3LPDA

Crystal structure of a subtilisin-like protease
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
339
structure length
339
Chain Sequence
APNDQHYREQWHYFDRYGVKADKVWDMGFTGQNVVVAVVDTGILHHRDLNANVLPGYDFISNSQISLDGDGRDADPFDEGDWFDNWACGGYPDPRKERSDSSWHGSHVAGTIAAVTNNRIGVAGVAYGAKVVPVRALGRSGGYDSDISDGLYWAAGGRIAGIPENRNPAKVINMSLGSDGQCSYNAQTMIDRATRLGALVVVAAGNENQNASNTWPTSCNNVLSVGATTSRGIRASFSNYGVDVDLAAPGQDILSTVDSGTRRPVSDAYSFMAGTSMATPHVSGVAALVISAANSVNKNLTPAELKDVLVSTTSPFNGRLDRALGSGIVDAEAAVNSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Subtilisin-Like Protease AprV2 Is Required for Virulence and Uses a Novel Disulphide-Tethered Exosite to Bind Substrates
pubmed doi rcsb
source organism Dichelobacter nodosus
molecule tags Hydrolase
molecule keywords Acidic extracellular subtilisin-like protease AprV2
total genus 118
structure length 339
sequence length 339
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3lpdA00
1ST2A 1XF1A 1GA1A 2HPZA 1P7VA 1AF4A 2IXTA 1WVMA 1TECE 2ID4A 2ZRQA 3CO0S 1WSDA 3PTLA 4WOCA 1SCAA 1TO1E 2ST1A 3DE4X 4DJ5X 2DP4E 3TI9A 4I0WB 1EA7A 3EIFA 1BH6A 3DVSX 4DWWA 1C3LA 1BFUA 1WMEA 1V6CA 1ZVKA 3DE5X 3I2YX 4ZARA 1Y3BE 3HJRA 1Y3FE 4JP8A 3WIUA 4ZOQI 1PEKE 1GTL1 1KDVA 5ARCA 3VSBA 1THMA 1Y33E 2E1PA 2W2PA 2WUWE 2WWTA 5FFNA 1S2NA 5JXIA 1R6VA 1T1IA 1YU6A 3F7MA 1TM5E 1OYVA 2SICE 3VV3A 1PJ8A 1R64A 3VTAA 1LW6E 3DW3X 3QMPA 5JXJA 1SELA 2ZWOA 2XTJA 3DE2X 2Z2XA 1HT3A 1TM3E 1KE1A 1PFGA 1PTKA 1SH7A 1DUIA 1SCNE 1SIUA 1Y34E 1SBTA 3WHIA 1Y48E 1P8JA 3AFGA 3EDYA 1SPBS 3BGOS 5AQEA 1OYOA 2P4EA 3PRKE 1GA6A 5JXGA 1V5IA 1TO2E 4KG7A 1BE8A 1SBNE 2V8BA 4CFZA 1Y4DE 1TM4E 1Y1KE 1C9JA 1Y3CE 3OSZA 5I9SA 1ST3A 4NE7A 2PYZA 3DWEX 3F49S 3F7OA 4J94A 4WOBA 2X8JB 2W2NA 4YN3A 1NDQA 1GTJ1 4B5LA 3Q5GA 4M1ZA 1S02A 2SNIE 1SBHA 1UBNA 1TM7E 1GNSA 3GCXA 5FBZA 2DQKA 1A2QA 3TECE 3I37X 3T41A 1GA4A 3WQBA 5AVKA 3GT3A 4DZTA 2W2MA 3VV2A 3I34X 3D9QX 1ZVJA 1SBIA 1C9MA 1AVTA 1SCJA 1YJCA 2Z57A 2PWBA 4H6WA 1GTG1 4OV6B 4C3UA 3DE0X 3I30X 5JMOA 4H6XA 1GT91 3DE6X 3DE7X 2PWAA 4HVLA 1SUDA 1NLUA 4AKSA 3LXUX 3EE6A 3L1KA 1KE2A 1NDUA 3A3NA 1YJAA 1SCDA 4CG0A 3SICE 3D43A 1OT5A 1MEEA 1Q5PA 4RYDA 3GCWA 5JXHA 2Z2ZA 4OMCA 5ARDA 1DBIA 2PKCA 3AJ9A 3LPDA 3SQOA 1Y3DE 1CSEE 1AQNA 3DDZX 1T1EA 1Y9ZA 1YJBA 1SUPA 1SVNA 2W2QA 1WMFA 3DE1X 2WV7A 2X8JA 3DYBA 1GCIA 3QTLA 5AVJA 2TECE 1KDZA 4K8RB 5SICE 4NMXB 1TK2A 1BE6A 2DUJA 3LPCA 1AH2A 1Y4AE 4KB5A 3H42B 3CNQS 1CNMA 5AMXA 4C3VA 4LVOA 1SUCA 1JEAA 1S01A 3ZXXA 3DW1X 1T1GA 1SN7A 1SUAA 4NE9A 2Z2YA 2Z30A 2ID8A 4CFYA 1AU9A 4Z2AA 2QTWB 3TI7A 2HD4A 3BPSA 5FAXA 3VHQA 3ZXYA 2Z56A 1TM1E 3GT4A 3A3PA 5B1EA 4LVNA 4OMDA 3UNXA 1KDYA 3BX1A 3LPAA 3WIVA 4H6VA 1EGQA 4AKTA 4BWGA 2PRKA 5CW1A 5ARBA 1WMDA 1IC6A 1SUEA 1SBCA 2B6NA 1SCBA 3AJ8A 3Q40A 2ZWPA 3DE3X 4MZDA 2IY9A 2XRMA 2SBTA 2PMWB 4FONA 1GNVA 3VYVA 1TMGE 2G4VA 1R0RE 2PQ2A 1AV7A 1AK9A 1MPTA 1VSBA 3DVQX 3P5BA 1P7WA 4GI3A 2WUVA 3DVRX 2GKOA 2Z58A 4HX2A 5B1DA 1SIBE 3A3OA 1SUBA 1IAVA 3QFHA 1SIOA 2W2OA 4KPGA 1C9NA 1BJRE 2SECE 1BFKA 5K7SA
chains in the Genus database with same CATH superfamily
3KOUA 2YZKA 1NVEA 5IZCA 4EYGA 4KMSA 1KS9A 4YDQA 4C0HA 5CDSA 4ZQGA 4MJLA 3ZE1B 1HQCA 3GRPA 2A67A 3C7CB 4TTVA 5F5LA 4L0CA 1N92A 1TW3A 4DWWA 2NZXA 3CZRA 3DFUA 1FBTA 2BSXA 1NW5A 1GTL1 1I0LA 3EFHA 2EEPA 3IIEA 1ZA2A 3K20A 4RJTA 5KREA 1NSFA 2Y1DA 4QYXA 2JFBA 4B85A 2C4MA 4Q3EA 4GXNA 4OP2A 1OFUX 2P8SA 2R7NA 2WE8A 5DO9A 2HMYB 4DCJA 4D26A 1ZRNA 4A7PA 4CEJA 3BKXA 1BS9A 1JQ3A 3L6OO 1C80A 1AF7A 3MT7A 4OXYA 3RJTA 4BV3A 3OIUA 4CCSA 3H4MA 4YAGA 5KOYA 3WAKA 3ZBUA 5EHNA 3EB9A 1HX7A 2BEUB 3LC7O 1H9AA 3DYIA 1N6HA 1E2FA 1U3DA 2V58A 2V7BA 3DEIA 5CJ2A 9LDTA 2BELA 1E6MA 1N5OX 3EZNA 2IYTA 5ALUA 4WZBA 5ALLA 2AFVA 3FYDA 4CKXA 2FZCA 3RHTA 4JLUA 4Y67A 4LYGA 1XTIA 2HZBA 4NH4A 4ZVVA 2WI8A 4PYLA 3UAXA 5JOQA 3ICEA 1MU0A 3GA7A 3QEBZ 1QIMA 1FDWA 2AA3A 5FWDA 1XJCA 1UJ2A 2VF5X 3A3KA 3QLTA 4M53A 2FW6A 4PGHA 2I4NA 5LNK6 1MJHA 1MRNA 5FQOA 1L5FA 2ATCA 3GLVA 5IUKC 4ASUA 5JZMA 3T1HB 3NHMA 1MORA 3D9QX 2JIQA 4HAIA 4CCWA 2GKGA 1JYSA 4FHCA 1USIA 3OZGA 1DPFA 2QN3A 1YOBA 3A2NA 3UT5A 4EPRA 