3LP1A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
total genus 154
structure length 554
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp1A05
5J2MA 4KB7A 4LY7A 4J9SA 4OKEA 4DSKA 2E6MA 3QIPA 4ED1A 2R2RA 1CXUA 1RNHA 4EBEA 3NGZA 3BQ0A 3TAMB 2RPIA 2GIRA 3KNAA 4YP3A 4CJPA 4O5BA 1T05B 2XI2A 3FRZA 1DLOB 4NRTA 2QE5A 3Q8PB 3RR7A 3KOAA 4NLDA 4Q44A 5CYQA 5KFCA 5C5JA 3UDLA 5EDWA 3AVLA 1DTQA 4FBTA 4ZP6A 1TKZB 3CDUA 1IKYA 1NHVA 4DF8A 2V0NA 3SNNA 4QWCA 2BRLA 3QEVA 4O44A 4DQRA 1BQMB 3PY8A 4OPKA 1IKXA 2HMIB 3QERA 4FW2A 3K5LA 5J2PA 3QETA 2XGPA 1KLMB 4FJGA 4TQSA 3BSAA 4DMNA 4N5SA 1RYRA 3I5AA 2PYJA 2HNZA 3PW7A 4B8AB 1VSFA 2IM1A 1J53A 2Z1HA 1B9DA 5HROA 1HARA 4FJKA 2IJNA 1S6QB 4I2QB 3M8RA 4BWMA 4LD0A 4J9KA 2RN2A 4NLTA 4IRCA 4F4WA 1NK5A 4DWIA 3MXIA 3T3FA 3VQQA 4BDYA 2IOCA 3CFRA 4JLHA 1QTMA 3NBPB 1HMVA 2XO7A 3TVKA 2F96A 4RW6B 4CEZA 5DGBA 3DOKB 3M9MB 2E9TA 3TANA 4M3XA 4CJKA 2O4IA 4B9TA 4CFCA 3EPGA 3NAEA 2OYQA 1ZBHA 1HNVA 5F8JA 3BSOA 3H5UA 4ZVHA 2BGGA 2RF2A 2C22A 1L5UA 4XIUA 4DG1B 1N6QA 2W9BA 3ZT0A 2W42A 5L1LA 3AA2A 3SUPA 1S9EB 5CYMB 4QWDA 1TVRA 4AHVA 4GC7A 3MTKA 2QV6A 1FKOA 3AVBA 2VG7A 4WE1B 2IC3B 2YNIB 1TKTB 2I5JB 3KK3A 4KE5A 4KTWA 3Q8SB 3DI6B 1U47A 4H4OA 3OYDA 3LP3A 3B6OA 4K4XA 3T5HA 3IGNA 1TKXA 4I7FB 4CIGA 3LZIA 1ASVA 2JLEA 4EBDA 3OLAA 1HNIB 3KKRA 5KFVA 1SUQA 4DQIA 2ZKUA 1ASWA 4W5TA 3KLEB 1ZYQA 2VG5A 2HHSA 4CESA 3OJUA 3LP1B 4Z4HA 3NAHA 4K50A 1KVBA 5KFJA 3QZ8A 3V81A 2UVRA 4N47A 4M42A 4IBNA 1T03A 1MMLA 3OL6A 5DG7A 5L1KA 3PW5A 2AGPA 5KFFA 4QWEA 3K58A 3AVCA 3VQAA 3NH0A 4RW7A 4CEAA 4CJ5A 3OYMA 1S4FA 3DLKA 4ED3A 2QKBA 4M3UA 4CF1A 4CEEA 1D1UA 4E89A 3HM9A 3L8BA 2D0AA 4KO0A 4HVJA 4MFBB 5KG6A 4KHYA 2HHXA 4E7JA 4FK2A 4ICLB 4M3YA 4C8MA 2YHBA 4KB1A 4JV2A 3DRSB 4JS5A 1RT6A 3SV4A 2PY5A 3DRPB 1W25A 5FDLB 4DSLA 3TABA 1BISA 3KTQA 5KFQA 1WSGA 4CHOA 4BWJA 3NGDA 3ICLA 4FJ9A 4KHNA 2B6AB 5JUMA 4EP4A 4R8UA 2YHAA 5J1EB 4TXSA 4DEZA 4CJVA 1S10A 3OVNA 4J9PA 1K1QA 3HKWA 4O55A 4HHTA 3S3OA 3T5LA 1LWEA 4OGCA 1RDRA 4ED0A 4M3ZA 4J2EA 5KG2A 2YNHB 2C28A 1TL3A 1ZBUA 3PX0A 3FSIA 5F8NA 5KGWA 5KFTA 1EETB 4K8ZA 4ZPBA 3I5CA 3PX4A 2A1RA 2AGOA 4KV8B 1T3NA 4KHRA 4O4GA 2DPJA 3NHGA 3KD1E 1GOBA 3N6NA 4QWAA 4W5QA 4HUEA 4G3IA 3ZSRA 4IFVA 2ZE2B 1NKBA 3O3FA 3KHLA 4E7KA 3PHEA 2FBYA 2ASLA 4CGFA 4TSXA 3HYFA 3V6KA 5KT7A 2QXFA 4FK0A 1A5WA 4ED6A 5L9XA 3CJ0A 3SI6A 1XWLA 3SQ2A 4CJTA 3DOLB 1JLEB 4LSLA 2D41A 1JLQA 3CFOA 1RTJB 2ITGA 2Z1JA 1D5AA 2JEGA 1S49A 4J9LA 5KG3A 4O0JA 2WOMA 3HL8A 1QE1B 3H2LA 2FBXA 3AVMA 2YKMB 3ZSQA 4CEFA 3VQ7A 4FBUA 4W5RA 1CXQA 5KG5A 1YTAA 5KFXA 1BIZA 4QCLA 5KFSA 3RMBA 4M95A 4C8OA 5EU7A 3HVTA 3FQLA 5KFRA 4DFJA 2KTQA 4JS4A 4ZPAA 5F8LA 3SCXA 3MR6A 3CO9A 4Y1CA 2I1RA 3QESA 3LP2B 4AH9A 5T7BA 2F8EX 3NMAA 1BCOA 4DTPA 1TL1B 1VSKA 2OPRB 1QSYA 4FLXA 2ASJA 3OYJA 3HXMA 1RT7B 5FRNA 5KFZA 3NAIA 4Q0BA 3FQKA 2QKKA 1TK8A 1VRUA 1LWCA 4QW8A 2HHTA 5C24B 4KHWA 3C6UA 5HP1A 2W8KA 1RT3A 4DS5A 2JC1A 5DG9A 1IKWB 3DLGA 1LWFB 3V9SA 5KFNA 2B43A 5KT5A 3KK2A 4K8XA 3MR5A 3ISNC 3KJVB 4PUOA 3VQ5A 3SJJA 3LAMA 3GIIA 1ZBIA 4FLWA 5DQHA 4X2BA 3S9HA 2G8UA 2DTUA 3V4IA 4IDKB 1S1VA 4QPXA 1S1XA 3IS9B 3TR8A 1W0HA 3EY1A 4C8LA 4DSIA 1BI4B 1JLGB 5KI6A 3L2UA 4CJLA 1JLFB 2OPSA 3ZT1A 3OYEA 4F4KA 4E19A 2W9CB 3VQSA 3QLHB 3OS2A 1KLNA 3MEDB 4LSNB 1RTDA 4ZMMA 2P5GA 4NRUA 4RNNA 1UWBA 3M8PA 3AV9A 4DTRA 4FZYA 5KFLA 4J9OA 2C2EA 4ZVFA 2KW4A 4RW8A 2OA8A 3MXJA 4ZP9A 4EZ9A 3D28A 1U4BA 1Q8IA 2Y1IA 3LAKA 1FK9A 4DQPA 4PQUB 3KK1A 3ZSYA 3BGRB 5J2MB 2O5DA 5KGXA 3K5OA 2ILYA 3P5JA 3QIPB 4FJ5A 4FJXA 3LPTA 1K6YA 4ID5A 4B9VA 4BDZA 1BIUA 1IKVB 5J2NA 3KMQA 3OYGA 3G6VA 1RTIB 3VN5A 5SZTA 2DFFA 4ECQA 1S6PA 5HLFA 1YVUA 1VK0A 2ATQA 3LP0A 1S1WA 5CYQB 3GV5B 4CGIA 2XY5A 2FJXA 2AQ4A 4FJHA 4QOZB 3M8QA 1DTQB 4KBIA 3HK2A 4CJEA 3PJXA 1IKYB 1KHVA 3S3MA 4E1MA 3NH1A 2ZQBA 3BDPA 3AA4A 1NOYA 1SH2A 3ZSXA 1IKXB 1ITGA 4NLYA 3NE6A 4R0EA 4NCBA 4Z4IA 2DPIA 4DLEA 3QINA 4HCBA 3OY9A 2ATLA 5J2PB 1HQEA 1RT2A 4IH6A 2C2DA 1NJZA 4CIEA 5KFEA 4JV0A 2D0CA 1BHLA 4RG8A 2HNZB 2AGQA 2YNGA 3C6TA 3MEEB 4KFBA 2FJVA 1NK8A 1S1UB 5KFYA 1JL1A 3DYAB 2CJQA 2WB4A 3C95A 1KVCA 4OKKA 4URSA 1SKWA 3OL7A 4IG3A 3SQ4A 1RT5A 1QQCA 3CWJA 3K59A 5D3GA 3RWUA 3CQ8A 2F8SA 3A2FA 5F8HA 5KFDA 3LPUA 1HMVB 1RT4A 2FBTA 3PZPA 3IN5A 1Z26A 4AHRA 4IR1A 4GC6A 4F2RA 4ECZA 4PY5A 2JC0A 1VSMA 2R7YA 3KLGA 1HNVB 3CG7A 4CEDA 5J2QA 1TP7A 3K2PA 3DLBA 3DLEA 3SV3A 1N6QB 2W9BB 4F2SA 1TGOA 4G1QA 3EZUA 1WNSA 2QK9A 4KREA 3TAGA 3D5MA 1HJRA 1NOZA 1B9FA 1TVRB 2FC0A 3SPYA 1FKOB 2BR0A 3QEPA 2VG7B 4CECA 3OS1A 4CF9A 3KK3B 3KLHB 1KFDA 1TV6A 4CF8A 4ECSA 2P51A 2AWZA 3E01A 2D5RA 4O3OA 2YKNA 3K5MA 3ISND 2E9ZA 1CLQA 4TYBA 3G10A 1TKXB 2R8JA 3M9NB 3PVXA 3SPZA 4YMEA 4I2PA 3U3YA 1RBTA 3FFIA 4GMJB 3PO5A 1S0OA 1WSIA 2WONA 4FZZA 1FKPA 2VG5B 3AO4A 4Y3CA 3IG1A 4URGA 4MKAA 3VQ8A 2EHGA 1SKRA 4XPCA 3V81B 5JS2A 1XC9A 3Q8QB 4E1NA 1T03B 3E51A 4W5NA 3ZT4A 4M3RA 3H59A 4IRKA 3CYMA 3OSPA 4FS1A 3LDSA 5KFGA 3QYYA 3HO1A 4KO0B 3QIOA 3MR3A 4KKOA 4J9RA 3G6YA 4ECRA 4E3SA 3H4DA 3I8DA 1VSJA 2WRMA 3GV7B 4ECTA 2R2TA 1D9DA 2FVRA 