ZA 3KUGA 4TXSA 4ZLJA 2F9WA 2GV9A 3L2QA 3N4QA 5KG1A 2JVOA 3KLVA 4H0XB 2RB7A 3OYDA 2U2FA 4NZ7A 4MKBA 1MDUB 3VQQA 1RACB 1SV5A 4CZCA 2R2TA 4YY3J 4KGMA 2C2MB 4FF1A 2DISA 4KRWA 1F5BA 1P1LA 3TO8A 1Q79A 3O4QA 1CXUA 5DZ6A 3TTCA 2LSNA 2EXUA 2I6WA 1VK3A 4JI7K 1F21A 4H5TA 1C4AA 1IKYB 3HK2A 1ZM2A 2W4DA 1NPPA 1VJQA 3THWB 2ZJPQ 1B3TA 3H59A 3G6ES 3BGRB 1E4FT 3RSEB 1RHRB 3IMQJ 1RYSA 4NLTA 2ZUAA 1MWYA 1BI4B 1RTHA 3SPZA 1NZAA 2FY8A 5K14A 2MZQA 1A5VA 3SCIE 3THYA 3UDVA 3CJ8A 3EN9A 3KHYA 3TAEA 3MPDA 3HL8A 1FTCA 4NYOA 5DS7A 4Z7YA 4IG0A 3GIMA 3CCQS 3SAFA 4KH4A 4KPYA 3OS0A 4PWDB 5KFUA 1RXOB 2FTRA 1RBSA 3QESA 1KNZA 2ZKTA 3BGOP 4RW9A 1U0SA 3WDOA 1NDKA 4EBCA 5JJBA 2R8JA 1YBUA 3BPDA 3HYFA 5HQ8A 1RYRA 3MZIA 4CCHA 4Q8FA 4NZ6A 2PFFB 3LP2B 4CVNE 2HMPA 4W5NA 1L3VA 2D1CA 3VZIA 3QWUA 4USJC 3SI6A 3PKMA 3P45B 2NZCA 3W2WA 1ZTTA 3WXIA 1YDLA 3UN3A 3MN7A 4C23A 4ZP9A 2G8FA 2ASLA 1T8EA 4E1NA 2I1RA 3D7EO 2R8HA 1VFJA 4QU6A 4JI0F 3NS7B 4H8KA 2CJXB 4H4MB 2E6LA 1VQ7S 1BIUA 4V19S 1HWJA 4MK9A 3UCUP 4A57A 4OYOA 2DEJA 3T5KA 3A1YG 3MEDA 4M5HA 5K8NA 1WSRA 2DJWA 3SPYA 1WHXA 3M30B 4FWLA 3CQ8A 4B1XB 1KVCA 4LH4A 3RRKA 2KXHA 3OQ2A 4LSLB 5FIIA 1XMOF 1NGGA 4FSVA 3THVA 2ZH5A 4DU1A 4HH0A 1V3RA 3NAHA 3G8TA 3C3LA 4OZ5A 1P27B 1VMBA 1RWNB 1NPKA 2ZGZA 2ZH2A 3F9KA 2FSKA 4W4MA 2WBNA 3DLLQ 2PYLA 3MWTA 2YPYA 1S3XA 3OUYA 2CQHA 2E1ZA 3QJLA 3P1GA 1Y11A 1IBMF 5M1PA 2AF6A 2YNIA 1U1OA 2NXEA 1RT1A 4TSXA 2BUNA 2MZ1A 4DUYK 1VQKS 2J5AA 2BANB 4ZVQB 3H8YA 2NZTA 4WFYA 1GK8A 2Z56B 2LEAA 4NLDA 3L2UA 3KJVB 2R7RA 3CG7A 1WDTA 3EY1A 3GG4A 2VFTA 5IT9Y 2EHGA 3D2FA 2R7WA 2P9NB 2EK6A 2HQ3A 4YUDA 3HPHA 1QM9A 2XHWA 1VC6A 3G25A 5HN0A 2I2YA 3C15B 2B6AA 3L6QA 3ZETB 3U8XA 2LEPA 1D0EA 1B92A 1VQLS 2ADCA 