5KOJA 1MT0A 3DDOA 3NUGA 5E2AA 3C1UA 1MAAA 2YFYA 3KUUA 4PLWA 2V6BA 3RT7A 1AKUA 3ZYCA 2ZI7A 2WZBA 3SICE 5EYPA 2BRUA 3C3CA 3GCWA 1XMIA 1NXQA 2G1JA 2P9FA 3EYWA 2I2DA 1KNXA 3BTOA 3WRWA 2A2ZA 2C5EA 2B61A 1T6BY 4EJSA 1U5CA 1ZYUA 3LBIA 1T2VA 1MC1A 1YBAA 4J0HA 3JY6A 2JEOA 2PUTA 2Z0MA 4Q1CA 5IF3A 3HP4A 4DCOA 3R8XA 3JARA 2EP8A 1U9YA 1FPQA 3RC7A 5A7FA 1XRJA 1JIKA 4IMRA 3QOWA 3VZQA 4QOEA 5E9QA 4CEHB 4Z2AA 2XE4A 3L8EA 1E3MA 1H93A 4RSRA 1Z56C 4NYJR 5CDHA 2BBWA 2VL7A 1PZFA 4KQIA 4WNAA 3DL0A 5KNDA 3PF8A 1EPUA 1T2EA 3D5EA 3GFOA 3D4NA 4JX8A 3WYNA 2APJA 4NEQA 4UDXX 4IH9A 5A0TA 1IZYA 4PZYA 2MYUA 2P3LA 3EMDA 4XM2A 2H54A 4ARUA 4CV2A 3IBGA 1XCLA 3UPDA 4IS2A 3AIMA 3O47A 4CL0A 5I4KA 1E89A 2RGBA 2GEBA 3KSZO 1KJ8A 4IO0A 4P7BA 4POAA 4ECEA 2AX3A 3DV0B 3OETA 2POCA 3BFVA 3P9XA 4ESVA 1GRCA 3HB5X 4F97A 4PRYA 2D13A 1GSHA 2OHJA 1FA9A 3ZY2A 4R84A 5IUJC 2NPIA 3GGOA 3PEFA 3QUTA 4ZQFA 3X1ZA 1Z17A 3E5HA 4GM0A 4YONB 4B2YA 5JNTA 2GA8A 2OCPA 3WJAA 4OPMA 2OHOA 4H7KA 2W6CX 4WH0A 2LVBA 2AOUB 2AQKA 4FHEA 1A8HA 4XE5A 4OLAA 4XYEA 4JI0B 3TQCA 1UZUA 2NP6A 1NBIA 3UBTA 4Q37A 3ZJUA 5C5EA 1SM4A 4ZANA 5BR1A 5JJBA 2OCXA 2E1PA 1RWKA 5EIFA 1T6XA 4INAA 3VPAA 2A92A 3S2FA 4EECA 3TL2A 1I7NA 1ZOPA 3MCAA 4LOLA 3ZE8A 5ESDA 4K6MA 2W22A 4QJBA 4PFQA 5A05A 3UHJA 1O54A 4M1QA 1XNRB 5CXXA 3B6EA 1T3SA 5AW2A 3PFWO 1GEGA 3PFFA 3S1LA 3FKSD 3LT0A 4X6YA 1LZKA 2P9YA 2O8BA 2IPAB 4FSDA 4NOMA 4E5MA 5LD2B 2OFPA 4I4TA 4MV4A 3KQUA 3I9V6 1DHRA 3B9PA 4GT1A 4Y6LA 3CN9A 3CCFA 3EULA 4E1AA 3S4YA 4HLUC 3QJYA 2DCMA 2AE2A 2RHDA 4HWSA 4AJKA 4Z54A 3T8YA 3FGZA 1EVZA 1N1MA 4S12A 4YV7A 2FSGA 1K75A 4M83A 1O4WA 2C9YA 2Q4DA 2V3WA 3I9LA 3U3MA 3BJMA 3OT4A 4UCFA 1AZSC 2WYIA 4M7OA 1QS0A 3V7YA 5MGNA 4FU0A 1SCIA 1MEJA 1P9RA 3Q3IA 1H4VB 1IEQA 3RJ5A 1VL6A 5B6PA 3FB1A 1GL9B 3LWBA 4EB8A 2C3MA 2JGEA 3K70C 4OHZA 4QO8A 3OOJA 3UJ3X 3Q87B 3M4ZA 3IB3A 4FIDA 1NZDA 1W44A 3MXOA 4K3UA 4BZPA 1I6WA 4WOJA 4I55A 2IZ6A 4XFJA 2YX1A 4BVLA 3UXYA 2FEKA 1JKMA 2H4JA 4KIFA 1YR3A 3SG0A 3E84A 3OTGA 5CIWA 2BFDA 4AZ0B 4LZOA 4REOA 1GZSA 8AT1A 2Z2IA 2JIDA 3PNLA 3RVOA 1QQTA 2Q5CA 3I6MA 4YUXA 1AA6A 4KB5A 2GYVA 2W6PA 4MUXA 1PR6A 3OU2A 2WUFA 3OAAD 2GCEA 5K3FA 2HXYA 1QMGA 1O6GA 3OMWA 1ZUIA 4OOFA 4P82A 1S01A 2V45A 3SLKA 1Y3AA 3LYLA 3R0ZA 1D4ZA 4QKQA 1RP1A 4DY4A 1AU9A 2YXLA 1A4RA 3TQTA 1OV4A 4HNUA 3HWX1 1HDCA 1NUHA 4NJMA 4Y9RA 4MS1A 5D3KA 3BB3A 3NHBA 3CRMA 1NX9A 5F1OA 1FC0A 1HA3A 1EUCA 2EJCA 2GN2A 2QN1A 4BVKA 4UFPA 5B4VA 3EDMA 3BT7A 1F3OA 2VYFA 4PTLA 4CGYA 3O74A 3OFJA 4RMJA 5GONF 5ER6A 5K8JB 1FXUA 1SQ6A 3HA5A 4IFBA 2HHAA 1H2XA 1M10A 2Q4EA 4YWHA 5C1PA 5C5IA 4CKCB 3DB2A 1SC4A 4YRLA 4I1SA 5EMNA 1MTZA 5TY0A 2C61A 3OLVA 2Q27A 2G7MC 2C4HA 1NJSA 4PLFA 2XF2A 1JEOA 4RTKA 3EPJA 3NJ8A 3PQ2A 4W5NA 2FPIB 1NFQA 1GG8A 2X5OA 2QM7A 1LI7A 1F0NA 2FA9A 1WXFA 3KJNA 3LJKA 4LQ4A 3IP6A 5T4HA 2ON6A 2HCBA 3W8RA 4N54A 2VJMB 4EL5A 4OREX 4ZTUB 4CL8A 3PQFA 1TO1E 4FJ0A 5AVUA 4OFBA 2QMQA 1V8ZA 3H05A 4DG8A 3CQ9A 1CZLA 3OT5A 2J32A 3G17A 3O9ZA 1GHTA 2HXSA 1RADA 3T54A 3UHPA 3WIUA 5IJWA 5KWJA 4GL4A 1NMSA 1KZHA 4RTPA 3B2EA 4AN0A 1OV6A 3VNAA 2RBEA 2L18A 8ADHA 1C3XA 3BRWA 4WLUA 1M7GA 2Q3JA 3I09A 5DX1A 4OB6A 1PLKA 1H1DA 4HAZA 1H2YA 1GQSA 3K0FB 3WGGA 1O8BA 2RHGB 5ITZA 5T3UA 2VHXA 4DVGA 4URVR 1PD1A 2RHWA 3FSGA 4MCJA 2O5CA 1DUIA 2Y1CA 2H85A 1ZEMA 4D9MA 2XNKA 1U6KA 3LHDA 1P45A 4MV5A 4JXKA 1X2BA 2SCUB 2XCOA 1WE2A 2FOLA 1FNDA 1R6UA 2H07A 3ILXA 4KN8A 4MAFA 2V8BA 1ZISA 2RJOA 1XNQB 1PSZA 1LGYA 5DGIA 4CM4B 4CG1A 2GRJA 3B70A 3O7WA 4JWKA 1NDQA 4KXLA 4ND8A 4FN5A 1MXHA 4YMGA 3E3LA 5DBGA 4I46A 4GRAA 5DNDA 4HB2A 1CLEA 5MFPA 5TV2A 4N0QA 5B1HA 2JHPA 3K53A 4R71A 1BXRA 5JAUA 1TL7C 2D2IA 3LO5A 3WWDA 2Q3MA 3W6UA 1IAQA 1LLQA 3SS7X 1HQDA 1J24A 1JLHA 2NP7A 4LYEA 1ZI6A 3GD7A 2CMHA 4QD3A 4RGQA 4ANFA 2B9EA 2H9IA 2IPXA 4BNNA 4EI9A 3E1SA 3RADC 3HRHA 4LHYA 1KOGA 3OIDA 5AI8A 1RJWA 2F3QA 1XWFA 3AUYA 4QE3A 1PZNA 1MENA 4QLOA 1EFTA 4TWBA 3I23A 3ZCSA 3TMYA 1DBVO 2O4CA 4LQCA 5F7JA 3IBYA 5J5AA 1TC2A 2XB9A 1X7ZA 2FPOA 1C0KA 3H5WA 2QKYA 4NPCA 5HCIA 1TAUA 1DWQA 1CF2O 4ZYVA 4I55F 3MC1A 2J0SA 4ZI7F 3HK2A 2QV7A 5KNBA 1VOTA 2WT8A 3HE3A 2FE4A 4MUAA 4P7GA 3IUJA 