3LP1A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 154
structure length 554
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp1A05
3NAHA 3BQ0A 4JV1A 4B9TA 1ZTWA 2PZSA 2VG6A 4I9LA 4WZMA 1I3AA 1S1TA 4UQGA 3MECB 4J9SA 1IKYB 3HJFA 3ZSQA 3OL8A 3T5LA 3DOKB 4CF0A 4IKAA 4MKBA 1RTDB 1HMVA 1W9HA 4URGA 2JEGA 2JC0A 3AVLA 2W7OA 3KTQA 1VRTB 2ZQBA 1BQNB 3KLFA 2PYLA 3TAEA 3VQSA 4ID1A 3PW2A 4LSNA 4J9MA 3RMDA 3SPZA 5E41A 1ASVA 4WYLA 2Q3SA 4TLRA 1RBVA 3FFIB 3ULDA 1LW2B 2WCXA 3OYDA 4FM2A 2UVUA 2BE2A 2JEJA 4Q5VA 3I5BA 3AVCA 4RG8A 2G8WA 4FLTA 4DQIA 1DTQB 3KLHA 4DMNA 4TY8A 3V9SA 1T94A 1WLJA 2JEIA 4I7FA 3I8DA 1G15A 4OGEA 4Y2CA 4RW4B 4Q45A 3CVKA 2IM2A 3BR9A 3LWMA 1LWCA 4CEAA 1BCOA 3LPTA 2FVRA 3C95A 2DPIA 4K4UA 3Q8PB 2UVVA 5DG9A 2FJVA 2E9TA 2EC0A 4W5QA 3PW4A 3LP3A 4LH4A 5F8IA 4NLTA 4AHVA 2HW3A 3VQ9A 2BGGA 1SV5B 3H59A 4ZVEA 2YNFA 4GMJB 2DTUA 3QEWA 4N41A 3M8PA 3OYJA 2ZE2A 2WRMA 1RT5B 4DF8A 1B9DA 2YKMA 1RA7A 4NLPA 2ALZA 1LAVA 3GIJA 3H5UA 3TANA 2HHQA 2R8HA 3HVTA 3UQSA 3HXMA 1KTQA 5KFOA 4CFBA 1SL2A 3V9ZA 5HP1A 3OYEA 3CQ8A 4DG1A 3ZT4A 3OS1A 3O4QA 4XPEA 5DG8A 3TQ1A 1RT7A 4HHTA 2HVIA 1SUQB 1HPZB 3MEGA 4FS2A 1S1XB 3ITHB 3AVIA 4E7JA 3OYGA 3K5LA 1J5OA 4NLUA 1S0MA 1BCMA 3QZ8A 3BQ1A 1RNHA 4Q8EA 1T05A 3V6KA 3IAYA 1T3NA 2BE2B 3L2QA 3CDWA 4RNHA 1ZBHA 1HPZA 4M3TA 4O0IA 4KB0A 4WFYA 2AU0A 1NK0A 2DY4A 1S1WA 4LSLA 4NRTA 4RUAA 1S6QB 1S0NA 2KZMA 4MFBB 1EKEA 1RDBA 2WHOA 1REVB 4Y1DA 1WNEA 1BQNA 3KLFB 1ZETA 3ASMA 1S1VA 5KFMA 1TQLA 4ZVFA 4IKFA 3DYAB 5K14A 2ETJA 2CJQA 4DL6A 5F8MA 4QWCA 3L2VA 1KHWA 2FC0A 4AHCA 3HVRA 1XHXA 3VA0A 5JXSA 3DLRA 1SKSA 5KFRA 5HLFA 4OKKA 1J5OB 5KFWA 2YNFB 3C6UA 1N6QA 1NHUA 3KD1E 1TVRB 3RMCA 2UUWA 3I5AA 4GC7A 4CGJA 1LW0A 4Z4GA 3P1GA 4Q44A 3IGNA 4CJ4A 1SKRA 1K1SA 3D0PA 3TABA 2RDJA 2XCAA 3UR0A 2XI2A 2XY7A 4EO6A 3SPYA 2VA2A 4E19A 1L5UA 4NCBA 5HP1B 1D9DA 1RTJA 1RYSA 4KHUA 5KG4A 1T03B 4CF1A 1JLAB 4CFAA 3NGDA 2F96A 2FBYA 5FROA 1LWCB 3AVJA 1ITGA 3SCXA 2C2DA 3AO1A 2RKIA 4ZP6A 1KCFA 4IRDA 3KLGA 1EP4A 3L3VA 2EHGA 1TL1B 1RBRA 3FQKA 3L2UA 1F21A 4NLDA 4CEBA 4YMEA 5CZ2A 1DTQA 3KLHB 4TYAA 5KRSA 2RF2A 2XI3A 3QIPB 1TKXA 5HRPA 4IFVB 1Z25A 3ISNC 4DTOA 1C1BB 4K4SA 3C6TA 3WNGA 3PW7A 1ZBLA 1I6JA 1WSFA 3DMJA 4N56A 4M42A 4I2QA 3VQAA 1S9EA 1JKHB 1DTTB 3PX6A 3PJXA 3IG1B 2YNIA 4ZPBA 2OPQA 2O4GA 2AX1A 1NK8A 3QINA 5J1EA 3M8RA 4TXSA 1RT6B 4FJIA 4DTRA 2YKNB 2X6SA 5HROA 2FVPA 3CIZA 4NLVA 1QAJA 1IKYA 4K4VA 3K5NA 3S3OA 3I5CA 1NJXA 4ECWA 4ECYA 4CJFA 3M8SA 5L9XA 4FBUA 1TK5A 2D0CA 1JLQA 3OYAA 2HHUA 4M94A 4H4OB 4U7CA 3MR3A 3DOLB 3K5MA 4DTJA 4CK2A 2YNGB 4M3RA 3T5JA 5J2NB 2XY6A 1RILA 4IDKB 3CDEA 4CJ5A 1RDAA 1NKEA 3H08A 4IG0B 4PQUA 3T5KA 2XCPA 4ECSA 2C2EA 4C8LA 3U3YA 1S6PA 3KKRA 1W0HA 3V4IB 4KI4A 3DRPB 3MEEB 2FLLA 1BISA 4IR1A 3L3UA 4R0EA 3PX0A 4KB1A 1TP7A 5EDWA 2E9ZA 1UWBA 5SZTA 2W9AA 2OPRA 2W9BA 1KRPA 4ECRA 4DTUA 3KLEB 2ILYA 4DU4A 4KKOA 3LP2A 4RW8B 4CK1A 4ZTJA 1GOCA 4J9LA 3IGVA 3DI6B 1IO2A 4QWAA 1TK8A 3RR8A 2ITGA 4AILC 2B5JA 1HYSB 1YTAA 1JLBA 1HQEB 2YNGA 4KFBA 2IBKA 3SUPA 3K2PA 3PY8A 4KAZA 2FBXA 4J2EA 4WYWA 3KLVA 2FVSA 1JKHA 4ECZA 3CWJA 2WOMA 1VSHA 3PR4A 1S9GB 3IN5A 3VA3A 3V81A 3RMBA 4FLVA 1JIHA 2AGPA 4FJ7A 3OYHA 1VSFA 4DQSA 4CE9A 1YT3A 4FZYA 3MAQA 2RF2B 1D1UA 1RTHA 4ZHRB 4CEDA 4W5NA 3TARA 2A1SA 4CHOA 4G1QB 4CEFA 2BRKA 4HCBA 1CXUA 1XHZA 1KSPA 4XIUA 4ELTA 1CZ9A 5J2MA 2G8HA 4MIBA 3QZ7A 1VRUB 1HNVA 3PVXA 4CF2A 1KLNA 2G8FA 2ASLA 4M41A 1QUVA 4KFBB 4FK2A 2WONB 1L3UA 4AHRA 2IM3A 3TAPA 4R8UB 5KG2A 3PJWA 4FLWA 4DSEA 4O44B 3KMSA 1IH7A 3K5OA 1UA1A 1NNDA 3MR6A 3QEIA 3KK2A 1UAXA 2UVWA 4FJ9A 4RW9A 4FLUA 2FBTA 1ASUA 3AA5X 1C1AA 3ZSRA 2R2RA 4B9UA 4WXOA 5KFJA 4Q0BA 3KIOA 4G3IA 3AVBA 1QE1B 2F8EX 3IRXB 3O3GA 4PA1A 3DLBA 3AVMA 4J2BA 3H4DA 3RB6A 4NLQA 2J6TA 3BREA 5L1JA 2KZZA 1S1VB 2JC1A 5KRTA 4KO0B 1IG9A 4DSIA 5I3UB 4JUZA 5HBMB 2QE5A 4DL7A 4K4TA 3SZ2A 5HLFB 3OSPA 3E01A 4J9NA 2FJWA 3AA4A 2PY5A 3ZCMA 4IDKA 2C28A 5KFVA 2R2UA 4NLGA 5EUHA 1WSGA 2AWZA 3DLKB 5HRSA 3DRPA 1UOCA 3VQQA 4IOBA 4CEEA 3BGRB 2J6UA 2D5RA 3SFGA 2BDPA 3VQCA 4CFDA 3DYAA 4YQWA 5KFTA 2YKNA 1RT3B 3HPHA 2XGPA 4JV2A 1REVA 1OS5A 2B43A 1WAJA 4CJ3A 3ZSWA 4MFBA 3LALA 1RBTA 4NLYA 3EPIA 4F3TA 3GILA 3IG1A 3VN5A 2W8LA 2ATQA 3QEVA 1LV5A 1KVBA 3OHBA 4F3OA 4CHYA 4B9LA 4CESA 1MU2B 1LWFA 4EBDA 2XHBA 4JS5A 4I2QB 3KNAA 5KG5A 4AHUA 3PV8A 3RRHA 3OYLA 2OPSA 2AGOA 5KFDA 1RT2B 4FZXC 4CEZA 4E7IA 4DTXA 3PUFA 3OSNA 3QESA 1RA6A 4O3QA 4Z0UA 3OS0A 3HHKA 4KHMA 1C1CA 1JLEA 4OPKA 3C6TB 2UUTA 5KT5A 4DU3A 4ZTFA 4LD0A 3HP9A 4CIGA 4FVMA 3V81B 4IFVA 4OLAA 4HKQA 3V9UA 3SI6A 4JRPA 2HWHA 4DG1B 1TAUA 4AH9A 1S0OA 3HPGA 3NF8A 3H5SA 2QKBA 3KLGB 4Q43A 3B6PA 3NF7A 2AX0A 1ZYQA 3C94A 4GC6A 2IS3A 2JEFA 3OJSA 1R0AA 3DI6A 3QGGA 4I2PA 4QW9A 5DLFA 4TY9A 4RW8A 4RW7B 4KV8A 4ZVGA 1NJWA 3TI0A 3Q8QB 3GV7B 1YVUA 1QHTA 4ZP9A 4EO8A 2ATLA 4IFYA 5DQIA 1CLQA 3LAKA 1MMLA 1JLEB 4O0JA 4MKAA 3DLHA 3D5MA 1N6QB 4X2BA 4NYNA 1IKXB 2VG5A 2RPIA 1IKVB 2D0BA 3P83D 4ID5B 1S6PB 5JS1A 3HK2A 2OPSB 4F2RA 4MK8A 2UVRA 4CJRA 4RNFA 3AVKA 3OYNA 4FK4A 2KQ2A 3QLHB 4QWEA 1C6VA 