3LP1A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
total genus 154
structure length 554
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp1A05
3DOKB 2C2EA 4CHZA 4M3UA 4FJKA 1WLJA 2YNHB 3OHAA 3IG1B 4J9RA 3RAQA 1S48A 1DTQB 3NBPA 3OS2A 1XR6A 4DFMA 2KFZA 4WFZA 2C28A 4J9PA 4LY7A 2HW3A 5KG6A 1BI4A 4FW2A 3DOKA 1RNHA 1VSMA 3G10A 4CGGA 5L1IA 2HWIA 2KZZA 3IG1A 1QTMA 4O3OA 5KFXA 4JRPA 1DTQA 3V1RA 3MR3A 4WZMA 4U6PA 5F8GA 3LWMA 4DLEA 4NLSA 4DQSA 4M3TA 4ID5B 3PZPA 5F8HA 4OLBA 3OS1A 1QSSA 3UQSA 3NKYA 1ASWA 4ZMMA 2QK9A 1JIHA 3IGVA 2HAIA 4DSJA 3HO1A 5KG7A 3D5MA 4I7FB 4ZP8A 5FDLB 2BDPA 5KGXA 4CF0A 4HHTA 1HQEB 2FVPA 3LZJA 3BSNA 1KSPA 4CEZA 4YP3A 3ULDA 3V9WA 4F3OA 3CFRA 3NH0A 4K4YA 4DFKA 4KHSA 3AVIA 4E7KA 4OGCA 2HHTA 3DDKA 4ED6A 4CJ5A 4KTWA 3D0PA 1U04A 1TL3B 3NGZA 1HQEA 4TYAA 1D9FA 2ETJA 2YKMB 3C6UB 3U6FA 3B6PA 4CF1A 2OZSA 3SFUA 1JX4A 4EO8A 3OYHA 4AHCA 2ASLA 4N47A 4KHRA 4O3PA 4FJNA 1TL3A 3FQLA 1RBRA 1U09A 3HJFA 1VSIA 5CYMB 3C6UA 4L8RB 5KFMA 1EETB 1C2PA 2IS3A 1WSGA 4OKKA 1FKOA 3DRSB 4YNQA 4NLVA 4KHYA 3VQ5A 3SI6A 3FFIB 2YNGB 1NHUA 4PUOB 3BGRB 2R8HA 4HUEA 5C42A 2FVCA 2Z1GA 2W7PA 1N5YB 3H59A 2XI2A 3GILA 3M8PA 3OL6A 3AA5X 4CF2A 3O3GA 3SCXA 1NK9A 5J2PB 4ICLB 2V0NA 1EETA 3EY1A 2I1RA 3VQ4A 1XHXA 3FFIA 3GIKA 2YNGA 1ZBHA 3RAXA 2J6TA 3QEVA 4J9OA 3BGRA 4K4VA 1UAXA 5KRSA 1C0MA 4FJJA 4E1MA 3NAEA 1Q9XA 4KREA 4ICLA 3OYAA 5KFZA 4KAZA 3PHEA 3IGNA 1IKWB 2HHSA 2OPQA 3L2UA 4QWCA 4NYNA 3QNNA 5J1EB 4QWBA 3S3MA 4CHQA 1JLQB 5HBMB 4FJLA 1GX6A 3VA3A 4I2QB 3PR4A 3AA3A 3KHGA 4IRKA 4ECWA 3IRXA 2X74A 3T5JA 4YQWA 3L2WA 2W42A 1ZBIA 2RKIA 4DQRA 1RAJA 5J1EA 3AO1A 4CJVA 3SUOA 5KT3A 1ZBFA 4CJLA 2R7YA 4DF4A 3ZT0A 1L5UA 2E9ZA 4CIFA 3KK2B 1JLQA 5HBMA 1S1TB 4J2AA 3DLRA 1FKPA 4C8NA 5DMRA 4Z4GA 2BRLA 4DMNA 1QSLA 2BR0A 4CK3A 3QIOA 3WNHA 3NHGA 4NLWA 3V6HA 1XR7A 5DG8A 5KGWA 4EP4A 4ZP7A 1LW0B 3OYLA 3MR2A 5CZ2A 3KK2A 4F4WA 2OZMA 3KHRA 1TKDA 1LW2B 5KFTA 1NK4A 1IO2A 4FS1A 1SH2A 2UVUA 3LAKA 4EBEA 3KHLA 1NKEA 3QINA 3QGIA 4NLXA 1Z25A 4Q5VA 1LW0A 4FM2A 2WHOA 2YNIB 4RW6B 2D0AA 1VRTA 4MIBA 4Q43A 1Q9YA 3RR8A 1LW2A 4K8XA 4TY9A 3VQAA 4AHSA 4E3SA 1HPZB 3GV8B 3E01B 4ZVHA 4FZYA 1Z4UA 2E9TA 2IJNA 3CJ5A 1RBSA 1KLNA 2A1RA 5HRPA 3O3HA 4XPEA 1VSKA 3TARA 1B92A 1W9HA 3I0SB 3NFAA 3MR6A 3ICLA 2R8GA 5KFDA 3K5NA 4NCBA 4LH4A 4RW9B 3ZT2A 5CY4A 1HPZA 4KV8B 5CYQB 3E01A 1BCMA 2O4GA 4AHUA 5KG0A 4QOZB 1XI1A 3DLKB 4FLWA 4F2SA 2PYJA 4DSFA 4ZPBA 4B9SA 3HVTA 3F9KA 3I0SA 4KHQA 1QAJA 4K4TA 4KTZA 3OS0A 4IFYA 3QGGA 4AH9A 4RW9A 4I2PA 5I3UB 3KNAA 4KV8A 5CYQA 1LAWA 3MEEA 1C1BB 1RT4A 2WK4A 3L2QA 4FJ7A 2R8JA 3I5AA 3HM9A 2IDOA 3DLKA 4DTSA 4GMJB 4B9NA 4KB1A 4N5SA 5JUMA 3C94A 3NL0A 3AVHA 3AVFA 5KRTA 4RNOA 4OKJA 4M95A 2FJVA 1TL1B 4CGDA 4N56A 3RB0A 3P83D 2OPRB 3L3VA 3SUQA 4ELVA 1JKHB 2GIRA 3QEPA 3BSAA 1RDRA 3BJYA 4HYKA 3NAHA 2AQ4A 5J2MB 2D0CA 4O4RA 1TV6B 1UOCA 4DS4A 4FYDA 3QEWA 2V9WA 2WOMA 4E1NA 3MR5A 3SPYA 2QXFA 2E4LA 3MAQA 1TL1A 3K5LA 1S10A 2OPRA 4ECRA 2G8FA 2HB5A 3MXJA 3QIPB 2E6LA 4IRDA 5J2MA 4O44B 2F8TA 4CEOA 3RRHA 1S1VA 3LZIA 3L2RA 2FLLA 2FBTA 1TP7A 3HVRA 2R2RA 4URSA 2WRMA 1ZETA 1QS4A 2P1JA 1QAIA 3DYAA 5KFUA 4HUFA 4OLAA 3QIPA 1S1WA 2AX1A 1FK9A 4WFXA 5F8NA 5EWEA 3NF7A 3Q8RB 1RT3A 1VSFA 2PZSA 4NLUA 4DTMA 3OL8A 4CIGA 3WNEA 2FC0A 5EWFA 4ED3A 2BGGA 3UIQA 4NCGA 1YTAA 4GW6A 3PUFA 5KFHA 4K8ZA 1K1SA 3V9SA 1LWEA 4IKAA 4J9MA 1JXLA 4CJUA 2FLPA 4URGA 3KK1B 5I42B 5F9NA 4FK4A 2XY6A 4FW1A 4URQU 1JLCB 1JLBB 3JSMB 4Y34A 4CJWA 3KLGB 3NGIA 3RMDA 4EEYA 1SUQB 3G0ZA 4RNNA 2GUIA 2VA2A 2IC3B 2VG6B 3V81B 3AO5A 2WONB 5L1KA 3K5OA 4I9LA 3N6NA 2ALZA 3KD5E 4EP5A 1B9FA 1JLCA 4F2RA 3KLGA 3QZ7A 1RBVA 1S0OA 3TI0A 4TN2A 1WAJA 1SUQA 3LAMA 3MXIA 3AVAA 2VG6A 3V81A 2J6UA 4FJGA 2WONA 3SV3A 1RTHA 5KFAA 4DTXA 1LWCA 1NKCA 4MK7A 4WYWA 4W5RA 3RB4A 1YTUA 2X6SA 4AHVA 3RMCA 4W5TA 4NLGA 3V9XA 4IKFA 1TKXB 4O3NA 5HP1B 4IOBA 4ED8A 2IM3A 1X1PA 2HMIB 1NK0A 2F8SA 1O1WA 3NCIA 1TKZB 4IH6A 5KT4A 4K4WA 4KO0A 1BHLA 1BISA 1JLAB 2LSNA 4JUZA 4F4KA 3HYFA 3LPTA 4M94A 1TKXA 3NBPB 5HP1A 3OSNA 3SQ1A 5JS1A 3AVGA 3TAMB 3DRRB 2HMIA 5C5JA 4ED1A 5JXSA 1TKZA 2VWKA 4N76A 2IAJB 4QW9A 4O3SA 3RWUA 5L1LA 2D7SA 1JLAA 1S6PB 1RT6B 4M3WA 3TANA 1HNIA 4CECA 3OSPA 3ITHB 3UDLA 4CFDA 1RDCA 3TAEA 1A5VA 2AX0A 2VG5A 1OS5A 3TAMA 3DRRA 1T03B 1KVAA 3HPHA 4FM1A 4DFJA 2IAJA 4IH5A 3PJWA 3DLEB 4QPXA 2G8IA 3LWLA 4Y2CA 1S6PA 3V9ZA 1RT6A 3CWJA 4QW8A 5KFNA 4ED2A 3Q8SB 4DL3A 4C8LA 3NH1A 5KFCA 3ITHA 3H5XA 1SL2A 3SYZA 1CXUA 1NJZA 2GV9A 1T03A 1RBTA 3HSTB 3ZCMA 1RILA 1IG9A 3DLEA 3K2PA 3VQSA 4CEEA 4GC7A 5L9XA 1U45A 1JXBA 3VQ7A 4B08A 1RYRA 3LPUA 3KJVB 2QE5A 4PQUA 1SKWA 3CIZA 2YV0X 3GIIA 2HHQA 4RNFA 2IBKA 2C2DA 3EPIA 1YT3A 3FSIA 3KKSA 5DG9A 4KB0A 1S49A 5FRMA 2ILYA 5KG4A 3MEDB 3KD1E 3QYYA 4Z4IA 3WNFA 4JRQA 3KJVA 5T7BA 3LANA 3CDUA 2KW4A 2NUBA 1BIZA 4KHMA 4HCCA 3PW5A 1DTTA 1VSHA 2XY7A 4G1QB 4KI6A 3M9MB 2B5JB 4JLHA 4DTNA 2W9CB 1HNVA 3LALA 1TK5A 4BWMA 1KFSA 3MFIA 4CGHA 3MEDA 3PW0A 3VA0A 2G8KA 2HHUA 4QWDA 4IR1A 1T7PA 1T94A 4FLXA 1FKOB 3Q8PB 2O4IA 3PW4A 3K57A 3G86A 2XCPA 3CQ8A 4CFCA 2YKNA 