5JDIA 3KQYA 3WYFA 4QNMA 1J97A 3BOSA 1CTQA 4HQ6A 2A58A 5I9LA 1IN4A 1L6IA 4FQ8A 4M1WA 5GZ6A 4F7DA 2Z30A 1ZJ6A 3UKDA 2AN5A 3A1DA 1I6LA 1LKZA 1YULA 1JF8A 1K27A 1YDFA 1RRFA 2HNAA 2ACEA 1K8ZB 2JLUA 2H2WA 3HM9A 4LFAB 4OQQA 4EM6A 5T4BA 3V4RA 2NACA 2HN9A 3OEWA 2V65A 1DAEA 1WMSA 2JGDA 1I3NA 1AKMA 1YZUA 1JE0A 2HLNA 2BOVA 2G83A 2WM9B 2XB4A 2XDWA 3E22B 4UQPA 4PAOA 3VU0A 2WKRA 3VA7A 5C51B 1Y8CA 5ADWA 3T9AA 5T6MA 5EJ8A 1O8CA 1AUQA 3FCUB 4PYNA 4JLOA 4MKHA 4M6WB 1PZMA 3U0BA 1B73A 1PT5A 5AIBA 2Z58A 4IQGA 4X20B 2FVXA 4L75A 3RD5A 2HI0A 3U7HB 5GV8A 2NO9A 1UM9A 3SNKA 1NMQA 1RRKA 2EGGA 3R9WA 1GAXA 3OZCA 3NTQA 4J1QA 1BWRA 2N75A 4BL5A 2HPZA 2YOHA 4BV8A 3NVKI 1M5UA 2ID4A 3LVQE 3K8OE 3OO1A 1J0EA 1W2GA 3IAFA 4MV3A 1WUYA 4URHA 5HEKA 1OXTA 4O4HA 2H63A 1EA7A 2EZ4A 2BEJA 5A9RA 1HDEA 2XA1A 1CY4A 3ZD7A 1V6CA 3RC8A 3BFKA 2HT6A 4IG4A 5C35A 4FDLA 3SF0A 4L16A 5IPFA 3K30A 4K6KA 5ITZB 3WBKA 3JWGA 1QZTA 4E33A 3R76A 3CHYA 4HCJA 2NU6A 3QU7A 1M1YA 4Q39A 4L9RA 1OYVA 2K7ZA 1UAYA 2B20A 4JP3A 3REQA 1X7YB 4G8CA 3K5PA 3QTBA 4MEAA 5C9ZA 2BDUA 2J1LA 2D1TA 1J0DA 3H1BA 4DW8A 2ONZA 1JHPA 4EPYA 3ETEA 2HA6A 3KXPA 4YAOA 4EMUA 1T13A 4ISCA 1DO8A 3HVIA 2PZBA 1PWXA 1F2UA 3HJBA 3AJAA 4UPVA 5J59A 5LXTA 2RAPA 2VPYA 3DHNA 1L7AA 5C8XA 1UDWA 4FGZA 1FX0B 5K6RA 1XPOA 1Z5GA 3O2NA 3REFA 2BEVB 1MVNA 1OY1A 3X44A 3PXBA 4AMZA 1ZJZA 1GV1A 2JBWA 1ONNA 2XQIA 4TKUB 2NO5A 5EG5A 1IBLB 1GNSA 5FBZA 3TZQA 4J6EA 1IYZA 4MEBA 4Q21A 1B23P 3L1IA 4WE3A 1G42A 5DHPA 4D98A 3SJZA 1TTTA 1EDDA 3EFEA 2IEBA 3DLPX 1KK3A 3KKQA 4W9NA 4Z7QB 3OUTA 1ZXBA 3AJDA 1KZ9A 4O1IA 1WUKS 5JAQA 4HB0A 1N2CA 4YJGA 3SXPA 1ZN2A 3G02A 3MMXA 3DFZA 3ZUPA 4Q9DA 2WA2A 4P3KA 3LXUX 2GN8A 1CPYA 4X7RA 4ZAVA 3WLAA 4TMKA 3GPIA 1GPNA 1A1SA 3B6IA 3LCUA 4YQEA 1HTWA 3BCHA 4Z4QA 5FJJA 3WDKA 2BHRA 3EZFA 2QTFA 3OQVA 2IVFA 4LX8A 1XAJA 4MP3A 4TL8A 3IMFA 4LKRA 5ALIA 1FS6A 1LWOA 3AR7A 2JA2A 3JQPA 3DPIA 3PL5A 1BU5A 5AKHA 3UZUA 2C54A 2DM6A 3MSCA 5ALQA 4JDPA 1J20A 1MDFA 4B6SA 1QGED 1SXJA 2J07A 4DTCA 4C4PA 4F8YA 4EYEA 1FNMA 1E7WA 1KEZA 3A27A 1MW8X 3MGGA 4D3FA 3N2KA 2IPMA 3E2IA 1MJFA 1KY3A 1QV9A 1R4AA 5CHYA 1K8RA 2Q1WA 4D02A 1Z2DA 3CG0A 3T95A 4OGLA 4IXNA 3L0SA 4UARA 3GT4A 5KJ1A 1Y5MA 5ESRA 6ADHA 2KQUA 3ESRA 3OZEA 4CE6A 4AKTA 3GG2A 2WM8A 5TARA 4RV9A 1E5DA 4BV2A 1TQ6A 3AHIA 5FPQA 2C5FA 4D46A 2JFHA 4GM1A 2A88A 3LI2A 3L4EA 4TGLA 1KYTA 4YMLA 3D54D 4UNIA 5EVJA 5EQJB 1ES9A 4GQBA 2B1GA 5DBOA 3TL3A 3WLRA 4M8NE 1WXDA 4J76A 3LWNA 3O5AA 1EK6A 5L4NA 2GO1A 2Q4OA 3ZQ6A 4EHJA 4IHKA 2ZAYA 2ODQA 3UATA 1H2ZA 5EJ2A 2MWMA 1JG6A 2CBZA 1T5OA 3C6YA 4M9XA 4B73A 1TUBA 1JRLA 3K71B 1ECJA 2QVZX 2JLBA 3I6YA 4KQCA 1E1MA 1FS4A 1NJ1A 4KQ6A 3STYA 3W8DA 4AT1A 5LP6A 1BFUA 4WUVA 1HZZA 4CG2A 4YJFA 4LE1A 3OECA 1NQ5A 3MTDA 3LOPA 2QE7D 4L15A 1CIPA 4QU9A 3EISA 1QIKA 1SHLA 1T5SA 4OYLA 5H81A 3G0DA 4FOLA 3KTOA 1TXGA 3OM0A 2DEUA 3KB6A 4IV8A 3UK6A 4IQ0A 4FE3A 4BRWA 4DAEA 2RHLA 2QLTA 3KKOA 3WYEA 3IT2A 4BKMA 4IGKA 3DLIA 1JHDA 1R2QA 5DGCA 3STWA 3ST7A 2F43A 1BEUB 3WYBA 5EPOA 1SBTA 5DISB 4QVKA 2PYDA 3CVXA 3Q3GE 1ID1A 4HEA1 2BUCA 4QAQA 2YJ4A 3BGOS 2GHRA 6CHYA 3BRSA 2GYUA 4B1FA 5CFNA 4UVEA 3UJNA 1HORA 4JOBA 1GKUB 4K9LA 1QO9A 2C5SA 1LI5A 2JGFA 3PC2A 1PDWA 1RAGA 2OHIA 4Y6OA 4DSTA 5AJTA 3FAZA 2WZDA 4TXHA 1WTAA 1XVUA 5CLFA 4KYUA 4OY3A 4Z1MA 1U3VA 1DRVA 1GTJ1 4F6LA 4GBMA 3D6VA 4CM6A 4KE9A 2CDRA 4Q82A 2G6TA 3LBYA 3Q7SA 2A1TS 2C03A 2FFHA 3M5CA 1P60A 4ZCPA 4KR2A 2JI6A 1H6DA 1GRQA 3QYFA 5EWMA 3TS1A 3B6KA 2PWBA 1GN8A 1QK3A 2P9BA 4FHFA 5THKA 1NT4A 2GPTA 4A4DA 1T2AA 3I72A 5DM0A 1ZRHA 3DUFB 5TVGA 4PN3A 1B8OA 3LGSA 3U80A 1IHOA 4D0LB 1KIFA 2VF7A 4I1RA 5JBNA 5IHXA 3IIIA 4R8KA 3PP8A 4C05A 3ESBA 4CTMA 1NYRA 1YQTA 2IXFA 1VIDA 1VL5A 2P6PA 2X4LA 4DMCA 2BR3A 2O2DA 4R69A 2ZIZA 4XUDA 4NCHA 3JQ7B 4PAWA 2H48A 2IW1A 5A6SB 4D4MA 2WNIA 5B58T 5CM9C 3LCVB 5DGXA 4L6CA 4JYPA 1ZESA 5FPKA 4YLEA 1G5TA 1ZL2A 3PBKA 4Q3KA 3GRRA 3V55A 3LU1A 1XNHA 3PDIA 4OLHA 3LC0A 4NBTA 2V7UA 1YDMA 1U2GA 1J0AA 4BS9A 1QG4A 2RGGA 1E9RA 1VI5A 3DVLA 2H1FA 3H1AA 3TLJA 5JS6A 3UO8B 4IDFA 1XD2B 3TNDA 5TF0A 1WMDA 1RYFA 2E9SA 3MA0A 2VWPA 3OU6A 4XARA 1X94A 1Q16A 4DL9A 1V3VA 4F38A 1VL0A 3GFRA 