3GIIA 4LSNB 5KFGA 3VQDA 2GUIA 3VQ4A 3NH1A 2VG7B 5KT4A 3T19A 2PYJA 4FJMA 3H5YA 1CSJA 3TWHA 1S6QA 1C2PA 4CJUA 2HHXA 3OHAA 3HM9A 3SYZA 5DMRA 1TAQA 3L2WA 1IM4A 3V9XA 4BWMA 1IKVA 2VG5B 5K14B 4B9SA 1T05B 5JUMA 2ZKUA 1X1PA 3N6MA 3MEGB 4QW8A 4DFMA 3OLAA 5F8JA 2VG6B 4ELUA 3HP6A 3KLIB 4E7KA 3FSIA 1RT6A 4YR0A 1J9AA 4O3OA 2KFZA 3G6XA 3CG7A 3ISND 3VQBA 1RT1B 1D0EA 2XY5A 4BACA 1KHVA 5KFYA 1RT7B 1DLOA 4CJQA 3LAMA 4ZP7A 4ID5A 4Y2AA 4DL3A 1VSMA 4RW6B 5F8GA 3V6DA 4B08A 4YFUA 2G8IA 3IRXA 2OA8A 1IKXA 4CJLA 2AGQA 4RU9A 3KK3B 3CFOA 4DFJA 1TK0A 1X9SA 1XI1A 1A5XA 4CJSA 4W5RA 4C8KA 2VWJA 2IGIA 3WNHA 4CCHA 3QIPA 3HVTB 2V4QA 2JGUA 3O3HA 2OPPA 1S1XA 3M8PB 1GX6A 4MK7A 4O4GB 1SUQA 1NK5A 1RT4A 4ED7A 4E0DA 3H5XA 2HNDA 1VSDA 3OL7A 4ZVHA 4FCYA 4DLGA 1NJZA 4ICLA 4LQ9A 4BWJA 1J53A 2OPPB 1WSHA 3GV5B 3QETA 1SV5A 4N5SA 3AVNA 4O3RA 1NK4A 4R5PA 1N56A 1HARA 1VRUA 4AHSA 3KMQA 5L1LA 4EYHB 1BGXT 3UPFA 1BI4A 4DSKA 3O4NA 1HYZA 4ECQA 1EX4A 1DLOB 2FJXA 5CY4A 3FQLA 3SUOA 3TAGA 1TKTB 1RT4B 1TV6B 3OYMA 4LH5A 1J54A 1NK6A 3C6UB 3THVA 4M3UA 4PUOB 4URSA 4FJ8A 4MK9A 5FDLB 4BE0A 4O55A 1U49A 3KK3A 4ED2A 1A5VA 1JLFB 3L8BA 4NZ0A 4TQRA 1FKOB 1S9GA 4F4YA 1JL1A 3HT3A 3EYZA 2FBVA 4HUFA 4FK0A 4N76A 3RB0A 1SL0A 1RDCA 1SH0A 3I0RB 1JL2A 4RZRA 1T8EA 4OKEA 3H2LA 4FXDA 1RT1A 3V6JA 4RUCA 1XR5A 2C22A 3KKSA 1JLBB 2X78A 3HPOA 4C8MA 2BANA 5CYQA 4ECTA 1HYSA 5F8HA 1WSIA 2W7PA 4DEZA 5KFIA 1EETA 1RTDA 5DK5A 3LWLA 3AO5A 3LP0B 1VRTA 4IRKA 4K8XA 1QQCA 4IG3A 3S3MA 1S1TB 2P1JA 2RDIA 3BGRA 4EBEA 4KTQA 3F9KA 3GIKA 2IC3B 3G0ZA 2R2SA 1ZBUA 2YNHB 2E6LA 4DWIA 4J9OA 4KREA 3HVAA 3E01B 1BIUA 4TSXA 3ZT0A 4CFCA 4DQPA 3QLHA 4J2DA 5HBMA 4KO0A 4FJXA 3NHGA 5KFPA 2E6MA 3O3FA 4AHTA 1U09A 1N5YB 2OH2A 3G6VA 3I0SA 3OLBA 3AVAA 3B6OA 2I1RA 4RW9B 3SV3A 1HQUA 3G6YA 3K57A 5J2MB 4IFYB 5EWGA 4DSJA 4O44A 4H4OA 4WZQA 1JLQB 4EZ9A 3TAQA 4HYKA 4IH7A 3KK1B 4ZPDA 4ZHRA 3DRRB 5KFSA 1X9MA 4Z4HA 5F9NA 2WK4A 2I5JA 4I2PB 1D9FA 3AO3A 3ZT1A 5KFNA 3FDSA 1RTIA 3QGIA 4M45A 5KG6A 4ED8A 2IJFA 2O4IA 1WSJA 1HYVA 1HNVB 3KHLA 5C24A 3NBPA 1ZTTA 1S4FA 4NYFA 5C24B 3BJYA 5KT3A 1MU2A 5KFAA 4M3XA 4CK3A 4G1QA 3KHRA 4I7FB 2HAIA 4ED3A 1BL3A 5KFXA 5L1KA 2E4LA 5KFUA 3CYMA 3LP2B 1BQMB 2GBZA 1D8YA 3KOAA 1K6YA 3SQ1A 4YR2A 1TL1A 3OYIA 1I39A 4FM0A 4B8CA 1NJYA 3CDUA 4DF4A 2W8KA 1QS4A 2P5OA 2C2RA 2X6NA 3PO4A 2HNYB 3OL6A 3N6LA 1S1UB 4CECA 3CM5A 2KTQA 2IOCA 3VQPA 3NFAA 1FK9A 5C5JA 5DGAA 4J2AA 2D41A 2J6SA 1NKBA 4JS4A 4WE1A 4EYIB 1Q9YA 1C0UB 2XRIA 4IG0A 4PQUB 5KFLA 2ZD1A 2OZSA 3A2FA 4HUGA 3EZ5A 3DLKA 3KLEA 5I42B 2IC3A 2B4JA 1SL1A 3RAQA 1U04A 4CHPA 4F4KA 2D3ZA 3QNNA 4OLBA 1RYRA 3SFUA 1B9FA 4KB7A 4KHYA 3CJ3A 4DL5A 1KFSA 3CM6A 3Q8RB 3NGIA 2NUBA 3V4IA 3L2RA 4NCGB 4RNNA 4PY5A 5KFHA 5F9LA 3KHHA 4FJKA 1TKZB 3IS9B 3GV8B 2IAJB 1S5JA 2OZMA 1Z26A 3I0SB 1C0UA 3BSOA 2GIQA 2WONA 4JLHA 2YHBA 1JXBA 1N4LA 3VQEA 3HSTB 4FJNA 4ZPAA 3NCIA 4LSLB 1S49A 1S1UA 2AJQA 2AQ4A 3KJVB 2W9CA 5KI6A 4CJVA 2HHWA 1L3SA 1GOAA 3PW5A 2R8IA 4EBCA 2EX3A 5KFKA 4YR3A 4CF9A 1W25A 4DSLA 2ASDA 1JLFA 3OS2A 2V9WA 3VQ5A 4F4XA 5KT6A 3PW0A 1RDRA 2HNZB 4OKJA 2ASJA 5FDLA 4FZZA 4LQ3A 5HRNA 4KRFA 1HRHA 4NLXA 2OPQB 2YHAA 5HROB 3T1AA 1DTTA 3HL8A 4DS4A 2HB5A 3PO5A 3DRSB 2RKIB 2CKWA 4KTZA 3M8QA 4Y34A 2BANB 4Z4CA 3MEDA 3MR2A 3DMJB 5HRRA 1C0TB 4YP3A 3PX4A 1U47A 3V1OA 3RRGA 3NBPB 2IMWP 1JLAA 4CHQA 1RTHB 4F8RA 4W5TA 4NLOA 3EPGA 3NMAA 3LPUA 3ZSZA 5EWEA 4ICLB 3KHGA 4BDYA 1GOBA 3BSAA 1RT5A 3M9OB 3PZPA 3MXMA 1U48A 1WSEA 3H40A 1TV6A 1ZBIA 4K50A 1RCHA 1HQEA 4IBNA 3VQ7A 3DLEA 2Z1IA 4GW6A 3NDKA 2XO7A 1RBSA 4DQRA 4B3OA 3RBEA 4H4MA 5D3GA 5C25B 5JS2A 3UDLA 4ZMMA 3CFRA 3MR5A 2W9BB 1Q8IA 1KLMA 1QSLA 4CIEA 4PWDB 3BSCA 3MFIA 1XWLA 1NHVA 4OL8A 4MH8A 4O4RA 2HNDB 3DRRA 3RTVA 4FYDA 3AVGA 4O4GA 4ECVA 3EY1A 3LP1B 2FLPA 2HWIA 4Z4EA 4DS5A 2B6AA 4IH5A 3SUNA 3QIDA 3JYTB 2P51A 3MXIA 4Y1CA 1FKPB 2WTFA 3LP0A 3FFIA 3JSMA 4BDPA 3QERA 3SQ0A 4CHZA 4F4WA 2ILZA 4E3SA 1EETB 4RW6A 2GC8A 3FRZA 5KG7A 3RAXA 4FM1A 5J2QA 3ZSYA 3HYFA 3MF5A 4CGDA 4KE5A 3PHEA 3TVKA 4GVMA 1TL3A 2Z1JA 1S9EB 3E51A 3DDKA 2YNHA 4MQ3A 4HTUA 4URQU 4FLZA 3G10A 4KPYA 2FVQA 4J9RA 4F50A 4I9QA 4J9QA 4XO0A 3S9HA 1TGOA 4RNMA 3RWUA 4QWBA 3OVNA 2Z1GA 3LP1A 4KHQA 4FJJA 2D7SA 2BQRA 3ZSXA 2Y1JA 4K4ZA 4RW7A 1S97A 2YV0X 5CYMA 5CYQB 1YTUA 1VSIA 4KTWA 4HVJA 3QEXA 3TAFA 3MTKA 3AV9A 3S3NA 3JYTA 5C25A 3CFPA 3OYKA 1T03A 3I0RA 4KAIA 3N6NA 5KT2A 4DTPA 3DM2A 2ZE2B 1LWEA 3AO2A 2V4RA 3ZSVA 3ALYA 4DSFA 1KVAA 1U45A 4J9PA 2XWYA 4BE2A 4CIFA 4PWDA 4PUOA 1A5WA 4H54A 3QYYA 4OGCA 4ELVA 2HHTA 1HJRA 1LWEB 1U4BA 4KV8B 1JXLA 5C42B 3SQ4A 4TN2A 1CXQA 4CGGA 3TR8A 3DLEB 4R5PB 2WB4A 4O3NA 1UA0A 5KT7A 2DPJA 1WAFA 2D3UA 4F2SA 1TVRA 5F8LA 4FLYA 4M3WA 2DFHA 4KHWA 3RR7A 5KFEA 4NCAA 4E1MA 4RW4A 4IQXA 2W42A 4DL2A 1S1WB 3SI8A 4EP5A 5KG1A 3H4BA 3UIQA 1QSSA 4DFPA 1L3TA 3NH2A 4TY8B 4B9VA 2Y1IA 4CGHA 1VSKA 4M3YA 4Y3CA 1B92A 4CGIA 1TL3B 1VSLA 5KG3A 1N48A 2VA3A 5I3UA 3ITHA 2R8KA 2R8JA 3V6DB 2VG7A 2X74A 5CYMB 2VWKA 4OJRA 2R2TA 2F8SA 1NOZA 3NGYA 1HMVB 5T14A 2V0NA 1JLGA 4N47A 4NRUA 4U6PA 3NL0A 1NK9A 3LANA 5J2QB 