4LF7K 2P51A 4R8UA 2Y1IA 1N33J 2V94A 4Y1DA 3H25A 5KPTA 4J9MA 5BN8A 5AQOA 2ZM6F 3WNEA 1BXNA 4CT8A 2YCHA 2IM3A 4KGVB 5BRDA 4OX6A 1GXLA 5M2PA 3J7ZT 1VSEA 1FRXA 2H51B 4I6MB 3NAEA 1WD6A 3H5UA 5B0DA 3THYB 2L9NA 4W92B 1RWVB 4PQUB 5ETPA 3IWNC 3D1OA 4ZJLA 4BCAA 1U1KA 4NLBA 3TVKA 2FVSA 2IAJA 4C4WA 1FX4A 4FWPA 2OD6A 1VQKN 1H73A 3KK3B 4LBPA 2DR9A 1TR0A 1L3KA 1UEUA 4DR6F 3LM9A 4JOUA 2VWBA 4J9QA 2VC0A 1X4GA 3KOAA 5K9FA 3JAMU 2YI1A 4Y2IA 4I0WA 1U2RA 2H5JB 4C3KA 1LWCA 5AFUA 2VQEF 4E1JA 3ZT0A 5LSRA 1BD6A 4DMNA 4LR7A 2XB2D 3VGUA 3U3YA 2D7SA 2ZH4A 3U3GA 2QWLA 3UI3A 5LJ3Y 2C2EA 2YKMA 1AT1B 2OPRA 3AVNA 3BUZB 4TY8B 1GAOA 4ED3A 3CPWM 4MK8A 3BF3A 1WHYA 5DJBA 3LP0B 1M1GA 1CJUA 4CLWA 4I4BA 4DN9A 2BABA 1IJEB 4FN5A 1S0MA 5AQPA 3CFRA 2J8SA 1K8AO 3R8YA 2ZJQL 3EPIA 3AY9A 1ZTWA 3M9NB 4GRSA 5EDWA 3W5XA 3Q8QB 2CPXA 3W66A 3MGJA 3PACA 1IQTA 4OHXA 1BQMB 2ATQA 3AD7C 3NVKA 4V19X 3S01A 4AD6A 3I8BA 1X4CA 4CE9A 1S1WA 1FJGJ 4DV0K 3MEDB 4JKHA 2X1AA 2A2DA 3AXMA 4I7FA 3VAFA 1VRUB 2IDLA 4AQYK 3BH7B 5G4DA 2KHCA 2JZ5A 2R7TA 3MEEA 5L1LA 4JI6F 3BB5A 2MZJA 1M5HA 1Y10A 4LFAJ 2JVRA 4F4KA 4IJAA 3HZEA 2DR7A 2R2RA 4C0OC 3QO9B 2Z2LA 5FRMA 1DTTB 3CF5L 3AA5X 3MMAB 3CM6A 4M5JA 4J9NA 5L8RC 3JQKA 2FZGB 4JI1J 1UP1A 4C48A 4ZKAA 3W2VB 4B3OA 4W98A 4DR2K 4K59A 3AO5A 2HZAA 3HF5A 2KZZA 1OVQA 2IVOA 1S0OA 1GX5A 1WBBA 2CQBA 4YB6A 4ZVEA 3VEXA 1VJWA 5GMEA 4UOGA 2QFJA 4FJJA 3HHEA 2VGMA 4NOHA 1N36F 2CQIA 1SC1B 3BBFA 3L4IA 1DAXA 1C1BB 3MPUB 3C15A 2E2QA 4DV3K 1A0OB 3T19A 2MKKA 1SJ4P 5M1KA 2W6KA 3L95X 1JLAA 3IA0A 2PMHA 3TSPA 2WVBA 3NL0A 4CLFA 3KJFB 1ZPWX 1RT3A 4FNIA 4HCCA 2X78A 1XC3A 4RW6A 5HO4A 2IM0A 4LF7J 5AFUH 4RUBA 2N82B 3T5LA 3AVAA 2M88A 2YH0A 4IH6A 2IC3B 4JI4F 3ET6B 4Y65A 3BO4A 