3VQ9A 3GIJA 2IMWP 3OYLA 1ASUA 4Q8EA 3MEGA 4B9SA 3PUFA 2AX1A 4BDPA 3MFIA 3DRRA 4KTQA 3L2WA 3L2RA 2XRIA 1G15A 2XI3A 4FJNA 1WSEA 3AVKA 4HUFA 2JEJA 3KD5E 3LALA 3ZCMA 2ILZA 4W5OA 1Z4UA 1SH3A 2G8HA 4FM0A 3DDKA 3NF8A 2EX3A 3OLBA 5K14A 2G8WA 1JKHA 1T94A 4O3RA 4FJ7A 2P1JA 4DL7A 5I3UA 1C1AA 2RKIA 1N5YA 1SL1A 4QAGA 4KHQA 3AA3A 4IQXA 2GC8A 4O3NA 2VWKA 1RAJA 4KPYA 4FLUA 1XR6A 4DU4A 4FYDA 1RBUA 4RNHA 4WYLA 1WSJA 3IAYA 4CHZA 4Q8FA 4LH5A 4K4WA 4DL5A 3KHGA 3GV8B 1HQUA 4RW4A 4NLOA 4HYKA 5KRSA 4GVMA 4IFYB 3GIKA 4CJ4A 5EWEA 1GOCA 4MIBA 2J6TA 3SI8A 1LAWA 5EWFA 3H5XA 2VG6A 3H40A 5CZ2A 3WNFA 1SL2A 4IFVB 2UVWA 1S9GA 1WNEA 4WFXA 3AA5X 2IAJA 2KQ2A 2OPQA 4AHTA 1NHUA 1L3TA 4O0IA 3QNNA 2EC0A 3V9XA 4HTUA 4H8KA 3HHKA 4M41A 1Q9YA 3QO9A 4E0DA 5E41A 4ZPCA 4LSLB 1JLQB 1RA6A 5DG8A 3WNEA 4AHSA 4I9QA 4Y2AA 4J9MA 4E7HA 4RNFA 5HRNA 2KFNA 4B9LA 3I0SB 4ED7A 2OZMA 4Y2CA 1XR7A 4CERA 4CJ3A 3V6DA 4DQQA 4DFPA 1N4LA 1BGXT 2WOMB 1C0UA 1HPZA 3ZSOA 3WNHA 1VRTA 4ZP7A 1N56A 4FVMA 4M45A 2HHWA 4EO6A 3O4QA 4RUAA 3H08A 3V1OA 3ZSZA 3ZT2A 1QSLA 4NLXA 4FM2A 3HVTB 1LW2B 4F3TA 3NKYA 4WE1A 4ZPDA 3QNOA 4JRQA 1TKTA 4NCGA 3AVGA 2V9WA 3L2VA 2IM0A 4NYFA 1LV5A 1SL0A 3MECA 4FLTA 4NLQA 3F9KA 3V9ZA 2X78A 4OL8A 4LQ9A 4OPJA 4RU9A 1JLCA 1VSEA 1HNIA 4IR9A 1QAIA 4WZMA 4Q0BB 5FROA 2BRKA 2W7OA 2HHQA 3KLEA 3RRGA 3C6UB 4ECXA 4CJSA 4RW9B 5HP1B 4CGJA 1RT3B 1K1SA 3OHAA 3O4NA 1JXBA 1RBSA 3DLGB 3D45A 2BE2B 4F4ZA 2XWYA 3O3GA 4PUOB 3HT3A 1SH0A 3I0RA 1HYVA 3OYKA 4HUGA 3QIDA 4ZP8A 4ELTA 3ASMA 3OL8A 3V4IB 4J2AA 1S1VB 2FLPA 2IA6A 3NL0A 1VSLA 1S1XB 3V6JA 3QEXA 2X74A 4DL3A 4IOBA 4C8KA 5CZ1A 4DU1A 4ICLA 1R0AA 3M9OB 1RTHA 1A5VA 2OPSB 3G86A 5C42A 4CCHA 1MU2A 2BANA 4ED2A 1JLBB 1Q9XA 4EYIB 3QZ7A 4NLUA 1D9FA 4CK2A 1RTDB 5KG4A 4URQU 1WAFA 1W9HA 3M8PB 4MK7A 3HJFA 3VQEA 1YTUA 3AVAA 2UVUA 3IRXA 4RUCA 4QW9A 4CF0A 5F8GA 1RDCA 1RDAA 2IDOA 2HNYA 2X6SA 1S97A 1FK9B 1TK0A 3QEIA 3VA3A 1C6VA 3KK1B 4EEYA 4CGHA 1NNDA 1REVA 4CE9A 4CHYA 3OYFA 4CJWA 1TK5A 2DY4A 3H4BA 4NLSA 2IM2A 1UAXA 1S1TA 4K4TA 4B3OA 3EZ5A 4ID5B 2FVSA 3CM5A 3VQPA 4IRDA 5KFOA 4WXOA 5J2NB 4H4MA 3DLRA 3H98A 5L1JA 3AO3A 4M3TA 5F8IA 5DLGA 3GQCA 5T14A 2W9AA 1S6PB 3RAQA 2BQ3A 4I9LA 5HLFB 4EBCA 4FJJA 3LP0B 1S1WB 1TQLA 3SZ2A 2AU0A 4YNQA 4CEQA 2R2SA 3M8QB 3DM2A 2HWHA 3THVA 4OJRA 3ALYA 3DLHA 4NYZA 5L1IA 3T19A 4XPEA 2HWIA 5EWGA 3B6PA 4Z0UA 4ZHRA 4CIFA 5EUHA 4QWBA 5KFAA 1L3SA 1X9SA 4RZRA 4CGGA 1WN7A 4ECYA 3MXMA 1HQEB 1GX6A 3ZSVA 4FXDA 1RT2B 1QE1A 1ZETA 5HRRA 1BQNA 2XCAA 3MR2A 5KT4A 1VSDA 4CK1A 1UA1A 1HYSB 2YNGB 3C6TB 3TAQA 4KFBB 1KSPA 3PJWA 3GIMA 4CHPA 5KFBA 1NJWA 3HSTB 3HVRA 4KHSA 4IG3B 3QGIA 1RT5B 1KVAA 3T1AA 5D3GB 2WCXA 1U49A 3RAXA 4FLZA 2OH2A 2HB5A 4TQRA 1C1CA 1RT4B 4B9NA 4PA1A 3VQBA 1IH7A 3V9UA 4Q43A 1J9AA 3L2QA 1KCFA 4FS2A 4ZVEA 3RTVA 1RT1A 3KLGB 1I3AA 4WXWA 5J2QB 3CVKA 1XHZA 3KIOA 1IKWA 1LWFA 3DLEB 2KFZA 3KLIA 4J9NA 4G1QB 2KZMA 3AVNA 3LANA 4DTOA 5HBMA 1QS4A 2P5OA 4O3PA 3JYTA 1U04A 4NYNA 4FW1A 1NJXA 4H54A 4ECUA 4IDKA 5C25A 3CIZA 4O44B 2W7PA 3SQ0A 1TV6B 2FBVA 4ID1A 4WFYA 2AX0A 5I42A 3E01B 2OPPA 2YKNB 2RDIA 4EP5A 3OYNA 3TAPA 2R8KA 4I2PB 4DTXA 2F8TA 2PYLA 3FFIB 3T5JA 2ZD1A 2WONB 5KFKA 1B92A 4DTSA 3KLFA 1NKEA 2YV0X 1FKPB 4YR0A 1C1BA 2HHUA 3IG1B 3UR0A 1XI1A 4IKFA 3AO2A 5HROB 4MH8A 3IGVA 1BCMA 3LWLA 1QHTA 4NZ0A 4B8CA 3NDKA 2B5JA 4DFMA 3VA0A 3V6HA 2LSNA 2FJWA 2UUWA 3UQSA 3NFAA 4PQUA 3V1RA 3VQDA 4E7LA 2R2UA 4TY8A 1JLAA 1J54A 3NGIA 4KKOB 1SV5A 4O4RA 4WFZA 4TLRA 4U7CA 2GV9A 4NLGA 2RF2B 5KFIA 4FJMA 3MEGB 2WHOA 3DRRB 1WSFA 1IKVA 1KFSA 1RTIA 3DMJA 4CHNA 1QSSA 2YNFA 4R5PA 4KAZA 4H4OB 4CFAA 4YFUA 1IG9A 5K14B 4NCAA 1DTTA 1JKHB 1RYSA 4TY9A 2HNDA 1NK0A 1RCHA 4ED8A 4OVLA 5I3UB 2RKIB 3ITHA 1N5YB 1QAJA 1C0MA 4BACA 4FLVA 1SUQB 1LW0A 4PWDA 3SFUA 3KKSA 3OSNA 4DF4A 3BJYA 4AHUA 1T7PA 2FLNA 4DLGA 3Q8RB 4IG0A 3MFHA 1EP4A 2FVQA 3NF6A 3CJ5A 3K57A 4O3SA 1J5OA 1Z25A 4C8NA 2Z1GA 3KMSA 1HQUB 4RW4B 3L3UA 3SYZA 2V4QA 4F4XA 3MEEA 1S1UA 4RW7B 1ZTTA 3DLKB 3DYAA 2IGIA 2VG6B 1JXLA 3BR9A 3VQ6A 4F8RA 4KTZA 1S9GB 5F8MA 2Z1IA 4CJQA 2D3ZA 4DSJA 4OLAA 2IAJB 5DQGA 3RR8A 3JSMA 1C0TA 1NK6A 1GOAA 3U6FA 2OPQB 2VA2A 4DSEA 4BE2A 3CM6A 2R8GA 1RT6B 3OJSA 3QO9B 4KAIA 3TAMA 4DS4A 3TAFA 4Z4EA 4K4VA 4CJUA 2J6SA 5FRMA 5KFHA 5CY4A 3OYAA 1GX5A 4K4ZA 4FK4A 3BQ2A 3V6DB 1EXQA 1T05A 4YR2A 1C0UB 1DLOA 1HPZB 2DFHA 4R8UB 1VRTB 4TN2A 5KFWA 3SUNA 4NLVA 1HRHA 5KT3A 4ELUA 4BE0A 4O3QA 4F4YA 3P1GA 1LWEB 3I5BA 3H5YA 3HVWA 1TKZA 4CK3A 4FCYA 1EX4A 4JV1A 4GW6A 3D0PA 3VQCA 1D0EA 4NCGB 3KLHA 1TL3B 3H5SA 1BQMA 3MECB 3RBEA 2HMIA 4FJ8A 4DL6A 1JLCB 4CF2A 5KFPA 4O4GB 4YQWA 1KLMA 4J2DA 2ETJA 4F3OA 1KHWA 2HHVA 3U3GA 1NKCA 1OS5A 1JX4A 4Z4FA 3UPFA 3AVFA 4FM1A 5F9NA 3NF7A 3OYIA 5DGAA 1ZBLA 1T8EA 4OGEA 1S6QA 4I2QA 2FLLA 4DU3A 4JUZA 3HPHA 3I0RB 1RDBA 4NLRA 1XHXA 3NBPA 1RBVA 2G8IA 3TAEA 4DFKA 4RW6A 3DOKA 2FVPA 1S0MA 4Y1DA 4Q45A 2BQUA 3OS0A 2OZSA 1R0AB 2G8VA 1RTHB 4HKQA 3PW0A 5C42B 1MU2B 5KG0A 2BANB 4DG1A 1YVFA 2R8HA 2ALZA 1FXXA 3RB4A 4AILC 1JXEA 2XY8A 3BREA 4K4UA 1S9EA 1NK9A 1UA0A 5CYMA 1JIHA 3LWMA 2R8IA 2IC3A 2YNIA 2I5JA 