3NKYA 5KGXA 2HNZA 3KLIA 3ZT2A 5DGBA 2HHSA 3RB3A 3OYCA 5CZ1A 4Z4IA 4QAGA 4NYZA 5DG7A 2LSNA 3GQCA 3DOKA 1QSYA 2IAJA 3NH0A 1Z4UA 3RB4A 4QWDA 5T7BA 3NE6A 3V6HA 1XR7A 1VK0A 1ZBFA 4M3ZA 1C0MA 1KFDA 2GIRA 4ED6A 1RBUA 1TKDA 3KD5E 2YKMB 3NAIA 3QGHA 1NOYA 3VQ8A 1CZBA 1KLMB 4NLSA 2KW4A 1XC9A 4C8OA 4FJGA 4CJPA 1R0AB 3SJJA 1D5AA 3V9WA 1T7PA 1KVCA 4B8AB 3P5JA 1GX5A 3K58A 2B6AB 4J9KA 3SNNA 4CERA 4BE1A 4WE1B 1SH3A 4K4XA 1IKWA 5C42A 4DLEA 4CJEA 4FJ5A 1RAJA 5F8NA 4KI6A 3D28A 3LZIA 5I42A 4K4WA 2JLEA 4JRQA 4QOZB 4CGFA 2ZD1B 1C1CB 3AVHA 3QNOA 1VSJA 5EWFA 3DLGA 2G8VA 2DFFA 1JLCA 2IM1A 5KFQA 4E7LA 4XPCA 4DU1A 4H4MB 5D3GB 3CO9A 3DM2B 3K59A 3RBDA 3HO1A 3EZUA 4F4ZA 1NKCA 3BQ2A 4DQQA 2HVHA 4FW2A 5DQHA 1LWFB 1HNIA 3V1RA 3AA3A 3M8QB 2P5GA 1SH2A 1QTMA 2HMIA 1QAIA 5DQGA 4YNQA 4OVLA 4O3SA 5DLGA 1L3VA 2R7YA 3OYFA 4DTSA 4EEYA 3QO9B 4KHRA 3TAMB 5J2PB 2FLNA 3LDSA 3AA2A 2OPRB 1RTIB 2A1RA 3OJUA 1LW2A 4KHNA 3MECA 2IDOA 4NLWA 4IR9A 3GYNA 5KG0A 4KSEB 4JV0A 1RT2A 4CJKA 3WNFA 1IKWB 4B9MA 2G8KA 3MEDB 4OPJA 2QXFA 3D45A 1NK7A 3DRSA 1K1QA 5KFCA 2XC9A 1Q9XA 4TYBA 3PR5B 2BRLA 3G86A 3CJ4A 1QE1A 3OL9A 2RN2A 2F8TA 3JSMB 5J2NA 4ED1A 1RT3A 1FKPA 4E89A 4KKOB 4Q0BB 4W5OA 3IS9A 4WXWA 2KFNA 4FW1A 3LZJA 3KK2B 4DL4A 3ZT3A 4BDZA 4LY7A 2BQUA 3U6FA 2QV6A 3NF6A 3QEPA 3MEEA 5FRNA 4R8UA 4H8KA 4IH6A 3M9MB 2Z1HA 3BSNA 5KFZA 3Q8SB 4FS1A 3VQ6A 1O1WA 4QCLA 3TAMA 4EP4A 3ZSOA 5L1IA 1TKZA 3CJ2A 2BQ3A 4CJTA 1VSEA 4B3OB 4HUEA 4NCGA 4DTNA 1FK9B 1BIZA 3OYBA 3WNEA 2HMIB 4CHNA 4O3PA 1XR6A 1WNSA 3T5HA 3DOLA 2E9RX 2HHVA 4IG3B 1C1BA 4IRCA 5J2PA 1TKXB 3QO9A 1RDDA 3MXJA 1S9FA 2DFEA 2OYQA 4MIAA 1FKOA 3HKWA 5EU7A 1JLCB 4CEOA 3F73A 1BHLA 3SUQA 4QPXA 4DTMA 4E1NA 2WOMB 4K4YA 1WN7A 2FVCA 3H98A 4KBIA 3RMAA 5J1EB 2R8GA 3NF9A 5FRMA 2D0AA 4Q8FA 1LAWA 4FBTA 2YNIB 1TKTA 1YVFA 3MFHA 4RNOA 2O5DA 3T3FA 1C0TA 1RTJB 2HNYA 5KFFA 4FLXA 2XGQA 1HNIB 3AVFA 2B5JB 4EZ6A 4ED0A 1BI4B 4CF8A 4O5BA 3GIMA 4HCCA 4E7HA 4TQSA 4ECXA 1BQMA 2I5JB 2G8UA 2IJNA 3DLGB 3CJ5A 4CJWA 1SKWA 1EXQA 3KK1A 4ZPCA 4L8RB 1X9WA 3V1QA 1UWBB 3M9NB 1S10A 3SQ2A 3NGZA 1JX4A 3QIOA 5KGWA 1EP4B 4ZP8A 1ASWA 4CEQA 1S48A 1Y97A 4B9NA 4FJLA 3KJVA 3CJ0A 2W9CB 1FXXA 4M95A 2BR0A 3U3GA 5KFBA 4Z4FA 4KHSA 3SV4A 1HQUB 4WFZA 4WFXA 4NLRA 4C8NA 1JXEA 3OY9A 3ICLA 4ECUA 3AO4A 1JLGB 2IM0A 2GV9A 2XY8A 5SWMA 4DFKA 4K8ZA 2QKKA 3BDPA 3HVWA 1N5YA 4FJHA 1LW0B 2IA6A 3NAEA 2QK9A 5KTQA
chains in the Genus database with same CATH superfamily
4DJBA 2E20A 2MZSA 3E9LA 1HBMA 5K9FA 1RWXB 1FRXA 4WZMA 1NJIT 4U8YA 1K8AT 2LLZA 3B6BA 4J9SA 2GAGC 4BC9A 3ZSQA 3OL8A 4YOVA 1ZAWA 4MKBA 4KQZA 1HMVA 1HBOA 2JEGA 4HACA 3AVLA 2CPEA 4JI0F 1U2VA 1BMQB 1BO5O 5B0CA 3OVSA 3TAEA 3M1VB 4DCOB 5B0AA 4BGAA 1WD6A 4FNIA 5DDRC 3SPZA 3D7SB 3HM8A 4C23A 1NO8A 3L6QA 4TLRA 1RBVA 1LW2B 3CF5L 5RUBA 5K8MA 3K89A 3GPAA 1UCNA 3I5BA 1FJ7A 2G8WA 2L3MA 4FLTA 1IBMJ 1X5PA 1NEEA 1T3VA 2DHGA 3V9SA 1J27A 2W6LA 4K5SA 1WLJA 2M8HA 2WW8A 2JEIA 4I7FA 2WSFC 4L3KA 3U9DA 1ULRA 4Y2CA 2MJNA 4OJGA 3DOMB 3P39A 4HVZA 2UVVA 2E9TA 1UVMA 2RRBA 3J7YI 2M88A 3LP3A 5F8IA 4KYZA 3IBCB 3HSCA 3EDQB 2HW3A 1R0CB 3D6FB 2YNFA 2DTUA 2ZE2A 2WRMA 3T41A 4O23A 3D0GE 4DR3F 4DV6F 3H5UA 5EVZA 3VAKA 1VBKA 3CCSS 1RBAA 1P27B 2Z0GA 4YY3F 1S72N 3O8WA 3I8BA 3IR5B 3M1VA 4FPBA 1VQPS 3IWLA 4YN3B 3V2UC 1VIOA 4A47A 2HVIA 2GO8A 1U0HA 1ZC6A 3WXIA 2O1PA 1SUQB 2EVZA 2DNYA 5AQXA 1S1XB 1KS2A 4L3QA 3R7SB 3K5LA 2W24A 2C2OB 1VQLS 2NRVA 4EIAA 2BKOA 5G0RB 4Q8EA 3V6KA 1U2FA 5DM6Q 1T3NA 5GAHI 3IR6B 2B9XA 1ZBHA 1HPZA 1VBYA 1NLVA 4RBVA 5F41A 4O0IA 4DN0A 1NK0A 1S1WA 5L38A 3MXHP 3AOCA 4NO7A 4NRTA 2UUCK 2AJ4A 1S6QB 1S0NA 4ZITA 2ACMA 2W4DA 3ELHA 4JYAJ 1R6YA 1WNEA 1BQNA 2ZEJA 1NM1A 3ZTSA 1JWWA 2VYPA 2RH3A 4HACB 5AQTA 1S1VA 2H9ZA 4MT1A 3I55S 2PGCA 3W8PA 5IT4A 4IKFA 3TX0A 2HBRB 1FESA 2ETJA 3J80Y 3BPSP 2GAHC 3L2VA 4ZLPA 3J81j 3DLRA 4LF9J 3DDNA 4ZN3A 2MZRA 4JI3F 3FEYB 4OKKA 1J5OB 1NH7A 4PKGA 3LUYA 3P4UB 2FZCB 1N6QA 2YWHA 3KD1E 4X4PA 2UUAK 3FZKA 3CCUN 2ZJQL 1LW0A 3P1GA 3HBTA 2AKWB 1K1SA 3D0PA 2XMVA 2XS5A 5GAEU 3BBFA 2XCAA 4OZ3A 3FBEA 2XY7A 2KT3A 2IBOA 4EO6A 3SPYA 2VA2A 5HP1B 1RTJA 2BV3A 2W2PP 3VQTA 2CIMA 4KHUA 5MAOA 1LWCB 3SCXA 1B0VA 3K9JA 2H54B 3AO1A 2DTJA 4S0MA 4LFBJ 1KCFA 4OFZA 3J81Y 1MWQA 4DCJB 1HLWA 1F21A 2MHNA 5CZ2A 2KFYA 4BRGA 5KRSA 3CXCR 2RF2A 3QRQA 3ISNC 1C1BB 4Z7YA 1Q82O 2X1BA 3HCXA 4OZJA 3ONQA 4BR5A 3C6TA 3L95X 5HVGA 2B7BB 2MGZB 4PPDA 4ES2A 4N56A 1ILYA 3GJRB 2V5HG 4I2QA 2X1FA 3QBXA 2HGMA 3CCQN 1JKHB 3P5TL 4WFAQ 1FI4A 3AA8A 4ZPBA 3F2KA 3SMSA 1FE0A 3QINA 3QT7A 3AQPA 5J1EA 4TXSA 1RT6B 4FJIA 2GZOA 2YKNB 2YKOA 4MO4A 4AYBD 4A2AA 1RLCL 3K5NA 3S3OA 2WUSA 1VYAA 1I94F 3J80U 4ECWA 4AL6A 4CJFA 3POTA 2D0CA 3HULA 3OYAA 4KT0C 2QLFB 1KC8O 4IOAQ 4U7CA 1J5EK 2VUGA 4DTJA 1BUXA 1NBEB 3T5JA 2XY6A 1RILA 1G6BA 2Y3YA 4CZMA 3CDEA 4RR5A 3THWA 1X5SA 3GG4A 2YHWA 1SBRA 1F60B 4IG0B 1RWNB 1CJTB 3MPWA 4ECSA 2C2EA 4C8LA 4U9RA 3U3YA 1W0HA 2FLLA 4BC7A 5EGYA 3DCAA 4R0EA 1Q7YO 3H3NO 3WXKA 2JL9A 4MKYA 2E9ZA 1KP6A 1KR4A 3BGUA 3HOTA 4IEEA 4A48A 1D9AA 3SSRA 4DU4A 4I6WA 5ADXA 3LP2A 2CYYA 4B1YB 