4DU3A 3ZT1A 4J2EA 3RMBA 1RYSA 4C8KA 1IKYB 4G1QA 4EBDA 3QO9B 2FVSA 2B5JA 1W0HA 4CCHA 5C42B 2W9CA 4ID1A 3CM5A 4RNMA 2XHBA 2XI3A 3M8PB 3KTQA 3A2FA 4DQIA 1NJWA 4B9LA 4X2BA 3DRPA 2AU0A 3ZSWA 1QSYA 4TLRA 1ITGA 2Q3SA 2XO7A 1J53A 2AJQA 1SV5A 1IKYA 1D8YA 3QO9A 5DLGA 1TKTB 2PYLA 2QKBA 4JV1A 4EYHB 4NLRA 3AVCA 3OYKA 3TAQA 2DFEA 2CJQA 4WZQA 2Z1JA 4DL7A 2OPQB 1DLOB 2JC1A 2FLNA 1REVA 3VQBA 3NF8A 1TKTA 1C1CB 4B3OB 4M42A 5KFFA 2UUTA 3SUNA 2B6AB 3O4QA 4NRUA 4JV2A 1GX5A 3M9NB 4M3ZA 3AO2A 3SPZA 3IRXB 1UWBB 3RBDA 2ZD1B 1IH7A 2WTFA 4O5BA 2HNYB 3CFPA 4IDKB 2RKIB 3EZ5A 1DLOA 3ZT3A 4FLYA 4EBCA 1ZBUA 4LSLA 3T1AA 3L3UA 4RW4B 4CFAA 1C1CA 4B3OA 1JLEA 2B6AA 4Y1CA 4KKOA 3TAPA 4ED0A 1FKPB 4KB7A 4RUCA 4J9LA 3FRZA 1UWBA 2ZD1A 5KG3A 2HNYA 4IDKA 3VQ8A 3FDSA 5J2NA 4LD0A 1X9MA 2DFFA 3MF5A 4FJMA 3KLEA 4RW4A 3V6DB 2JEIA 2QV6A 5DG7A 1SH0A 1RA7A 4BE2A 2D3ZA 3DLBA 3NE6A 3O4NA 3MEGB 2G8UA 4ECVA 1RDBA 4CHNA 3PV8A 2ZKUA 3PVXA 1UA1A 3QGHA 4B9TA 3VQDA 1NK8A 4Y2AA 4C8OA 3ASMA 1HQUA 4TQRA 4IH7A 3H4DA 4F4YA 4FK0A 1U48A 5KFEA 3DMJB 4FBTA 1VK0A 3TVKA 4YFUA 1RT5B 1S0NA 3DM2B 1NOZA 5HRRA 4KAIA 3C95A 3V6DA 1L3VA 1VRTB 4RZRA 2EX3A 4CK1A 4DU1A 4NLPA 4DSLA 3MEGA 4CFBA 4ZP9A 4K4XA 3DI6B 3K58A 4PWDB 1SL1A 3SQ0A 3ISND 1D1UA 3EZUA 4RUAA 4K4SA 1K1QA 3PW2A 3EYZA 2R2TA 1KTQA 3DMJA 4KHWA 5C25A 3HK2A 3CJ2A 1RT5A 3DM2A 4KHUA 4CJQA 2KFNA 2FBVA 3ZSYA 5KFLA 5JS2A 2WB4A 3E51A 4CEDA 1J9AA 3DI6A 4ZPCA 4PWDA 3OJUA 4CJEA 1S5JA 3G6VA 3RRGA 4CJPA 4FJ5A 3VQQA 4OKEA 4H8KA 1NK6A 5EDWA 2XCAA 4IQXA 5EWGA 3HVTB 3VQPA 4FJXA 3VQEA 4IFYB 4NLYA 1ZTTA 3I5CA 4I2PB 2OPSA 3U3GA 3MEEB 1RT4B 4WFYA 4DEZA 3OYJA 5KG2A 4CEFA 2X6NA 3AVNA 1QQCA 3QEIA 1RTIB 3OLAA 2BANA 5KFPA 3OY9A 1WSEA 1UA0A 1SL0A 5HRNA 4QCLA 3SFGA 3BDPA 3GV5B 1LV5A 3BQ2A 3RR7A 2HNZA 3OVNA 3KIOA 4U7CA 2UUWA 2ILZA 3SI8A 3M8QA 4DFPA 1RTIA 5KFQA 2ATQA 4XIUA 3PW7A 1L3SA 2G8HA 3KLVA 2AGQA 4CJFA 1RT7A 4Q0BB 4J9SA 2WOMB 4MFBA 4KTQA 1RTDA 3CDEA 5SWMA 4FZZA 1D9DA 1K6YA 2IM0A 1X9WA 4F4ZA 4J9NA 5J2QB 3QNOA 3H98A 2FBYA 1KLMB 4UQGA 3LP2B 4Z4HA 3AA2A 4Q0BA 2FJXA 4CEQA 1S1VB 2Z1IA 1NK7A 2R2UA 1BQMA 4B9MA 4NLTA 3V1OA 4FJHA 4DG1A 3OJSA 1XC9A 5KFVA 3NGDA 3DYAB 3LDSA 3TAGA 3K5MA 5J2QA 1XHZA 2V4RA 1S1WB 1J5OB 1KLMA 3N6LA 1Z26A 3LP2A 3IAYA 1FK9B 4R0EA 4R8UA 3VQCA 1JLGB 3HHKA 4CERA 3PX4A 2P51A 1RT3B 1JL2A 2RDIA 5CZ1A 3PO4A 4F50A 3TQ1A 4OJRA 4NYFA 4NCGB 3MECA 1J5OA 1A5XA 4LH5A 1IKVA 4DTRA 2I5JA 1LWEB 5HRSA 1JLGA 4F3TA 1S9GB 2DPJA 1TK8A 1RDAA 3KMSA 4DSIA 3U3YA 5HLFA 1WNEA 2BQRA 4DF8A 2BQUA 1D0EA 1XR5A 3RMAA 4O3QA 3I8DA 1S9GA 4MIAA 2IMWP 2XGQA 4ZP6A 1QHTA 4FM0A 1N6QA 2E6MA 3TWHA 1S9FA 5EUHA 4IFVA 1CZ9A 3K59A 1BIUA 1RTHB 5KFBA 1T8EA 3ZSVA 3NMAA 3SQ2A 1LWCB 1NOYA 3NH2A 3CJ4A 3AVBA 1JLFA 1TAUA 4WYLA 1EX4A 4QAGA 1CXQA 5KFJA 3HKWA 3AVKA 1SKSA 4M3XA 3CVKA 3MFHA 3SZ2A 3S3NA 2DTUA 4KO0B 3BSCA 5T14A 3OLBA 4HTUA 3JYTB 1SKRA 2G8VA 4E7IA 2XC9A 2B4JA 2O5DA 4ZHRA 2FBXA 3V6KA 4CEBA 3AVMA 2BE2B 1NK5A 5KG1A 4BDZA 2Z1HA 2IM1A 3JYTA 3DLHA 1HNIB 1HMVB 2JGUA 4RW7B 4ELTA 1C0UB 2ZQBA 2VG5B 1NJXA 1TQLA 4DL2A 4M3RA 3H2LA 3OL7A 4PA1A 4CGFA 4XPCA 3RTVA 2BE2A 2YHBA 1QE1A 5HROB 4M41A 1U49A 4RW8B 4Z4CA 1J54A 1HMVA 4IG0B 4RW7A 1C0UA 4E89A 3MTKA 3V4IA 1BGXT 2FJWA 1VSEA 4DL5A 3RBEA 4NYZA 2Y1JA 4CHOA 2ASJA 4FLVA 2CKWA 5HROA 3GIJA 3CFOA 4Y1DA 4FJIA 1S1UA 2WCXA 2JEFA 1QUVA 2HNDA 2OPPB 4RW8A 5DGBA 3G6YA 3H5YA 4J2BA 1RT1B 3AV9A 4KI4A 4O0JA 3HL8A 2IOCA 4PQUB 5KT6A 3S3OA 4IG0A 2VA3A 1GOCA 4B9UA 5KFSA 4RG8A 4J2DA 1MU2B 3NDKA 1NJYA 2G8WA 2W9BB 1R0AA 1VSDA 2F8EX 3M8SA 3L2VA 3V1QA 3CM6A 2ITGA 4HUGA 4IBNA 3ZSOA 2V4QA 4K4ZA 2YNHA 3OHBA 2OPPA 1RT1A 4CGIA 4JS5A 3H4BA 2UVWA 3EPGA 3WNGA 5DK5A 2IGIA 1VSJA 4MK8A 4KHNA 4ZPAA 5KFIA 1KCFA 1MU2A 4KRFA 1DTTB 1S1XB 4NZ0A 2W9BA 3CDWA 1BL3A 4MKAA 4NLDA 3RB3A 1T05B 1HNVB 3KOAA 2AGOA 1TAQA 4H54A 1SH3A 2YKNB 5KFGA 2QKKA 1S1XA 4DQQA 2DY4A 3QLHB 4ID5A 5DLFA 1T05A 4Q8EA 4DL4A 4RNHA 1RDDA 4DQPA 3GQCA 1HYZA 3I5BA 1KVCA 5FROA 4HVJA 3OYCA 5EU7A 2B43A 3DRPB 1N56A 5KG5A 1WSIA 4I7FA 5C24B 3I0RB 2XY8A 1SV5B 5FDLA 2ZE2B 4CEAA 3GYNA 3QLHA 1EXQA 3QIDA 4W5NA 3NF6A 1ZTWA 2GBZA 2W7OA 4QWEA 3OYGA 1D5AA 4JV0A 4DTUA 3KLIB 5C24A 3I0RA 2GIQA 2JLEA 1REVB 1WAFA 2ZE2A 4ECTA 1ZBLA 2ATLA 3GV7B 4CGJA 4ECSA 1ASVA 4NLQA 1GOAA 1XWLA 2YKMA 4Z4EA 2XWYA 2KQ2A 4FS2A 1WSFA 2F96A 4ECZA 1A5WA 4K4UA 4O4GB 4FVMA 1W25A 2RF2B 4CJRA 3OYNA 3H5SA 5F8LA 3KLIA 4AHTA 1HYSB 4DLGA 3AVLA 2YNFB 4LSLB 5F9LA 2KTQA 2XY5A 1JLEB 2DFHA 4CJ3A 4ED7A 4CJ4A 4KKOB 4ECYA 2A1SA 3HPOA 5CYMA 1LWFB 3KLFB 5F8MA 3PO5A 2P5GA 2BRKA 4FJ8A 3DRSA 1N48A 4DTPA 5L1JA 4N41A 4Q44A 5E41A 4O4GA 2AWZA 4DL6A 3UR0A 2RF2A 2J6SA 5J2NB 1HYSA 4PUOA 1TVRB 4W5QA 2YNFA 3KLEB 4B8AB 4E19A 4FLUA 4E7LA 1KFDA 1N5YA 3P1GA 4Z0UA 2AGPA 1EP4B 4QWAA 2UVRA 2E9RX 4CF8A 5J2PA 4ECXA 1U4BA 2R8IA 2FVRA 1LWFA 3KLFA 2R8KA 2D5RA 4EO6A 4W5OA 3F73A 3OYIA 2FVQA 3O3FA 3G6XA 4O3RA 1HQUB 3P5JA 4XO0A 4NLOA 2RPIA 4DWIA 4I9QA 1TVRA 4ECQA 1RT2B 4DS5A 1RCHA 4CK2A 4IG3B 1EP4A 1WNSA 4M3YA 5KFWA 4YMEA 3QEXA 5KT7A 4WXOA 1IKWA 3HVWA 1JXEA 3T19A 1HYVA 3HPGA 5C25B 1RT2A 