5E3AA 1BG3A 2FJVA 3DI6A 4CNYA 5J1PA 2ZHOA 2M7SA 1QVGR 2I0XA 4HHHA 3C95A 2J7WA 2BQUA 1VC0A 4JI6K 3T1AA 4O3SA 2V6AA 2C2RA 2K3IA 3RRGA 2G2ZA 3VQBA 2WOMA 5J1EA 4N47A 2PO4A 3H1QA 4MIAA 4JNEA 5I3PA 4B3MF 1N5YB 4BR0A 3F44A 1BY9A 4QWCA 2OSQA 4RW4A 3TAMB 1TUGB 4LF7F 3CCSN 3ZX2A 1U8SA 1FVQA 2PE8A 4CZIA 3I56N 3W5YA 4WK1A 3VTIA 1IBKK 4KSEB 5BR9A 3BF4A 2BJ7A 2O8DA 1RQ0A 2AW0A 2ROEA 4C7QA 2D3ZA 5DG8A 2EX3A 3V9SA 4JI2F 3AGKA 1JIHA 4I6WA 5DLFA 3I31A 3MMCA 3J8AA 1VS3A 3NXZA 3SAHA 4DV1K 1JLEA 1N5QA 4ER8A 4QIGA 4H5WA 2E7XA 4ED2A 1YTAA 3FBFA 1NK5A 1H72C 3NAIA 4K43A 4BRQA 4YB5A 2WB4A 3CEDA 1G4CA 3MMBA 4O8KA 1ZH5A 2LQBA 3N0VA 3CJKA 1NEEA 4OQJA 1B7FA 1QQNA 2BYCA 2C2NA 2H3EB 4BDYA 2HQFA 3SMSA 1XQSC 4P10A 2IMWP 2E7VA 1QVGM 1NKCA 2YNGB 3NEKA 2K1RB 3HHLB 1DZ5A 3F5TA 1AA1B 2N4CA 4BWJA 1LWEA 5KT5A 1C4CA 1C0MA 2CPEA 5ITHA 1VRUA 5LL6Z 4YOWA 1D09B 3L4QA 2AZ3A 2VKRA 4KRFA 4N76A 4OV1A 4JKDA 2E1MC 4ZPCA 3GLJA 3QO9A 3O9TA 3HI0A 1TGOA 3R1HA 3WIUA 1VYAA 5C42A 1HYSA 2CIMA 1A5WA 1FJCA 4RCHA 4NYNA 2GQCA 5AQTA 3V6DA 3LAMA 2WK4A 2M5YA 1KKHA 3S1TA 4Y00A 4DV4F 1U6ZA 5D4OA 2WSCC 4JI2K 4A2BA 1N5TA 4KB7A 4HTUA 2RHKA 3POTB 4GVBB 4WZMA 4IFVB 5LXRA 3WUHA 1OYEA 2RIJA 3D6MB 4HEA9 3TVZA 4YR3A 3MN6A 1QQMA 3M8ZA 3IM8A 3IO1A 2RQKA 1FJ7A 4PWUA 4E7JA 4USUA 1OH5A 1NBEB 3OYNA 4BRFA 1PC4A 2MQOA 4KI6A 4BC9A 4DU3A 2DNZA 2CYYA 2V4RA 3P38A 4FVMA 4EFAC 3IGVA 2UUCJ 3ZT4A 2YXLA 2YWWA 4O3OA 1FRKA 2NRWA 1NAQA 3O5TB 4CP5A 2E9RX 1N54B 1H7WA 4RUCA 1I5OB 2EW9A 2OGUA 2CJ9A 2F8HA 2D74B 1FFWB 3RR8A 2W2PP 3SBMA 4AM7A 3H2UB 2G2YA 1S79A 3PFEA 3VVUA 4H4OB 1URRA 2BH1A 4HHUA 4C0BA 1SIWB 1N5YA 1M1HA 1CPZA 2G13A 1WSGA 1HKBA 4HACA 3FLCO 1N56A 3R5DA 4CF9A 2OD4A 1W25A 4TU7A 3CCWA 1YK9A 