4F3MA 4YDUC 1WEYA 3TZYA 3E9PA 1IO2A 4QWAA 3RR8A 4AILC 2UXCK 2A2DA 3ZXWA 3N4WA 1HQEB 1NWKA 4M5IA 2IBKA 2BJ1A 5HVFA 1ZBTA 3QATA 4RBTA 2F63A 2KXNB 4DQ8A 1UVLA 5BR8F 2FVSA 1JKHA 1HWIA 3K7RA 1O5JA 3PR4A 3OFGA 1XUPO 2AEFA 1ELOA 2DGTA 3BKUA 3HHEA 4MKVA 3JQMA 4M7YA 3UD5A 1OPIA 3MAQA 4FZYA 4KGXB 5H1SV 2A1SA 1VC6A 4HH1A 4CEFA 3B8AX 3M2VA 1XHZA 4XIUA 2EFGA 2CQ1A 4TU8A 3EE8A 3PYDA 4MIBA 4FXVA 4CF2A 3VEVA 2H3GX 1H2TZ 4KFBB 4ENOA 1VOMA 4YHHJ 2VC1A 5AZJB 1L3UA 3CQXA 1PG5B 4AHRA 2IM3A 2AP1A 1DURA 5KG2A 2IVYA 1UA1A 4PABA 2RU3A 2FDNA 2VASA 4O0NA 3ZZPA 3NY0A 5AQKA 3MZIA 4FJ9A 2VONA 4RW9A 2V69A 3CJ1A 4BRFA 2P9CA 4C3KA 1ASUA 4B9UA 4CNYA 2NXEA 5KFJA 1E3MA 3KIOA 4G3IA 4BGBA 4DR5J 1Q16B 2DY1A 2ZDOA 3DLBA 4J2BA 1BWVA 3H4DA 2J6TA 3BREA 3ZETB 4A59A 4DV0K 4NA3A 3RSEB 4BR9A 4K4TA 3SZ2A 5HLFB 2QYCA 2J8AA 2CNOB 1S5ZA 2LEAA 2PY5A 2YX4A 2VD3A 2R2UA 1WSGA 2BM0A 2H51B 4GKKK 4DUZJ 5HRSA 3Q24A 5AE3A 5D4OA 2ZH3A 2D5RA 3VQCA 4CFDA 1WG1A 2LXIA 4YQWA 3DRXA 4FWOA 2YKAA 5F0XA 2WTUA 4DR1K 5BN9A 1RT3B 3HPHA 4CZLA 1REVA 2B43A 4CJ3A 3ZSWA 2HVDA 1RBTA 2ATQA 1LV5A 4RWXA 1IVZA 1BQXA 4X66F 4LF8J 5HJXA 3WX4A 4JI5F 4I2QB 3KNAA 4JYAF 3FMBA 2QI2A 3SXLA 3PV8A 3TSPA 3OYLA 3MN9A 4FZXC 3CPWM 5GAHU 3H3OB 4JI3K 4NZ7A 2DB1A 4Z0UA 2ROPA 3OS0A 3HHKA 4H0OA 1TU0B 1RWOB 4YB7A 2OSRA 2CPXA 3HP9A 1QUPA 3TA2A 4OLAA 4IFVA 4MJKA 1S77D 2AA4A 4DG1B 4IEIA 1TAUA 2NYIA 1UKUA 3H5SA 5A8RB 3SDEB 3NF7A 2AX0A 4BVOA 3UWTA 3TUPA 1NB7A 4J9UE 3CB4A 2D0OA 3ILOA 3OJSA 2OCEA 2V50A 3DI6A 3IWXA 2WC9A 4A2BA 1Q0NA 4YY3J 1NJWA 3DLLL 1RWMB 4K0KF 3NGTA 3TI0A 1CJUB 5AQFA 2K3KA 4DR3J 1YVUA 1PKUA 3MHYA 3SBGA 2HS0A 2FSKA 3LAKA 1JLEB 3D5MA 1T0TV 2Q3PA 1H0HB 1RP5A 4LVNP 1EKRA 2E5HA 3HRGA 4HDGA 5JS1A 3B54A 4RNFA 5D4PA 3W2WA 3LOUA 1Q5YA 3R1HA 3QLHB 4QWEA 3R5DA 2RHSB 2LXFA 2CVIA 3P5BP 3TSQA 4N77A 2GUIA 3NH1A 5KT4A 4KH0B 2ZZMA 3B4DA 2MQOA 2P9IB 1S6QA 1C2PA 1O0PA 2HHXA 2BJEA 3JB9k 2HQFA 4USVA 1WKKA 1KQGB 2VFUA 4PG5A 3BDEA 5AT1B 2DT9A 4IZ9A 1HBUA 4GKJK 5DETA 5JUMA 2GX8A 2ZKUA 3W5ZA 3IMQJ 4UZBA 4P6QA 3HP6A 3M8ZA 1RT6A 4CLLA 4YR0A 1UVNA 2KFZA 3LW5C 4JD2A 1X4HA 1D0EA 4HTIA 5CXTA 4OPAA 1KHVA 1HW9A 4U7UD 2RILA 1RT7B 4CLPA 1T9YA 2LQ8A 3M7VA 1VSMA 4RW6B 3V6DA 2ABYA 3IRXA 1Q1KA 3M30B 4JI8F 7FDRA 3R5CA 1TK0A 1X9SA 4C48A 2E88A 2P9PA 1P8ZA 3R2DJ 2IGIA 3BF3A 3WNHA 2V4QA 3VVTA 2JGUA 1YX2A 5LXYA 2JX2A 3M8PB 1X4AA 4MK7A 2W2QP 1RT4A 4ED7A 3H5XA 4QR0A 3GJTB 4DLGA 2XYHB 3OR1A 4CZJA 3HMJG 3LM2A 2CG4A 1FW6A 2OPPB 1WSHA 1PJ5A 1SV5A 1WHWA 4N5SA 3AVNA 2F4VF 3L7UA 2YWGA 1BI4A 2KKHA 2D3OR 1UFWA 1W2BM 5CABA 1RWUA 5FLXU 5C2GA 3ENVA 4TU7A 4USHA 3TZXA 5L9NA 4K8RA 1J54A 1M90O 4BY9C 1NK6A 4M3UA 1SPBP 2GJFA 1WTBA 3WIVA 4O55A 1PAUB 3KK3A 1FX2A 1JL1A 1OVYA 3ZZZA 4FK0A 2V8VA 4C0HA 3RB0A 1RDCA 4JI7F 2QT7A 3EJMA 1JL2A 4LF6J 3EMTA 5HK4A 4OKEA 3H2LA 1MN7A 4RUCA 2B8PA 1RSCA 2C22A 3KKSA 1JLBB 4FVUA 2X78A 3Q83A 2AMCB 4LJMA 4ECTA 5F8HA 3TA0A 2CNLB 3I96A 2W7PA 4YORA 3E66A 5A76A 4O8UA 3N5BA 1RTDA 2YY3A 4X62F 2RS8A 3LP0B 3W66A 1RDUA 4P7VA 4ED4A 4IG3A 4P2XA 3S3MA 1S1TB 4TNOA 4LBHA 2RDIA 3BGRA 3ZTRA 4EBEA 4KTQA 2QLJB 1ZPVA 3F9KA 2HF4A 5EOYA 4QIWD 1RABB 1ZBUA 4DQPA 5HBMA 2IVFB 4DZDA 4FJXA 4OZ0A 1SCJB 3O3FA 2HZCA 2ZOGA 1U09A 1N5YB 2OH2A 3ZX2A 1KDNA 2XMKA 3US5A 6FDRA 2YPYA 2OD4A 3FMWA 3B6OA 3GLJA 4RW9B 1N34K 1RBOB 4MAKA 3SV3A 1AUDA 2HGNA 2Y8WA 3H1VX 5M1KA 4DSJA 5A6PA 4O44A 4WZQA 1U1RA 2FIUA 4YB1P 4RWTA 4FL9A 5KFSA 4XDCA 2D3O1 4I67A 4Z4HA 1VQ4N 3BBCA 3F44A 5E0OA 2WVBA 2AHOB 4M45A 1YRUA 2W7AA 1G1XA 1HX1A 2IJFA 2QTDA 4CI0B 3ZLJA 4JHDA 1HYVA 2IRYA 5BPLA 1HNVB 2MKHA 5C24A 4B3MF 3W62A 2DHHA 3A8IA 5LOQA 5KT3A 4DMZA 4GVBA 5E3CA 1T9VA 1FNMA 1PJ6A 1Y11A 1MWZA 3U1NA 4CYUA 4OHVA 5IWAF 2VB6A 4NX9A 2KYXA 2WAQD 3VEWA 3CYMA 2J9EA 1ZA2B 1D8YA 2ROEA 3O44A 1I1GA 4HHUA 3L09A 5G4DA 4FM0A 1RCOB 2Y9HA 1QS4A 3I9V9 3PO4A 1WC1A 4LR8A 5HMXA 1YJ9S 4ZVQB 3J7YP 1UJ5A 1FK9A 4U96A 5DGAA 2Z4PA 4J2AA 2L9DA 1NKBA 4JS4A 4WE1A 1X8DA 2HFVA 4OYIA 3EEQA 4IG0A 2GJ2A 2Q0UA 4IWVA 5JVGL 4RWWA 2ZD1A 2OZSA 3MWBA 4NE9C 1IBCB 3WHIA 3LO3A 5A8WB 1XERA 1F5BA 1SL1A 3RAQA 1U04A 2CPJA 2D3ZA 5M2PA 3QNNA 4OLBA 1RYRA 4KB7A 3TJAA 5A2QY 2HZVA 1YJNN 4DL5A 3WT0A 3NWRA 3Q22A 1Y10A 1VRQC 4NCGB 1TZ0A 3KHHA 4FJKA 1TKZB 4X4NA 3TNVA 2W40A 3SQGB 1S5JA 5GMKa 1Z26A 1S72S 2XEXA 4BR4A 2QLBB 4JKAA 3MD3A 1EQ0A 1JK9B 1WOOA 1N4LA 2QYGA 2F8MA 3VWSA 2B9EA 2BW2A 4P9SA 3HHLB 1S1UA 1S57A 2U2FA 4FSVA 2OGUA 4CJVA 1XNQF 1GOAA 2LU1A 3PW5A 3DGPB 2HZAA 2R8IA 4CO2A 3CMEN 2EX3A 2VPYB 1W2IA 4YR3A 4CF9A 1W25A 1RZMA 2MGZA 3LDNA 3A5MC 2V9WA 5GAEP 1EIYB 3DRYA 2HNZB 4OKJA 1R8PA 2J8SA 2P6SA 4JI5K 4NLXA 4CH1A 3DXKB 2YHAA 4RTFD 3Q8UA 2R3VA 1NGFA 1DTTA 4CZIA 3QB0A 3HL8A 5ELZA 1JB0C 3R2CJ 3DRSB 3HSZA 3PSIA 2DITA 2F9TA 4F25A 5HRRA 1BD6A 2LYVA 4C0BA 2VPXB 4F67A 3GYGA 5GADU 4P2MA 1RTHB 5CHCB 3EPGA 3GL1A 3A8EA 3OUYB 1MLAA 4BDYA 1VQNN 1XK8A 3FRYA 4WFAL 4CLFA 1J2VA 3MX5A 1DQ8A 3MXMA 5B0DA 1GTHA 2KVIA 2BOPA 2Z2YB 3IKMA 1WSEA 2UXDF 2DR6A 4A8MP 2RIJA 1HQEA 3TA1A 2BJ3A 2L48A 4CO3A 2WW4A 1RBSA 2NRRA 2XYPB 2VF3A 2YQ3A 3UI3A 1HHQA 1CJTA 4RCHA 