3QFCA 5E95A 3V4VB 4F0JA 5KIAA 3OF3A 4FONA 5BQ5A 4DEXA 1XZFA 2J3DA 4LJLA 4HY3A 4U4AA 1AJEA 2OZPA 5A9SA 4DKXA 1WQ4A 2A8YA 2JBHA 1LRJA 2ZYGA 4EHKA 4B3DA 3ZD6A 4MUBA 1J2RA 1O95D 4BNHA 3EPRA 4RA6A 2YVLA 2XYRA 3FNGA 2HA5A 3WTBA 3MGBA 3CPJB 2WMOB 5IC4A 3SPXA 1BHO1 3LDUA 1ZGCA 2FGKA 4JELA 4NMHA 2A86A 3U7JA 2WJGA 1OX6A 3CUVA 1IXZA 2W6MA 3EGXA 4GF5A 3OPVA 5TC4A 2XOEA 2VPXA 1ENOA 3FWYA 2JFWA 3O3CA 7MHTA 1L7DA 1DAOA 3EFOB 1IPEA 2A7QA 1E1LA 5K03A 3K4QA 2JVIA 2P2LA 3GLQA 3PQ4A 1QHSA 2PSEA 2PZ8A 5EC8A 1PWEA 1ORRA 5D51S 4RHTA 5BYJA 2H4XA 3A1TA 4L6AA 1LX6A 1TX4B 4PAQA 5DSXA 1V5EA 2OBXA 2DJIA 3G82C 4LBYA 3NM5A 1NE7A 1NT2A 3D5QA 3KYCB 3QELA 3THYA 3CKMA 2GF9A 3L6BA 3VO8A 4RZ2A 1NL3A 2RH4A 3FUUA 4LK3A 2IXAA 2B35A 2BHLA 3UTDA 2VDKB 3SQNA 1WG8A 4TT3D 4CVNA 4CIYA 2ZWVA 2WFMA 5BSUA 1N3BA 3NHRA 3PJFA 4HV4A 1NF8A 2WAAA 1LY1A 5EKXA 4JT2A 4S0XA 4DUGA 4A8TA 1U1FA 3BXEA 1DB3A 4G9GA 4IQFA 3TNLA 2DFNA 4RMGA 1WLSA 4IW3B 4KN5A 4WFJA 4TXJA 3FKSA 3KKEA 2CJYA 1MJGM 3EW9A 3ULKA 1M2VA 1Q3KA 3HU1A 4NDAA 1Y1QA 1BQEA 4ZAWA 1Q0LA 2Q2WA 3P9ZA 1S7GA 4JL5A 4OB7A 2LCQA 4ADSG 2VTDA 4DE5A 1I1QB 3RWMB 1CYDA 2XUIA 1EXDA 3FFWA 2RHJA 1NPDA 1XG5A 3B6ZA 4QQRA 2BFNA 4CEIB 1AHNA 2B83A 2AUTA 4NCIA 5CA0F 4BNDA 1TUEA 4BLSA 5AW9A 2AKYA 3QHPA 4BFYA 1W2WB 5BNTA 4PX3A 4QYSA 1Z4OA 1YR6A 3K2BA 1Z13A 1N6NA 3H84A 3M9LA 4V1CB 5AK3A 1ZD1A 2Q8NA 3PHBE 1QV7A 1QGOA 1JFVA 2C2WA 3SC6A 2ZRBA 1BDIA 4F5EA 5J43A 2AR9A 1VRWA 2O8FB 3MS2A 5F9HA 1RWWA 1C8KA 3I1JA 4GDMA 4JP2A 3LA8A 4HAVA 5FJIA 1CR0A 1FSGA 1PT6A 3CNOA 4QUBA 3RVBA 3U48A 2HBZA 1FP6A 2GO7A 1ULAA 4ZN6A 3KJGA 2ZUVA 4H16A 5AJXA 2QP4A 3O1JC 3UNXA 3OQIA 1P2SA 4ENUA 1VL1A 3G88A 5SZHB 1Z68A 2QM8A 4KXUA 2HQBA 3DKRA 1YD7A 3ET5A 1NUAA 1Y7TA 2IHVA 2CN1A 2VHQA 1R0SA 3L7AA 4O2LA 1Y8ZA 5CLQA 3QVTA 2XZLA 2A9RA 2VF8A 2GD2A 1FXWA 2QRVB 2O2CA 3I2KA 2QQ0A 2UZAA 3T7EA 3FHTA 3F2IA 4TRRA 3VBCA 2PZGA 3C8ZA 3U4MA 3HEMA 2F00A 4RE6A 2PBFA 4ALKA 5IYZB 4ZTZB 1RQRA 1NBAA 4XFKA 3OWOA 3K0BA 1ML3A 5A5EA 1E94E 2VP5A 3A1UA 3STTA 3UB2A 5E7QA 5ALMA 3BQMB 1Z6PA 5BRJA 4G4GA 1F0YA 2ZJ5A 3KCQA 1GLGA 2V55B 4DZZA 5JQGA 3CWQA 1PR1A 1L5VA 1KBZA 2HQRA 3IQFA 3S5UA 4NMWA 1YB6A 1KC3A 2WC1A 3L8HA 5B7NA 5EXPA 2AV6A 3AF5A 5REQB 4GHWA 4AX4A 4Z1MD 4G4JA 4W1PA 4YAWA 2YWGA 2V6GA 4DJEC 1SJ9A 5CVVA 4Y0AA 3MQ2A 4FI3F 4G1CA 4XQEA 1UFKA 2I55A 2C5LA 1MV5A 1ZM7A 3ETCA 2QD3A 2FNAA 3PC3A 3JQ9C 1QOQB 2HB6A 4D99A 3HYNA 4UPEA 2IUTA 1HYQA 2DPHA 4KVFA 3X2FA 3V34A 3U4HA 3PEYA 2IYEA 1QGYA 4AG6A 2XCIA 4CUKA 3T0GA 4D6PA 1ADCA 2HADA 5C18A 3KHSA 4HQ0A 1MFPA 5L9AA 3DT8A 5CCDA 3HB1A 4O4IF 3EXFB 2H4YA 2ZSJA 2ODNA 5CLHA 1DOAA 4CM8B 4YRKA 2C3YA 4RTLA 4TWRA 4PQRA 4Q19A 2GAJA 5AHRA 5HF9A 4F3CA 2JIBA 3Q7EA 1C9JA 4Z7NB 4WK2B 3A4VA 3DMHA 1Y37A 1QE0A 1YDWA 1ZI8A 2QE7A 3K31A 4UU8A 4YO7A 5DULA 5G0SA 3SEAA 1I7PA 4JV5B 2ZANA 1GYRA 1TQ8A 2GJ8A 3ZI0A 1AKWA 1YB5A 1SQ0A 2FFJA 1AUVA 2ZKIA 1Y4ZA 1DKMA 2IXBA 4PLZA 1GDDA 4PGMA 1FNCA 1E3IA 3TZKA 5IH3A 1AMUA 3ZGNA 3JZIA 2GZHA 5ADUS 2PUFA 1AKNA 4IDQA 2QEQA 4CKZA 1GLVA 1WKCA 1YGYA 2QMZA 3GJRA 3TF5A 3D3WA 4F2HA 2Q0XA 3UGKA 1W4CA 1P3DA 1RYYA 2CE2X 1VE3A 2IPLA 2V4MA 2XMRA 2XWBF 3F9RA 1G7SA 1KVQA 4IIGA 4LG1A 4YP5A 1MQSA 2XNJA 4PBTA 4S0ZA 1TADA 5GV7A 2REBA 2I5PO 2FWBA 5A3QA 2BHTA 2NU7A 3LP8A 4IFIA 4PGGA 4L8LA 2NUBA 4BN5A 2V0CA 4HDAA 4OQZA 1PV4A 4JUAA 3Q15C 1MW9X 4N12A 3ZDYB 4MHTA 2ZI6A 3O4GA 3PD1A 3EQ2A 2N1MA 5BPFA 2E3JA 3CLHA 3RGWS 4B7AA 1QHGA 5M04A 2AI1A 3ZNOA 3WNCA 1JECA 4EDHA 5AFSA 4TMYA 5B6JA 4KACA 2C4WA 2PSHA 3DEZA 3RYFB 5IXSA 2ZJAA 2CHUA 2EKBA 5KDOA 4JMLA 4L28A 4M0UA 3IAS1 1H6AA 4MO9A 4V02A 5EEHA 4EIWA 4ABTA 2PTHA 5CDTA 5BUQA 1ZBDA 3IQEA 4PEVA 2HIAA 2Z98A 3MILA 3HMKA 3C5VA 1RQPA 4JJGA 1PG0A 2XNSA 2WU4A 2COUA 1M5TA 3FOAA 1XDZA 5DCUA 1T8UA 1XLVA 4BZQA 4CIVA 3QVSA 3ILVA 3OE7D 3E18A 2XKBA 4L5JA 4WINA 1T36A 5CBPB 3CW8X 4MEJA 2CKDA 2D1RA 2Y1GA 3MINA 3DVRX 2HK9A 3AETB 1SOAA 2W2KA 5JFOA 1QC5A 4YAKA 4RU1A 3UENA 1A9ZA 4G0VA 5TQ0A 3N8GA 1BHJA 4NAUA 1ZK4A 2H7CA 1VBKA 2J5KA 2P68A 2W6JD 3CTMA 3GJ6A 3NR2A 3OOEA 2NWQA 3R5KA 5CJPA 3CUUA 2HYIC 1L0BA 2GF0A 4DDMA 3VOAA 2R7KA 2HSJA 5ESXA 2EJUA 1E8DA 1KJZA 1JLRA 4R7ZA 