3GFHA 1V3ZA 1SJFA 3D4JA 4MKAA 4TVAB 2YQ0A 4OPJA 1WC3A 2IBKA 1U2VB 3HI9A 2WONA 3CCVS 2NREA 5D8HB 4FLWA 2OTJS 4OYPA 4ZVHA 3IS9A 2DNHA 5L9XA 2UVWA 1NK9A 5HLFA 4DV7J 2HMIB 3AVCA 2F8SA 3CDWA 1UJ6A 1ACMB 5C25B 1U47A 1TP7A 2W41A 2E9ZA 4C1NI 3ETMA 2DY4A 3DCAA 3ZEUB 1GXUA 5FLXU 2HG4A 3QSIA 2GAHC 3THWA 3TUIC 2Z57B 3T1HJ 1RAHB 3ZSYA 1T03A 2Q6CA 3O08A 4DR1K 4BBYA 3ZX0A 1GOCA 1IQZA 1I3OB 1Q0NA 5TKWA 1Z2LA 4BC7A 2A10A 3VEWA 1M0SA 5LMUK 4DG1B 4LQ3A 4MJKA 4RNNA 5LSLA 5GAGP 1X5SA 3HHLA 4WPAA 1RT4B 1OJ4A 1QLNA 3PG9A 2WSEC 1RDWX 2XS7A 1NLKL 3DLBA 1UPPA 4ZVOB 4CO4A 2AYBA 3CJCA 1WN7A 3LDSA 4X62F 3BP8A 2KZMA 1HQEB 4AHUA 4A2AA 2XMJA 1JMTA 3PW4A 3DHXA 1TL3A 1QZ6A 3ZXWA 4DTOA 3TEHB 2QMXA 2NCKL 3M6WA 2ASDA 4BR2A 3I0SA 4AE5A 3HFVA 1RILA 5ADXH 3SQGA 1U45A 5D3GB 4QJVA 4CI6A 1R89A 1EHWA 1XC9A 3UD4P 3JSMB 2ROPA 2XGPA 2NRTA 2EPIA 4A8KA 4HUEA 1OSDA 3GILA 4PUOA 1WTFA 2H1YA 4NXNK 3AOCA 4B8CA 5E41A 3FR0A 4TNOA 2RJZA 1BL3A 1S6PB 2V67A 2VA2A 2DNQA 4G1IA 3DRRA 4KBIA 5IZHA 5BR8J 4FLVA 3RG6A 2HQDA 4A46A 1IN0A 4RWXA 1U26A 4OHWA 1YJ9N 2A6OA 3DM2A 3N01A 3UKUA 1EP4B 4K8RA 2HS3A 3RTVA 3HDSA 4N8OA 1NJIT 5BYQA 5C2CA 2B4UA 4FOIA 3LZIA 2XLKA 3QNWB 4E8UA 1U2FA 1YIJS 5AQFA 2ZBCA 2AQ4A 4OPKA 6FD1A 3R1XA 2KQ2A 4IRKA 5H1SV 2WHOA 3J7AP 3D7SB 3BKFA 4JI6J 2BM0A 4DQSA 5LJWA 5KG4A 3CXCR 4DX8H 2W7OA 4XH4A 1YF5L 2WW8A 4B3RK 3V4MA 1SUQB 4N8NA 3SCJE 4NXMJ 1RADB 2VWKA 2GMLA 3M1VB 4CYUA 3ONQA 3I56S 5FDLB 4NRTA 4FW1A 4FS1A 3EX7B 1RT7B 2C3UA 3QT8A 1HW8A 4MTPA 1AROP 2Q36A 1S4FA 4QOZB 3HP9A 2ZH7A 2QJ3A 2Y3YA 4KHRA 4DLGA 5AQWA 2RHSB 4ZIWA 3DLRA 1HR0K 5LXYA 2Y9HA 3QEWA 2WBMA 2QXLA 4FK2A 4FJGA 2XLIA 2DPJA 4P71A 4B1WB 3W60A 4M3WA 5ETNA 3RGIA 2PI4A 4K8ZA 1IKVA 1RTJB 2RMLA 4CLSA 