3K8VA 3QPIA 5AJ3F 4OYPA 2B4PA 1MSWD 3MR5A 3MPYA 2K7KA 1PBUA 3AH6A 1Z2ZA 4QQBA 2HVZA 3OBWA 3BYRA 1XMOJ 3CJTA 3LP1B 4PG7A 2M0GB 2ZWPA 2MPUA 4DS5A 4DV2F 3DAWA 4GKKJ 3FFIA 3JSMA 3SQ0A 4RW6A 5EX5A 2R7RA 1WC5A 1Q81T 4JI1F 4L74A 2EC2A 3TVKA 4I6YA 4PG6A 3G8QA 3AJDA 4DUYJ 3MMJA 2YNHA 4MQ3A 2E2QA 4DR5K 1HHTP 3LDQA 1ATNA 4J9RA 4I9QA 4J9QA 3S9HA 4E2FB 4RNMA 2KN4A 3RWUA 5AQMA 5HN0A 4QS8A 2JJ4D 4Y65A 3ENBA 3MMAB 4FJJA 2YV0X 1GQEA 4LVOP 4BC4A 2VBXA 2ZC4A 3UN5A 4KTWA 4HVJA 3MTKA 3AV9A 3UE5A 2R7XA 3F9MA 4DTPA 1CS4B 1DZ5A 2ZE2B 2BM1A 5AXNA 4DSFA 3HD1A 5DDQC 2DNZA 5A6WA 1QVFR 1RGVA 2JNJA 2JZ5A 4I68A 2KI2A 2CXEA 4CIFA 4PUOA 2JFKA 3FCWA 4CZCA 1VISA 2DR9A 2HHTA 1Q53A 1J5EF 2A6AA 2MQMA 1F1BB 2R4FA 4CGGA 3ADAC 4IDHA 3TR8A 4UY8O 1KEKA 3NGRA 2UUBF 5IXUA 5FIIA 1VC5A 2JDJA 4QIFA 1SJ3P 3DLEB 3W64A 3ZTOA 1HQ2A 4X65F 2I0XA 5B0EA 5KT7A 5JJBA 1RJJA 4OX9J 2L9WA 3RGIA 1SXLA 4M3WA 1X9JA 4DV7J 4GMKA 1DAXA 4NCAA 2UXCJ 3FKBA 1NRKA 2W42A 4JV5J 3VTIA 3W9IA 3QSIA 1K9MT 1QSSA 4DFPA 2B7CB 3FSYA 1X31C 5HL7Q 4Y3CA 3R6GB 5M1FA 2F3JA 3OV7A 4RO0A 1TL3B 2AP6A 3A12A 4MLEA 1MDUB 1N48A 4AF1A 2JHEA 5E33A 1Q18A 5I3UA 4QJVA 3ITHA 2R8JA 3V6DB 3WIUA 2VWKA 4OJRA 4NI2B 4I6AA 1AFJA 1HMVB 1HBOB 2V0NA 3IM9A 4CM2A 1JJ2R 1UFKA 4WQ4A 3TP2A 1JLGA 3WBZA 5KGXA 4WIQA 5DGBA 3RB3A 3CCZA 4LSZB 5DG7A 2LSNA 4W98A 2VOPA 1F3VA 3NH0A 1B3TA 4GY2B 1XR7A 2K8GA 1C0MA 1FF2A 3VEOA 2N4DA 3HHLA 4FVCA 1CJUA 1H7XA 5FLXO 1DFDA 4C98A 1PYSB 1KQSM 3LF0A 4A8OA 1V5IB 4BRQA 1D5AA 5HQLA 4LFAF 1GLAG 2DCUB 3AOAA 2B6AB 3EN9A 2C3UA 4BE1A 4K4XA 1SH3A 4LR7A 2HURA 1IUJA 2VQEJ 5C42A 3CJAA 2UUBK 4Z2XA 3LZIA 3DOMA 5I42A 3CCEN 4K4WA 1MWMA 2DYAA 5CZVA 4FKXA 3IR7B 2YHXA 4F7VA 1VSJA 1NGAA 2GTDA 3DLGA 2DFFA 4ILRA 2DIVA 4PL7A 3G82B 5KFQA 2VQFJ 1N88A 4H4MB 1CEZA 3P49B 3QAEA 3A5LC 2E5JA 1NGCA 4PHTX 3FCVA 1N0UA 5EY4A 3HO1A 2DHAA 4F4ZA 2RU9A 4FW2A 2ZM6F 1HNIA 1K0TA 4USUA 1Y4ZB 2FY1A 3VEXA 2GMHA 2CJKA 2R7YA 3OYFA 3EVWA 4DTSA 4EEYA 2HRTA 3QO9B 4LF7K 4CT8A 2FC9A 2CUYA 5J2PB 1IJEB 4ZN1A 5IS2A 3MMVA 3AHPA 3ZZ0A 3MECA 2IDOA 4LRFA 3VGLA 3MM8B 3H8YA 4PKIA 1R43A 2EKNA 4B9MA 2HWTA 1E6YB 1NK7A 5KFCA 1NDLA 3T9NA 4K59A 3ILIA 2W01A 1OVQA 1HWUA 4OJHA 3I56S 3JSMB 4OX9K 1RT3A 4B3RF 4E89A 4KKOB 4WIIA 2Q66A 4X84A 1FEEA 1AT1B 3QFHA 3EKUA 1OY9A 2Z58B 3IS9A 1OQ6A 2DISA 1APSA 4DR2J 4DL4A 2X3GA 3U8XA 4BDZA 3I87A 3MN6A 2BQUA 4IXCA 1Q95G 3U6FA 1F0XA 2QV6A 1TL4A 4IH6A 5E3AA 3VQ6A 2YXLA 4QCLA 3TAMA 3UCGA 3ISZA 3FUYA 2BE7D 5CR4A 4B3OB 4NCGA 4DTNA 1BIZA 3WNEA 4ETZA 2OELA 3PNIA 4ILGB 1TUYA 2RE1A 3AY0A 4CHNA 1XR6A 5FJ4A 1WNSA 1FRKA 1WHYA 3DOLA 2DNGA 4IRCA 5J2PA 4A8YA 1RDDA 2DFEA 3HKWA 1JLCB 4CEOA 3GJSB 3F73A 1QVGM 3SUQA 3I56N 4DTMA 2Q43A 3N0VA 3PEHA 3OTOF 4K4YA 4CLZA 5J1EB 4HH0A 3CJ9A 3IAM9 1LAWA 4ALZA 2ZHBA 4ANEA 2BTFA 4RNOA 1X7VA 3OXLA 3ET6A 1B64A 1V3SA 4ED0A 4YOXA 5D4LA 2DGQA 2AEJA 5D0HA 2BJ7A 3GIMA 1WDDA 2AJ2A 4BS2A 2WVCA 5CA5A 5CYJA 2I5JB 1VLYA 1Y5LB 3CJ5A 4C1NI 1EXQA 3RYLA 3KK1A 1U1MA 1OPZA 1X9WA 4USWA 3M9NB 1S10A 1NLKL 3SQ2A 1N0VC 1EP4B 5BYQA 2BEFA 4I4BA 4FJLA 1CQMA 1MG7A 4DU7A 4DX5A 2LXUA 2R7QA 5DM7L 4C2MA 4ZVSB 2KRBA 3A8YA 1HQUB 3ULEA 3VF4A 2IM0A 1ZM2A 3MWTA 2XY8A 4NXMK 2QKKA 1N5YA 4A5BA 4GKJJ 1LW0B 5KTQA 2KG1A 2NQPA 1HD0A 1HA1A 2QN6B 2LP4A 4NXNJ 3HHNB 2PZSA 1MWYA 2PEHA 1S1TA 2P9LA 1F2HA 4DV1F 1IKYB 3HJFA 3M5RA 2FC8A 3T5LA 4X4RA 1N33J 4CF0A 3HT0A 4WPAA 5CAAA 2JC0A 2W7OA 1VRTB 1V3RA 3KLFA 2Y0SD 2OI2A 4JI8K 3I31A 2E5LF 4WTYA 3GSDA 1NMEB 1M5HA 4NYOA 1F5CA 2HFNA 3TW0A 4WYLA 5GMDA 4DV4J 2Q3SA 4AXIA 1NU0A 5BREA 1NMNA 2JEJA 5J1PA 5AQHA 3U4LA 1KD1O 4OI2A 3CCVN 4DR3K 4DV6K 3O9RA 3R9PA 3K17A 1S12A 2IVPA 4OJ3A 3R6LB 3KYLA 2ZZTA 1CZAN 2WVDA 2MKYA 4Q45A 2LQBA 3CPEA 1RACB 4LFAK 1PAEX 2AZ1A 1VQMS 3W63A 4LR9A 1LWCA 4DOZA 4FYXB 2KKZA 4LF4J 2UZAA 3KUHA 4B1ZA 3HHLC 4AQYF 3C95A 3P96A 2ITMA 4K4UA 1WC6A 4LF5K 1NBWA 4KBOA 3G82A 4X4QA 4QS9A 4NZ6A 1UEUA 3PIOQ 4H03B 1NM2A 3VQ9A 2NCKL 1SV5B 3DXSX 5LL6d 3H59A 2MKCA 3QEWA 1WEZA 3R5GA 2XMAA 4LFCF 3Q2TC 2W1BA 2YKMA 3TX8A 4NLPA 2DNMA 2CGLA 3JTOA 2HFZA 3TANA 5H9EK 4LF8K 2HHQA 2R8HA 1FNOA 3HVTA 2Q6CA 2QWQA 4JB8B 3HXMA 1KTQA 4PYDA 1PC4A 2J9CA 1N32K 3V9ZA 1DEJA 3QRRA 3CQ8A 3ZT4A 2M3DA 3JXOA 3AY9A 2NLWA 3D3CJ 3NLCA 4DUZK 4FS2A 2W2MP 1YZ6A 3AVIA 1U1LA 2CH6A 1PIEA 4NLUA 3HFZB 1S0MA 4M5HA 1BCMA 3BQ1A 1YHQN 2PFDA 2DH8A 1GMUA 4RNHA 8AT1B 1S22A 4P75A 3TO8A 3QFUA 2AU0A 4LSLA 4NLBA 4L72B 4UW2A 5M2UA 4RUAA 1EKEA 1REVB 1UTAA 3AAQA 4LREA 4B3MK 2H4YB 1TQLA 4CLYA 3E1YA 1UL3A 3DYAB 2EFQA 2CJQA 5CD4A 4DL6A 2ZH1A 1KHWA 2FC0A 2X3DA 3ZZRA 2L41A 4L3NA 1R7IA 3UNYA 4WKYA 2EXUA 1G2EA 2YI1A 3C6UA 1NHUA 4BRNA 3BYPA 3I5AA 1DQAA 4CGJA 2MQ8A 3IXQA 3NCPA 1BG3A 1RU2A 3G4SS 3ZYYX 4CJ4A 1AUSL 2OHDA 2RDJA 3EO3A 2LDIA 3UR0A 5ETOA 3ET6B 1O13A 4NCBA 1D9DA 3T7ZA 1JLAB 1VCTA 1VAZA 2F9WA 2RVJA 3CCMN 2IJRA 2O8FA 2B4VA 5L39A 2HIQA 4L76A 1OY8A 1KXPA 2WB1D 3B82A 1HLUA 3HHDA 4ZP6A 1N5QA 2EHGA 1Q8KA 1TL1B 2G2YA 3MTJA 4PXDA 2O3DA 2YWFA 3GCXP 1FEHA 3BH7B 1Z05A 4HL9A 4P2FA 3N79A 3VR1A 2OKQA 2XMUA 3H7HB 4Z94A 1I6JA 5K8PA 1JQGA 4I6MA 5I3QA 