5CYPA 5C31A 3VU8A 3UGTA 5C7IO 5JXWA 3ADDA 2X8LA 3P45A 3UUWA 3V1TC 4YCSA 1NM5A 2AMVA 3DM5A 2NO0A 2WM2A 3D3KA 4OXNA 5I7AA 2ADFA 5C7LO 1CV2A 1QGUA 2QAJA 3FJYA 5JHHB 3QUAA 5CB8A 2X5XA 3QVJA 1H9CA 3C6XA 3FHCB 3L92A 1FTNA 1PJSA 1K7YA 4W5WA 2SICE 5FNVB 1SVIA 1QU3A 1I4OA 5IANA 1IFXA 1KAQA 1KI6A 1HC7A 3GROA 1G3QA 4H7FA 5K4AA 1EUZA 2R60A 4GH5A 4M1EA 5IAGA 3W5UA 4XGQA 2PD4A 5HUHA 3THWB 1LPNA 1TA9A 4OHKA 3PENA 1MP0A 1RWPA 2AFRA 4I1IA 1E8MA 2H3HA 4AJEA 4DT1A 4CKWA 3MYYA 4MLCA 2CXUA 1Q1QA 2MHCA 3GYGA 4OXKA 4JBLA 1M2OB 2ERXA 2X7HA 3PCXA 4M0CA 2HCFA 2J6IA 3TLGB 4KZKA 1SCUB 3ICOA 4MV8A 5H80A 2FRVA 5I9SA 2ZDQA 4URYR 2QX4A 1YUBA 2Q4RA 4RCVA 2X3UA 5C1IA 2YZ2A 3OQHA 2G0NA 3UT0A 2E0IA 5FV7A 3W7VA 1ZOIA 1E6LA 1ZUD1 3PDCA 1ABFA 2D00A 4JEIA 1XZNA 3RG2A 2EL7A 2F90A 4DCMA 4E46A 3IDSA 4C6HA 4QDUA 3R7AA 5FV4A 4HFJA 5AHKA 3D3JA 4NV3A 4OKIA 3ZG6A 4TQAA 3RBAA 4CQMA 1DCKA 5GJVC 5G1NA 5EHIA 4BPBA 3GEIA 1DAGA 2R96A 1IATA 4MUMA 1DE0A 5L7YA 5LYJB 3TB6A 2VDUE 3NOVA 1DAKA 4J0CA 2PYIA 4MS1B 1GL7A 3QEOA 1U04A 3HCNA 4UUNA 1QTNA 4A6EA 2PXAA 4JYAB 3SN6A 4NCNA 4WRRA 1G7TA 2GBIA 3KKNA 3MAGA 1IM2A 3NAMA 4L4SA 1KDZA 4CKCA 2PUWA 4GU5A 1P7ZA 4UUOA 4FE4A 1KFEB 5HKBA 2NVBA 1USVA 5E6RA 2ZXEA 3CNQS 3EX7C 4QARA 2YBEA 4LVOA 1FYXA 4O4JB 3OJLA 1TU4A 2XBLA 1XVIA 4RVFA 1HUQA 4RLFA 4QRHA 3RS0A 3HKBA 3P20A 2KE5A 4FMCB 5KJCA 2BFOA 1VIYA 3AEQA 2X58A 3OPNA 3ZBPA 4QC2A 1Z37A 3O0TA 2Y3IA 1R9NA 2PRKA 5FA6A 2B6NA 1ENZA 1IC6A 2NVWA 2OFWA 4E14A 1F2DA 3OJCA 2YIJA 1R0YA 1Y5IA 3JQEA 1PP4A 2EG5A 2BZ1A 2ZJ4A 4Z99A 5KQLA 2EQ5A 5TNXA 5C3MA 1OFTA 5LQNA 1H2HA 1L7VC 3JATA 3E05A 3KUDA 4DA6A 3ETNA 3RVSA 1MNQA 2QYOA 3QMVA 3M83A 2ID9A 2FMXA 2GTIA 4BVBA 3EBPA 4YXFA 2AF4C 3C85A 3WRXA 3ABIA 1IUNA 3OQPA 4F3KA 3OZSA 1LS6A 3AL2A 4JI3B 1DTWA 4QTUB 3HYSA 1IEVA 2GI4A 1SFRA 2L19A 3KVRA 4PZZA 4HL6A 3WGZA 1KSHA 3AVXA 4IVPA 4LGYA 1MC4A 3GUVA 4AP9A 4RZSA 3UG6A 3KOWA 4XDZA 1UXHA 1KP3A 3EQ6A 4LJ6A 4M8IA 1AQJA 3OJ0A 1SO8A 4C76A 4UUQA 1DJPA 3UC5A 1SXHA 2PUVA 1F3LA 5F35A 5FCDA 3PRJA 1XEXA 4B0OA 4KEAA 1NATA 1Y89A 3H2KA 4RGVA 1M2KA 1Y9EA 1YF3A 3N9IA 1PJ8A 4CMKA 4RD3A 5CNJA 4ESEA 4LZZA 1EU1A 1M1YE 1XN1A 3TLMA 5JS7A 1KWGA 2BTQB 1V8FA 1VJ5A 3ZDRA 2X1HA 5AVQA 2ZT7A 4KUGA 3SOPA 4B9AA 4MV6A 3WLIA 5KX5F 4IHJB 3UQZA 3NC0C 2ZQ5A 1EDEA 4IMPA 5D6OA 3VYSB 4OLBA 3ABRB 3SJCA 4AVYA 5A3SA 2EBFX 4HDNA 1INLA 1Q12A 4MLDA 3BM5A 3KWLA 5FYQA 3L06A 2XNDD 5LQJA 3R3ZA 1RC1A 4ZHQB 3HP7A 4D3DA 2BSQA 3MLEA 2C98A 3SIRA 4BE9A 3U61B 5F3WB 4N7MA 1B0UA 1NPTO 3GLHA 4B7XA 1YQ9A 2A0XA 4PCLA 3N70A 4JQCA 2YICA 2DZDA 2JIRA 4F96A 4JA2A 4YO8A 3ZU2A 4QPNA 1QYIA 5JAMA 2C3UA 3W6ZA 1F2TA 3ZD8A 5AVKA 4F4DA 4X60A 4KJXA 4WKNA 1YZVA 4TLDA 1NWCA 5A4IS 3B13B 5A4DA 3GAFA 3LYUA 2WJWA 1LQTA 1CZUA 1LI4A 3HKEA 4L5CA 4MRAA 5K3DA 3TAUA 4AG3A 4F1KA 3GIWA 1GUYA 3AHEA 1NN0A 2NUAA 3M0EA 3RBXA 1ZCBA 2OHGA 1Y3IA 2DFKB 4U00A 5JXHA 1KWKA 2WWFA 3M3DA 4J7AA 1OA0A 1P4GA 3LD9A 4P84A 5LB4A 1MHTA 2IY7A 2YHSA 2DR2A 2DJ5A 4NYMR 5ECWA 1C3VA 2F6RA 3LPCA 5BWLA 5K0LA 2ZTMA 4C0AC 1AXRA 1NBWB 3F47A 3JQGA 1IULA 3O84A 5HIIA 5DHUA 2VBFA 3UAGA 3VR5D 4OA5A 4EA6A 2PKEA 1DL5A 1AK1A 3BTVA 3C1OA 2ZAIA 1T10A 2DVMA 3MUFA 3WGUA 4LOKA 3Q8MA 1EP1B 1NUPA 2FN8A 3G85A 4MA5A 2XZDA 4YJ3A 2C9BA 5BN5B 4OX9B 2DUUA 3N05A 2XADA 1DTEA 2O6HA 5AI9A 4AUMA 1S3IA 3COYA 1YS9A 4D96A 2OCGA 4NRDA 3EG5A 5K3AA 2O52A 4RDXA 3L1HA 1L4HA 1QAMA 2GCOA 2FQ1A 1KQPA 2J87A 1NW8A 3LC2O 4E7OA 2OTCA 5IWAB 1GTVA 1KNQA 2G67A 2WTEA 2PGJA 4ZI3A 4I66A 3O93A 1WZEA 3HCOA 4BCCA 4PCVA 4WDQA 5FWYA 1WVIA 1V26A 2C29D 3RYHA 1WB5A 4D8XA 1VP9A 3RC9A 3F6BX 2VH1A 4I8DA 4ZPJA 3SR3A 1GQQA 5JXJA 4RQTA 4DCUA 1MAHA 1XMSA 1U80A 4OBEA 4S1PA 4ZJUA 2QY9A 2NIPA 3U7RA 3K7EA 3SYRA 3ZIDA 2IH5A 1AF4A 2VCYA 3WLHA 4YALA 4HTFB 3I0NA 4UMFA 2CEKA 1OLSB 5FTNA 3H17A 3JQAD 4O5OA 3ZUGA 5BV1A 3BERA 5LOVF 2ZRNA 1MH9A 4G8BA 4OF4A 4DLVA 3ZQKA 3DE5X 4HN9A 2FQWA 2PJRA 3KSAC 2P3OA 1IOLA 3AX6A 3GARA 3NALA 1RQNA 3NWOA 4IIUA 2NZYA 2RK4A 1VJ1A 4BOYA 1ZNXA 3DQPA 3NCHA 2RBKA 2I7VA 5AM3A 4MW5A 2RGRA 4Y2QA 1UR5A 4X7BA 3FMPB 1W5EA 1B8VA 2Z8YM 1ODKA 2OBFA 1QNFA 1P77A 2PZLA 1PFKA 2VCHA 4KGXA 4YLGA 1EUQA 4ZI2A 3PC4A 