1IM4A 4KSEB 4EYHB 2D7SA 3DI6A 2DFEA 3P83D 2IS3A 1I6JA 4DTJA 4N56A 3BSCA 3LZJA 3IRXB 1I39A 3ZT3A 1X9WA 3F73A 2HNYB 4I7FA 4JRPA 4DTUA 2FVCA 2ASDA 2GUIA 1S48A 2D3UA 4ZTFA 1REVB 2XY6A 1VRUB 1LWCB 1CZ9A 1CZBA 5KFMA 2Q3SA 2JEFA 2JEIA 3LP1A 1X9MA 2RDJA 1S1TB 4B3OB 5HRSA 2CKWA 3UIQA 4KRFA 2NUBA 4Z4CA 1TKDA 1KRPA 3HVAA 4WZQA 2IBKA 1VSIA 3KK2B 4RNMA 1ZTWA 1YT3A 4IFYA 4ECWA 4K4YA 4H4MB 4KHUA 2O4GA 1XR5A 3FDSA 4TYAA 1F21A 4L8RB 5JXSA 1NK7A 5DLFA 2XC9A 1S0NA 4N76A 2HVIA 1WAJA 4MFBA 3ZSWA 4BE1A 2VA3A 3DM2B 3EPIA 2E4LA 3DRSA 4ZTJA 3DRPA 5FDLA 4J9QA 5JS1A 5HRPA 2IM3A 3AO1A 2J6UA 3G0ZA 4ZHRB 3MAQA 5F9LA 4NLPA 4RNOA 1LAVA 1JL2A 3I0SA 1TAUA 1S9FA 4IH5A 4CFBA 2W8LA 4CEOA 1EKEA 2B6AA 3TWHA 4DTMA 1UWBB 1BQNB 1TAQA 5J1EA 1IO2A 5SWMA 2HAIA 4K4SA 4XO0A 4KB0A 4RW8B 3PW2A 1S5JA 3KHRA 2XCPA 3OL9A 2PZSA 4IKAA 4MK9A 3MF5A 4HCCA 4ELVA 1LW2A 3PR5B 4DL4A 2YNHA 3PO4A 4EZ6A 4CHQA 3RMCA 1QUVA 4LH4A 1X1PA 3PW4A 4MK8A 1EETA 3NH2A 5KTQA 4KHMA 1C1CB 4KV8A 4DTNA 4B9UA 1VSHA 4KI4A 2WK4A 4UQGA 3GILA 2AJQA 3CJ4A 4U6PA 2B4JA 3ULDA 3OYCA 4RW9A 4M3WA 1BL3A 3HPOA 4Y34A 1RT1B 1RDDA 3KHHA 3RRHA 4CGDA 2Y1JA 3AVJA 4CJFA 2GIQA 3SQ1A 2BE2A 2ZE2A 3KLVA 4AHCA 3KLIB 3PR4A 4N41A 4IH7A 5KFUA 5HBMB 3NGYA 1U45A 3JYTB 4J2BA 1NJYA 1KTQA 3SFGA 3M8SA 2XHBA 1RA7A 5C25B 4CFDA 3BSNA 1Y97A 2E9RX 3DOLA 1JLEA 1WSHA 1L3VA 4Z4GA 5I42B 1RTJA 2OPPB 2KZZA 3GYNA 1HYZA 4M94A 5DMRA 1ZBFA 4B08A 2YKMA 1UOCA 2ZD1B 1JLBA 3KLFB 3BQ1A 3VQ4A 1C1BB 3K5NA 4FLYA 4MIAA 1L3UA 4WYWA 2UVVA 1SKSA 5KG7A 2XGQA 3CDWA 4OLBA 2B5JB 3LP2A 4ZVGA 3HP6A 3CJ3A 3RB3A 2IJFA 2E6LA 3HP9A 1TL1A 2OPRA 2C2RA 3RMDA 1RT7A 3RB6A 4YR3A 2XY7A 4CEBA 4E7IA 4TY8B 1JLAB 4DQSA 1WLJA 3AO5A 3AVIA 1SV5B 5KT2A 5C24A 3OHBA 2G8KA 4CJRA 4KI6A 3WNGA 1D8YA 2HW3A 3L3VA 3KJVA 3V9WA 1U48A 3CDEA 2VWJA 4FJIA 1RILA 3EYZA 3AVHA 3T5KA 1C2PA 1U09A 3DMJB 3HPGA 3C94A 1NK4A 4NLWA 2YNFB 4ECVA 3RBDA 2G8FA 4R5PB 3N6MA 3CJ2A 4DL2A 2A1SA 3RB0A 3IS9A 1DTTB 5KT6A 3TARA 3QGHA 2HNDB 1RBRA 3S3NA 1BI4A 3ITHB 4Q5VA 1JLGA 3PX6A 3QEWA 1JLFA 4B9MA 1LW0B 4MQ3A 4PWDB 2W9CA 3PV8A 5KG1A 3QGGA 3RMAA 3N6LA 3QLHA 3OYHA 1A5XA 3CFPA 3MEDA 4LSNA 3V1QA 4FZXC 4IG0B 1EP4B 4LQ3A 2WTFA 3NF9A 1J5OB 4OKJA 1O1WA 2D0BA 5DQIA 5KRTA 2JGUA 3TI0A 3SUOA 1CSJA 2HVHA 4DSFA 1HYSA 3SUQA 2BQRA 4FJLA 2GBZA 4EO8A 2UUTA 3OYBA 3TQ1A 3O3HA 4MKBA 3G6XA 5DK5A 3NCIA 2X6NA 3JSMB 1C0TB 3BGRA 2V4RA 4F50A 2BDPA 1N48A
chains in the Genus database with same CATH superfamily
4ES2A 1RBAA 2OTLN 1FD2A 4J9SA 4S0MA 1TYQB 1F5BA 2UXCK 4DSKA 2E6MA 5AQPA 3QIPA 2J76E 5K8PA 3MPWA 1HI8A 2DD8S 6FD1A 4NRTA 2QE5A 3RR7A 4Q44A 5F2RA 4BR0A 3QT6A 3UDLA 1VQ8S 5F0UA 5EDWA 3J7A1 2Q0RA 2I9SA 3L4IA 3MPVA 2HKEA 4DF8A 3TUJC 4QWCA 1UKUA 4DQRA 3C6HA 2VL1A 2DBBA 4OPKA 3WIVA 1IKXA 2HMIB 3O44A 5J2PA 1K0TA 3QFWA 1KLMB 4A8SA 2CDQA 5GMKa 1YIJS 4OPAA 4DMNA 5LSOA 3I5AA 3PW7A 5HATA 4F0KA 4DPUA 4ILLA 1VSFA 1MN9A 2G2OA 2Z1HA 2P9CA 1HARA 4CT8A 4EAHD 2IJNA 4ZVTB 3M8RA 4BWMA 4LD0A 4AQYJ 2RN2A 4NLTA 1NZAA 3MN7A 5AQYA 2E1RA 3VQQA 2W2PP 4BDYA 1FERA 2AJ0A 2KVIA 1HMVA 3TVKA 3WX8A 4CBUA 3J81O 2HHHJ 5DGBA 2E9TA 1KC8T 2VFTA 4CJKA 2HHPA 4JN4A 4CZKA 3UCZP 4IO9Q 3R6MA 1U8SA 1L5UA 4G6VB 4PHTX 2CWXA 1NAQA 4DR7K 2PFUA 1N6QA 4DR4F 3ZT0A 1J5EK 4BQZA 5L1LA 1FNXH 3J7AN 3AA2A 4ID8A 2IFXA 1PJ6A 1URNA 5CYMB 4XAKA 1TVRA 3BYRA 4GC7A 2QV6A 1FKOA 4WE1B 5CD4H 1TKTB 2A3JA 1SVDA 4ZOSA 5KOWA 1XMQF 3B6OA 1NU0A 3IGNA 1WSVA 1TKXA 2J7WA 3LZIA 3LPYA 1ASVA 4K8RA 2JLEA 3KKRA 3IUCA 2RAQA 2GVZA 4A8KA 3MWTA 2LA6A 3OJUA 3KG0A 3VERA 3LDOA 4C6AA 3HSZA 3LA0A 3IWXA 2LXFA 4ER8A 4JI2J 4WWSA 3OA9A 3HBTA 1N33K 2UUBF 1E3MA 2LLZA 1T03A 3OL6A 2WUSA 3DFEA 2HG4A 5L1KA 3K58A 4H5WA 2ZNYA 4AXJA 3WBZA 4CEAA 3ONQA 5A8KB 1K44A 3DLKA 3CCUS 2V68A 3UN2A 2RH3A 2E5IA 2VBZA 3EE9A 4E89A 3L8BA 2E5GA 2PA8D 4CI0B 4MFBB 4KHYA 2VDHA 2ZH2A 1E4FT 4ICLB 1Q78A 2XZDB 1PYTA 3PTWA 4FWRA 4JV2A 4LFAK 3ULEB 2M7SA 3DRPB 3C15B 3GDQA 1OY9A 4DR6F 3P3DA 3SSQA 3OTOF 1FD8A 3C14A 3OQ2A 5DM7Q 3NGDA 3ICLA 2IBOA 4FJ9A 3DXBA 2FGCA 2E1AA 4KHNA 4EP4A 3CC7N 4CJVA 2QGFB 3D0HE 4O55A 1UWAA 3VGTA 1LWEA 3ILOA 4ED0A 4M3ZA 3D6FB 4ZDNA 2E1CA 1ZBUA 3D7EO 1F6TA 4HLBA 2QRRA 3L7OA 5KFTA 4FWMA 3R7BB 5FIIA 4CLKA 5AXLA 3VQTA 2A1RA 1T3NA 5E3RA 2AEJA 2DPJA 2D3OR 2UXBF 1APSA 3CPWM 2H65B 1UAWA 4W5QA 1QLNA 1EKRA 3E1YA 3OXGA 4N7TA 3KJFB 3QBXA 1NSKL 2O8DB 4ZJOA 3O3FA 3CD5A 2DGUA 1HBMA 4LFBF 2FBYA 4JKDA 2G1DA 4CGFA 1ROFA 4OX9K 3V6KA 1OJ4A 1TUYA 4ED6A 3TR5A 1HQ2A 2ROPA 3TUPA 2P2CB 4GKJF 4LSLA 3MPUB 3CFOA 2RB7A 1IBMJ 1RTJB 2ITGA 1Q7YT 2Z1JA 1D5AA 2BJ8A 1OH7A 2WOMA 2CPFA 3AVMA 3FCWA 2A5XA 3VAFA 1RHRB 4A8MP 4KH5A 3RU0A 4FBUA 4DR1J 4W5RA 1RHMB 2FJDB 5DS7A 4WFNL 4M95A 5EU7A 3HVTA 3OTBA 2JH3A 1WBBA 5E2QA 3DU6A 2KTQA 1P9YA 1TL7B 2U2FA 3MR6A 1FJEB 4Y1CA 1NM2A 1VDHA 2J9DE 1YI2N 5T7BA 1M1KO 4NE9C 2V50A 4DTPA 1XTZA 2OPRB 1YJ7A 2PMWA 2PBDA 1VHIA 2J4RA 1RT7B 3ENVA 3LGHA 4QZVB 2FY1A 2DCLA 5E33A 1TK8A 3MMCA 1LWCA 1RAIB 2HHTA 2HFNA 3CCWA 2W8KA 4IJNA 2JC1A 4WTOB 1NLKL 3DLGA 1W2BR 3HMJG 5KFNA 2B43A 3V9SA 5KT5A 3ISNC 3KJVB 4PUOA 2M3DA 4U95A 3DNCA 