2GQCA 3D2EB 3W65A 4W90B 3PX6A 4IOCQ 1ROFA 3IG1B 4OHYA 5AQIA 2NZTA 1OJ4A 3ZZTA 2E2OA 5ETNA 3VF2A 1Q81O 5A0YB 4K4VA 2CZ9A 4UTGA 4B3SJ 2OTLN 1UPMB 1YBAA 1FFWB 4ZVRB 4ECYA 1H74A 1V6HA 1E4GT 2E1ZA 2P8IA 1JLQA 2GFFA 4Q2LA 3MR3A 9RUBA 4CH0S 3DGVA 4CK2A 3TOQA 2YNGB 4M3RA 1M1KO 5J2NB 1VMBA 3FR0A 4IDKB 1FD8A 4JKGA 4CDIA 2WFBA 3SLCA 4CJ5A 4LIWA 4Y2IA 4NXMF 5LMNF 1NKEA 3H08A 2GVDA 4PQUA 2XCPA 3IAS9 3OBIA 2KRRA 4UT4A 1S6PA 2DXDA 3V4IB 3DRPB 2B56A 5CH7B 3L3UA 4DN9A 3VCDA 2BH1A 4KB1A 1Q82T 4RKUC 2MKSA 1EWQA 2J7KA 4DTUA 3KLEB 1KTVA 2ILYA 2PFUA 2QMWA 4KGMA 1IBLF 3BF4A 4CK1A 4B3TJ 5D0RA 3CCSN 4UQTA 3IGVA 3R1LA 3MMCB 1F3FA 1YTAA 1RISA 2YH1A 4CBUA 1JLBA 5B09A 4JI0K 3PY8A 4KAZA 4J2EA 5K8NA 2Y1RI 4DV0F 3KLVA 3W3DA 3OTOK 1YHQS 3IN5A 3RMBA 4Y00A 4FLVA 2AGPA 2AD9A 4JI2J 4DQSA 2KHDA 4X4OA 2CPDA 4W5NA 4XDDA 3EKSA 2VFRA 2YQ1A 1SVDA 4ERDA 3FBBA 2OSQA 5J2MA 4C3LA 3MM9B 4PXCA 1UMJA 1HNVA 3VGUA 4H5TA 3H46O 1KQFB 4M41A 2IPOB 4FK2A 1CG2A 4FOEA 3TAPA 2KB2A 2A18A 4R8UB 3MMBB 2HHHJ 4O44B 3K5OA 4DR1F 1NNDA 5HL7L 4B1UB 2UVWA 3KKFA 4M5DA 3ENAA 5IQ6A 4FLUA 2EEYA 3JTNA 3CJSA 1NG9A 4F9OA 3SJHA 3WZ0A 4JYAK 1MROB 2RT3A 4KHPF 3BBBA 4FWLA 2HKEA 4PA1A 2MTLA 3P4IA 5CZXA 1KD1T 5AQOA 3CULA 4YY3K 2CAJA 1TYQA 3VAGA 2FD2A 2JVRA 5AQGA 4AM7A 4JUZA 2XB2D 2QE5A 4NA1A 4DPUA 2CGJA 3OSPA 2NXCA 3O2IA 4J9NA 1QHAA 4IDKA 4JKGB 2C28A 2ZJRL 2CDRB 1BA1A 3GB0A 1W7WA 3CCVS 3K5PA 3PYEA 1WG4A 4PZVA 3DRPA 3HLUA 3BGRB 4A4JA 2J6UA 5IT9Y 1YJWN 2RRAA 1WG5A 1X4FA 3CNQP 3VF0B 2A42A 2DKOB 3BN4A 1D4XA 1YQHA 4UOFA 2NR0A 1OS5A 4ZVPB 1JJ4A 4MFBA 4F3TA 2W8LA 1YIJS 4K2JA 3OHBA 2ZH8A 4F3OA 1B70B 4CESA 1S76D 1LWFA 2WVFA 4AHUA 2ACYA 4CEZA 4E7IA 4C6AA 3PUFA 3HSDA 5DS7A 3NWGA 2CGKA 5AQPA 4KHMA 2M70A 2ZUAA 2UUTA 3JXUA 4DU3A 4ZTFA 4LD0A 4CIGA 5HMZA 4HKQA 3QMLA 1WACA 4FYVB 1VQPN 3MCNA 2MKIA 4DCPB 2MZJA 3HJVA 1XJWB 2BX6A 2OUGA 3IO1A 4X4VA 2GA7A 3SAGA 2IS3A 2JEFA 1R0AA 3QGGA 1H7WA 4QW9A 5DLFA 2MMYA 3KXDA 3BEXA 4RW8A 4RW7B 1B99A 1TUGB 3X1LB 3Q8QB 5JLHA 2C2NA 2K3IA 3K0JA 1CJVA 4ZP9A 2BUPA 1GEHA 4YHHK 2ATLA 5IT9O 1M5PC 5DQIA 2HIYA 1CLQA 2XM3A 2A5XA 1MMLA 2YH0A 3VPZA 3DLHA 4EFHA 2JOQA 4X2BA 3UN2A 2VFSA 2VG5A 2RPIA 2D0BA 1S6PB 3KJFB 2OPSB 2MZQA 4YOYA 3AVKA 3OYNA 2H5EA 2P9IA 2B0GA 4CW7B 3UDVA 3GIIA 1HNZJ 2AYBA 3VQDA 3VQ4A 2PYJA 1N5SA 4UUWA 1IG8A 2CPYA 2NXJA 2YWWA 4CWBA 3OHAA 1GAOA 3OT9A 4QBUA 2J4RA 4JKCA 5M1QA 2DNHA 3N28A 5DMRA 3L2WA 4WF9L 1IM4A 2P9SB 2QA2A 4BWMA 2E7WA 2VG5B 1X1PA 3N6MA 3MEGB 2ERRA 1DQ9A 5F8JA 2GQQA 2VG6B 2VICA 4ELUA 3KLIB 5LMNK 2K7JA 3G6XA 1H3DA 2OP5A 3CG7A 2HSTA 1RT1B 2XY5A 1IM6A 4FOIA 2ZGYA 4DI6A 2I2YA 4Y2AA 4B08A 1TFYA 2ATCB 2OA8A 1IKXA 4CJLA 4RU9A 1S7IA 3AB2B 1MROA 3CFOA 2HOEA 1YDLA 4JI6K 3SMPA 3CPWR 5C2FA 2OPPA 1S1XA 1MN9A 4ZVHA 4FCYA 2YHYA 1TUWA 1NGDA 3N4QA 4ICLA 2PBDA 3JAMU 3NS6A 1WEXA 4BWJA 3AGKA 2LQ5A 1EO1A 3GV5B 3QETA 5LJ3Y 4WP8A 5BYRA 4O3RA 4N8OA 4X62K 4NOHA 4R5PA 1N56A 2P9UB 5BPMA 1JJCB 3KMQA 5L1LA 1NPPA 1WI6A 3CQYA 3PCOB 1NAQA 4DSKA 1A6LA 3JAMO 3O4NA 4A62A 1Y3JA 1EX4A 4A57A 1TKTB 1FXLA 1TV6B 2I8EA 4ZCMA 4PUOB 1YZ7A 5FDLB 3PRVA 2GNKA 3FVYA 2E1CA 4E8UA 5BR8K 4ED2A 2VQEK 1A5VA 3FC9A 2J0WA 5CHIA 1HJOA 1FKOB 2D1CA 3HT3A 4WWSA 1F2GA 2IIHA 3HZGA 2XZWA 3TSUA 3I0RB 1Y9OA 3SCIE 4FXDA 2AW0A 1FVQA 1XR5A 4PWWA 1HNXJ 4C8MA 1I5OB 5D78A 1IN0A 2Y1LB 1EETA 5DK5A 4FXWA 3DXKA 3AO5A 1NZ8A 3IFRA 5B0FA 4P52A 3TTDA 2XSFA 3CC7N 1QQCA 2CPFA 2P2CB 3HHLD 5AQWA 3H0PA 4CZEA 2N3LA 2QWMA 3GIKA 1XMQJ 2IC3B 3M32B 4ZPVR 4KREA 2LDYA 1BIUA 2Q0RA 3M8WA 3QLHA 4J2DA 3IDHA 1HKBA 2BUNA 3GWCA 1FRHA 1ZXOA 4JI6J 2NPFA 2NLXA 1FX4A 3G6VA 4DV3K 4DPWA 2FXUA 3CETA 4JI4F 2XZDB 4U95A 2RAQA 3AVAA 3MPUB 2BOAA 1YI2N 2I1RA 2EW9A 1OYEA 1HQUA 3K57A 4WU3A 4LF9K 5EWGA 2CG8A 4ZPWR 3BPDA 1E6YA 1NDPA 1JLQB 3TAQA 3KG0A 3AAPA 4ZPDA 3O80A 4ZHRA 3L3CA 2JFDA 2J0SD 3G8SA 2UUAJ 1HKAA 3A13A 1D9FA 4CYUB 5KFNA 1RTIA 3QGIA 5JICA 4YDDB 4OV6A 3BO4A 3ZX0A 3I33A 3AFGA 1YBTA 3NXZA 1QVFM 3KHLA 4ISGA 1VQMN 1NDKA 2OD6A 3W5YA 4Y2MA 2GQ2A 1ZBSA 3BP8A 4A8XA 1WF1A 1YJVA 4UY85 4CTAA 5THWA 4ZOSA 3BO3A 1IR1A 1R59O 4NXNK 4G1QA 2Z56B 2F5GA 2HQDA 3BH6B 4YOUA 2HAIA 1RAOA 4ED3A 1H6KX 3ZNJ1 2UUCJ 1BL3A 1IQZA 5KFXA 4LBPA 3WXJA 3LP2B 2GBZA 2C3PA 4CM0A 3CD6S 1WBDA 1TL1A 3A0IX 3OYIA 2CQIA 3IMXA 4JKBA 1NJYA 2Z2LA 2LA4A 4DF4A 2W8KA 2C2RA 1M5KC 2X6NA 4USMA 2HNYB 3KDOA 4NMLA 2RNEA 4CECA 2XLIA 2Q2RA 3K9KA 2L9NA 2KT5A 3NFAA 2F9DA 4OYAA 2J6SA 4EYIB 4C8YA 4DR4J 4PQUB 5MLCQ 1VHXA 1KONA 3A2FA 5E3PA 2W25A 3EZ5A 4JKFA 3MM5A 4JEPA 4QIEA 3DHXA 1IXKA 3KLEA 5I42B 5C15A 4FP9A 3V5RA 2RHKA 3OTEA 3SFUA 4OI1A 1B9FA 2AEMA 2CZVC 5DDPC 1WHVA 3DGPA 3CM6A 3RBXA 2R42A 3MUTP 3C65A 1ZM4A 5F9LA 2BBEA 1DT9A 2OZMA 4B02A 4JBCA 3BSOA 2FB0A 2GVDB 4G1IA 4JLHA 3G4SN 2YHBA 4AQYK 3VQEA 1U8WA 3OFFA 4FJNA 3NCIA 1WBBA 2AJQA 1LCUA 4BRCA 3GFXA 4F26A 2HHWA 4Z7CA 3PYGA 4YOEA 4EBCA 1M5VC 1NHKL 4BVPA 4DSLA 3LPEA 2ASDA 1JLFA 2YX1A 3OS2A 3EVOA 3POTB 3VQ5A 4F4XA 1RDRA 2PA3A 5KPZA 3VETA 5GADI 1N5TA 5HROB 1U0HB 4DV2K 3AT1B 3T1AA 4C11B 2Q31A 1GMWA 3KG1A 3PO5A 2FHJD 1RADB 3TZZA 2RKIB 4KTZA 4MLHA 