4BNMA 2D0PB 3H2YA 4HZUB 3RK1A 2WJPA 5KTOA 3QEMB 4QOSA 3BULA 4TQUS 4EELA 2WICA 1YVPA 4QPZA 1U28C 2J6CA 4HUJA 2CCKA 1U0OC 2YH2A 4G09A 4PZUA 3PSAA 3PEEA 4Z7JA 5FOQA 3OCUA 2YKGA 2V8OA 3LUPA 2C4KA 3GJ3A 4DARA 1FVHA 1XZKA 2W4IA 3IIKA 5K8UA 3G2MA 1F4LA 3QMMA 4CNQA 4CLRA 3CNBA 4CYMA 1YKSA 1SVMA 5JAOA 2RGYA 3AG5A 2PFSA 3DBIA 3ENZA 3O95A 3TZEA 4FBMA 1SK8A 3DBRA 4XDGA 1TAHA 1WABA 1E9SA 2TSYB 3LWZA 3L18A 3N53A 4QZVA 3D7RA 2ZUEA 2R4UA 1K7XB 3UFXB 1DC5A 4C3UA 4UAGA 3JAKA 3TIGA 1UC5B 2P9HA 3PKJA 1T5IA 3L7LA 1GKIA 1SUDA 3QVGA 3W3AD 1J4AA 1HK7A 4A16A 1E1QA 4NZZA 1JYFA 1YVEI 3PFIA 1G2OA 3AWDA 3EF3A 2X8WA 4QGBA 4A0QA 1II8B 3B48A 1GZ4A 1IZ9A 1OX4B 2HJ9A 2HF2A 4YHHB 2CLCX 1XVTA 1QZZA 1Y9ZA 4XDHA 1EHYA 2ZRKA 4KIJA 1CD5A 3U9TA 1ESNA 1PUIA 1OHHA 4B17A 2CBXA 2P1ZA 3SP1A 4IGEA 4B40A 1JFFA 1ZK3A 3RTAA 3SQWA 4HFRA 3U9LA 3IOBA 1MOQA 3NHWA 2GZAA 2HPHA 3N7TA 2IF0A 2EFHB 3NDRA 5LUBA 3RUHA 1WM1A 1D7OA 4KXQA 1E6EA 1UK8A 3WLMA 4EGJA 1HDRA 3H1FA 1EG2A 2MIIA 4MX8A 4RPKA 4K6OA 1WWKA 4Z1OA 4US2R 5T7BA 1TZMA 3HCCA 4L9AA 3DCNA 2B4QA 2P41A 2XE6A 2C2MA 1JG7A 2A0UA 4A0HA 3PT9A 3QUBA 3S8MA 2QX8A 1FSPA 2Q1UA 3HO1A 1WSWA 3CF4A 1U9ZA 2OLJA 3NGMA 3T5CA 1EEHA 1MXFA 5CW2A 5KTYA 2H2AA 4GECA 2DFLA 1N5LA 5JNUA 1N3YA 4L0QA 4MV1A 5TLSA 1KA9H 3DNFA 1NBME 1YHNA 2Y66A 2XYHA 3WKAA 3FGOA 3LQFA 1NJ2A 2C96A 4ZVOA 4FIZA 4MUJA 2I80A 3MTJA 5BW6B 1JDUA 4C2UA 5JPCA 1BG6A 5GJCA 2ACKA 3B82A 4ZEXA 3RSFA 4C43A 1VG8A 5DYIA 3OJWA 2OG1A 2V96A 1GR1A 4NESA 4AUNA 1HDGO 2EZTA 3I62A 1AGRA 1ICEA 5BQPA 1OYWA 2NUPB 1R0WA 3DNMA 3KBBA 1CUAA 4MQEA 2B1QA 5T41A 1UBJS 2IU4A 1FNBA 1B7GO 2XXJA 1EVJA 3TLKA 4WCFB 3DVAB 2XMQA 4I3FA 4MR9B 3EC2A 1IDOA 2QLFA 2XLCA 3KOOA 2B2CA 4KWIA 3JD1A 3DJFA 3KWFA 1SG6A 4Y9TA 2A94A 4XGRA 2JKYA 1O7JA 2Z9BA 3U3RA 1SKQA 3H0KA 4I9HA 3VO9A 3ZVLA 4AMBA 5KVCA 4PHHA 2QTAA 3OCYA 5TMBA 5J3JA 1G5PA 4BWFB 5DI3A 4AF7A 4E5DA 2XDAA 4UQOA 1S2OA 5JMTA 2BUAA 2G5PA 3PGA1 5E6SA 3MMPA 2WTMA 2HH9A 2O59A 5DWDA 2WIKA 5TQJA 2IYVA 3JQCA 3C14C 5F64A 4ENSA 4LHWA 3K5WA 3TWOA 5EJMA 9GPBA 4RIGA 4M55A 4I3GA 5ALHA 2CW5A 5IN4A 3LG2A 3U7FB 3E48A 1TFUA 2PE5A 3NFRA 1I1OA 1V95A 1WIWA 2X3YA 3C48A 3HY3A 3EZLA 3ND8A 1GPKA 4LN1A 4MH0R 4UTOA 2YXNA 3UJCA 2BT4A 3T7KA 1LSOA 4WLFA 2Q5LA 1RI1A 2VAPA 4WD3A 4EWLA 1OPXA 1GTG1 1Q1ZA 1NXVA 2CLOB 1RQ2A 2E4YA 4HPXB 4OJKA 1W34A 3PDHA 4DCGA 4JBGA 3W5JA 3W4IA 3ICPA 3MS4A 4R2IA 4XRRA 4IKEA 3BTSA 3EUWA 4YDSA 2XMGA 4MPPA 1BA3A 5JD5A 1Z82A 4WV3A 5IARA 3UG7A 2Z2ZA 3QRWA 1HNWB 2IDKA 4RF4A 1IEXA 4LPSA 2PRIA 1U81A 3MELA 4QPCA 2W2QA 1ZR2A 2ZIXA 1EP2B 2B8WA 5EPUA 4C30A 3HXPA 1E20A 2KWIA 3ZV4A 2XTMA 4EMSA 1VHTA 1DAPA 4F2WA 4P3OA 2JFOA 3IE0A 4J0GA 1CT9A 4DBVO 1KDOA 2C94A 2Q6IA 4IVNA 4YMHA 1Q0RA 1R0XA 2CXTA 3SJUA 3LW7A 2IELA 5FORA 1CDEA 5KTPA 3RVMA 4TV9F 1T8YA 3VI4B 3TTUA 4DDVA 1AGPA 3BAFA 1Y5NA 1DGQA 2GBLA 3A3PA 1I6KA 1I0ZA 1NM5C 2FPUA 3N7AA 2C92A 4R8LA 1QRTA 3I6QA 3WRYC 2AC2A 2QPLA 2HFJA 1VB3A 1YQEA 1C0LA 4ZO8A 3UK7A 1KO4A 3DQZA 4FGKA 5BXYA 2F8TA 1UPXA 3GT7A 3UT5B 3ZK7A 4FT4A 1E4YA 1VKNA 1Y9DA 2G88A 2Z1DA 4CTJA 3P32A 4Z4IA 4MQ4A 2IUSA 3AV0B 4IOMA 1A0OA 3UYLA 3AVQA 1BGVA 3QG1A 4P5PA 4F4JA 5MDHA 1BEZA 1USUA 3S99A 4XGIA 4N6NA 4HPWA 2EBHX 1FFDA 1XQYA 3TPZA 1A9XB 3P8ZA 4ZDKA 4L4ZA 1QGAA 5JALA 2H1LA 2R5WA 4BQSA 4C2TA 1OFGA 4PR3A 2ZVPX 2Z3ZA 4ZOEA 3LDAA 3ZQ4A 2R48A 3ABQB 1QO7A 3LSTA 1C4XA 4NBRA 5F4ZA 3WL8A 5KYWB 4R2KA 3O75A 1C30A 3RC2A 3PWSA 1L2TA 4Q4AA 4YP7A 4ZCSA 3PXAA 4YMWA 4F21A 3PI7A 2GN4A 2GEDA 1KYWA 2GS9A 3QWHA 4AFNA 3L0DA 4IEEA 4B35A 1N33B 3EGDB 4QDTA 4OI1A 3PVCA 1XLWA 5A62A 2NW6A 4B32A 1QK4A 4DMKA 1RU3A 5E6UA 5FTWA 3TSZA 2MT9A 1WOMA 3IHTA 3QMPA 2CUTA 2UYQA 3IBSA 1WV0A 1U1CA 4Z3OA 4LHZA 3WV4A 2CXSA 3R9XA 2G4CA 2XVMA 1P7PA 1G8AA 1LA2A 2WFLA 3MUEA 3ECAA 2IU6A 5HBRA 2PO5A 4C4TA 4O8CA 1QF9A 2JLZA 3GBPA 1QRDA 4QFDA 4LXYA 4A6PA 1POWA 5A1TA 3QENA 5JXGA 2BR4A 4X44A 4XKJA 3ZJ4A 5M5BA 4DUYB 1Y42X 1NIPA 1AKEA 1UOPA 3RQSA 1G2PA 1KSFX 3O83A 1AM4D 1EXWA 2J7PD 3R6TA 3K09A 4X00A 1M8PA 2OOKA 3KZCA 5FO1A 2FR8A 3WL3A 4BYMA 4DC9A 3A9TA 3A04A 3GOQA 4D8WA 1M6NA 4UZEA 2PUEA 1GFIA 2DFTA 1XT6A 1SURA 2ECFA 3CISA 3I37X 3NYIA 4LRWA 