2BVZA 3LAMA 5AQUA 1P6TA 1ZPVA 5F3ZA 1MDUB 1N5QA 2G8UA 5CH7B 2JSXA 1XNRJ 3W9HA 4DV6J 4DXLA 4QPXA 4BG8A 4P6QA 4AQYK 3UNGC 1S1XA 4OZ3A 3SMSA 1JLGB 5KI6A 3L2UA 3CDBA 3GB0A 1JLFB 3OYEA 4OJ3A 2HHHK 4JK8A 2BJ7A 2C2KB 1GLJO 1NJIT 1HR0K 3SAFA 2DH7A 3MEDB 1H7XA 2QI2A 5CQGA 1VQ5N 3AD7C 1QAXA 3M6GA 5IS2A 3W9JA 1F9HA 3DLJA 1WACA 2YHXA 3MMBA 4BCAA 2XWXA 2MHEA 5HMWA 1OSDA 4DTRA 2YJEA 3EICA 1UPPA 4OJ1A 2F4FA 2MYFA 5HVFA 1RHKB 5L38A 4EZ9A 2Y8YA 3M6VA 2ZH9A 1DQ9A 2MTLA 1FK9A 3T9ZA 4PQUB 3JQMA 5BPMA 4JI4F 5KGXA 3CJSA 2PFDA 1X4AA 2VU5A 4ID5A 3HHDA 1GEHA 4ILRA 1JQGA 4MDBA 1Y5IB 4JI2K 5GAHP 3VN5A 3EDRB 3ID6A 5LXRA 1HHSA 3MAAB 5CYQB 4CM2A 4L3QA 2IYGA 1RHQB 5IT9U 4Y0FA 1DTQB 4KBIA 3PJXA 2C2OB 2D0OA 4L72B 1FNMA 3SSRA 1N36J 1SH2A 3CJTA 1WDTA 4JKBA 1QTNB 4AL7A 2ACYA 1ATSA 3NE6A 5EY4A 3W7BA 4DLEA 4HCBA 3OY9A 4RLEA 3R97A 2RJZA 3IBCB 1Q82T 1RT2A 5B08A 3A3NB 5KFEA 1WTFA 1HBOA 3C6TA 3D1QA 2Q31A 4LFCF 1NK8A 5E7OB 2P9IB 1NHKL 3WXLA 1JL1A 4NZ6A 3B8AX 2QLWA 3NGKA 4BC4A 1VS3A 5JVHL 3ISZA 4P52A 1VQLN 2AW0A 4E8UA 4AT1B 3HHLC 2FLOA 3SQ4A 2NUUG 2KYXA 2QWRA 3RUBL 1QQCA 5D3GA 3S7RA 4P2MA 5F8HA 3LPUA 2BV3A 1RZMA 4CLPA 1X0PA 1KR4A 2IVNA 4A2BA 1RT4A 5GAGI 3H7HB 1SPBP 1W2IA 5K8OA 5BN8A 1RADB 4CQ1A 1OYEA 3OFEA 4F2RA 3WC0A 1UW4A 5JJBA 3CJ8A 1KD1T 1B3TA 4WFBQ 3C66A 7AT1B 4F2SA 3GJRB 4B3MJ 4YS2A 2QK9A 3GJTB 2GO9A 3D5MA 4UY8O 3S6EA 3FSXA 3R9PA 1B9FA 2FC0A 2BR0A 1KEKA 1G99A 2VG7B 1U1OA 4CF9A 3KLHB 3EVOA 2B4UA 4GVBB 1T95A 5E0OA 2NXEA 1SJFA 1SC3B 2MKSA 1QM9A 1UZDA 2D5RA 4O3OA 2CQ2A 1HNWF 2E9ZA 4I67A 5D78A 5GADP 3PVXA 3WT0A 1UP1A 3THXA 5ITHA 2X51A 2PAVA 1RU2A 4IJAA 4OHWA 5B0FA 1X4EA 3W9IA 2BKPA 1IBMK 3IFRA 2HVDA 2RE2A 4FZZA 2HFSA 3NP5A 4URGA 1VQ6N 4JI7F 3VQ8A 1SKRA 5JS2A 1RE1B 4YB6A 1N5VA 3O1LA 4ZVQB 3W2WA 4E1NA 4DR1K 2YKQA 1GLCG 1UW9A 1VLYA 1RHUB 3CD6N 4M5HA 4NMXA 2NXJA 2D1KA 1RTZA 3CYMA 2DNLA 3A8KA 3VETA 1PAEX 3QJPA 2OSQA 2NYHA 3J7YU 3GV7B 3PIPQ 1HBUB 3TNVA 3VGVA 2IMWP 3MFIA 4K2XA 3NY0A 1G15A 2KLAA 4FJNA 3AVKA 4HUFA 3ZCMA 1U2RA 4FWLA 4OMFG 3B4DA 2V69A 1FWKA 3VR1A 3CCVS 5KQ8A 1RI7A 3I8BA 1C1AA 2F3JA 1XNRK 4QAGA 4DV6K 4BRGA 2EG1A 2K3KA 2GC8A 4CO4A 1GTHA 5SUHA 2M5YA 4FLUA 2RILA 4I64A 4DU4A 4WYLA 3U1MA 1OKJA 1T9WA 1WSJA 3IAYA 3GFHA 4ANDA 4K4WA 2L9DA 3PM9A 4RW4A 3HTVA 5BR8J 3E66A 2KFYA 2ZH6A 1GOCA 4PL8A 4MIBA 3SI8A 1LAWA 3WNFA 1YVNA 2NRHA 3DXKB 2DJWA 2HZVA 1WNEA 4WFXA 3R3LA 5AT1B 2N3LA 1S6OA 7FD1A 4I68A 2Q66A 3D2EB 2MPUA 3HFZB 1JCEA 1RLCL 1L3TA 4HTUA 4M41A 4M5MA 3MHYA 3LM9A 5AZIA 1JK9B 2YPZA 3CPWR 4JKAA 2WSFC 3FBFA 1RA6A 5DG8A 4Y2AA 2EPIA 2VV5A 3UE5A 5HRNA 2OGUA 2XMVA 1YJUA 2OZMA 1N4LA 3L7UA 1C0UA 1VRTA 4ZP7A 1HD0A 2RHSB 1UL3A 4DU8A 3D6TB 2F7VA 3RZAA 3G96A 3O5TB 3HOSA 2VD3A 5AJ3F 3MTJA 3UKRA 1WF0A 2LQJA 4FM2A 3P39A 3DGPA 1LW2B 1DBDA 3QNOA 1H2TZ 3F2KA 1QZ6A 1HWUA 4HACA 4KGVB 1RGIA 3SCJE 4OPJA 1TMJA 4ZLLA 1T44A 3CQXA 3ZFVA 3O9SA 4C1NK 1N36K 5IT9O 3CCEN 1R8BA 2C1EB 4IR9A 5F0XA 2GS8A 2HHQA 3L3CA 3PSFA 3KLEA 3C6UB 4ECXA 4CJSA 3JS9A 2DGQA 2F1FA 2JFKA 1HA1A 3D45A 2GA7A 4G9ZA 2JWNA 3UB5A 2O67A 3I0RA 1MWMA 3P31A 1VK3A 3OL8A 5CXTA 2FLPA 4NL5A 4BLGA 1IR2A 1Q5VA 1H2VZ 3CJBA 5AQSA 4C8KA 5CZ1A 1BWVA 2GEMA 1HX1A 3M9OB 2QMUB 2OPSB 1GNKA 1MU2A 2BANA 4RUBA 5ADXH 2RRBA 1BWFO 2NLXA 3M2UA 1MLAA 4NLUA 4QU7A 2F8HA 4DCJB 4URQU 4CLWA 3NS6A 2QIFA 1U1PA 4KHPF 1TUGB 3MMVA 4MK7A 4B3MK 4FVCA 4RO0A 5FLXY 2BX6A 3P8BB 5EX5A 2YWEA 5F8GA 4LJMA 4Q2MA 3MDFA 3QEIA 3VA3A 4C4WA 3KK1B 4CGHA 4YY3F 4CE9A 1ZOTA 1AA1B 2AEMA 2DHSA 1VQKS 2DY4A 4JI3F 3HI9A 2YQ0A 1WC5A 4K4TA 3ATUA 1GMVA 2FVSA 1Z1ZA 3CM5A 4E1JA 3VQPA 4CWBA 4FL9A 4CZEA 3SCKE 1XMOF 3THWB 3J7ZT 3H98A 1Q95G 5DLGA 3GQCA 2W9AA 2YBVA 2FF3B 2BQ3A 5HLFB 3FKBA 3I55S 3SZ2A 2AU0A 4L6V3 2GJIA 4QU6A 1GMUA 3M8QB 2HQFA 3CB4A 1HWIA 2P9NB 2JOQA 5L1IA 3T19A 4XPEA 3M2VA 2E5LJ 2HWIA 1K9MT 2YKOA 3B6PA 4Z0UA 4B1YB 4QWBA 1U2FA 4QS7A 1WOPA 1Y10A 4OZNA 1HUXA 2Z0GA 4ECYA 3BO3A 4FXDA 1QE1A 3MR2A 5KT4A 2WFBA 2YNGB 4KFBB 2VDIA 3HI0A 1NNEA 5HJYA 3G8SA 4I56A 5C2FA 2H54B 1YWXA 4MO4A 1L3KA 2PIIA 1U0SA 4DUYF 2PDAA 3EZWA 2VUGA 4FYWB 1RT5B 4CZFA 1NSAA 3VGKA 3QT5A 2W2QP 2WCXA 3RAXA 1U49A 3BF1A 2CPHA 2E7WA 4YOTA 2OH2A 4ITSA 1C1CA 3GFYA 2Y8WA 3VQBA 1IH7A 2ZHBA 2N3OA 2HPUA 3HM8A 4Z94A 2KJWA 1I3AA 5J2QB 2G2YA 2FSJA 4RBTA 4H0VB 2AV5A 3KIOA 5BR8K 2APOA 2H5EA 4Y2IA 1Z6RA 5C7PA 5IM0A 1UJ6A 4DUZJ 3P6YC 3AVNA 1FWPA 2JZ5A 3L9ZA 4DTOA 2YWHA 1DQ8A 1VBYA 4NYNA 4X4PA 1SIZA 4HH0A 3RRKA 2Z4PA 4H54A 2ROEA 1UEUA 3W63A 5A2QU 4JI5J 2EBGA 2A42A 1TV6B 2FBVA 1BQXA 3CF5L 4C23A 1TTHB 3E01B 1VQ4N 2YKNB 1JJ2M 3OYNA 2CZVC 2DT9A 3FGUA 3FFIB 3T5JA 1YTYA 5DM6Q 1N32F 2CXEA 4YR0A 1VIOA 1C1BA 3ZETA 2HHUA 3IG1B 1XI1A 4IKFA 3BR8A 3AO2A 4MH8A 1BCMA 3BZQA 4XDCA 4TKTA 4GRSA 1ZA1B 1X4GA 4FZVA 4CJ7A 3M8WA 5AQTA 4X62J 3PYDA 2DGSA 1VR6A 5EN1A 3V6HA 2ITMA 2V2VA 5C15A 3NFAA 4E7LA 2R2UA 4TY8A 2DVIA 2CRLA 3NGIA 2HMPA 3JXUA 3ZTOA 4I6WA 3R5BA 5I3QA 4UQTA 2ZC4A 1ATRA 1YJNS 3HHEA 4X64J 4FJMA 3PIOQ 3F0NA 1D8ZA 4ZJLA 3TJAA 4JKCA 5F3TA 4LF6F 2BABA 3DRRB 5B0GA 3D4JA 3D1HA 1B7YB 3UO0A 4E2FB 4OO1J 1FF2A 4F3QA 