3OYEA 4TXSA 4AHRA 3CO9A 4BACA 3Q8QB 4I2QA 4IG3A 4MKBA 1KHVA 4ZVEA 4ELUA 3FQKA 4EZ6A 4TY8B 4KPYA 4BE0A 4BDPA 4E7JA 4NCAA 3ZSQA 2BQ3A 5KT5A 1IM4A 3PX6A 4Q45A 5KFOA 1RTJB 5KFKA 4Q8FA 2VWJA 1N4LA 1NHVA 1S1TA 5F8IA 3V6JA 1VSLA 5KT2A 2KZMA 4FXDA 2OPSB 4IRCA 1L3UA 4F4XA 3CJ0A 4EYIB 4TY8A 2X78A 2HHVA 1ASUA 3BREA 2RN2A 2OA8A 4DTJA 3TR8A 1HARA 1RTJA 1TGOA 4R5PB 1YVUA 3ZSRA 2BANB 3LP0B 1YVFA 2ASDA 2XRIA 4Y3CA 4OGEA 5SZTA 3SV4A 4TYBA 4JS4A 3BQ0A 3T5LA 2HNZB 3VQ9A 4MH8A 4CJTA 4BDYA 3M8QB 2YNIA 4R5PA 4RW6A 3BQ1A 3LP0A 4YR0A 1RT7B 3HP9A 3MXMA 4EZ9A 4DSKA 3S9HA 4MFBB 5KTQA 1Q8IA 1RTDB 1FXXA 3KKRA 3HVAA 1KHWA 2R2SA 4FBUA 4CF9A 1BQNB 5FRNA 4ZPDA 1G15A 2D41A 5DQHA 4KFBB 2JEJA 3SNNA 3OYBA 3OL9A 3SQ4A 1RBUA 4H4OB 2W8LA 3LP3A 3VN5A 3CG7A 2D3UA 4ZTFA 3DOLB 4GVMA 3OYDA 4B9VA 2HHWA 3D45A 5KFYA 2Y1IA 3ISNC 1IKXB 1BQMB 3L8BA 3QERA 4DG1B 1BQNA 5KI6A 2HVHA 3LP1B 4FCYA 1ZYQA 3QESA 4KFBA 3AO3A 3GIMA 4H4OA 3DLGB 1TK0A 3HXMA 3KK3B 2D0BA 4OVLA 4R8UB 3DOLA 2JC0A 2HHXA 4FJ9A 5I3UA 1IKXA 1C6VA 3QZ8A 3PJXA 2EHGA 1L3TA 4H4MB 4ZVFA 1C1BA 3N6MA 1CZBA 4ECUA 4CIEA 3LP1A 4DSEA 5F8JA 3T5KA 3UPFA 5D3GB 4OL8A 3DLGA 3MECB 4KE5A 5KFRA 1GOBA 3KK3A 4OPKA 1IKVB 4E7HA 3NAIA 2I5JB 4LQ3A 4TQSA 4WE1B 4YR2A 4IR9A 4CESA 1I6JA 4H4MA 4J9QA 2IJFA 3AA4A 1JKHA 3V9UA 5HLFB 5D3GA 4E0DA 3M8RA 3PX0A 2VG7B 4AILC 3PR5B 1C0TB 3IS9B 3H08A 1TV6A 1S9EB 5DQIA 2HWHA 2C2RA 1X9SA 4PY5A 3RB6A 3IN5A 4WE1A 4BWJA 3ZT4A 2EC0A 5DGAA 3AO4A 4KSEB 3OYMA 4DTOA 1N6QB 3HT3A 4NRTA 4HCBA 3OYFA 1KVBA 2P5OA 3T3FA 1S0MA 2VG7A 1C0TA 3IS9A 3M9OB 3SUPA 4O44A 4IFVB 5K14B 4B8CA 3KMQA 3CYMA 4CHPA 1Y97A 1S9EA 4KBIA 4MQ3A 1I3AA 4TSXA 3SJJA 1S97A 4FLTA 4CJSA 3BSOA 1JLFB 3NGYA 4OPJA 4DU4A 1I39A 2RDJA 2OH2A 5K14A 3H5UA 1JL1A 3H40A 1S4FA 3CJ3A 3ALYA 3KHHA 1MMLA 4ZVGA 1NNDA 1B9DA 4HKQA 2UVVA 4FLZA 4F8RA 4O0IA 2GC8A 4BE1A 2JEGA 1BCOA 2OYQA 1RA6A 4CHYA 1EKEA 4O55A 4ZHRB 2IA6A 4C8MA 3NF9A 2XGPA 1KRPA 1NKBA 4FZXC 1U47A 4J9KA 3B6OA 3TAFA 1WSHA 4YR3A 3KLHB 3KK1A 5I42A 1CLQA 1HRHA 5DQGA 3PY8A 1JLBA 3JSMA 2PY5A 3TABA 4CE9A 2YHAA 4MK9A 4GC6A 3C6TB 4LSNB 2IC3A 4CJKA 2C22A 1HJRA 1T3NA 3T5HA 1QE1B 4ZTJA 4RU9A 1WN7A 3KLHA 3THVA 3D28A 1VRUB 1F21A 4FK2A 2IM2A 2DPIA 3ZSXA 1CSJA 3C6TA 4LSNA 1S6QB 3QETA 3BR9A 3V4IB 4WXWA 3VQ6A 1C1AA 2W8KA 1WSJA 3AVJA 3HP6A 1S1UB 4M45A 2HNDB 1LAVA 1VRUA 4G3IA 4K50A 2W9AA 4LQ9A 1S6QA 2HVIA 1R0AB 1BI4B 4Z4FA 3ZSZA
chains in the Genus database with same CATH superfamily
3DOKB 3ADAC 3IM9A 2APOA 1WLJA 3K8VA 2YNHB 2LXFA 4M1KA 2Z8QA 3RAQA 1YIJS 3OS2A 1FD2A 1XR6A 3ZNUA 2RAQA 2OTJS 2HYIB 2C28A 1OQ3A 5KG6A 5M1NA 2A6OA 2XQCA 1RNHA 1VSMA 5L1IA 4DHVA 1X4FA 2E1AA 1QTMA 2VFVA 3P31A 5C0YA 4WZMA 4U7BA 2MQOA 2VPXB 1SPBP 4NLSA 3GPAA 3OVBA 5F8HA 4PWUA 5CZVA 4JD2B 1QSSA 4KBOA 1WSRA 4O8KA 2QWMA 1UP1A 4ZMMA 1JIHA 2AJFE 3Q7CA 1FWLA 3HZ6A 4X64J 1QTNB 4I6MA 5KG7A 4ZP8A 1R8PA 1UZHA 5FDLB 4C97A 4FNIA 2XZWA 1HQEB 2FVPA 1SJFA 2VODA 3BSNA 3HT0A 3F44A 4CEZA 4YP3A 4F3OA 5LSLA 1HD1A 3CFRA 2DGTA 3NH0A 3L4IA 4OGCA 3CPEA 4LUBA 4CJ5A 3G8TA 4MKYA 4CO3A 1U04A 4XH5A 4OV6A 1HLWA 1E6VB 4KH5A 2CJKA 3THTA 1ZBTA 4X62K 4CZJA 1KBRA 2PSZA 4KY3A 3B6PA 4BCAA 2E5GA 3K9JA 5F0XA 2DGOA 2BZ2A 1JX4A 4H0VB 3OYHA 1E4GT 4KHRA 4ISGA 2RS8A 4FJNA 3W63A 1X3NA 1UPPA 3DXBA 2ZDOA 5CYMB 3TNVA 3DDIA 2NUHA 4OKKA 1FKOA 4KHYA 3VQ5A 3R6MA 2QLBB 3FFIB 2WFBA 2GVDB 3VPZA 4PUOB 1DY3A 2R8HA 3LF0A 3D7SB 4GKJK 3H59A 2XI2A 3GILA 3FC9A 1NK9A 2OCEA 3H46O 2G13A 2YPYA 1U1PA 2I1RA 4LC9B 3VQ4A 1XHXA 4DR3K 2BBEA 2BA9A 2VFTA 3QWPA 2VFUA 2YNGA 2EFGA 2FQQB 3K7RA 3KG1A 1KC8T 2PE8A 5KRSA 1C0MA 3NAEA 1GAOA 3PTWA 3R1XA 1RUSA 2AW0A 2XMWA 4ICLA 1F1BB 3OYAA 5IWAK 4E8UA 3PHEA 1U1KA 3N79A 3IGNA 1IKWB 2VF3A 2DR6A 1NPPA 2MQPA 2F40A 1ZPVA 4C8YA 2AYEA 4Y00A 2DNMA 4JHDB 2BJDA 3IRXA 4F26A 2X74A 2ZNYA 3UVJB 2H9ZA 3L2WA 2WVFA 1RXOB 2PN6A 5J1EA 2QC3A 1ZBFA 2WBMA 1MMNA 4USKA 2CQBA 1ULRA 1AT1B 3IRWP 2QWRA 1JLQA 4CLSA 3SBGA 1S1TB 3CCVS 4NEYA 3M8YA 1VQ5S 5IOLA 4C8NA 1VBZA 1GEHA 1TFWA 5DMRA 3D68A 4JI5F 3RVCA 4Z4GA 2GMLA 1NB7A 2RE2A 4PG7A 3ATUA 5GIOA 1XR7A 8RUCA 3QB0A 1LW0B 4ERDA 3W5YA 3OYLA 2ZNZA 3D0IE 2NZCA 4OYPA 3AA9A 2V6AA 3HI9A 4ANCA 3VEOA 5KFTA 1NK4A 4CI6A 1G6BA 2N7CA 4DR2K 5EY4A 2R7SA 1F2HA 1XQSC 1CJVB 3OBYA 1U02A 3UN2A 4EBEA 4YY3F 1RAFB 4CM0A 3QGIA 4NLXA 3C15B 3R8EA 1Q86T 2NLXA 4UQTA 2DT9A 2OGUA 1VQ9S 1Z4UA 5FLXY 2O8EB 2ZUAA 2A1RA 3EJMA 2CADA 3K0SA 3I0SB 3MR6A 3HHLB 3ICLA 4WKRA 4FSVA 1N34K 2ZBIA 3ZT2A 3O9SA 3M6UA 4KV8B 1SC1B 2W6KA 2UYTA 1N5TA 5KG0A 1XI1A 4KQZA 3FEXB 3VV2B 1H74A 4ZPBA 3HVTA 3TWZA 1QAJA 4K4TA 2MXYA 3QGGA 4AH9A 3TOQA 4I2PA 5CYQA 1C1BB 1U2VB 4FJ7A 5F3ZA 3C19A 5SUHA 4DTSA 1R3NA 5GAGU 1DGKN 1E6YB 2ZJRL 2Q43A 2DR7A 3LTOA 3ID6A 1HWUA 2C1EB 5KRTA 2DHGA 2A10A 4GNIA 3AAPA 1TUYA 4N56A 1BD6A 4K59A 3L3VA 3IM8A 1ICEB 3QEPA 3UD4P 1FWPA 3BJYA 3NAHA 3DXMB 2D0CA 2P9PA 1UOCA 4FYDA 4KGXB 3QEWA 4E1NA 3TTFA 2NCKL 4B3RK 3CERA 1TL1A 4BRGA 3NCPA 2DTJA 2OPRA 4OHWA 3PJ9A 2G8FA 2Y0BB 1UZDA 3K0JA 5J2MA 5BXIA 1I1GA 3HVRA 5DM6L 3MM6B 2WRMA 3H3NO 3R6GB 1ZETA 1U1QA 5K8MA 3DYAA 2W01A 