1YF5L 3PX4A 1U47A 3RRGA 3NBPB 4B3TF 4CHQA 2ZGZA 3DU5A 1WOSA 4JI6F 4W5TA 4DU8A 5IV3A 1HNWJ 1HWJA 3F56A 2VKRA 3LPUA 3UVJB 3LH2S 3M6XA 4ICLB 1RE1B 1RT5A 2RDDA 3G6ES 4M7XA 5KOWA 1XMQF 4QPTA 3VHQA 1ZM9A 3D1OA 1SIZA 1B7YB 3H40A 1TV6A 1W97L 3THTA 4K50A 3SBTA 1HWKA 2ZWHA 4DR4F 1UJ4A 3NDKA 4B3OA 2CQ2A 2V7ZA 4H4MA 5C25B 5JS2A 4I0WA 3BEGB 2QMUB 3UDLA 1S79A 4H4KA 4PWDB 1HD1A 1WOQA 1XQIA 5IC4B 2D69A 1RWWB 4GVEA 2O01C 4OIXA 3RTVA 4M5LA 4O4GA 3AVGA 2VIHA 2P9SA 3EY1A 1BY9A 4Z4EA 2B6AA 4IH5A 4UOGA 3Q0AA 2W4PA 2G13A 4Y1CA 3QNWB 4BDPA 2EFOA 4CHZA 1EETB 2GC8A 3C7NB 5KG7A 3RAXA 1FWKA 3BR8A 4QR1A 3CDAA 1YUWA 2HQIA 2MSTA 2VQFK 2FZKB 3PYFA 4HT5A 4M5KA 4OZ1A 1BXNA 5HATA 2E2NA 3BKFA 2QC3A 5JVHL 3NMUA 4PKHA 2Z1JA 2UXBK 1RKJA 3P8BB 4HTUA 4J7CA 1URRA 4QIGA 4A8SA 4KPYA 3IFEA 3GFYA 4B3TK 1TGOA 4QWBA 2F7VA 3OVNA 3LP1A 3I55N 4KHQA 4BRAA 2D7SA 4ZDNA 4EFAC 4JI4J 2I7NA 1S97A 4USKA 5C2DA 1JMTA 5MLCV 5EX3A 1N8RO 2UU9F 2KXFA 4PG4A 2Q79A 3FEXB 3S3NA 2QG9B 2QLWA 3D6TB 5AQNA 2YCHA 2ZF5O 3PIOL 5C25A 5A8RA 3OYKA 1T03A 2XO6A 5KT2A 4F0KA 5E5NA 2ADCA 1LWEA 2MSSA 3AO2A 3C0BA 3B4MA 2Z57B 2CQ0A 3KVGA 1U45A 4OMFG 2UXBJ 4BE2A 2BW7A 4CBXA 3B8HA 2HBYB 1DKGD 4E1JA 3QYYA 2XQCA 1HJRA 1U4BA 5FPNA 1PILA 3E3XA 2GV1A 1CXQA 4B3SK 3TVYA 2WZ1A 2GW8A 1HNZF 3D67A 2DPJA 2XLJA 4HI1A 4OLOA 1T9XA 5F8LA 2V2ZA 3QFWA 2DFHA 4KHWA 5KFEA 2UP1A 1ZOTA 4RW4A 3C15A 2H5JB 5LJ5Y 2V2VA 1U1KA 4M63C 5AR0A 4YDXA 1PJ7A 3O1BA 5TKYA 3UIQA 2CJ9A 3QAUA 2V8DA 3NGUA 4B9VA 4M3YA 1OMSA 1UW9A 2HFSA 4DR7F 3O8MA 4OLPA 2UXBF 3M30A 2VG7A 3KJQB 1RI7A 2VOOA 3IWNC 3NGYA 1V5VA 4OV1A 1U6BA 4PEOA 4C11A 1HI0P 2ZM6K 3MDFA 2P9GA 3CF5Q 4ILHA 4NRUA 3NL0A 1NK9A 4ES3A 2Z2ZA 4NYPA 5IWAK 4MIWA 5CZ1A 4Z4IA 4J5OA 1SS6A 3GQCA 3DOKA 2VC0A 1QSYA 1WSVA 1Y7PA 4LFCJ 3UO0A 1OH7A 1Z4UA 3CCJN 2RRNA 3NVMA 5M1NA 2HMPA 1ZBFA 4M3ZA 1K8KB 1KFDA 4C0OC 2GIRA 3TEGA 2YKMB 2JRSA 1PSDA 2FF6A 2R7OA 1CZBA 1VQ7N 2KO1A 2VBWA 3M4XA 4GV3A 4DB3A 3R8EA 4FJGA 4ZJQA 1PC5A 3W9JA 3V9WA 3CGIA 4BCAA 3TUJC 4H0TB 2OMLA 3SNNA 5E2QA 4WE1B 1Y5IB 3CT9A 3Q2SC 4IO8A 4CJEA 3Q7CA 1RAJA 1K0VA 4KI6A 2V7YA 2QL9B 2I38A 4Q7AA 1X0PA 5DM7Q 2PEBA 5EWFA 1HIYA 3CIPA 3CO9A 2CQGA 2DD8S 3L9ZA 1P6TA 4AM6A 3AA9A 2DGOA 2HBZB 2WSEC 3RBDA 3EZUA 1XC3A 1AA1B 2HVHA 5DQHA 5L46A 2P5GA 2HMIA 4QYRA 1QAIA 1WHXA 5M2RA 4OVLA 1L3VA 3SK3A 1TUVA 1R31A 3TAMB 2FYXA 2O8CA 2FGOA 2OPRB 5JLFA 4GO5X 4BG9A 3D2FB 4KC5A 1ACMB 2AYMA 4X4SA 4DR4K 1LEOA 4IR9A 4P10A 3GYNA 5KG0A 1NSAA 3BO2A 5AQSA 4CVNE 2HHHF 1IKWB 1KVKA 3CTRA 4ZA1A 3NGSA 1HNWF 1QZ5A 1K1QA 3CCLS 2XC9A 3MGJA 1Q9XA 4K43A 4TYBA 2NRWA 2W41A 3GDQA 2N7CA 2CNNB 3OVAA 1T02A 3QMQA 4OX6A 4AE5A 1FKPA 4RPFA 4Q0BB 1KKHA 2K2PA 3I4PA 4WXWA 2RQ4A 3EE9A 2LA6A 1J6ZA 3LZJA 2BE9B 1ATSA 4LY7A 2IVMA 3MAAB 3NF6A 3D0HE 5LMUK 3MEEA 3VEYA 4WCEL 4H8KA 4FF1A 2B9WA 1O1WA 3DKDA 3WXLA 3UKUB 1Q7LB 1YTYA 2XS2A 5I9EB 5L1IA 3I32A 2BQ3A 4CJTA 3A8JA 4RUHA 2EK6A 1FK9B 5AJ3K 3OYBA 4UUXA 3SCJE 3TZWA 3CHWA 1OSDA 1FVSA 4O3PA 3NCQA 2Q97A 3X3UA 3D6HB 1T95A 3UFCX 4PXBA 5M1PA 2OTJN 2JWKA 3DXBA 2O8DB 3PM9A 4IG3B 3LDOA 2BMBA 4A5AA 3J7Z5 1BDGA 2ZOFA 1S9FA 2OYQA 4MIAA 5D4NA 1KAZA 3U1MA 4QPXA 2W2OP 5LMUJ 2VDIA 4E1NA 2WOMB 3O5TB 2UU9K 3KUGA 3O1LA 4KBIA 2RMLA 1U1QA 2RS2A 4FBTA 2J0QD 3MFHA 1ZH5A 4BRDA 2O5DA 1C0TA 1RTJB 4OI6A 3AVFA 1WDTA 1XMQK 2C2ZB 4NXMJ 2BABA 1VQ5N 2A3JA 3BGFA 1SKUB 4TQSA 4ECXA 1B0PA 2ZBIA 3I9ZA 2IJNA 3DLGB 4CJWA 4DR2F 1RAIB 4ZPCA 4L8RB 5LJWA 1JNRB 3R5BA 5AQJA 2QSWA 5HQMA 4CEQA 1Q4RA 4DX6A 5D15A 3CJ0A 2ZH2A 1VQKS 1VR6A 2N7YA 3U3GA 4U67Q 1RHUB 5KFBA 4JHDB 1S99A 1ZPWX 5U47A 1EKSA 4WFXA 4NLRA 4ECUA 4LBIA 2HPUA 3KJNB 5J1NA 3H2VE 4LF5F 1W2BR 4K8ZA 4X65K 2E1AA 3BDPA 2EI5A 3HVWA 5M1OA 3HSGA 3OFHA 1K9MO 2CA9A 3VENA 2QK9A 3NAHA 3BQ0A 4H5NA 1W26A 4B9TA 1A0OB 3P6YC 4BROA 2VG6A 4I9LA 1T3OA 1I3AA 3ENQA 4DXLA 2HFUA 1JXVA 1RHRB 3MECB 2XWXA 4DV0J 4G1PA 3TWZA 4IKAA 3CMES 1RTDB 1W9HA 3G9CA 1U24A 1MMNA 3J8AA 2ZQBA 4B17A 1X4GA 1BQNB 2QRRA 3PKYA 2VGMA 3QRPA 4IYQA 3VQSA 4ID1A 4LSNA 3L7PA 5DO2A 3RMDA 5E41A 1ASVA 2H48B 3NNCA 4AL5A 3UW1A 3FFIB 1VQYA 2WCXA 3OYDA 4FM2A 5T7LB 4Q5VA 2YX6A 3AVCA 2VPWB 1T9TA 4DQIA 1KN6A 2GX9A 2Q1NA 2ZVIA 1DTQB 3KLHA 4DMNA 4TY8A 1HBNB 1T94A 1OSCA 1H2VZ 5A0YA 3C2PA 4RLEA 2QM1A 3CVKA 2VGNA 2IM2A 4ZCLA 1RAEB 4KH4A 2FZGB 1DRZA 2JLGA 4W92B 2CQ3A 3LPTA 2FVRA 2DPIA 4KH5A 1KOHA 1QLNA 5DG9A 4WU2A 4HTJA 2EC0A 4W5QA 3K2YA 4LH4A 1E4FT 2QO3A 3GG1A 4NLTA 3TUIC 4J90A 2CRLA 3CJ7A 3OTCA 1CVJA 2V67A 2BGGA 2QEXS 4ZVEA 4GMJB 3VTHA 3P45B 4F02A 4OX7A 4HWIA 2LEPA 1U25A 7FD1A 4DF8A 1B9DA 3MPDA 1BU6O 4UOHA 1IBKJ 3D66A 3W5XA 3FJ2A 1LAVA 2NUHA 4CJ7A 3GIRA 3C66A 3T1HF 4OI4A 1D8ZA 3UQSA 3CE8A 4CFBA 1OY6A 3GU0A 1SL2A 2PMWA 4JI7K 3OYEA 2LFVA 4GRSA 2X1GA 4DG1A 3FNNA 4IO9Q 3T1HJ 5DG8A 1WTFA 4HHTA 4DR7K 5L8RC 1HPZB 3MEGA 1FD2A 1YKWA 4E7JA 4A8QA 4LRCA 3D2WA 1GLFO 4NASA 3BS9A 1RNHA 1Y00A 3IAYA 3L2QA 4HDHA 1O8BA 4M3TA 2VZ9A 4CBWA 3HZEA 4CZHA 4WFYA 2DY4A 5GINA 4DV3F 2KZMA 2AV5A 1CLFA 4Y1DA 3V4MA 4IJNA 1ZETA 2VFVA 1YVNA 3ASMA 5KFMA 4ZVFA 5B0GA 5JVHQ 3G8TA 4YEAA 2E7VA 4M1KA 5BR9A 