3Q24A 3OW2M 1TFWA 1IG9A 5K14B 1FVQA 3T41A 2NSBA 2EKNA 1V5VA 1EHWA 2RKIB 1N5YB 2DHAA 4N77A 1C0MA 1LW0A 4PWDA 4FXWA 3Q23A 3KKSA 4MT1A 2ZJQQ 5A8RA 2AZ1A 5K9FA 3BJYA 1S77D 2FLNA 4IG0A 3W61A 3CJ5A 4O3SA 1BXNA 3E8OA 3D1OA 3L3UA 2OIHA 3PJ9A 3OR2B 3IP0A 5IV4A 4F4XA 3MEEA 4Z37A 3QICA 4L74A 4EGLA 2VG6B 2MGZB 1F3VA 2XMMA 3VQ6A 1VJWA 5F8MA 2Z1IA 1BC6A 2ZM6F 1VQON 1EO1A 2M9KA 5DQGA 1WOSA 4AFFA 3H3NO 4NA1A 3HRGA 1TYQA 3VAHA 4BE2A 1Y7PA 2Z30B 3V5RA 1U1QA 4DS4A 3TAFA 2KG0A 4B3SF 4QS9A 5AQOA 4K4ZA 3KVGA 4Y2MA 3V4MA 4YR2A 5HJXA 1HPZB 4JEPA 2GX9A 4KY3A 3KK7A 3LDLA 1FTRA 1WTBA 5BPNA 1HRHA 4BE0A 4MDAA 2X1BA 1KBRA 1SAZA 2Q36A 4WF9L 3D7SB 4JV1A 4GW6A 3D0PA 1Q1KA 3CE8A 3MN6A 1TL3B 2ATCB 2QEXN 3U7JA 2CQGA 3MECB 5EX0A 2YWGA 2HMIA 1QZ5A 2E5LK 4FJ8A 3QFPA 2F4VJ 3O6QA 5KFPA 4O4GB 1KLMA 4B1UB 3MOZA 2I6WA 1KHWA 3KJNB 5M1NA 1NKCA 2G2ZA 1IXKA 3UPFA 3AVFA 5F9NA 1SQKA 3NF7A 1T8EA 5C10A 3AA9A 3HPHA 1KS2A 1RDBA 1OY8A 3GU0A 2XYPB 1HKAA 3TWZA 2C3UA 2LQ5A 4X65F 4DR5F 5LT5A 3C19A 3LO3A 3CXCR 2DH8A 3MURP 4CO5A 1S0MA 3TW0A 1AFJA 4Q45A 1RTHB 4BBYA 1VCTA 2QWPA 3M5RA 3Q2SC 5KG0A 4CP5A 3O08A 3BREA 2GHPA 5CYMA 2AMCB 2CQDA 5D0HA 1KVKA 2XYGB 3ET6B 3S41A 4DUZK 4GV6A 2AJ2A 2DFEA 4ZVRB 3CHWA 3NWRA 3L6QA 3IRXB 4CTAB 3C0BA 3J7YI 3ZT3A 5I9EB 1MA9B 3LDPA 3VF0B 4DTUA 4JI5K 3M30B 3D66A 1YSJA 2D3UA 3SXLA 2MSSA 2FXUA 2ASPA 1MSWD 5A2QO 1T0TV 1XQIA 2JEIA 1PAUB 3VEVA 2RNEA 4PKDB 3ZTRA 5D6GA 1S1TB 3R3TA 2CKWA 4ZCLA 3SK3A 4KRFA 2NUBA 2GUPA 1TKDA 3HVAA 4WZQA 3KK2B 3OFFA 4RNMA 1BO5O 3VAIA 1ZTWA 2V7YA 4IFYA 4RX6A 1U6BA 2PSZA 1RU1A 8RUCA 5HAOA 4BRPA 3MR7A 4H4MB 3Q2TC 4TU7A 3Q0AA 5A8KA 3MUVP 2XC9A 2F7TA 5K5MA 1WAJA 4MFBA 2LEBA 3EUNA 3KDOA 4GV3A 1YBUA 3DM2B 1FI4A 4YDUA 3ULEA 3UI3A 3C15A 3DRPA 3BUZB 4EIAA 4ZTJA 4J9QA 5JS1A 1FX4A 3D0GE 2J6UA 2V7ZA 3AO1A 3P4UB 3MAQA 5F9LA 4NLPA 5BN9A 4TU9A 4RNOA 4U9RA 4NX9A 1SCJB 4BRCA 3QAEA 1ELOA 3Q86A 4X64K 4CFBA 3TWHA 4OYOA 4USTA 1BQNB 4ZS6A 1IJJA 2F40A 2BE9B 4K4SA 4KB0A 4RW8B 2XCPA 1WI6A 2HFZA 3ZNJ1 1OWXA 4LF4F 2IMOA 1GFWB 3IAS9 2G13A 3G6EN 1AXQA 2HQ3A 1FDNA 4Y00A 3VALA 4CHQA 3AQPA 2CZ9A 4HI2A 2K06A 2RVJA 4IOXA 2UU9F 4MK8A 4DV3J 3N28A 4DCHA 3DGVA 3CCMS 1W97L 2B8PA 1FVSA 4M5KA 2VPYB 2AJQA 4U6PA 5JLHA 2W41A 2XS7A 5AQVA 1RT1B 3PACA 1KOOA 2UUCF 4CJFA 2O8DA 3MWBA 3MXHP 2P5VA 5M2RA 2V94A 3R5AA 2BOPA 4J2BA 2CQBA 2ZOFA 1KTQA 3SFGA 2I7NA 2XHBA 2CQPA 4DOZA 2E9RX 3ENBA 4Z4GA 5I42B 3SDEB 1RTJA 4BRKA 1NGFA 2B7CB 2ZD1B 1JLBA 3KLFB 2NR0A 3OTCA 2LXIA 4FLYA 5D0EA 1L3UA 4WYWA 4FP9A 1TL7A 4X4QA 4OLBA 3CI5A 2B5JB 1JJ2R 3CJ3A 3RB3A 1NDKA 2E6LA 2OSRA 2LU1A 2OPRA 2BH1A 3TP2A 3ZZOA 3RMDA 3GTYX 5H9FJ 1RT7A 1GT8A 2QA4N 1RAEB 1JLAB 3RBZA 5KT2A 2ZGZA 1M0SA 2G8KA 2VH7A 4CJRA 2F4VK 4C11B 1TL5A 3WNGA 3TO8A 3KJVA 3OR1B 4AM7A 2NPIA 1GXTA 1UPMB 2DH9A 4FJIA 1C2PA 3LUYA 2IVPA 1NK4A 1ZM4A 4WYBA 2YNFB 2F9JA 5A0YB 4CLZA 4AL6A 3N6MA 2BUPA 5KT6A 3QGHA 2HNDB 1PIEA 4DR3J 1RBRA 4FWNA 2JJ4D 3ITHB 2VYPA 1JLGA 1P1TA 4JI2F 4LF7F 4M8LA 1JLFA 2Y1RI 4DV4J 3CMAS 3CCQN 4OX7A 3PV8A 3O9RA 3TTFA 1H2UX 3QQCD 3OYHA 2DB1A 1A5XA 3MEDA 3V1QA 1EP4B 2E2OA 4LQ3A 3NF9A 3GOIA 1J5OB 3WDOA 3GJSB 3J81Y 5KRTA 5CABA 2M52A 3TI0A 2ZJRQ 1NPPA 1UFWA 1FFSB 2HVHA 2A10A 1HYSA 4FJLA 1X60A 4EO8A 4ZVPB 4JHDB 3MAHA 2HBMA 1UEVA 5DK5A 1RFQA 5GAGP 2X6NA 2WC9A 4F50A 2BDPA 1T9YA 4PG5A 4HDGA 4LY7A 4OKEA 3A8IA 9RUBA 3C16B 2R2RA 3OUYB 3P5BP 2ZKTA 3NGZA 3BQ0A 4BR9A 4WCEL 2Q3PA 1IJEB 3QB0A 4YP3A 2ZJPL 1T05B 2LQ8A 2XI2A 3FRZA 5AZJB 4UOHA 3EJMA 3MCAB 3MAAA 3KOAA 2J0XA 2RMLA 5IWAJ 4NLDA 5CYQA 5C5JA 4FVUA 1TUWA 2HYIB 4Y0WA 5MLCQ 1DTQA 3SQOP 1TKZB 3CDUA 1KXPA 1HFEL 1NHVA 2BRLA 4O44A 1S5ZA 3I4PA 1X8DA 3NGSA 2DGVA 3SAHA 3JS6A 4KPCA 4DX7A 5LJWA 1E6VB 4QYRA 4FW2A 1KAZA 3EVMA 2BZ2A 3QETA 3VWSA 2XGPA 3BSAA 2JWLA 3QT7A 4B8AB 1U6FA 2P9IA 4RJVA 2IM1A 1B9DA 2ZZTA 3KKFA 1S72N 2EK1A 4M1KA 4FJKA 2GQCA 1S6QB 4EHTA 1I51B 3M4XA 4I2QB 5LMNF 1SZ2A 1NK5A 4F4WA 4DWIA 2ZH3A 1D09B 4O8KA 1B4SA 1QTMA 5B0DA 1K8AT 4RW6B 4CEZA 3FLCO 4R25A 4DR1F 3DOKB 2CPYA 3CCTA 3TANA 4GVEA 3MM9B 4DV3K 4ZPTR 5DZ7A 4CFCA 1R8PA 2OYQA 2ZDPA 1YRTA 5F8JA 5MAOA 2BGGA 2C22A 2PE8A 3VV2B 1Q79A 2W42A 4AD6A 5EOYA 4DN9A 1UVLA 1S9EB 2ZOMA 3MTKA 2G1HA 2EEYA 4IOAQ 4BHQA 2VG7A 3K0SA 2YNIB 2I5JB 1UVMA 4PQAA 4KE5A 2E7VA 4H4OA 1Q7LB 4GVBA 3BPSP 3H90A 4I7FB 4MAKA 5G0RB 3OLAA 1HNIB 2IA0A 4DQIA 5FLXU 2QT7A 1NGBA 1ASWA 1FRKA 4BG9A 4I1TA 3AQOA 3T69A 4Z4HA 4K50A 2V4JB 4ENOA 1JMTA 3DHXA 3QZ8A 2XTJP 4N47A 2XULA 1MMLA 2YHYA 3PW5A 2NZ4A 2HQIA 5KFFA 2VGMA 3AVCA 3VQAA 3NH0A 2DHGA 1S4FA 2QFJA 4ED3A 4CEEA 1WSRA 3ULHA 3Q22A 3BH6B 4M63A 2HGMA 2D0AA 3BKFA 4E7JA 4CZIA 1SBRA 5H9FK 1RT6A 1HBUA 4DSLA 1VK8A 2CVEA 3BGLA 4MTPA 2ZZMA 3AY0A 2MLZA 4CHOA 2F8MA 2B9XA 3QAUA 1ZAVA 5J1EB 1VIXA 3Q8YA 4MIWA 1W7WA 3BV8A 2KL8A 2O66A 3AAPA 4Y2KA 4I6MB 3H2VE 2VONA 4BRHA 3G8QA 4J2EA 5KG2A 2YNHB 3D54A 1YX2A 3KG1A 4DR3K 5F8NA 5KGWA 1HKBA 1JJCB 5JMVA 3JB9k 3MPDA 4DV4K 5HI7A 1HNXJ 2AGOA 1S4EA 4BY9C 2C3PA 3G8TA 5D0RA 2Q1NA 3ZO7A 2NNWA 3DXKA 1OYDA 2ZE2B 1NKBA 5EHHA 2XLIA 3T1HJ 4E7KA 2HIYA 3PHEA 2XO6A 2GX8A 1RSCA 