2MKIA 3P45B 4NXNK 5L9NA 1MWZA 2M8HA 1M90O 3E3XA 1ZAVA 4JV5J 4TU8A 3R97A 1RT3A 1J5EJ 2HKEA 4NLUA 4ILHA 3WNEA 2OEMA 2FC0A 5EWFA 3OTBA 3UIQA 5CXTA 5IC6B 4ILLA 2J9DA 2YX6A 1K1SA 3EUNA 1OSDA 4J9MA 4LBPA 1ELOA 4CZFA 2P9UB 2HQCA 4UOCA 4IDHA 1H72C 4KT0C 3FCVA 4URQU 1JLBB 2HBRB 4F3QA 3JQMA 3NGIA 5HL7L 2PO4A 2DKOB 2VG6B 4F0KA 2WONB 2F9WA 4ZN3A 3N6NA 2CVIA 4EHTA 3CJKB 1N52B 1NGFA 4EP5A 1HI0P 5BN9A 3DGPA 4F2RA 3QZ7A 1RBVA 2FXUA 1S0OA 1IG8A 3G8QA 3PRDA 4TN2A 1WAJA 4BS2A 2MZSA 5D78A 3MXIA 1VRQC 4NZ6A 3AVAA 2OSRA 3V81A 4FJGA 1AB8A 4DKWA 4UZCA 4C0OC 1LWCA 1NKCA 2BTFA 2CGLA 1HI8A 2BXJA 1YTUA 4DZ6A 4NLGA 4IOBA 5AZIB 3EL2A 2MLXA 2HMIB 2F8SA 3BO2A 1O1WA 4OLPA 4F25A 5MAOA 5B09A 2VGNA 4M63A 4DPXA 1BHLA 1NEEA 3VGVA 2D3OR 3FCHA 3TZZA 4JUZA 1F2GA 5M1FA 4F4KA 4JI0J 3HYFA 3LPTA 4GKJJ 1TKXA 1YDLA 4J8FA 3MN5A 3AD9C 4ED1A 3CMAN 1X31C 2B9EA 1M5VC 1NGGA 3CC4S 1NGBA 2OSQA 2IAJB 4O3SA 3RWUA 4HI1A 2D7SA 2F3JA 1JLAA 4PG5A 2LQ8A 3TO8A 4RTFD 1HNIA 4A62A 5DRKA 5KQDA 3N4QA 4WK3A 1KVAA 4JN4A 4FM1A 1HKCA 2VHGA 4JI1F 1Q82O 4IH5A 3PJWA 3DLEB 1T9TA 4ZLNA 4BRPA 1HBNB 3V9ZA 2ADBA 4DL3A 4QW8A 4CWBA 5KFNA 4DV0K 1XNRF 1H0HB 3NH1A 5KFCA 1WD6A 4GMKA 3GBTA 3M05A 4I6MB 4BQLA 3HSTB 1IG9A 2FZKB 5BR8J 2QA4G 3OUYB 1BQXA 1WDDA 2HQDA 2ZGZA 5L9XA 4DV2J 1K0VA 4OI4A 1HNWK 3HFZB 3LPUA 3KJVB 2QE5A 4PQUA 2C2DA 3L09A 3EPIA 4FYXB 3EE3A 1S49A 5FRMA 5KG4A 3QYYA 3M5RA 2H4YB 5LOQA 4JI4J 3LANA 1TL7A 2Q31A 5B0AA 4HCCA 1DTTA 5A6WA 4DR2J 1NDCA 2D9OA 5M1KA 4DTNA 1YRXA 3WHIA 2W9CB 5D0GA 1NNEA 3BEGB 5KPRA 3PFEA 5JLFA 3D6MB 1BU6O 2V2VA 4QJVA 3M3ZA 4CT9A 4WFAQ 2V9KA 1FKOB 3Q8PB 3VF6A 4JI3K 3K57A 1ACMB 1MWQA 2GJ2A 4YHHF 3TUZC 1KOHA 1SC3B 2FVSA 1VHXA 3ONQA 3BGLA 2XHBA 5MLCV 3A2FA 1NGAA 3H42A 2AU0A 4DHYA 1J53A 3GR1A 1SV5A 4U67Q 4DU8A 1IKYA 1D8YA 3QO9A 2F4VK 2PYLA 4IEIA 2ZZTA 1S72S 3W8PA 1RWWB 1YJWN 1VQ8N 2Q97A 2DFEA 3DFEA 1M1KT 2NYIA 4PXBA 2FHOB 4A2BA 3B82A 2VPYB 1VCTA 1GLAG 4B3OB 3UE2A 4ZLJA 2UUTA 4FWKA 3SUNA 2F9JA 4NRUA 3FZLA 4JV2A 3TU5A 4M3ZA 3F0NA 1IBCB 3IRXB 3SSRA 3RBDA 1IH7A 3CFPA 3CHWA 2HVDA 3ZT3A 2R7QA 4FLYA 4B3TF 1PG5B 2KFYA 3CDAA 3HRGA 1G7CB 2YWWA 1SQGA 3JXOA 4RW4B 4CFAA 5B0DA 4KKOA 3TAPA 4KB7A 3SQOP 1CPZA 3FRZA 2ZD1A 5KG3A 2EBEA 4LRCA 5J2NA 2NRXA 4H0YB 3VGSA 4M7XA 3AXMA 4FJMA 4UY8T 4CO1A 4B3MJ 1PC4A 5D77A 2CPFA 3DLBA 3HSCA 1VQYA 3NE6A 4I0WA 1CJTA 4ECVA 3PV8A 2HK3A 4CHNA 2ZKUA 2V8PA 3PVXA 3QGHA 3W66A 3H45C 4Y2AA 3ASMA 1QD1A 3FRYA 2C3YA 1U48A 3RYLA 3DM2B 4G6VB 4DV7K 4KAIA 3C95A 3SAHA 2DEIA 2ZVIA 2JWLA 2VZ9A 2G9OA 4DSLA 1DKGD 4CFBA 2ZDPA 1YJVA 4K4XA 4JI7K 3FMBA 3UNYA 1SL1A 3ISND 5CYJA 1D1UA 4K4SA 2MQMA 3EYZA 1HBOA 1RT5A 2HMPA 3OBWA 2FBVA 3ZSYA 5JS2A 2O8BA 3DI6A 1UW9A 3OJUA 2BKNA 4USTA 3TW0A 4AQYF 2UU9K 1FJGJ 1FXDA 5EWGA 3HVTB 1VR6A 1FWKA 4ZOSA 3VQEA 4OI0A 1X4CA 4NLYA 1ZTTA 5LJWA 3I5CA 4I6WA 4L76A 5D4OA 1W7WA 4I2PB 1S22A 2IJRA 2JLFA 2KM8B 4Q7AA 3VZIA 4JKAA 3VVTA 4OZ1A 5M2UA 2HWTA 5JVHQ 2DNQA 1V5IB 4A57A 4CLTA 1KONA 1ILYA 3GCXP 5D4PA 1NM1A 5HRNA 2X51A 5B0FA 2I7PA 1RDWX 1NMNA 3BZCA 1TUVA 1AXQA 3OVNA 1CBKA 2UUWA 2PIIA 3S1TA 4H4KC 4XIUA 1L3SA 1XMQJ 1BMQB 2BX6A 2AGQA 4CJFA 1RT7A 2GGPB 4J9SA 4PZVA 4KTQA 4HACB 3V4MA 2UUAF 1S79A 2JSXA 3LA0A 4F4ZA 4J9NA 5JVGL 2PFDA 4USMA 2YH1A 4TKTA 3TA0A 3LP2B 3ZETB 1V3ZA 4HHUA 4Z4HA 4CD3A 3AA2A 4Q0BA 3Q86A 2CQCA 5HMWA 2Q6BA 2PDAA 2GTDA 4CW7B 2E5LK 2R2UA 1BQMA 2JX2A 3PDNA 4B9MA 1DT9A 1YBUA 3TVZA 1XC9A 3QT8A 5E3AA 1F9HA 2RHKA 4PPZA 3DYAB 5B7WA 1JNRB 1YJ9N 3MCSA 1XNQF 1EO1A 3O8MA 1RWXB 3IAYA 1Q0NA 5AQMA 3KJQB 3T1YJ 1IM6A 4DXLA 4OLOA 3HHKA 4CERA 3PX4A 1FRXA 2P51A 4AL5A 1RT3B 3A13A 1JL2A 3FE1A 3VAKA 5GAGP 3MMAA 1VQKN 4NYFA 4LH5A 2ZH6A 4CDIA 3CJCA 3CXCM 5HRSA 4BC7A 1LQ9A 1JLGA 3NP5A 5GIPA 4K5RA 5ADXH 3ZTOA 1IBLJ 2FHJD 1HW8A 3VCDA 1ESVA 4DSIA 1URRA 4QYZK 3DN9A 1XTZA 5HLFA 2BQRA 5JLHA 2BQUA 1NXIA 2HRUA 3D1HA 2HZAA 2OI2A 4AM6A 3G82A 1WELA 3VMFB 2VWBA 1S9GA 4MIAA 2IMWP 3D66A 4FM0A 3LDQA 4DV6K 3DGPB 3L0QA 1OWXA 2V94A 2Z0GA 2KG0A 4IFVA 1NU0A 3LQVA 3NGRA 3B54A 4LR8A 4DUZF 3NMAA 3SQ2A 3CC7N 1LWCB 1NOYA 3OBIA 1URNA 3AVBA 1QVFM 4K42A 1JLFA 2MKSA 3OFEA 1SJ4P 4WYLA 1RKIA 1SQKA 1CXQA 5LMUK 2YX7A 3JS9A 1U1MA 3AVKA 4MYUA 2DIUA 1VMBA 2P2CB 2VQEJ 2ROPA 3TA1A 4BQZA 1EZZB 1W2BR 1Q1KA 3OLBA 1SKRA 3D7EO 4E7IA 3SEOA 2VBWA 3OFGA 3R5CA 3IDHA 2GX8A 3NEKA 2B4JA 4BRCA 3HI0A 5AXLA 2FBXA 1AZSA 2ZH7A 3AVMA 2HQIA 3W9HA 1JB0C 3C14A 1QHAA 2XTJP 4DQ8A 1F9FA 1HNIB 3VETA 3OW2M 3CD0A 4ELTA 1Q95G 4J9UE 4LVOP 3JTNA 1TQLA 4DL2A 1OMSA 3FZKA 5ETVA 2CQ3A 3RTVA 3BY5A 3IC1A 1WKKA 4ILMA 2E2NA 2DGQA 3ENHA 4IG0B 2K1RB 1C0UA 3THXA 2W1BA 4DV5F 1BGXT 1VSEA 1GMWA 2CKWA 5HROA 1LXJA 4OYMA 1Q8BA 1Z2LA 4JI6F 3GLJA 1A6LA 2JEFA 2O67A 4PAAA 3G6YA 1WOQA 4J2BA 4O0JA 4B3SJ 1X0PA 3GJQB 1RCOB 3HL8A 2IOCA 4PQUB 5KT6A 2RQ4A 3AY0A 3VEWA 5JVGQ 3DCAA 3F41A 4DR4F 3PLAA 1R0AA 1VSDA 2F8EX 3D2FA 3L2VA 3W1YC 3ZSOA 4K4ZA 3OHBA 1E3MA 3R5JB 4A8OA 1B64A 5ITHA 1K9MO 4PXDA 2HBYB 1ZPWX 2CPXA 2R42A 4JS5A 2UVWA 2GZOA 3EPGA 1N32K 1PC5A 4MK8A 3NNHA 2QT7A 4KHNA 2A2DA 1DTTB 3SMSA 2HBKA 4NZ0A 2W9BA 3JXUA 1IJJA 3MHYA 