2OLWA 2GCFA 3T1YJ 5F8MA 4AHCA 3DLLQ 1XHXA 3VA0A 1OYDA 4NMXA 3AD9C 5KFRA 5HLFA 4KY3A 5GVQA 1W7AA 2MHEA 3PIPL 3HKZD 3QSYB 4Q44A 4H0XB 1RXOB 2ZHOA 3IGNA 1LFWA 2E2PA 3J81O 3CMQA 5AZJA 3L7OA 5KG4A 1T03B 3FK4A 4CFAA 2AJ1A 5FROA 2F96A 2FBYA 4B3RK 2BZ2A 2FF3B 1N36K 3G2XA 2APOA 2RKIA 1UWAA 3GZ7A 3O6QA 1RBRA 3FQKA 5LSRA 4NLDA 4CEBA 2NPIA 4YMEA 4CLTA 2R7SA 1OH8A 1TKXA 3G87A 5HRPA 4DUYF 2OO4A 4IFVB 1LWXA 3PJ9A 3CSKA 2MQLA 4LF5J 3WNGA 1NGGA 3PW7A 1VHIA 2EPIA 3DMJA 4M42A 3CCUS 3VQAA 3SDEA 3OPKA 4HR2A 1RB0A 1NGBA 2CJBA 2YJFA 2HGLA 3OBYA 2OPQA 2O4GA 2AX1A 2CQHA 2FJBB 1HR0F 3VGTA 5K20B 4GO7X 2ZJRQ 2W6KA 3BN7A 4MDAA 5AQYA 4NLVA 1QAJA 4DX7A 3HZ6A 4BC2A 3I5CA 2HQ3A 4OYBA 2ZUGA 4FBUA 1K47A 3CXCM 4M94A 4H4OB 3BM7A 5GIPA 3DOLB 1CC8A 3K5MA 3J7ZO 4EMDA 1TMMA 1LQ9A 1PO6A 3MR7A 1U2RA 3R6MA 3SCKE 4Y28C 2FSNA 1RDAA 4DKWA 2NRTA 2M4MA 3OR2A 3T5KA 2V4JB 2RSQA 2V4JA 1U7LA 2UXDJ 1OWXA 3RJMB 3KKRA 5LMUF 2KDOA 2ZBRA 5AFUA 3OTOJ 4IR1A 3LDLA 1HW8A 1TP7A 3QFPA 5EDWA 3MUVP 2O8BA 1UWBA 2CDQA 5SZTA 1WUUA 2W9AA 2FQQB 3MOZA 2W9BA 1KRPA 2GS8A 3O9SA 4DL0C 2CPIA 4ECRA 4KKOA 2YKQA 4RW8B 3ZTPA 4NEYA 3MMBA 5HJYA 3DI6B 1TK8A 2C2MB 1HYSB 1U1PA 4CO5A 3NP5A 3K2PA 1N33F 2F40A 2YQ0A 4RL1A 2QW9A 2FBXA 5B8HA 2XULA 4WQ4C 2UUAF 4ECZA 3CWJA 1V4TA 3GTYX 2NUUG 1VSHA 4V19J 3O4WA 2HSEB 4CP5A 2ALYB 4ER8A 2E7XA 1V9OA 1JCFA 3VGVA 2VODA 4C3MA 3G25A 5JMVA 4BHQA 4HHHA 1CC7A 3RG6A 3M3ZA 5DDOC 1ATRA 1YT3A 2L08A 4FWSA 2RF2B 1RTHA 4ZHRB 1SQKA 4CEDA 3TARA 3ZEUA 4CHOA 2BRKA 5I4MA 1CXUA 1SC4B 3MURP 4PWUA 5F0UA 3CMAS 3NOGA 2G8HA 4OHXA 1HR0J 3AD8C 2QMXA 2G2OA 2QZ8A 1VRUB 1P9YA 3PVXA 1KLNA 3OD2A 4P71A 2G8FA 2ASLA 2EG2A 2CQPA 2WONB 4BC5A 3SCLE 3MAAA 4FO0A 4BRMA 2ZZNA 3KMSA 1IH7A 4DR7J 3H45C 1K8KA 3MR6A 3M6UA 1NSPA 3QEIA 1UAXA 1R8AA 4ISFA 4DHYA 4LF2A 1C1AA 3ZSRA 3PTWA 4WXOA 3CJKB 2RB7A 3AQOA 2A3ZA 3GE9A 1QE1B 2F8EX 3IRXB 1R8BA 1T6CA 4R0JA 3O3GA 4V19S 5LY3A 3N01A 1YI2S 3THWB 4ZS6A 3D54A 5L1JA 2KZZA 1S1VB 8RUCA 3G71N 2AT1B 2RHQB 2ZM6J 4DSIA 1IG9A 5I3UB 4AFFA 5IT9U 4DL7A 4UOCA 2QA4G 4OO1J 3MDQA 2V6AA 1Z1ZA 3E01A 3ZZUA 3THYB 1NGHA 3ZCMA 2KVQE 1LOUA 3A5NC 4NLGA 5EUHA 5ETPA 2AWZA 1HBUB 1FWPA 3VQQA 2N82B 4CEEA 2PFFB 3CCRN 5DRKA 3DYAA 1FO1A 1IWGA 5C0YA 1CJKA 1LK5A 5KFTA 1GMWD 1L3KA 2AYEA 5A2QO 1QQOA 4JV2A 3T1YF 1KAYA 1WAJA 1U6ZA 2FUG9 2CQCA 4NB4A 4YUDA 2CNKB 3TU5A 4NLYA 3EPIA 3IG1A 3Q7BA 4ZVTB 3QEVA 1R8HA 1KVBA 2ZWOA 2HLUA 3DDIA 3MM7B 4OX8A 2XHBA 4JS5A 1KVJA 3NMRA 5CQGA 4FWKA 4WCEQ 1RT2B 4DV3J 3MUMP 3PRDA 4DTXA 3M2UB 3OSNA 3QESA 4O3QA 4LF6K 3IBFB 5HOOA 2ZFHA 3R9LA 3HSJA 5E7OB 1C1CA 2P9KA 3C6TB 3OXFA 1YJ9N 3KUEA 3WQUA 2JWNA 2NSBA 4FVMA 2VV5A 1R27B 3SI6A 4JRPA 3BGLA 4B3SF 4P7TA 3RW7A 8ATCB 4AH9A 2XSJB 3A3PB 1S0OA 3TYTA 3KLGB 3PXGa 2IRXA 4OJ1A 1XEZA 1U02A 4I2PA 1YJRA 2YVSA 4J8FA 5BJRA 2J5AA 1VK8A 2G0JA 1U8SA 4TY9A 4ZVGA 4KV8A 1HNXK 1QM9A 3VOVA 3CC4N 4XAKA 4KRWA 1QHTA 3MM6A 1IBKF 1KQSR 1NMDA 5GMEA 1RHQB 4PG8A 5FLXY 4F36A 4QR2A 1GT8A 5AXLA 4CLUA 2D0PA 1IKXB 1IKVB 1VQ4S 3P83D 4ID5B 1X3MA 1ITPA 3HK2A 5LM7E 4ETXA 4MK8A 2UVRA 5HAOA 4DV7F 5H9EJ 4FK4A 4N7TA 3WX8A 2KQ2A 2FPHX 2LQ9A 2POKA 4LSNB 3NGKA 3L4IA 3T19A 2CQBA 4FJMA 1TR0A 1ESVA 3N5FA 1HBNA 3TWHA 2BJDA 3NEKA 4CJUA 1NGJA 2VCPA 3SYZA 1TAQA 1TMJA 4FPRA 4FWRA 1BOTO 1QTNB 3VAHA 4B9SA 1T05B 3SSQA 4F3QA 2VQEF 3OLAA 4FNHA 1SJ4P 4E7KA 3FSIA 2DPNA 1J9AA 2IDLA 3WUHA 4BACA 1K73O 4WF9Q 2UU9J 4BQZA 3OW2M 4CJQA 4IO1A 4ZP7A 2V2QA 1N52B 2JSXA 4DL3A 2G8IA 5SUHA 2AGQA 4ZJLA 3NNAA 4DFJA 4XTTA 3LGNA 2ASOA 4W5RA 2V9KA 5BRDA 3NCRA 2VWJA 1B7FA 1JCEA 3QIPA 3HVTB 3O3HA 2DO0A 5IOLA 1WF2A 4JV5K 1GX6A 4IO9L 3J7AP 4O4GB 2V34A 1NK5A 4E0DA 1GK8A 1VSDA 4JNEA 4LQ9A 4ZVUB 3EE3A 4JI8J 1J53A 1O51A 3SIPB 1FRLA 2M5YA 4BQLA 5DZ6A 1UEKA 2OFHX 1HARA 1VRUA 4AHSA 4LRAA 1BGXT 2XSJA 1NPRA 1SQFA 3UPFA 1IBLK 3IRWP 1HYZA 5TKWA 3C16B 3RW6A 3FQLA 3SUOA 1U6FA 3M2RB 1RT4B 1AROP 2MQPA 1VQ9N 3Q8YA 3C6UB 4OZ5A 4URSA 4MK9A 2DGSA 1IWAA 4DV2J 4P2SA 3WEEB 1JLFB 4USTA 1S9GA 4F4YA 3ZX3A 3EYZA 2FBVA 3CD5A 3SQOP 1IJJA 4N76A 3HOSA 1SL0A 4BR2A 1SH0A 3THYA 1RT1A 1EHWA 4HI2A 3C3LA 1EZZB 1I3OB 1RUSA 5GAGP 2A2CA 2VH7A 3HPOA 2XTJP 2BANA 5CYQA 2PT0A 1B4SA 1WSIA 2PN6A 4DEZA 5KFIA 3MK6A 4GVLA 1CJKB 2A1BA 3LWLA 2E66A 4IRKA 4J37A 3UKUA 4ZIVA 4DR1J 3AARA 1CBKA 3WDOA 2AZ3A 2R2SA 4EHUA 2E6LA 4DWIA 3QQCD 1R6VA 3HVAA 3E01B 1VIXA 3PFOA 1FTRA 2QJ3A 3D68A 3ZNUA 3NHGA 1U1NA 2E6MA 2FLOA 3RAMA 3THXA 3I0SA 3OLBA 3DJCA 4M8LA 5A8KA 4L75A 1SQEA 1FDNA 1WSRA 3G6YA 2M9KA 4IFYB 2GGPA 1VQON 1CJVB 2QSFA 1IQTA 3VF6A 2FGCA 2HK3A 4IH7A 5F3TA 4DV1J 3DRRB 3CI5A 2EK1A 1X9MA 4EK2A 5B7WA 5LSOA 5F9NA 4I2PB 1NDCA 1ZS6A 1KVIA 2P9NA 2V8HA 5T41A 2O4IA 1VQ6N 4ZKAA 4JI1J 1WSJA 3U27A 2CFXA 5ETTA 1ZTTA 1S4FA 2ZJPQ 2AYGA 2B4UA 5C24B 1S6OA 2DNOA 2UXDK 2E1RA 5HI7A 1MU2A 1IBLJ 5KFAA 3M6GA 4DR2K 4M3XA 3TR5A 4CZGA 3MCSA 4CK3A 1U0SA 4H5VA 4JP8A 1M5SA 3LA0A 1XMOF 3T6JA 2CQDA 2HBJA 5ETRA 2E4LA 3LPYA 5KFUA 1BQMB 4IJAA 3KOAA 3SQ1A 3W7BA 4DPYA 1I39A 4B8CA 3LL3A 2QWRA 5AJ3J 2VFTA 3D9BA 4R79A 2G0IA 3CM5A 2KTQA 3DNCA 3C6HA 4WQ5C 3TPQA 3VV2B 2D9PA