2ASLA 4BS2A 4TSXA 4OHVA 4HWIA 3TJ9A 5KT7A 4FK0A 1A5WA 1R31A 1F1BB 3CJ0A 1XWLA 1WDDA 2OTJS 2D41A 2ZFHA 2VFUA 2JEGA 1H1VA 2RUGA 3L4QA 1RCOB 2QL9B 2R7RA 1BUPA 3HL8A 4LR7A 3H2LA 2V5HG 2YKMB 3D67A 3VQ7A 5AXMA 1CXQA 5KG5A 4QCLA 4K42A 2VBXA 3RMBA 3O9UA 1S12A 3BDEA 4DFJA 4JS4A 2PI4A 3NEKA 2I1RA 5IWAK 3PKMA 1LK7A 4WJBA 4Q7AA 1BCOA 2CGJA 1TL1B 2ZEJA 4NI2B 4WU2A 4JKGB 5HMZA 3AOCA 3OYJA 4NXNJ 5KFZA 5B0EA 4QPTA 3PNIA 3DKDA 1C0FA 4JBCA 1VRUA 1IBLF 2RU9A 1U0HB 2G0IA 2YX6A 3C6UA 3GE9A 3RSEB 5GAEU 2B0GA 2H1YA 5EX3A 1PSDA 1REGX 3VESA 1IKWB 1LWFB 4JI8F 3DXMB 2NREA 4JV5F 4FNIA 3N79A 3VQ5A 1HPMA 1QJHA 3ZNUA 4FLWA 2IHR1 4OJGA 1N5TA 2KT2A 1YG0A 3WEEA 2PC6A 3IS9B 4DX5A 3AY9A 1F3FA 3EY1A 1KD1O 4P71A 2FSNA 1UZHA 2VASA 4H4KA 2OPSA 2FIUA 4E19A 2W9CB 5D4LA 1RWKB 4X4SA 3VQSA 3QLHB 5HSPA 3OS2A 3I9ZA 4FWSA 3TX0A 2XMAA 1IBCB 2FHOB 4OX8A 4NRUA 1UWBA 4FZYA 5KFLA 4ZVFA 1H72C 4RL1A 4LF5K 3MXJA 4ZP9A 3JSBA 3D28A 1U4BA 1URRA 5LMUF 5AE1A 3KK1A 2R4FA 4ZPVR 3ZSYA 3JSRA 4CO3A 4NLCA 5AQIA 3TA2A 1KP6A 1OPIA 4FJXA 3OVSA 1DQAA 4WKYA 4ZKAA 3QRPA 2Z2LA 4LF9J 3KMQA 2DISA 4AUKA 3THWA 3OYGA 1RTIB 4FKYA 4ED4A 2QFIA 5SZTA 1X3NA 4ECQA 4USUA 1HW8A 5HLFA 2O01C 3W5XA 2MLXA 2XY5A 4DPWA 1FJ7A 4QOZB 3M8QA 5LJVA 2UUAJ 3HK2A 2P9NA 3S3MA 5M1PA 1MWKA 2ZQBA 4LF8F 2P9LB 1S79A 4NCBA 1ITGA 4R0EA 3VEXA 5A8WB 3QINA 4WKRA 2EFNA 4JKHA 3I82A 3EEQA 2MJUA 2ATLA 2XB2D 4CIEA 4JV0A 1BHLA 4RG8A 2YNGA 4KFBA 4OYZA 4TVAB 5KFYA 4YN3B 1HWLA 2UV8A 4DR2F 3TSUA 3X1LB 4AF1A 3TUIC 5ETRA 3OL7A 1SI9A 4PL7A 1RT5A 1O5JA 2F8SA 1O6XA 3K59A 3W62A 3CQ8A 3A2FA 1AFIA 5GMDA 2UP1A 1DT9A 3FEZA 4K5RA 2QYGA 2H3GX 2Q43A 3KNGA 1I94J 4ECZA 1VSMA 4JAXA 3HZGA 1HNXK 4CEDA 5J2QA 3OT9A 2W9BB 1WNSA 5C2CA 2BM0A 4M5DA 2NS1B 3VHQA 1HJRA 3SPYA 1RWXB 3CMEN 4CECA 4CZMA 1WKKA 2HBKA 3T1HK 1TV6A 4CF8A 4ECSA 1PJ7A 3MPYA 5IFMA 2P51A 2AWZA 3E01A 2YKNA 3ISND 1T02A 1UFKA 1CLQA 4TYBA 3SPZA 4YMEA 3U3YA 3UW1A 1RBTA 3FFIA 3PO5A 4GMJB 1S0OA 2HSEB 4P73A 1FTCA 1YZ7A 3E9OA 2GWJA 4KT0C 3AO4A 2LDYA 4WK1A 4Y3CA 4IEEA 2MKKA 3IG1A 4DPTA 4MKAA 2EHGA 2QSFA 3V81B 2AJ4A 1XC9A 4M5JA 5IC6B 2DTJA 4FXVA 1NO8A 3E51A 5L9NA 2HQDA 3GCWP 4M3RA 5C0YA 1QAYA 1B7FA 3OSPA 4YDDB 4ILMA 4FS1A 4K0KF 5BYSA 2HWTA 2WTUA 3TX8A 4KO0B 1AW0A 5F41A 2BW7A 4QBUA 2JNJA 4ECRA 4E3SA 2WVFA 1LEOA 4K41A 1R0BG 1VSJA 4ECTA 4NXNK 1XJWB 5E84A 2YQ3A 4ATNA 3T6JA 4QJVA 3DRRA 2Q97A 2GHWA 4OLPA 2DKOB 3L2WA 2DNZA 3J7Z5 1QHAA 4JB8B 4QOTA 3KD5E 4DKWA 3LALA 5IT9Y 2GJFA 3CCRN 1Z4UA 2QWLA 4BGBA 3BGFA 3NF8A 3SMZA 2GVDB 4UZCA 5K14A 1ITPA 1T94A 2KO1A 4O3RA 4FJ7A 4DL7A 1CEZA 2RKIA 1N5YA 3AOAA 4U8YA 1GLBG 3CT9A 2J8AA 3DN9A 4IQXA 1RAJA 2BUNA 4KPYA 4CO1A 4IEIA 3CCJS 4CHZA 2LU2A 3D0IE 1UVIA 4IWVA 5AQLA 4BC9A 3M1FA 3GIKA 4CJ4A 2J6TA 2HF4A 3H5XA 1U1KA 3NS5A 2VG6A 3H40A 2MGZA 2UVWA 2YCHA 4NMLA 1RAOA 3NMRA 5DO2A 1VQMN 4U8VA 2PI5A 3UD3P 3A8YA 1NHUA 4PRFA 1CJKB 1RABB 4F7VA 4UF4A 3BO4A 2IVYA 3VMFB 1XMBA 1GMWA 2G4BA 4ZPCA 2C2NA 2PO4A 4JI0J 3DLLL 3WNEA 4I9QA 1VHFA 4E7HA 3I0SB 4CJ3A 4DQQA 1FO1A 1BGXT 1HPZA 1V3ZA 1HD1A 1N56A 4FVMA 3MD3A 4LF9K 1RQ0A 2CQ3A 2N4CA 3V1OA 3EVWA 4X4RA 2GGPA 3ZT2A 4LVOP 1IBKF 4C8ZA 4ZIVA 4ZPDA 3DAWA 2CJBA 3N01A 1GLLO 4MLEA 1NXIA 3DXSX 4YDXA 3EE3A 1OH6A 4NYFA 1SL0A 3MECA 4FLTA 4CLLA 2X78A 2OANA 5F1XA 2UUAK 3UNYA 3P49B 5T41A 4RU9A 2ABYA 2VGNA 1PGZA 3F44A 2XS2A 3HD1A 1QAIA 5KOXA 1IR1A 1N0VC 2W7OA 3WXIA 2J8SA 3KWIA 4AL5A 4RW9B 5HP1B 4WFNQ 3HJVA 1RT3B 4UUXA 4BRNA 3MCSA 2WBMA 4ALZA 3GG0A 5J1NA 2XWYA 5F0WA 5AQNA 4DHYA 4C3KA 2RS8A 1SH0A 3VGUA 3IA0A 1HYVA 2P9PB 3QFUA 2VIHA 2HAFA 3QIDA 3V4IB 1P8ZA 4JK9A 4EK2A 1S1VB 3J80U 2IA6A 2RQCA 3CCSS 1VSLA 3V6JA 1T6CA 2IVMA 1IN0A 1RTHA 5KAKA 3G86A 1N8RT 2I8EA 2WZ1A 2HIQA 4X62F 1YJWS 2MXYA 3TVYA 1I94K 4EYIB 2KH9A 2JFDA 1SC6A 1RTDB 3MCMA 5KG4A 3ZZ0A 1T6DA 3R2CJ 3R2DJ 3ET6A 1WAFA 2J0WA 3M1VB 1XBWA 5H1SQ 1W9HA 2E8AA 1DARA 2CPIA 2NCKL 4DR4J 1YTUA 1N52B 4X66J 2I2YA 3IRXA 3AT1B 4CTAA 4QW9A 4NA3A 1VBZA 1RDCA 1RDAA 1S7HA 4X64F 1S97A 3M30A 2QX0A 3CCLS 1VQPS 3TEHB 1P1LA 2RQ4A 2DNMA 1TK5A 1XMQJ 1YJ9N 4BR5A 2KM8B 3H4BA 3A4TA 1S1TA 1S99A 3JTPA 1PJ5A 2QLXA 3LH2S 4CD3A 3A12A 1VQ7S 3ZZUA 4DV0F 2C42A 3O8MA 5D15A 4ZJQA 4H4MA 3DLRA 3AO3A 2EWSA 3D2FB 5CAAA 1WHYA 2KI2A 3VF4A 4EBCA 1CJTB 3IFEA 4OV1A 2UUBJ 3GCXP 4YNQA 2HZAA 3DM2A 2HWHA 4OJRA 5GINA 5AQMA 3ALYA 4NYZA 3SMPA 3LL3A 5EWGA 4NWBA 2MQNA 4QQBA 5EUHA 1N88A 2OAUA 4FNHA 1FDBA 2OTLS 4CO0A 2QLBB 3CTRA 3AA8A 1X9SA 4RZRA 5IT4A 1WN7A 1XEZA 3HSJA 1LCUA 1GX6A 5LJ3Y 4B3RF 1BQNA 4DCOB 3OTOJ 1VSDA 1G2EA 3SLCA 3EGWB 4CK1A 1HLUA 5IZHA 3TAQA 2Q6CA 4PABA 2Q1LA 2DIUA 5K8MA 2C2ZB 1Q81O 3FZLA 4CHPA 2EFVA 3S8SA 4FPAA 2RSQA 3JAMO 4IG3B 3QGIA 1W2BM 3ZLJA 1UCNA 1KVAA 4I6YA 3UCGA 1MROB 2E88A 1S22A 4B9NA 5M1QA 3VGMA 3CERA 3L2QA 1FJGJ 1RT1A 1C4CA 5GADU 1U1RA 1V3SA 4WXWA 2KXFA 4CZLA 5JVHQ 1XHZA 3JXOA 1FW6A 1YITN 5AR0A 5HK4A 2UXBJ 3LANA 3BKTA 2P5OA 4O3PA 1U04A 2QZ8A 3W3DA 3E9PA 4IDKA 1NGAA 5KPTA 4DL0C 5IC4B 1NH7A 2E20A 4ID1A 1BU6O 4LFBJ 3N5FA 1RKIA 2NQPA 1M1KT 5I42A 3SDEA 3FEYB 3Q89A 4ZN3A 3QPIA 1ZH5A 3G9CA 2R8KA 3HD2A 