2B9WA 3AH6A 3QSYB 3RB3A 1VQ4N 4ZCIA 4NOHA 2ZWOA 3GG1A 3NLCA 1TAQA 4H54A 4DL0C 3CQXA 1W7AA 4CZHA 4X4PA 3GIRA 1IVZA 4LR7A 5KFGA 4DBQA 2QKKA 4OHZA 1R27B 4JI7J 3W2VA 2NPIA 1RCXB 4OYZA 4ID5A 5LSRA 1GLFO 4IO8A 3WEEA 3Q2TC 2DNKA 3ULEA 1B0TA 3C6AA 3I5BA 1KVCA 2RHQB 2UUCK 5KG5A 2FC9A 4I7FA 1UL3A 4Z37A 2P9SA 4JKHA 3NS5A 3DJCA 1SV5B 3PM9A 1OVYA 4DCHA 3QLHA 2MY7A 3NF6A 1WEYA 4DV3F 2E1RA 1U6BA 3OYGA 4RWWA 2LYVA 3H1QA 4CBUA 3RJMB 3J80U 3KLIB 5C24A 2CPIA 1RACB 4R25A 4HVZA 1NGHA 3MGJA 1B0VA 2IIRA 2LXUA 4NLQA 1GOAA 1XWLA 1ZZNA 5H9FK 1NWKA 5M2RA 2GCFA 4FS2A 1FRIA 4K4UA 3IXQA 3HSJA 1Y5NB 4DR1K 3CF5Q 4FL9A 1YK9A 4LF1A 2DFHA 2HSEB 4ED7A 4CJ4A 3N5BA 4KKOB 3MM5B 2A1SA 4F67A 3HPOA 1LWFB 2H51B 4M5KA 3PO5A 4N41A 3U9DA 2OFGX 1N54B 2GWKA 4DV4F 4WCEQ 3MD3A 2V7YA 3M4XA 3O1WA 3M6XA 3QAEA 3A8EA 5J2NB 4OX9K 5F0WA 4FLUA 4Z0UA 1EP4B 5HSPA 5J2PA 1U4BA 3KLFA 3C66A 4PKHA 4EO6A 5A8RA 4DWIA 4I9QA 4P10A 4ISFA 1CEZA 3KXDA 2XYHB 3WQTA 4V19S 3BZKA 3Q8YA 2V69A 1YJTA 2XLKA 5KT7A 3CCWA 1WB9A 4CZLA 2CJAA 5AE1A 2GUPA 1HBOB 1T11A 1RT2A 2YJFA 1HNXF 4I67A 4CZMA 4AHRA 2ZJPL 3QMQA 1WTFA 3HSDA 4IG3A 3CC2N 3PEJA 2ZOGA 1PYOB 3MM8A 4E7JA 4I6YA 4ZCMA 1WHXA 3ZSQA 2BQ3A 5KT5A 2Z2ZA 4OZ5A 5KFOA 1RTJB 3TPQA 5KFKA 4Q8FA 3PACA 2VWJA 4OHVA 4A8MP 1F5CA 3I9V9 2QYGA 3IFEA 4AF1A 1VSLA 5KT2A 1MWYA 3I87A 4DX7A 3M7VA 4IRCA 4WTYA 4EYIB 1N33J 3CIMA 1ASUA 1U2FA 1EQYA 3TR8A 4IZ9A 1HR0J 1TGOA 2OIHA 2JHEA 3ZSRA 4HDGA 4DCPB 3LP0B 2XRIA 4Y3CA 3LOUA 2I6WA 4M63C 1RBLA 3CEDA 3VENA 4UUWA 4U7UK 1CZAN 1FKAF 4CJTA 4R5PA 4RW6A 1U0HB 2CYYA 1RT7B 3MXMA 2WAQD 3S9HA 2V7ZA 2CQGA 5CCLA 1Q8IA 3VTHA 3U8XA 1FXXA 1RKJA 3HVAA 1BQNB 2NUUG 3CMAS 2R7VA 1G15A 4KFBB 3SNNA 3Q2SC 3OYBA 4PABA 5E3CA 1RBUA 2W8LA 3LP3A 1HLUA 3VN5A 1OY9A 4ZTFA 4B9VA 2UV8A 5KFYA 2QL5B 4CLPA 3BF1A 4WWSA 4WFNQ 1BQMB 1KQFB 1WF2A 2HFVA 4UOFA 2HVHA 2WSEC 1ZYQA 1XN9A 3HFVA 1NRKA 3FGUA 3J80O 1IWGA 3QFHA 4NYPA 1TK0A 1RAOA 3KK3B 4PXCA 2D0BA 4OVLA 5JMVA 3DOLA 4BVPA 3PJXA 2YY3A 4ZVFA 3MM7A 2DXDA 2CZVC 5CD4A 3MCAB 5F8JA 4M5GA 5D3GB 1TUWA 3MMAB 4OL8A 4W90B 2LP4A 2LVWA 4KR0B 3VGTA 1PIEA 1V3SA 3R3TA 5LM7E 3MDQA 1NLKL 1AYEA 3WXJA 2EKNA 1WSVA 5HLFB 4E0DA 2LXIA 1IBKK 4LF5K 2DGVA 8ATCB 3PR5B 3ZZPA 3H08A 4UY85 2N7YA 2HWHA 2C2RA 1X9SA 1OY8A 3RB6A 2F63A 4FVUA 2EC0A 2HLTA 4LF6F 5AQWA 3OXGA 1OQ6A 2ZH1A 4NRTA 4HCBA 3W0LA 2KHDA 1KVJA 2P5OA 5L8RC 3JAMY 1WC5A 4OX6A 1S0MA 4IFVB 1UWAA 3KMQA 2CQDA 4CHPA 4MQ3A 5LT5A 4G65A 3SJJA 3KWGA 3KDNA 4EK2A 1VBXA 2AJ1A 5CA5A 3VAGA 3QJPA 2KL8A 4CJSA 1DURA 3CCMN 1VQMN 1PAUB 2M0GB 1JLFB 2F8HA 4C9DA 4OPJA 1I39A 3PRVA 4USIA 4FPAA 4BR2A 2CJYB 1JL1A 4EMDA 4HT5A 4TU9A 2MKKA 1B9DA 4ZDNA 4IOCQ 2P9IB 1R59O 2WVDA 1BCOA 2OYQA 2YWHA 4CLKA 4CHYA 3MAAA 2IA6A 4I68A 3QRRA 1AZSB 1K0TA 1YJWS 4HHHA 1VQ8S 3B6OA 3C14B 5ETSA 3KLHB 1P1LA 2Q66A 2DD8S 2CJXB 5BYSA 2YHAA 1C4CA 4K0KK 4GC6A 3GFYA 2IC3A 1I5OB 1A0OB 4CJKA 4DUYK 3HLUA 1WC3A 1HD0A 3BBBA 3A5MC 3THVA 2VUGA 3ZTQA 3CJTA 4A46A 2DPIA 3KUGA 1CSJA 1S6QB 4OI6A 4J90A 2ZKTA 4LF9K 3N4WA 2W8KA 3GE9A 1IV0A 4O23A 3W65A 2HHHF 1C0FA 1QVGR 5BPNA 3BN7A 2A6MA 4K50A 1IR0A 3O08A 4ED4A 2OELA 2HVIA 2UXBK 1VIOA 1R0AB 1BI4B 2E1MC 1UCNA 4OPAA 4FJKA 3OHAA 1ZC6A 3IG1B 4JK7A 3E9OA 2IA0A 3LM2A 1DTQB 5KOXA 3NBPA 2DHSA 3O9RA 3HHLD 4JI2F 2CIMA 5IV4A 4DFMA 4JI5J 2RH3A 3ATVA 2HWIA 4JB8B 2KZZA 3EGZA 4QBUA 3EICA 3EKUA 1BO5O 3V1RA 1K73O 5ETTA 5I3PA 4M5JA 4Y2KA 3NVMA 2YQ1A 1N5SA 5HMZA 4LF2A 3LWMA 1VQPN 4DLEA 3W2VB 1ROFA 4DQSA 2F7TA 4ID5B 3BO3A 3PZPA 1WHYA 4YY3J 1NJIT 2B9XA 3OS1A 2QK9A 3IGVA 2HAIA 1NMEB 3LUYA 3G4SN 3HO1A 1QLNA 2HVZA 1YX2A 4I7FB 3LL3A 2BDPA 4CF0A 3LZJA 2XMAA 1CULA 3KJNB 4DU7A 3OTDA 3PKMA 1U8SA 4K4YA 4DFKA 2HAFA 3PSFA 3AVIA 4E7KA 3I32A 4JV5F 3R8YA 2HIQA 2QL9B 5ADZA 1J5EF 3DDKA 4ED6A 4BR0A 3H6EA 2RDDA 3QATA 1TL3B 2QJ3A 3U02A 5AQIA 3SMPA 1TYQA 2ETJA 2QIFA 3LGHA 3AY9A 1PYTA 4CF1A 3SDEA 4O3PA 2F8MA 1WEXA 3FQLA 1RBRA 1R6YA 2XMKA 3C6UA 4L8RB 4BG9A 1EETB 4YEAA 3K2YA 4YNQA 4NLVA 1KQKA 3W3SA 1IUJA 4GKKJ 5C42A 2FVCA 3CCJN 3M8PA 4X62F 4O8UA 3AA5X 4X65J 5J2PB 3ZX2A 1YVNA 2FJAB 5A0YA 2D1KA 2LFVA 4H0OA 4C2MA 4IO9L 3RAXA 5A8RB 2J6TA 1M5HA 4E98A 1U6ZA 3GSIA 3BGRA 3UKRA 1UAXA 1IR1A 4FJJA 4E1MA 4NEZA 2QM1A 4DCOB 5DDPC 2JFDA 4KREA 4KAZA 5F1XA 2J7UA 3O9UA 4B1YB 4QWCA 4NYNA 1KN6A 2KRBA 2KXHA 3HOTA 4JI0F 2ZH9A 2YKQA 4GKJF 3ZZTA 1WEZA 3KHGA 4DR3F 5LSOA 1WF1A 2W42A 1KQGB 3I4HX 3D6FB 3AO1A 4CJVA 5KT3A 4CJLA 3MZIA 2R7YA 2AZ1A 4DF4A 1L5UA 3ZT0A 4CIFA 3KK2B 1QVFR 5HBMA 1EKRA 4H5VA 3DLRA 3BBCA 4C98A 2PBDA 2F65A 5IWAF 3GZ7A 2EBGA 2GJFA 4DMNA 3M32A 2HFUA 4CBWA 1WI8A 2QMXA 3O1BA 2BR0A 4CK3A 4AD6A 3QIOA 3NHGA 3V6HA 2C2OB 5KGWA 4LSZB 3MR2A 5CZ2A 3RUBL 4OZ3A 4ER8A 3CC7S 2A40A 2OZMA 1O5JA 1TKDA 1IO2A 1JJ2M 1SH2A 1J27A 2UVUA 2W2PP 1X5SA 4LFAK 2KHOA 4LBIA 4FWOA 4OX7A 2AV5A 2MJNA 3KHLA 1NKEA 4Q5VA 3K8WA 4RW6B 2DJWA 1VRTA 3OW2R 2PEBA 3RR8A 3GYGA 1LW2A 2JWNA 2B8PA 3FEYB 3UR3C 2VOPA 5A8KB 1WOPA 2CXEA 4JAXA 3E01B 4FZYA 2UXDJ 5EN1A 1RBSA 2K3IA 4L3NA 1KLNA 2RUGA 4OYOA 3FVYA 3W8GA 4JK9A 4XPEA 3WDOA 3NFAA 3ULHA 3Q23A 2R8GA 2V67A 4RUBA 