5D7BA 1PFQA 5KQRA 2HWXA 1NLZA 5KAMA 5T8KA 3R6DA 4RPLA 2PGNA 3GUHA 1YVRA 4H0CA 1V1RB 1EHIA 1PS8A 2AMYA 2GJSA 3VR2A 2NTVA 4UCQA 3DOJA 3OQIB 4LYHA 5F51A 2EW8A 1Q1BA 1VKZA 2PV7A 4DIBA 1ZC4A 3PEWA 4KNYA 3TJMA 2P4SA 1P80A 3O8LA 4JU8A 1PEYA 5CT5A 4E11A 1Q6YA 1FFBA 1M1UA 5DBIA 3F8SA 4QJ3A 4DDWA 2HEIA 3OX2A 1TGVA 2Q3CA 2X0RA 1OLUB 2VQSA 2AEJA 4HWOA 2NSHA 3NUZA 5AK5A 1EKXA 4CW7A 1NNEA 2NMVA 4RTRA 4TMZA 1EFVA 3U7QA 3J81k 1PWHA 1RBQA 1A69A 3PQEA 1S8NA 4DSUA 1QAQA 1GU7A 4NNOA 1Y81A 4PFJA 1OBOA 5DU2A 1G2IA 2ZZNA 5IKOA 1SRRA 4EKEA 4MKRA 4L5IA 3TRDA 3CRW1 4G0WA 3P27A 4BIIA 2PMEA 1DJOA 5D1HA 1GCAA 1CVRA 2WKQA 3ZGVA 1HE1C 3H9GA 3VR3D 1PZXA 1SB8A 1T91A 3QLVA 4IDBA 4ZK6A 3ER8A 3KWMA 1IY1A 3HU5A 3ITKA 1ZICA 3SEZA 4IEFB 1ZSVA 2BGTA 1MB3A 2I65A 3AT1A 2H00A 3AJRA 4MWCA 4BFCA 1C29B 1RQLA 4C3ZA 4WKCA 4MB6A 2DBQA 4M7WA 5BSRA 1WHSB 4FNGA 4Y6SA 1VPWA 1PJCA 3DLHA 1W29A 3RVRA 1HT0A 3ESDA 4LF6B 4TYNA 3TQQA 3M4JA 5FIUA 2J45A 1WKVA 2AIRA 3L4BA 4TKZA 4DV1B 1KRXA 2J5XA 1PN3A 5TE9A 2AFIE 4LX0A 1JU4A 5IBPA 1VKOA 1OTXA 2BD0A 4NG5A 1SOVA 2J5BA 3R23A 4HQKA 5D5QA 3WK4A 4KREA 1VE7A 1VQ1A 4CLOA 4I0WB 4BCDA 1VIAA 5HQJA 3KBOA 4ETNA 4WY5A 3ZHOA 3LXRA 3M4XA 2PAFA 4PYKA 3AWIA 3HO6A 5ARCA 1X19A 2FWPA 4LRSB 1LS1A 3ZKWB 4RETA 5CB4F 4BJ6A 3U6KA 4BJ5A 2XWPA 1P0QA 3IAUA 4I4IA 1DFIA 1QVVA 2XKAA 1E0SA 1JSCA 3HFGA 1B74A 1BGXT 1G66A 4QUIA 2PPLA 3V1MA 3ZWNA 4XIJA 3UCXA 5IBQA 2ZWOA 5HUQA 2GF2A 4F46A 1RYNA 5BO5A 1O0SA 2PZEA 3F6CA 1K89A 2JK0A 4MQMA 4OMFG 1EDZA 4P4NA 5CCBA 3AUXA 1SH7A 2VNKA 3TDMA 1FYVA 1WDTA 3N2EA 4IEIA 1AB5A 1DRUA 1HFKA 3JZMA 3T5TA 3TW8B 1O1YA 3W79A 1K4YA 2BI8A 1KI7A 3BHIA 4D0NA 5JWRA 2IP1A 2PXXA 1YS4A 1UZNA 1ISHA 3P97A 2Q4TA 4U9IS 4V3CA 1SVKA 4ZYUA 1I2AA 3O4HA 2J7KA 3O8OA 3ZNQA 5E4TA 1V1JA 3FPEA 4PIPA 1MIHA 3FY4A 3VYTB 1KPIA 1EXMA 2AFIA 5IT0A 3V9PA 1QGZA 5J63A 1SBYA 1CUEA 2VDOB 1R9GA 1FFCA 1UADA 4K6FA 5H68A 1VLJA 4GVXA 2JC3A 2BV3A 4ZREA 3ZHRA 1YHYA 4A8HA 4HNHA 4BX8A 1K6IA 4CQJA 2H5EA 1L4YA 2W00A 3I39X 3KU4A 3WMXA 3U9SA 3NYRA 1KI9A 1JH8A 3AKEA 3PUKA 4P1ZA 2IEIA 1E1RA 3EPKA 3PNKA 4UEKA 2INGX 3JD2A 3NRCA 3ZWKA 2JZCA 1KVUA 2ZW9A 2ONYA 3JQ8A 4KR6A 1DTSA 1FVOA 1QHFA 4GXTA 3AEKB 3KZ1E 4P5EA 1NLFA 1SQFA 1MVLA 2A84A 3WRYA 3MWFA 3P1JA 2ZJOA 3OMLA 1OF1A 2KB0A 5J47A 2FPGA 4Y30A 3F6EX 3H75A 5EIAA 3HCDA 1X8JA 3X1JA 2C2BA 3VVMA 3MT9A 3DP9A 1RXUA 2W43A 1WHTA 4HB4A 1LBSA 1OVGA 3PLNA 3AB7A 1WXIA 4CM4A 4W5OA 3WMGA 1G5HA 2QVYX 4RD1A 3K9FC 2ZCUA 4HDMB 4KBGA 4WBSA 1IK6A 2OYCA 1S3SA 3GUZA 3K6KA 4FQ5A 1V6SA 4CM9D 2JIZD 5FAXA 3WO1A 1RCFA 1UIMA 5HKKA 3JYOA 2VLBA 1YZGA 4MS3B 3IP7A 3BA6A 3DMFA 3AKCA 1C7IA 3GLSA 3HABA 4NZ9A 1L4KA 2Y0DA 3V1LA 4B3BA 3LNTA 4MVYA 4B48A 2G1KA 4UBLA 1HE2A 4ZTBA 5L45A 3TIFA 5ERYA 1J8VA 3TCXB 3VYVA 3F90A 3R0XA 1P4RA 3BWBA 3EZYA 2XT0A 4GZMA 3QVUA 3IBCA 5IAEA 5EXSA 2WUVA 4HX2A 2COKA 3IAXA 3RFXA 4G2NA 2JD2A 3EGCA 1X1TA 3ZHCA 4RNDB 1XGKA 3QEAZ 2OM2A 3QX3A 4DQUA 2QRKA 1LBIA 2OORC 4J9UE 2PRZA 3TSYA 4IXDA 1RYBA 1XJWA 3DHVA 1MH1A 1E9FA 3Q7PA 3SI7A 2GOYA 4MWZA 2QSUA 1HNZB 3W5HA 1L8XA 2BBTA 3ZNPA 2JS7A 3IIMA 4XWAA 1AHPA 3IVMA 3JVDA 3SMQA 2ZS8A 1WDLA 4ARVA 4COOA 2Q3FA 5EIEA 4JP5A 3E5MA 3W2IA 2HMAA 6PFKA 4QBHA 3VR3A 4GPEA 2YOFA 1E7MA 1E3WA 2CZQA 3I12A 2JGDB 2YRFA 1H8HA 1SELA 2FZGA 2I8AA 3PHHA 2HMSA 1L5OA 4LTDA 3Q8KA 4NP6A 4CKBA 1E7QA 2NTNA 2JI4A 3DEAA 3INYA 4QBGB 4WK6A 3KQHA 3JQBC 3CLTD 1Y34E 1KI8A 1NWHA 4WOPA 1FP1D 4AP5A 3HFRA 3PB3A 1PJQA 1BW9B 1D8AA 3H5LA 1YFLA 1GA6A 1D4FA 4O5AA 3KZMA 1J7KA 2BR5A 2CNDA 2VS1A 1VGQA 4ZT4A 2PX3A 5B2ZA 4K05A 5FB3A 1RWOA 2NZVG 1G64A 3S1AA 1POXA 5BWBA 2DB3A 2D4AA 3RF7A 4P4UA 4GOXA 3KG2A 3W8FA 1RTTA 4BFUA 2WU8A 2QN2A 2YXPX 4HI0E 1T9HA 1U4NA 3HNRA 5BOSB 1M8FA 4GE3A 4U7FA 4EI7A 2I9KA 3DDNA 3NORA 4BJ3A 4WASA 4D41A 1L7PA 4O4JA 2QBYB 4R1QA 2VEOA 4Z9XA 1RRGA 3Q10A 3A9UA 1BAPA 1Z2OX 2HK7A 1C9KA 4MA4A 4MUFA 4DDTA 1GM5A 5SV2A 4FYIA 4LTMA 3H2GA 2WHXA 3RVDA 3MTBA 1JMYA 4M3NA 2CT8A 4WN9A 4WVFA 3REQB 3T7AA 3EXEA 5LQDA 4LFBB 1U8CB 4H15A 3ZX4A 4YUWA 3C15C 2NO4A 1QF7A 3AR2A 4LSZA 2MJLA 2OP0A 4KGVA 5I48A 2UZ0A 3AJ9A 5JVDF 1EEXB 1ITZA 5GINE 1EE9A 2B8EA 1HSOA 5BN4B 1YJBA 1KEUA 