4I2PB 2OJ3A 2PYLA 4JI0K 3PXGa 5BJRA 4BC2A 2NZTA 3CMQA 2ZD1A 2WONB 2ZH1A 3KLFA 3UVJB 2YV0X 1BHNA 3G4SN 1HWJA 2Y1LB 2Q79A 5HVGA 1QY7A 5H1SV 1P8GA 4A8XA 2ACMA 4NZ0A 4JI1F 1SC1B 3ID8A 3NDKA 2QWOA 2JLGA 2B5JA 3KJQB 4DFMA 1YAGA 1U1NA 5CCMA 3QSYB 1TMMA 4KQZA 2W2MP 4F67A 2Q2RA 3VQDA 4WQ5C 1F9FA 1JLAA 1J54A 4O4RA 4WFZA 3OVBA 4U7CA 4C11A 2ALYB 2N7YA 4C9DA 5KFIA 1RBLA 3UE2A 3MEGB 3OR1A 1WSFA 4JYAF 2F9TA 1IKVA 1PBUA 1H73A 4CHNA 2PMZD 2XNQA 2YNFA 5A0YA 2MZSA 2ZBCA 3R1HA 3IDHA 2MZ1A 3LW5C 4TY9A 1UEKA 2HNDA 1VI7A 1RCHA 4OVLA 5I3UB 2ERRA 3ITHA 4OJHA 4C98A 3US5A 4BACA 1MWYA 4KGXB 4FLVA 4CBWA 3SFUA 3OSNA 4LIRA 4DF4A 3J80O 4CZGA 1MW7A 3AHPA 4JNEA 4DLGA 1U7LA 2ZH5A 1EQYA 1EP4A 2LECA 1AT1B 3NF6A 1KKHA 5AXKA 2AEFA 1J5OA 4C8NA 3KMSA 2DNHA 3SYZA 3N0VA 4CDIA 1S1UA 3TOQA 4R79A 3TVZA 5IV3A 4JHDA 1YHQN 2DY1A 3DLKB 3DYAA 3FZ2A 1LK5A 2HGLA 4KTZA 3CC7S 4DR4K 3EM1A 1CLFA 4X66K 2OPQB 4P2SA 2VA2A 4KH6A 3OTDA 4MYTA 3O6WA 1TFYA 3JTOA 3C16A 1X3MA 3OUYA 3QO9B 2AYBA 4Z4EA 1XMQK 3C14B 5CY4A 4IXCA 1HR0J 4JI4J 4DX8H 4CLUA 3V6DB 1T05A 2DFHA 1NBEB 2CUYA 3SUNA 5A2QY 3UN3A 4NLVA 1ZM3A 4ELUA 3HX9A 4F4YA 1LWEB 3I5BA 3H5YA 3NVMA 4Y65A 1TKZA 4FCYA 2UUBK 5CYJA 5AQQA 1LOTB 2O1PA 1E6VA 2GZOA 2V34A 2CDRB 4HR2A 1JLCB 4BRDA 4USKA 4YQWA 4F3OA 4DHVA 3U3GA 2HGNA 4USMA 3ZX0A 2VWBA 4FM1A 5DGAA 3OTOK 3CQYA 4OGEA 1S6QA 4I2QA 1HBMB 2DPNA 4LFCJ 2Z2ZA 1NGDA 2F63A 4NXMF 4UY8T 2V6AA 2CVIA 1XK8A 4ISEA 4RW6A 1YI2S 3DOKA 2FVPA 2QL7B 3MM9A 1YDLA 4Y1DA 3OS0A 1K8KB 3ZTQA 4PKGA 3PW0A 4YHHJ 1YVFA 4W98A 2ALZA 1FXXA 1JXEA 4K4UA 1NK9A 1S9EA 2I0XA 2XLKA 2ZHAA 1FJGK 2QC3A 3TZYA 4NYPA 3CC2N 2B51A 5ADZA 3QDKA 1JIHA 2R8IA 2E5JA 2YNIA 2I5JA 1EX8A 4EU0A 4EYHB 2UXBK 3P83D 2X1FA 1E6YA 4DTJA 2FPHX 2O8EA 1X9WA 2HNYB 4I7FA 3NNHA 3PDNA 1S48A 4LFBK 1REVB 2MQLA 2XY6A 1LWCB 2Y0BB 1CZ9A 2QWQA 1BDGA 2Q3SA 3GIRA 3BEGB 1HNWJ 3CC4N 3FR0A 3L09A 2V4JA 3UIQA 3AJ2A 1KRPA 1WHVA 2IBKA 5A6WA 2GHVC 4ILHA 2B9YA 2GO8A 2IDEA 3VF6A 2ASOA 1EJ7L 1VQ5S 2X3DA 4DV5J 5AE3A 2O4GA 5K8NA 1XR5A 2R7UA 3FDSA 4TYAA 3I4HX 4L8RB 1J6ZA 4B3TJ 2JHEA 1S0NA 4U67L 4UOGA 4BR2A 3MCNA 1ZM2A 3ZSWA 3OXFA 4OZJA 4K7QA 2D0PA 1WG1A 4BE1A 4CLFA 3THPA 1WEYA 1IWAA 2IM3A 3UDVA 4LMZA 2KB2A 2KT5A 2RIJA 2NPFA 4ZHRB 4XTTA 3PG9A 1JL2A 1D4XA 4UUWA 3JSYA 4M5GA 1EKEA 2YX4A 5J1EA 3LOUA 1YLXA 3POTB 4BR4A 1EQMA 3OL9A 2CNOB 4IKAA 4I6MA 1R8AA 2O3DA 4PCQA 2YNHA 3FUYA 2MKHA 3PO4A 4DV1F 1QUVA 2P9SB 2D69A 2P9EA 3CULA 2HS4A 3PW4A 3B6BA 2A6OA 4V19S 2DHHA 4DTNA 4B9UA 4C48A 4UQGA 3GILA 1JCFA 2DR5A 1NGEA 2BM1A 3CJ4A 2B4JA 3TTCA 3IWNC 4M3WA 1BL3A 1FE0A 3KHHA 2Y1JA 3EZOA 3MN5A 3SQ1A 3QNWB 2YVSA 2V8PA 4E98A 2BE2A 1G6BA 2ZE2A 3FBCA 4LRAA 1F5AA 3CUNA 1WC1A 4IH7A 5HBMB 2CQ4A 2DO4A 1U45A 4ZCIA 3JYTB 2GQ2A 1GH8A 4D3GA 3DC2A 3CEDA 2IRXA 3JQKA 1RA7A 1VQLS 5M1OA 4CFDA 3BSNA 2E1MC 4A5AA 1WHXA 3C65A 1YUWA 5C2GA 1WSHA 1L3VA 1Q16B 4LBPA 2KZZA 1HYZA 2M8HA 5DMRA 1TUVA 4BVPA 3MMJA 4B08A 2YKMA 3CJQA 3LTOA 3SQGB 5BRDA 4JI4K 3VQ4A 3I56N 3K5NA 1JJHA 2HK3A 4CIOA 1NRKA 1T9XA 4MIAA 1NZ8A 3KWGA 3CDWA 4MMOA 5BRFA 3CF5Q 2DGXA 2R42A 3RYLA 2O8BB 2IJFA 4EMDA 5AJ3J 3HP9A 1NBWA 3TSPA 1TL1A 4JKGA 5LOQA 2ZWHA 2NXNA 1LFPA 2XY7A 4P7TA 2XLJA 3ETOA 1WLJA 1NU4A 1SV5B 1U0HA 1U1LA 3MMAB 3OHBA 4USWA 3RSEA 1X5OA 2EBEA 1T9TA 4CLTA 3PKYA 3D2WA 4C7QA 5A76A 5CA5A 3DXMA 3QRRA 2QWNA 3L3VA 4LR9A 1NB2A 3CDEA 2DXEA 2QG9B 2PD1A 4MYUA 3D6RA 1GLFO 1VQ6S 3DMJB 4C3LA 1FRMA 4NLWA 3RBDA 1VBKA 4R5PB 4QIFA 3W8GA 3RB0A 3BN4A 3IS9A 4LFCK 3ZTPA 3P45B 3TARA 3P4IA 3CD6S 3PEJA 1SQEA 4A47A 1K47A 4A8YA 3AFGA 3THXB 2CJAA 3B54A 2W9CA 5KG1A 3QGGA 3RMAA 3QLHA 1M90O 2CQ1A 2W24A 4FZXC 2WTFA 3FZFA 3K2YA 4W92B 4YHHK 2D0BA 9ATCB 2OFHX 4DSFA 5HQMA 2DNGA 1VRQC 3SUQA 1KDNA 4U7UK 2GBZA 4OZ5A 5DDPC 1XNQF 2IIRA 3BBBA 3G6XA 4J91A 2V4RA 1C0TB 2ASYA 1YGYA 2QW9A 1VC5A 3VPZA 1CXUA 1SB6A 1RNHA 4EBEA 1NG9A 3TAMB 1HHQA 1HLWA 3JQJA 2HBQB 2A0FB 4YY3J 4CT9A 2RPIA 2ZOGA 2GIRA 4KC5A 1R8HA 2OEMA 3FGVA 1HNWK 4JI3J 4O5BA 4YB5A 1Z05A 1DLOB 2HS3A 3BY5A 2OCEA 2KN4A 3Q8PB 3LGMA 4AE5A 5KFCA 2F9WA 4DV5K 1XMOJ 2LDIA 3AJDA 1K0VA 4P9SA 2WBNA 4IUFA 3AVLA 4FBTA 4ZP6A 1V9OA 4B3TK 2E1ZA 2V0NA 3SNNA 1PC5A 3QEVA 4ILGB 1HL6A 4NEZA 2P9LA 3I32A 3EN9A 3PY8A 2B9EA 2DHXA 1E4GT 3H1VX 2LKZA 5A8WA 5GADI 3CW2C 5IT0A 3UD4P 2WSEC 3K5LA 1RHJB 5B0CA 3BGUA 4EFAC 1S59A 3T1HF 4N5SA 4WPAA 5CZVA 1CQNA 2C3OA 3FJ2A 3QMQA 5I3PA 5M2UA 1VQ9N 4WF9Q 3MZIA 1WI8A 4OYMA 5HROA 3DHWC 2VCPA 1HNZF 1DKGD 3MX5A 2COLA 3WQUA 4IRCA 2VB6A 2DRAA 5K20B 4PG6A 1QVGM 2W6LA 4JLHA 1Y5NB 2IVFB 3NBPB 2XO7A 3U8XA 4FO0A 4DUYJ 2HBYB 4DQ8A 3C6AA 3M9MB 1NCLA 4M3XA 1HW9A 2O4IA 4B9TA 3EPGA 2AP1A 3NAEA 1ZBHA 3BSOA 2RF2A 3CCES 3L95X 2MEWA 4XIUA 4DG1B 1VC6A 2W9BA 1A6LA 4YDUC 4ZLJA 3SUPA 3QATA 4OX6A 4NXNF 3WHIA 4D3HA 2LEAA 2Z2MA 2HFOA 2LEPA 3Q8SB 4YOWA 3M2RB 3OYDA 3SBTA 4K4XA 3VAGA 4IDHA 2V51B 1VFJA 2OEJA 4EBDA 1SUQA 3IBFB 1ZZFA 2UXDF 4FWQA 1FE4A 4FWKA 3KLEB 1KONA 2BMBA 3N4WA 2CNLB 2NRWA 3EKSA 2HHSA 4CESA 3AH6A 3NAHA 5LXYA 3D68A 5KFJA 1GLAG 3V81A 2K7KA 2UVRA 1B70B 4FPBA 4M42A 3NCQA 4WQ4A 2DCUB 4RW7A 4WQ5A 4CJ5A 