4LH4A 2FJEB 4DR2F 3BPDA 1HPZA 1QUPA 1BCMA 2O4GA 4WU2A 2A6AA 2KB2A 4AHUA 3SCLE 1FA0A 4QOZB 2MKHA 2G0JA 4FLWA 4DSFA 3CJ9A 1S59A 4B9SA 2HQ3A 4FPRA 3OFFA 3KYLA 3J7ZT 4CP5A 2ZH3A 4RW9A 4LIWA 4AXIA 3ENWA 3MEEA 1RT4A 4RBVA 2WK4A 4YB6A 2W4PA 1XMOJ 2R8JA 4KHPK 3HM9A 2N3LA 3DLKA 3CCSN 4ES2A 4KB1A 4B9NA 3OXLA 2EFNA 1LKZA 2QGFB 2N4CA 1N34F 3AVHA 2NS1B 3H2UB 4DPUA 3AVFA 4RNOA 1AFIA 2UUBK 4LF4K 3O5TB 1HBMA 3RSEB 3KUHA 3VEVA 3BYRA 1EQ0A 1UEUA 4UZBA 2JL9A 4R79A 1RDRA 4HYKA 2AQ4A 1XNRJ 4DS4A 2VH7A 2DVIA 2WOMA 1FTRA 3MPWA 3SPYA 4OZNA 3AOCA 1OY6A 5GINA 2QXFA 2HSTA 3ZZYA 2MMYA 3LDPA 4IO9Q 4ECRA 2HB5A 3P38A 2AEFA 5GAHI 2W2QP 3EVMA 1VQ4S 4NLBA 2F8TA 1VAZA 5AE2A 3LZIA 3ZEUB 2FLLA 4H5WA 1Y5LB 3IBWA 3AJ2A 5K8NA 1UETA 2P1JA 5KFUA 5AQRA 1R8BA 4FOIA 3QIPA 2HIYA 5T7LA 1Q53A 5F8NA 4B3RF 4I4BA 1K8AO 2QX0A 4DR5J 4DTMA 2FJDB 2H54B 4IEEA 1RWOB 4B3MF 4M8LA 2HRTA 2IVMA 2X3GA 4L75A 1X9JA 1YJNN 4OZLA 5AQUA 2CPHA 2F5GA 3SK3A 3V9SA 1LWEA 1JXLA 3CCTA 1M5OC 4KIAA 5F9NA 1WHVA 2DH7A 1J6ZA 4Y34A 4CJWA 4BGAA 5L46A 1Q78A 1RWUA 3JQJA 1HL6A 3G0ZA 2MGZA 2ZH8A 2IC3B 3WXMB 3AO5A 3N0VA 5DM7L 1D09B 2BE7D 2ALZA 3KD5E 4JOUA 3TUPA 4DJBA 2ASMA 4ES3A 1JLCA 2BOAA 1SJ1A 3KLGA 3SBTA 6FD1A 1SUQA 5IC4B 3LAMA 2PI4A 3UO0A 2J6UA 1SC6A 4B02A 4DTXA 4CNYA 4Y65A 4CZGA 4MK7A 4WYWA 1X8DA 3RB4A 4DR6J 2BUNA 1UAWA 2NNWA 3F2KA 4CLFA 4WP3A 5HP1B 4ED8A 5GAHU 1NK0A 4JI8J 3MN7A 2HBQB 2W7AA 5T41A 4IH6A 5KT4A 2C3UA 3QRQA 3ELHA 5E0OA 3A5NC 3QSIA 3KK7A 3M2RA 1KTVA 4B3TJ 3FZBA 2H65B 5IV3A 4JYAJ 2LDIA 3NBPB 3OSNA 5JS1A 3AVGA 4PHTX 2IRXA 5C5JA 2ATCB 2IPOB 4I6AA 1TKZA 4CJ7A 3AQPA 5L1LA 3GMGA 3E9PA 3O1LA 1RT6B 5KOWA 4CH0S 4WK1A 1X4BA 3IO1A 1T3VA 3VF4A 2OKQA 2CZ4A 2AX0A 3G25A 1OS5A 3TAMA 2QSFA 3DRRA 1XJWB 4MLEA 4J7CA 5LMNK 4JP8A 3CC2S 4KH4A 4P73A 2G8IA 3C46A 2AD9A 2QEXN 1S6PA 4DPOA 3A8YA 3CWJA 4ED2A 3Q8SB 4C8LA 1XC3A 3ITHA 2X1BA 1UVMA 2DNGA 1YZ6A 3SYZA 1AUSL 1JCEA 1T03A 3QQCD 3ZCMA 2CJBA 3PRBA 3ZZRA 2UXCJ 1KS2A 2VL1A 1OJ4A 4CEEA 4WF9Q 4GC7A 1CULB 4X66K 3PIPL 1U45A 3VQ7A 1RYRA 2A41A 3R5GA 4USUA 3CJBA 2X1FA 3FSIA 2O1PA 2GQQA 4HLBA 4KJIA 4AQYJ 1WBBA 2KT3A 5IZHA 3D2WA 3KD1E 4Z4IA 3UN3A 3U1MA 2KW4A 2NUBA 3SDEB 4KHMA 4PL8A 3JTPA 1IBLF 1VSHA 2XY7A 4G1QB 4KI6A 4UOGA 2L48A 1HNVA 3LALA 1TK5A 3DU6A 3J7AP 4CGHA 3MEDA 1HNWF 3M1VA 2JVOA 4FLXA 3G86A 2XCPA 4C3MA 2POKA 4CFCA 4J2EA 3RMBA 3CPWR 2A3JA 4C8KA 4DX5A 3JSYA 2B5JA 1W0HA 3O5BA 5C42B 4ID1A 2BKPA 1S3XA 2NR0A 2WVEA 2XI3A 3M8PB 1Q7YT 4DQIA 3R9LA 5JMNA 3DRPA 3CUNA 5FJ4A 3DOMA 2XO7A 3NVKA 3H20A 2W2NP 5HJYA 1OYEA 2DNLA 3TJAA 4EYHB 4NLRA 2MZQA 4USHA 1MNEA 4A8WA 3OYKA 2QMWA 3Q89A 2MB0B 3UDEA 3T69A 2R7XA 1KD1T 1RZMA 1REVA 1CS4B 3VQBA 5HI7A 3GG4A 1TKTA 3N5FA 4K7QA 2IYIA 1UPMB 2M88A 3JS6A 1GX5A 3M9NB 1XNQJ 3AO2A 2KKZA 3D2EA 3EDRB 1UWBB 2HNYB 4IDKB 4DR7K 3EZ5A 3C7NA 1DLOA 1YHQN 2AJ2A 4EBCA 1WWHA 3T1AA 2X3DA 1C1CA 4ISEA 1VS3A 2B6AA 3E66A 3VGUA 2XS5A 2GHVC 5G0RB 4RUCA 4H5RA 1H7WA 1NHKL 3VQ8A 1RGVA 2DHHA 1T9UA 2I9SA 1S5ZA 4MYTA 1FCAA 3MF5A 4A48A 1WG4A 2QV6A 4HT7A 3PG9A 1XEZA 3CCMS 1VQMS 1K8KB 3O4NA 3MEGB 1OPIA 2D3O1 2ASOA 3WIUA 2HS4A 1UA1A 1R31A 1NK8A 5L38A 2DYAA 1I94K 5ETRA 4YS2A 3H4DA 1VLYA 1N36J 1VK0A 2WTUA 1O0PA 4DI6A 2OTLN 1FRLA 1NOZA 4BRLA 5HRRA 3ZZ0A 1FO1A 3B6BA 3MWPA 3V6DA 1L3VA 5BPLA 1VRTB 4FKYA 2HFOA 4NLCA 2E5JA 3ZLJA 3TP2A 3H3OB 5C7PA 5F2RA 3K58A 3H8YA 3SQ0A 1EB0A 2DRAA 3DMJA 5C25A 3CCRN 3H25A 4KHUA 3UKUB 5LJ3Y 5FPEA 3O6WA 3PIPQ 3HM8A 1WUUA 2MZJA 3BZQA 3E51A 1VQLN 1GNKA 4CEDA 1J9AA 2G0IA 3T6JA 2KYZA 1VISA 4PWDA 4LFBJ 3DRXA 3RRGA 4CJPA 4OKEA 4DV7F 4KH0B 2LA6A 2XCAA 1U0SA 2GMHA 3VQPA 5K5MA 3HHNB 4FJXA 2BJ1A 2H1YA 4ILRA 5HJXA 5GAEI 4JI7F 1P90A 3MEEB 1WOSA 1BA1A 1RT4B 3OYJA 5KG2A 4X4VA 5D0EA 4PXEA 5KFPA 1CQMA 2DK2A 1SL0A 3E2EA 3SFGA 1A9NB 2MQQA 1HBMB 1Y00A 4BGBA 1LV5A 1VI7A 3BQ2A 3L95X 4G1IA 2UU9F 4U7CA 3N4PA 2ILZA 3NG8A 1RTIA 4ZVTB 5KFQA 2JLGA 3PW7A 2JZ5A 1B3TA 1GLEG 2DXEA 3M6VA 2WOMB 2XO6A 4DV5J 3GJRB 2BOPA 1VGYA 3QRPA 1HI1A 1D9DA 2BM1A 5AQGA 1X9WA 6AT1B 4FWLA 3VEYA 3MI7X 5J2QB 3OR1A 2NYHA 4HTLA 4HI2A 3QNOA 2FBYA 3MURP 1KLMB 3IFRA 2DO0A 2VPZB 4OZ0A 4CEQA 3P6YC 3MMBB 2Z1IA 1OH7A 4NLTA 4E2FB 4JNEA 3P49B 1SCJB 4BRDA 3NGDA 1VQPS 1U24A 4UT4A 3TAGA 3OTOK 2XSJA 3H7HB 1J5OB 3BYPA 1Z26A 2E7VA 4R0EA 2PFUA 3SAFA 3AB2B 2QMUB 2EEYA 3R7BB 1RAIB 2NRVA 5AQLA 1CLFA 3G4SS 2RE1A 2Q6CA 1QQNA 4L3QA 3GSDA 3QWUA 3BGUA 3PYEA 4F50A 2KXNB 3DGVA 1CC8A 4HH0A 1ZOTA 4DV1K 2GO8A 1IKVA 2I5JA 4P2FA 1LWEB 2E5LF 5GAEU 3W5XA 4F3TA 1V6HA 2WVCA 1T9WA 1TK8A 4JK8A 1RDAA 5GMKa 1MROA 1BC6A 5CD4H 4DPTA 5H9EK 2MGZB 1NZ8A 2Y1RI 5CR4A 2GNKA 3RZAA 2MQ8A 4HDHA 4GVBA 4O3QA 3BKFA 3TX8A 1RAEB 4BR9A 4RWTA 2XGQA 2IBOA 1QHTA 2HFZA 5AZJA 3TWHA 1HBUA 4DV3J 3VEZA 2Q79A 1ZM2A 5C15A 5EUHA 2I0XA 2XLJA 1ZM4A 2V4JA 1UJ5A 3WUHA 2OO4A 1TAUA 2BYCA 2NLWA 3GE1A 4CTAA 2HOEA 2ASYA 4M5LA 1EX4A 4QAGA 1F5BA 2QRRA 3CCJS 3TSUA 4FF4A 1N33F 2BUPA 3MPDA 2L9WA 4X4UA 5T14A 2EVZA 2MHNA 1D9AA 3JYTB 4DV6F 3MM9A 3E1YA 2XC9A 2AT1B 4PG4A 2EPIA 3ZFVA 4ILJA 4BRNA 3P4IA 2VJVA 1U25A 5KG1A 4BDZA 4DV4J 1FFWB 3R2CJ 