2JEGA 1RNHA 2HWTA 4Q7AA 4E7KA 5J2NA 4H0TB 3EDRB 3HVWA 1K6YA 3G82A 3RW6A 4MH8A 1TAUA 1K0TA 2JFDA 1F1BB 1XUPO 1WEZA 1RT5B 5JS1A 1QDUB 4NYFA 1FKOB 1N6QA 2HBMA 5D0EA 2BE7D 4YB1P 4PG4A 5IFMA 3I9ZA 1OY9A 1XNQK 4PQUA 4NE9C 1JLBA 3I33A 4ZPBA 5CHCB 3W63A 2HBRB 2LKZA 2L3MA 2X1GA 4CJUA 4LT6A 4QOTA 4H0PA 4WTYA 4F04B 4WBFA 4QW9A 1U48A 3TQ1A 3MMVA 4FLZA 3ZSQA 2VG5A 3KKFA 4FF2A 2VF3A 1WDDA 5D0RA 1E4GT 4AH9A 1RDUA 3RW7A 2RT3A 4FZZA 4KR0B 4GO7X 3PO4A 3V9ZA 4QQBA 4O55A 3LPYA 3E3XA 3SAGA 2BE9B 4UUWA 3M8PB 1XK8A 3IBCB 5DGBA 4JI1F 4P2XA 2FJDB 5CABA 4HI2A 1ZETA 2ZZMA 3DLGB 5I42B 2FBYA 2DR5A 1VQ4N 3LQVA 4B3SK 5KFSA 4JV2A 2B9WA 2KFZA 1Q9XA 2FC0A 4CLZA 3EZ5A 3RBZA 3J7YP 4M5GA 3S8SA 1IKWA 1JKHB 4NYZA 2C1EB 2VCPA 3ICLA 3BKUA 2VOPA 4FWRA 1R27B 3PVXA 3KUHA 2EBEA 3CMEN 1TL7A 1KAXA 3FDSA 2BBEA 4JI4K 4E3SA 3CJKB 2R2UA 2CJAA 3QWPA 1QAJA 2G1HA 1Y4ZB 3QATA 5KFXA 1QZ5A 2KYXA 2XO7A 4MIBA 5CZVA 3NNCA 2LXUA 4CFAA 1CJUB 3TRGA 4KPCA 1RHMB 4FJXA 4JI3J 2XS5A 1JLFA 3ENOA 3D28A 3D6TB 3E66A 1V4SA 5EWEA 1VQ5S 2DRDA 2ADBA 1S1TB 3SMZA 5M1OA 4FWKA 4W5OA 1QSLA 3KHRA 1YRXA 4OKJA 4YORA 1JLQA 1UFLA 5J2PB 1T9XA 2MKHA 4WYLA 2MJNA 4O44A 1MWKA 2E4LA 2H5EA 1RAIB 3SSSA 2CQ1A 3MMJA 3W3SA 1U8WA 1FRMA 2G0CA 4F2RA 1HNXF 4DR6K 4HKQA 1Q18A 2ZHBA 3KLFA 1CBKA 2VJUA 2PMZD 3DOKB 3DRSB 1UKUA 2ZF5O 2UXCF 1VCTA 3BSCA 1TELA 1CG2A 1HLUA 3KIOA 1SH0A 4B3SF 2V8VA 3OXLA 4ECTA 1SKRA 1QHTA 4MDBA 2E29A 1OYDA 3P6YC 1S5JA 1LWFB 3H1VX 3MMAA 2IVFB 2M52A 4JKCA 2YKAA 4IJNA 2HHWA 2FXUA 2P1JA 4USMA 3RVCA 4AQYF 2DGQA 3EYZA 2HHHJ 4OLPA 4CRJA 4MYUA 4YY3K 4HTLA 3TA0A 2W2OP 4XEIA 3PXGa 3B6BA 3TVYA 2HHHK 4DL7A 2OEJA 4ILRA 1S9EB 1JLQB 4BY9C 5DDQC 3EVMA 4NEYA 1ZBFA 1RI7A 2DR8A 4B1UB 2QLFB 4NCAA 5AQRA