4PR6A 2QKBA 2I7PA 4M3UA 4CF1A 1VQNN 3HM9A 4KO0A 3WXMB 1X0FA 2K8GA 4HVJA 5AJ3K 2VQFF 2HHXA 3ZX3A 4FK2A 2R7WA 1LFWA 4M3YA 2V2KA 1SQFA 3DRSB 4OZ2A 4JS5A 2FF6A 1W25A 2I38A 1KQSM 3KTQA 2DEIA 3M2UB 1WSGA 4BWJA 5E3QA 2B6AB 4R8UA 2YHAA 3R1XA 4N8OA 4LF6J 2D9PA 3K7RA 5AQWA 2GVDA 4J9PA 1SIWB 3HKWA 3HZEA 4P75A 4H0PA 3T5LA 1NSQA 3MUMP 3RJMB 1SJ3P 4IFEA 1ZBTA 5L8RC 3W8PA 2C28A 1GMWD 3PX0A 1NPKA 2LFVA 3EGZA 2X1AA 1EETB 1SS6A 3PX4A 2BA9A 4KV8B 1MMDA 3EWGA 2HFUA 3NHGA 5BRHA 3KD1E 2P9GA 1GOBA 1FKAF 2L48A 5HMXA 3CXCM 4G3IA 3ZSRA 1R59O 4F9OA 1GLEG 4DV7F 3KHLA 4GNIA 2B8QA 2J9DA 3GSDA 3H0PA 1YBTA 3IR5B 2CH6A 1GXUA 4KHPK 5L9XA 2B56A 1AZSB 3SQ2A 2ZM6J 4CJTA 2Z56B 4F0MA 1M5PC 1JLEB 3KDNA 2DNNA 1QUPA 1S49A 4J9LA 2A2DA 5AFUH 4O0JA 4IOCL 1BLUA 1QE1B 4YY3K 2W2NP 1G1XA 3FBBA 4OIXA 4DV2F 2FB0A 2ZZNA 3ZSQA 4CEFA 4JI3K 4C2MA 5KFXA 2YH1A 1BIZA 4HH1A 5KFSA 4C8OA 2ZBIA 1V4TA 5KFRA 3ENAA 3EE8A 4ZPAA 5AQGA 2HVEA 4G65A 4RUHA 4CNYA 1OPZA 2HFVA 3QESA 3TZWA 4RR5A 1XMOK 2F8EX 1UFLA 1YJRA 1OO0B 2RHKA 2ZVSA 3A5MC 2ASJA 3HXMA 1S76D 5FRNA 2JVOA 3HULA 3FQKA 2H51B 2WVCA 4JKFA 2XZTB 1RUSA 4QW8A 4KHWA 1VQ4S 4WBFA 5HP1A 2FJEB 1XERA 1RT3A 1Q86O 1UJ4A 4DS5A 2EFQA 5DG9A 2CZ4A 4A8OA 4GKKF 2M4MA 5HOOA 2A2CA 4K8XA 4QYZJ 3BS9A 2BKOA 3GIIA 2P9PA 1ZBIA 1YQHA 3O8WA 3S9HA 2DEJA 1H7WA 3EMTA 3NCRA 3V4IA 1S1VA 4H5TA 3CSKA 2CPJA 2JRSA 3TR8A 3BP8A 4C8LA 1TZ0A 3WZ0A 3EKUA 3ZT1A 4OHYA 4X65J 1DY3A 2KU7A 4DR5J 4DUYK 2GMHA 3TQEA 5U47A 3TU5A 3J7AP 5CD4A 4QIWD 1RTDA 4ZPWR 2P5GA 4A8FA 3M1VA 2AYGA 3BM7A 5DDRC 3AV9A 3W5ZA 2ZVIA 1R6YA 2KW4A 4C97A 1MWZA 2OA8A 3A5LC 1Q8IA 2Y0SD 2Y1IA 3LAKA 4CO2A 4PG4A 3BGRB 4BROA 1HKCA 1UTAA 5J2MB 5B09A 3K5OA 4Z2XA 2Y9HA 3P5JA 3BEXA 2MJNA 3MM7A 3LPTA 1K6YA 1NMEB 4BDZA 3VF2A 1VGYA 1BIUA 1FXRA 3GFXA 4WFAL 4F4AA 3G6VA 3HOTA 3D2FA 1EQ0A 5E3CA 2GIFA 4FWPA 1RAFB 3SIPB 1N32K 2ZITA 3GV5B 2YX7A 5ETMA 1O0PA 2AQ4A 2WVEA 1F0XA 4FJHA 1UMJA 1CJVB 4HHHA 1BOTO 1IKYB 1KHVA 3NH1A 1VQOS 2MDAA 4WCEQ 1DFDA 3BDPA 4ZN1A 1FRJA 3IR7B 1VISA 4OZ1A 3ZSXA 4NLYA 3WQPA 4Z4IA 2ZJPQ 2DPIA 3FZKA 2FJAB 3O80A 4IH6A 1NJZA 5ETSA 2VQEF 2D0CA 3R8YA 2HNZB 4A57A 2AGQA 3MEEB 5HL7L 3FCHA 4P2FA 1U24A 3C95A 4LRDA 1WUUA 4URSA 1VC0A 2JDJA 1SKWA 1SXLA 4LF6K 4JI0F 2G0CA 2EWHA 1A0OB 2F9DA 4IG3A 3RWUA 2D3O1 4LF4J 2CYYA 1RK8A 1MROA 2QEXS 4CYUB 2NUHA 4AHRA 4IR1A 4GC6A 4FF3A 2W2OP 4PY5A 2JC0A 2RD5C 2UU9J 4OPHA 2KXHA 1WEXA 2R7YA 1FHTA 3IMQJ 5GMEA 2JL9A 1HNVB 4M63C 1TP7A 3RBXA 3DLBA 4PZVA 3EZUA 1QVGR 5T7LA 4KREA 3TAGA 1NOZA 4BRMA 3BGOP 2UXCF 2AF6A 2UUCJ 3KK3B 3CJRA 3VAJA 1CPZA 3FE1A 1EB0A 4QS8A 4A5BA 4MO5A 3GMGA 4RU2A 4PEOA 1IM6A 1TR0A 2HK2A 2R8JA 3H3OB 4KH4A 4I2PA 2ZM6K 2M88A 2BJ9A 2WONA 3UVJA 2VG5B 3WQTA 2OO4A 1ZAXA 3HHLB 3M6XA 4DN0A 1M5KC 5GIPA 4XPCA 2ZWPA 3G71N 4GO7X 3OHRA 4DBQA 3Q8QB 3UR3C 2CFXA 3CJKB 4B3SK 4I0WA 2C3YA 4W5NA 4CNZA 3NXZA 3ZYYX 2BYCA 3U02A 3H59A 4IRKA 1JWWA 3LDSA 3QYYA 4A62A 3R5CA 4KGMA 3HT0A 5M1KA 2FY8A 2FVRA 3VQ9A 3OBIA 3GIJA 4TU8A 3OYLA 1QDUB 4Q8EA 3MEGA 4BR7A 4BDPA 5HO4A 4X66F 2VOPA 3VEZA 2R9LA 1NGGA 2HF3A 2YHWA 4JI6J 1WSEA 2HLUA 2ILZA 4W5OA 2MQOA 2G8HA 4FM0A 3DDKA 3RVCA 4QYZK 2EX3A 3OLBA 2G8WA 3N5BA 2PN6A 1H0HB 2P1JA 1R27B 5AQXA 4C0HA 1WG4A 5I3UA 1N8RO 1KQSR 2WSCC 1SL1A 1FCAA 2H4WB 4KHQA 1R7IA 1UVNA 1T9UA 4O3NA 4DR7F 3PHTA 1V4SA 2XHWA 1J5EF 4M7XA 4FYDA 4AYBD 4IYQA 4V1Ak 2POKA 5BYRA 4LF7J 4X65K 3GZ7A 4DR5K 4PXBA 4LH5A 1OQ3A 3R8EA 3KHGA 4NLOA 1C0GA 4HYKA 5KRSA 4GVMA 4M5IA 4OYPA 4IFYB 5TKWA 1VQ8N 2OELA 3D6HB 1AUDA 4DMZA 4IFVB 2YWWA 2OPQA 2DITA 4AHTA 4K5SA 1M5OC 1SJ1A 1S7IA 5FPMA 4O0IA 2EC0A 3V9XA 4H8KA 3HHKA 3G6ES 1Q9YA 5J1PA 3QO9A 1FDDA 3M7VA 2DRDA 4E0DA 3HLUA 3CPEA 1N33F 1YIJN 2VFVA 1JLQB 3D3BJ 4J9MA 4B9LA 4ED7A 1XR7A 4EFHA 2KJVA 3V6DA 2G0JA 4DFPA 2B4VA 3PRBA 4G1IA 1QQMA 3THTA 4B02A 4DZDA 4EO6A 1Q53A 2RE1A 4GO5X 4RUAA 3T1YJ 4QIEA 2YTCA 1DEJA 4H4KC 3ZSZA 4NA2A 3KFWX 4NLXA 5CZXA 1YRUA 1WC4A 3QBCA 2PEHA 2Z58B 4LFAF 4WE1A 4JRQA 1TKTA 2Z2YB 2LA4A 3AVGA 2V9WA 2IM0A 1LV5A 4NLQA 3F9KA 3V9ZA 1FJGF 3I6PA 3F9MA 2FZCB 4LQ9A 5BYQA 1JLCA 4PG8A 1RACB 5JICA 3GG1A 1VSEA 2YI1A 5FROA 4Q0BB 4FF2A 2BRKA 1KWMA 1BUXA 1SC4B 4NO7A 3NNCA 3RRGA 3IO1A 3R7SB 4CGJA 3O4NA 1YKWA 2R7SA 1MMNA 4JP8A 3HT3A 1EWQA 2X7IA 3OYKA 4A61A 4J2AA 2CPDA 3UWTA 2OKQA 5IQ6A 2ZDOA 3RGIA 5LMNJ 2FSKA 3D9BA 1NH8A 1RCXB 2ZHOA 4DL3A 4IOBA 4LF4K 3HF5A 2CGKA 1HI0P 4ICLA 4UT4A 1K8KA 3I87A 2QA4S 1RDUA 4FF1A 5BPLA 3JAMY 4ED2A 1JLBB 3QZ7A 2UU9K 2LVWA 4OX9F 1YJVA 5HANA 2QJ3A 3CCUN 2P6TA 3ZXWA 2ADBA 3QRQA 3M8PB 2D9OA 1GAOA 4K2JA 2FDNA 2QLFB 1CBKA 3A8JA 3AGRA 2GNKA 3C46A 4ES3A 1ICEB 3AVAA 4RUCA 2CPZA 2AKWB 1FFWB 2HNYA 2UUCK 1TK0A 3M6UA 2E1YA 2MQPA 2CG4A 1Y5LB 1C6VA 3RG6A 1K73O 1REVA 3FNNA 2W6KA 4CHYA 1UVKA 2DYAA 3OYFA 3U1NA 4CJWA 2M2BA 3A8EA 1X4HA 2CG8A 2W4PA 4MJKA 3EZ5A 3TUZC 3IBWA 3CCQS 1WC6A 3OFHA 1O13A 2WW4A 5J2NB 2EW9A 4M3TA 5F8IA 1UETA 1V6HA 1M1GA 4UW2A 2QMWA 5JVGL 1N34J 5AQZA 1RWUA 1S6PB 3RAQA 1HBNB 4FJJA 1F2HA 3MN9A 3LP0B 1S1WB 1TQLA 3ZC4A 4IQMA 3GJQB 4CEQA 2HEKA 2R2SA 4DB3A 1NUEA 1JNRB 4QIGA 4V19J 3K17A 2EI5A