4JI1K 3J7Z5 1U2CA 2Z1HA 2M4MA 2LU1A 5IT9Y 2OEKA 4A5AA 3W5ZA 5LMUF 5HQ8A 3PCOB 3IR6B 3ZX3A 3HCXA 4M3RA 3OL7A 4PA1A 2CWXA 1S6UA 2FYXA 2BE2A 2YHBA 1QE1A 1KQSM 1R43A 4M41A 1H73A 3US5A 3CB4A 1J54A 1FJCA 1HMVA 4RW7A 2AEMA 4E89A 3MXHP 3V4IA 3EMTA 2GVZA 2MQNA 3C16A 2Y1JA 5FPDA 1RHUB 3IWLA 2BJ9A 4Y1DA 1S1UA 1QUVA 4RW8A 5DGBA 4F7VA 1Q79A 2ACYA 1TU0B 1HNXJ 1GOCA 4RG8A 1KVKA 4CVNE 2P9EA 1NJYA 2GAHC 3V1QA 3CM6A 4YB1P 2ITGA 4AXJA 1RB0A 4HUGA 2YKPA 3MK6A 3SXLA 2DB1A 4K43A 2OPPA 3GCWP 2MY8A 4RJVA 1RT1A 2ZWPA 1YAGA 4C1NK 3R7NB 1FXLA 3DDNA 4H5NA 3WNGA 5AJ3K 5BJRA 2I7NA 1MU2A 1YBTA 4KRFA 1EWRA 4CH7A 2QL7B 3CDWA 4FPBA 1PILA 2W6LA 4NLDA 2ZITA 4M5HA 1HNVB 2LQ9A 3GFXA 1N8RO 4LIRA 1SKUB 4FF2A 3A12A 4MAKA 2AGOA 3D6HB 4B9QA 2IMOA 2MEWA 4QIWD 4OQJA 4RL1A 1S1XA 2C42A 5AQOA 1T05A 4Q8EA 4DL4A 3MX2A 4DQPA 3ENOA 4AL6A 4HVJA 5DETA 2GA7A 3T1HK 2B43A 4NL5A 1N32F 3DRPB 3QGPA 1WSIA 3NGSA 2EW9A 3DOMB 4C48A 3I0RB 4H0PA 2ZE2B 2BW2A 2VQFK 4FYVB 3PYFA 3QIDA 2D0PA 4W5NA 1LK7A 2LCWA 1VOMA 2XSFA 2P6SA 2GBZA 1IJFB 2DY9A 2FY1A 1O6XA 3CCSS 4KH6A 3CSKA 3EEQA 1R6VA 3TJ9A 3W61A 4P2MA 2BEFA 3MEKA 1REVB 4ECTA 2CDRB 2ATLA 4CGJA 3P3DA 4ECSA 3V5RA 2YKMA 5AE3A 4CZIA 4Z4EA 2L08A 2HS3A 1Y5IB 1Q7YO 2UUCF 1A5WA 2G4BA 2KO1A 2LA4A 2PMWA 3OYNA 3H5SA 5F8LA 1HYSB 4CIOA 3AVLA 1FD8A 2YNFB 5F9LA 4CYUB 2XY5A 1NLVA 4CJ3A 2AZ3A 2AJ4A 4X84A 3D4JA 4ECYA 3SMZA 3HZGA 2PEHA 4D3GA 5F8MA 4M5NA 4FJ8A 1KAYA 4LF7K 5L1JA 3LPEA 4O4GA 2AWZA 1FFGB 3UR0A 2RF2A 1CVJA 1EAYC 1IXKA 2LQBA 4ZVSB 1TVRB 4P7VA 4B8AB 1HHTP 3OA9A 4E7LA 1N5YA 4FWQA 2FZCB 2AKWB 1CJKA 1N5QA 2XMMA 3MMVA 3OYIA 4XO0A 4NLOA 2K8GA 2RPIA 4ECQA 4LF6J 3FGVA 5JICA 3BB5A 1K47A 1RCHA 1RADB 4BRFA 2X1GA 2KJVA 1SVDA 2UV8G 3FCWA 3RG6A 1YJNS 1QZ5A 4OX9F 3HVWA 4IUFA 2F7VA 3P39A 3R6LB 4OFZA 3HPGA 3OR2B 5C25B 2DEJA 4CNZA 4NXMK 3Q8QB 2Y1LB 3ILJA 2PMHA 3AD7C 4MKBA 1J2VA 4DV1J 3CDBA 1GMWD 4GVLA 3C6HA 4BE0A 4BDPA 3M30B 2V63A 1WG5A 4Q45A 2K06A 3QT7A 3GYXB 5I4MA 2HBZB 1NHVA 1JQGA 3UDCA 2WC9A 1YKWA 3A3OB 3GFZA 3TX0A 4F04B 2KZMA 3MPUB 3CJ0A 4TY8A 4OIXA 5HQLA 3X3UA 1HA1A 2RN2A 4P52A 1WOOA 1FXRA 4L74A 5E2QA 1YVUA 2OAUA 4EFHA 1MLAA 2CQIA 2DR9A 5SZTA 3HOSA 3SV4A 3D67A 4JS4A 2LKZA 1YI2N 2UUAK 3M2VB 2VBZA 4P72A 4BDYA 2YNIA 4QR2A 4K41A 4YR0A 3HP9A 4DSKA 2LEBA 3C0BA 5B0BA 3KKRA 3I4PA 1KHWA 4NMXA 3MWTA 2ABYA 3D3CJ 4ZPDA 3I33A 2IVOA 3OL9A 3VF0B 5HMXA 2HHHJ 2A1BA 3WC0A 4X4QA 2D3UA 2RU3A 3D45A 1U8WA 3OVSA 3D0HE 2Y1IA 3QERA 3D1OA 2YKOA 3ZTSA 3TUIC 4IJAA 5KI6A 3LP1B 2A18A 4FCYA 4KH1B 2B4OA 3NWGA 1LWXA 3AO3A 2DH8A 1T95A 4H4OA 2V8HA 1QZ6A 2QEXS 1TL5A 1S0VA 3O6QA 4JI2J 1PBUA 2P9NB 4FJ9A 2Y3YA 1IKXA 1C6VA 4GKKF 4H4MB 4A4JA 4G9ZA 3N6MA 1CZBA 4CIEA 1DHMA 1N0VC 4X65F 2W24A 1U7LA 3TEHB 2R3VA 4ILGB 2VONA 3DLGA 5KFRA 4LRAA 1IKVB 5IT9U 4E7HA 2I5JB 2XG8A 1DARA 2H4WB 4BBYA 4WE1B 4YR2A 2Z4PA 1TL4A 3CJQA 4CESA 1I6JA 2XYPB 2HHPA 1ZA2B 1JKHA 3V9UA 1MROB 3M8RA 2D74B 3PX0A 2VG7B 1F0XA 3GR0A 3IS9B 1S4EA 5E84A 1S9EB 3VGKA 5EX5A 1KAXA 4PY5A 4GVBB 3LO3A 3ET6A 3MUTP 4DUZK 1Q16B 5E3PA 2L3MA 5DGAA 2NSCA 5AQNA 4XH4A 3THWB 1Q81O 3HT3A 3EZOA 1HWKA 4M5IA 4B17A 1KVBA 1HBUB 3SCKE 4LFCK 1C0TA 2ZF5O 5K14B 3CYMA 2XM3A 1I3AA 1WC0A 4P71A 1OSCA 2KVIA 1WHWA 2GQ2A 3WBZA 4FLTA 5M1PA 1N0UA 4WFAL 3GJSB 2E88A 3NGYA 1IBKF 4EI2A 4LF5F 2PA8D 2RDJA 3NGTA 3W9IA 3HZEA 2OH2A 5KPZA 3UN5A 3H40A 1PKUA 3TUJC 3ALYA 2LLZA 3KHHA 2J0QD 1VQ6N 4MJKA 4ZVGA 4J5OA 4FLZA 4O0IA 5CE3A 2I38A 2WUSA 3L4BC 3NWRA 1TFYA 1EKEA 1UFKA 2RHSB 3AHPA 1UVKA 4C8MA 3NF9A 4U67L 2XGPA 1KRPA 2QWOA 1NKBA 4PR6A 5AQKA 4J9KA 3KK1A 5I42A 1CLQA 3PY8A 2LDYA 2PY5A 3F56A 3C6TB 4LSNB 4X62J 2JH3A 2DR5A 4WIQA 2UXDF 2Q1NA 1QE1B 3WXLA 5DJBA 5H1SQ 4MMOA 4L72B 1B99A 3A4TA 2ZWHA 3CCZA 1H7XA 1SJ3P 2VB6A 4IJNA 1YHQS 1P6TA 3OTEA 4F9OA 3THYA 3BR9A 3V4IB 2GVZB 3MN9A 4DR4K 3J7YI 3VQ6A 3HP6A 3AVJA 2V8GA 1S1UB 3SLCA 4C3LA 1LAVA 1VRUA 4ZCKA 4K0KF 4G3IA 3I31A 4NMLA 4LQ9A 1R8CA 1OKJA 3SSSA 4TU7A 4DUYF 4OYBA 1UVJA 4DR3J 1XMOF 2ASPA 2NXNA 3ETMA 2C2EA 2FB0A 5H1SV 1RU1A 4CBXA 2MKJA 2Q1LA 4ZJQA 2LQJA 1S48A 4Z94A 5HO4A 2QN6B 2OTLS 1WC1A 4YB7A 4WFZA 4FXVA 4ZJLA 4HH1A 5IWAJ 4J9PA 4LF9F 3LM9A 5A8WA 4FW2A 4K2JA 3DOKA 3M2UA 3B8AX 4IWVA 4O3OA 3EDQB 2LU2A 4OJGA 2C2KB 4NA2A 4GVEA 4JRPA 1RBOB 3CCRS 2IY5B 3KFWX 2UXBF 2PGCA 5F8GA 4XH1A 3UE5A 4M3TA 1VQLS 5IT9O 3C2PA 1JJ4A 2FY8A 3QICA 3CIPA 3NKYA 1HNZK 3THPA 4A61A 3N28A 2DNNA 2FUG9 2QA2A 3D5MA 4LMZA 5HVGA 5KGXA 4HHTA 1SC4B 3CT9A 3R2DJ 3Q83A 4LJMA 1IR2A 1FDBA 4JD2A 5BN8A 3AAQA 2ZOFA 2HHTA 2J7KA 4DR5F 5JVHL 4KTWA 3J7YU 2JRSA 3D0PA 3SCJE 4PYAA 2KI2A 3NGZA 1HQEA 5L39A 4QS9A 4KGZB 4TYAA 2YKMB 3SCIE 2V2ZA 2OLWA 2AJ0A 4ZVPB 4ID8A 2KYXA 2Z57B 4EO8A 1HKAA 5DDOC 4AHCA 4N47A 2ASLA 4CD1A 4E1JA 1NUEA 3VZHA 3O8WA 2QWNA 1U09A 3I55N 5HATA 3FSYA 4IYQA 2XHCA 1WORA 1E6VA 2CGKA 5KFMA 1P8GA 1C2PA 1FRHA 5BREA 3LDOA 3B78A 1N34J 4U9RA 2GX9A 2YNGB 1FE4A 1APSA 2R7OA 2VBYA 1FEEA 2BJEA 2KLAA 4HUEA 4A8QA 3F5TA 1Y4ZB 1UEKA 5FLXU 1N5YB 3PIOQ 3OL6A 3O3GA 4ICLB 3BH7B 1CJKB 5ETNA 3O44A 1BHNA 3FFIA 1VJWA 2Y9HA 1ZBHA 1H2VZ 4O0NA 4DR6F 3QEVA 5C12A 3G71N 4S0MA 3B4DA 3FLCO 3GU0A 2RD5C 4JI8F 3GFHA 5LL6Z 1U2RA 1AUDA 5K8PA 2MJUA 1S6OA 2HHSA 2OPQA 2C2ZB 4L73A 3QNNA 4PG8A 5J1EB 4QWBA 1BDGA 2QYCA 4JYAF 2CA9A 4CHQA 2NRWA 2GFFA 1JLQB 4FJLA 1KC8O 1GX6A 3VA3A 4BRAA 2ZBRA 2F9DA 2ZVSA 1RK8A 1GLJO 2C3MA 3N9UC 3AD8C 4YN3B 3WT0A 2GHWA 3VQTA 4KRWA 1ZBIA 2CVEA 4DQRA 4B3RJ 2M8DB 4AE5A 2XMJA 1NAQA 3WX8A 4J2AA 2ACMA 1FKPA 4X64K 3DNCA 2ZJQL 3IUCA 4JHDA 5C2DA 1YG0A 2W40A 1Y3JA 1QSLA 1DJ0A 3KZBA 1WTBA 1FNOA 3UVJA 4NLWA 1BE4A 4EP4A 2NRTA 5AQQA 4FPIA 5FD1A 4NXNJ 9RUBA 5DO2A 2CPEA 5D8HB 4FS1A 2BVZA 5AQVA 4ZLPA 2UXCF 3BS9A 2HBLA 1T3OA 5C2GA 1CQNA 1LW0A 2YNIB 2DISA 3BGOP 4Q43A 1Q9YA 4K8XA 3VQAA 4AHSA 3DU5A 4H0TB 4JKFA 4ZVHA 4YB5A 2IJNA 2FHMA 1NMDA 5D15A 3TARA 3C15A 2IFXA 4NCBA 3K5NA 4YDDB 1Q86O 4LFAF 5CYQB 4I1TA 1Y7PA 2BV3A 4PCQA 1RAHB 4CH1A 4M5DA 3ILOA 2QA1A 4F2SA 5EX0A 2LEPA 4ZITA 2VICA 3F9KA 3I56N 3I0SA 1VQNN 1PO6A 4UUXA 4KHQA 2GAGC 3HHLA 4KTZA 4IFYA 3L4QA 3J81Y 1P9QC 4EGLA 2NPFA 3KNAA 4KV8A 1LAWA 1X5OA 5HOOA 3HX9A 2OUGA 2KXFA 3W60A 2IDOA 4GMJB 4N5SA 1QJHA 3MDFA 5JUMA 2P9PB 3W64A 1REGX 4C8ZA 1G3OA 4M95A 3QFPA 1Y0HA 4XDDA 3TYTA 1MSWD 2VC1A 2FJVA 2DNOA 1TL1B 4CGDA 2OPRB 1JKHB 3BSAA 3KJFB 2V2QA 5J2MB 4O4RA 4Z2XA 1EIYB 2AP6A 5DZ6A 3MR5A 4OI2A 5FLXO 2VKRA 1FDNA 2CNOB 7AT1B 1PGZA 2PD1A 4KHPF 4QIVA 4IOAL 2XHWA 1T9VA 1W2IA 3DXSX 3MXJA 1NO8A 2E6LA 4IRDA 1M90T 3DXMA 2UUBF 3CNQP 4P74A 3HTVA 3RRHA 1S1VA 4FWRA 2FBTA 1TP7A 2RQKA 2R2RA 3FEZA 2ROGA 1BY9A 2K3KA 1QS4A 3GONA 1QAIA 4DPYA 4BLGA 2Y8WA 1U26A 4Y2MA 4DV0J 4OLAA 1FK9A 3ZTRA 1KDNA 1DFDA 2NXUA 2J4RA 4OJ3A 4XAKA 1RP5A 5EWEA 2FZGB 3NF7A 2KG1A 1X4AA 1FRMA 3NOCA 2PZSA 2NXEA 3MM6A 3OL8A 2B4PA 2IVPA 4ED3A 2BGGA 2U2FA 5C2CA 3CD6N 3UB5A 1HNWJ 3WC2A 4NCGA 1YTAA 4GW6A 3PUFA 3IMXA 4K8ZA 3KVGA 4P9SA 3SBMA 1N36F 2ZJQQ 1RWKB 3VAHA 2FLPA 4C0HA 3KK1B 5I42B 1HWIA 2XY6A 5DZ7A 1TR0A 4NWBA 2YKAA 3UW1A 4D3HA 4KGKA 1JJCB 3RMDA 3JQKA 2GUIA 4BRKA 3V81B 5L1KA 3J8AA 4IFEA 3K5OA 4X4SA 4I9LA 2QTWA 4Y2IA 2WSCC 3EKSA 1ZAXA 3HFKA 4QPTA 1KR4A 3G2XA 2N82B 2P9UA 3ILIA 2DGWA 2RMLA 1D8ZA 4B1XB 3TI0A 3CMQA 1RHQB 3CF5L 2VG6A 2MDAA 2WONA 4LFBF 4JI3J 3SV3A 5KFAA 3G6EN 4WPAA 4U8YA 1L3KA 1X4EA 4W5RA 1FX2A 1QQOA 2BJ7A 4AHVA 3M1FA 3Q22A 4IKFA 1TKXB 2K7KA 4O3NA 3ENBA 2IM3A 3I82A 1X1PA 4WCEL 1U1OA 4BR4A 1NBWA 1YJUA 2BABA 5AR0A 1JLAB 3G8SA 4R0JA 3CCEN 2D0OA 2Y8YA 2F4VJ 3ZYYX 4M94A 3SQ1A 5AZIA 1FEHA 1GT8A 1MN9A 2HMIA 1RBAA 2DPNA 5JXSA 1Q82T 5FPMA 4NA1A 3BF3A 3QT5A 3TTCA 4QW9A 2XULA 1BWVA 3M2UB 2E1YA 4TLQA 3TANA 4CECA 4ZPTR 3QJJA 4H4KA 4CFDA 1RDCA 3HD2A 3TAEA 1A5VA 1R8HA 2VASA 4ETXA 1V4TA 4DFJA 2IAJA 2JDJA 4QPXA 2DITA 3AOBA 1HKBA 2CUYA 1KOOA 2HF3A 4OPHA 4JV5K 2MZ1A 2GV9A 1RBTA 3NCQA 1J5EK 4HEA9 1O8BA 3DLEA 2J7WA 2RJZA 2UP1A 2ZBPA 3VQSA 4EWTA 1HBNA 1Z6RA 3BEXA 4IOAQ 1YSJA 2QWQA 2HGNA 1SKWA 1TL7B 3H0PA 2DGXA 4MO5A 3CTRA 4EIAA 5EX3A 2XMUA 5LMNF 4RNFA 3QNWB 4DUTA 1YT3A 2YI1A 5E26A 3R5BA 3KKSA 2G2OA 3OUYA 5HMYA 1RJJA 2LMIA 2J0XA 4DV7J 1YI2S 3WNFA 3KJVA 5T7BA 1OYDA 2PC6A 3CJSA 2SXLA 1TTHB 1EJ7L 4P2XA 5EOYA 4BWMA 4X66F 3JB9k 2G8KA 3PW0A 4QWDA 3IAM9 1OH6A 2DRBA 2HF4A 2DBBA 3PW4A 2UZAA 4B1ZA 1UEVA 2YKNA 1GLDG 1IKYB 4EBDA 3QO9B 3NNCA 2W9CA 3CM5A 3BH6B 4OHYA 2UU9J 4DB3A 1RHJB 3DHWC 1NJWA 4WFNL 4V19X 3JSBA 5CQGA 1ZAWA 1QSYA 3ZSWA 5ELZA 3LW5C 1ITGA 3CCUS 2VC0A 3K17A 2AJQA 4WYBA 5DLGA 4JI0K 5KPTA 3AVCA 3A3NB 4USJC 3VWSA 2YH0A 4A2AA 2BW7A 2ZZMA 2O8DA 2CJQA 2V52B 4I56A 2KHCA 3J7YP 5BRHA 2OPQB 5A76A 4OHXA 1IJEB 3U1NA 5D0HA 2FLNA 4H03B 4DX6A 3KG4A 5KFFA 2YHWA 3O4QA 1XK8A 4PG6A 1IBMK 1B7YB 4GV9A 4WQ5A 3GDQA 3ETOA 5CZXA 2OD6A 2RU9A 3SPZA 2C3PA 2I8EA 1R8AA 2ZD1B 2ZHOA 3NXZA 2WTFA 4O5BA 1M1KO 1W2BM 1G1XA 3J81U 4BRIA 1YXQA 4LSLA 1P27B 4HTJA 2QI2A 4B3OA 3IKMA 1QM9A 2GO9A 1FKPB 1V3RA 1CJTB 1MA9B 4J9LA 6FDRA 4CLUA 1U1RA 2CQHA 3O2IA 3EVWA 1GQEA 5BR8K 1EKSA 2H5IB 3FDSA 4C7QA 2E5LJ 3A1YG 3NRBA 4LD0A 3CMEN 1BWFO 4DV2K 1X9MA 2DFFA 3KLEA 5GAGI 4RW4A 2QLXA 3W7BA 5DG7A 1SH0A 1V5VA 2G8UA 4P6QA 5AQJA 1RWVB 4WP9A 3VQDA 3HF5A 4DR7F 1HQUA 4IH7A 4USWA 2QWLA 2KU7A 2ZZNA 1SI9A 4FBTA 3TVKA 2XS7A 2HZCA 1RT5B 1S0NA 3GB0A 1VQ6S 2YTCA 1NGCA 4JI4K 3FZFA 4UY8O 2EX3A 3L7UA 4DU1A 5DS7A 2O3DA 1EX8A 4ZP9A 3WZ0A 2O8BB 3MUMP 3DI6B 4IOCL 1HWLA 1K1QA 2EK6A 4Q2LA 2ZHAA 2PAVA 1KTQA 4ZVRB 2VGMA 1FJEB 3HK2A 3DM2A 4QYZJ 2NREA 2MHEA 4ZIWA 5KFLA 3VALA 2VV5A 1M5KC 1I94F 2WBRA 4MDAA 3NGKA 4LR9A 1B0PA 4M5DB 5B0CA 3VQQA 4A5BA 5A2QY 1NK6A 1WI6A 5EDWA 4DV6J 4IQXA 2MKCA 4IFYB 2MQLA 3PHTA 3E9LA 4Y0WA 3U3GA 2CPYA 1QY7A 4DEZA 4FYYB 1M1GA 1PJ7A 4CEFA 4P2SA 3OY9A 4PPDA 5LMUJ 1UA0A 4X4OA 4LVNP 2E1CA 3HSGA 4GV3A 1ZM3A 1T6DA 3MCOA 4FO0A 3SI8A 4DFPA 3M8QA 1NDPA 1VYAA 2ATQA 3C65A 3ILLA 1QQMA 4Q0BB 1Q8KA 4ATNA 4MFBA 3PFOA 1RTDA 3TVYA 2BE9B 5SWMA 4CRJA 4FZZA 1JWWA 2YBVA 1NB2A 4F0HA 1VQON 1K6YA 2QA4N 3B8HA 2AP1A 3LGNA 3OPKA 4BRMA 4P7TA 4FWNA 2GGPA 1S1VB 2A2CA 4QR0A 2ALYB 3BR8A 1OO0B 2HK2A 4HACA 3V1OA 4FJHA 2B4UA 3OJSA 5KFVA 4F0MA 1JCFA 3LDSA 4B3MK 1ATRA 1XHZA 2E7WA 2V4RA 1Q4RA 3N6LA 3QFWA 3ZETA 3LP2A 2HFNA 1FK9B 4R8UA 3VQCA 3FBBA 3T9ZA