1ZUHA 1ZM4A 1I4TD 3DAHA 2GYWA 2OZKA 3G2OA 3QFFA 4E12A 2C97A 2C42A 3NANA 2ZJ6A 4I6JA 4ZDWA 4E4RA 3JCZA 3ZS9A 3K05A 5L3QA 3HYCA 3G5AA 2X0NA 1XXHA 1Q7CA 3CS3A 4QQFA 1A2KC 2GZSA 3IESA 3B1JA 3P7MA 3QLEA 1T1GA 2VJNA 3NWJA 3HDHA 3ROZA 1ORWA 1Y1SA 2WD7B 2XIJA 3L05A 1A3CA 1TMKA 1T8RA 3EMKA 4YV0A 5TIIA 1MRSA 1XQVA 2OK8A 3WIBA 1T5TA 3V97A 3UMBA 3FNIA 1FVFA 3PEUA 4BJ1A 4U39A 3UHOA 3ER6A 3RK4A 3PICA 1R0CA 4FWIB 1EQAA 2QJFA 4KBYA 4P32A 1VHDA 5EL0A 1I51A 4D9KA 1NXXA 4B3RB 3KS9A 4N3NA 4NK5A 4IZHA 4H1VA 1IB0A 4I5EA 1EJ6A 2R0QC 2ZU6A 3B1FA 4FUQA 5FBWB 3U39A 2PRJA 1P7CA 2QR5A 3ISVA 3L7NA 2OBYA 1M8GA 5MF6A 4N5LA 1YZNA 5C34B 4BUJA 2PKXA 1D6NA 3I6BA 3K5IA 5HS6A 5DM2A 4HDNB 1COZA 1VRVA 4XVCA 2PU5A 2HHHB 1J5XA 5CX4A 4FDVA 1Y98A 1CQWA 2IC5A 5ICEA 1PEAA 2OXEA 2R2GA 3PNYA 3EVEA 3D4IA 2PMDA 2NTEA 3MIZA 4TL9A 3WK5A 4ODIA 3KUCA 4ZV9A 3PUZA 1K2WA 4DA8A 2HCJB 4HYEA 3K70D 3LA6A 3QEKA 1HEYA 3WWOA 1OXMA 2XZOA 4M0LA 2VDWA 4QIHA 4D5GA 2ZRIA 4JBHA 3C5CA 5EWJA 1IPHA 4BO7A 1JAHA 3WNDA 4ZV7A 4NFLA 3DZGA 3HVRA 3JQAB 3ZY4A 2JHGA 3PE6A 1EVLA 2OUKA 3OIGA 5H9VA 2D2FA 4A3SA 4MVJF 4PX9A 4PN7A 1R27A 3X1WA 3HWRA 1KDTA 2P4HX 4M99A 4Y18A 2CV1A 4K9QA 3B3JA 3LXXA 3WB9A 4AYWA 2OY0A 4YJ2A 3EXHA 3OE7A 1U1GA 4IX9A 3KD2A 5KJFA 1ZGAA 3CURA 3C39A 1WD5A 4CDGA 5JFGA 2OGSA 2A1UA 5HJ5A 5KMGA 1R88A 2FEPA 4J3JA 4IF6A 4E6PA 2P78A 2RK6A 1ZNWA 1G41A 1RT9A 4RD0A 2SNIE 1NP3A 3W5DA 4BLOA 5HJ7A 3EMVA 1EFHA 3JALA 5LU9A 4JLDA 5JNLA 2WJVA 2CV0A 2QMEA 4ZHQF 1XOIA 5DX8A 4ZA2A 2COEA 5I7UA 3B1XA 4OUKX 1YTLA 1THZA 4LDJA 4EZEA 1E5TA 2R5FA 4UU7A 1YJAA 1LLFA 4MR8A 4ENQA 4JOCA 3B5JA 3T1TA 1JHVA 5K8VA 4E07A 2VT2A 4J1TA 3CIOA 1Q7GA 2VCEA 3KFXA 2WRZA 3EDQA 3F5SA 3GRVA 4A23A 1B0PA 4UOZA 2WWXA 3EPHA 4O0MA 1NURA 2EEZA 4S04A 3CBQA 4DOMA 1G8YA 1UJ6A 2WV9A 1E2PA 1KO8A 5HE9A 3FA2A 4Z9AA 5KB3A 1PNRA 2I7TA 2PWZA 4DJDC 2IH2A 1J0CA 4DB2A 3TIVA 4EYSA 2JD1A 2Z2YA 5LOVA 3FBGA 1B6GA 1DELA 3N2LA 1L9XA 1WP9A 4HTAA 1KMMA 3KLMX 3R74A 4TV8B 4HDOB 3UWKA 4RAQA 5CYGA 1P61B 4QRIA 2D7DA 1J1IA 4Q16A 1DOZA 5KNCH 3CF2A 3I2JA 2BGUA 3M34A 2G8NA 2UUPA 3UH0A 4Z49A 5B57C 3I92A 1COWD 4BC1A 1I7SB 1WMBA 3OPQA 2OV6A 4OD0A 4U8HA 3YASA 4ZYLA 5I7WA 2PS1A 3L6CA 1GG2A 1NVWQ 3K32A 3MIIA 4DA9A 2FZ4A 3ACCA 2FU5C 2FYTA 2VAMA 3GGSA 4TTPA 3PJRA 2OPHA 2XF8A 5L8VA 1NAHA 5C4GB 2WF9A 4LGMA 4TXNA 5SY4A 1N2GA 5CDFE 4JVSB 1XF1A 3G2QA 2NQTA 4EF5A 1I0IA 2WYWA 3DBHA 3GYBA 2JIOA 2IZ7A 2VKQA 1WVMA 3PTLA 4HVTA 4QDJA 1TTPB 3WOHA 3RHZA 1SCAA 4JJAA 4MB2A 1G8PA 4Q93A 4OHYA 2QN6A 1KMHB 5ABPA 1V8PA 1QS0B 2FJ0A 4L07A 2VUUA 1ZSYA 3HL4A 2A7XA 1XF9A 2E85A 3A0RB 1XZGA 3PDIB 4RIIA 4XYMA 4YACA 4KFUA 1IHPA 3VRHA 2BCJQ 1M3SA 3N87A 4RPJA 3GNTA 1YJ8A 1H6BA 2O0LA 2QAIA 3AI7A 1UINA 2ZBRA 4DGQA 3B2NA 3DHWC 1UP7A 5BXQC 1X80B 5BYAA 4P4TA 4L8VA 1BKDR 4RBNA 3ESYA 1YA4A 1A7AA 3V8PA 1GPBA 2OESA 3OIYA 2NU9A 1JGTA 5JZOA 4GKKB 3N8NA 1SAYA 3IQWA 2YXDA 4B4VA 1CQJA 4YCCA 2GX6A 4QO7A 5FFMA 4ZYWA 3AF3A 3VYUB 2ZB3A 3UHFA 2CVPA 3HKDA 1Z28A 1JSZA 2FPKA 1CP2A 1K8YB 4IILA 4L4UA 4P5DA 1BYUA 3G9TA 2YYSA 4KTVE 3WGNA 2DQKA 4CR7A 1VMAA 4K9RA 3UICA 1JKIA 1ISPA 3SS8A 4M98A 2OO5A 4NJMB 3PHJA 2EAUA 3WK7A 3LP5A 1Q2XA 3X1MA 3GNLA 5JWHA 5A03A 1K8QA 5GADl 1ULZA 4Y6QA 3A14A 4UDYX 3VU9B 1XPUA 2B4YA 3PRHA 3EGEA 1E9VA 1GZDA 1N6OA 2Z2KA 1CUBA 1CEYA 4U2CA 3OEEA 4DCTA 1FQKA 4JC0A 5AKXA 3H87A 4PPGA 3A26A 5FHRA 2PHZA 3U81A 4JT4A 3L7YA 4XB2A 3BHJA 3X0DA 1EM6A 2EV9A 2WM3A 2O2YA 3DA8A 2VJCA 3JTEA 3MVEA 5E1DA 4OL0A 2J5QA 1M2FA 4JBYA 2AXPA 3P9IA 4NMLA 4ZIRB 1DJQA 3OO0A 2NZUG 4WADA 1CUZA 3DUWA 3DWFA 2AEEA 4GIBA 4JC5A 5ALPA 3JYHA 3ZHUA 4EFLA 1W0CA 4R83A 3DW1X 3P9RA 2D5IA 2IXDA 4GP9A 1FQOA 3DZHA 4F4IA 4P86A 3IPLA 1Z47A 3NHKA 2TS1A 2Z56A 1W8DA 3F0TA 3TSOA 2AXNA 2R62A 3TGLA 1R1DA 1RPZA 3PTAA 1H2WA 1VLQA 4LISA 2VUIB 3KQSA 3BMOA 3PJEA 2NYVA 1ISIA 1U2PA 3BIXA 5FLYA 3SIXA 2BI4A 3TLZA 5B3LA 4IHAA 1U4SA 1EUYA 1UQTA 3F4KA 4UPDA 1C0IA 4UM7A 2QTRA 4YNBA 3WGMA 3IL2A 2V6FA 3NHLA 3P94A 1JEQB 2I4TA 4G1BA 3ROTA 4BN0A 1KFBB 3VZSA 2DBYA 1VJRA 1JR3D 4TS4A 2O8EB 1WB4A 2FPPA 1TT7A 3STHA 4FLEA 4KSYA 5EZ6B 1KQFA 5JTTA 4B0PA 2IS2A 3TW4A 2JH8A 1X1BA 3B2QA 1SHUX 1OD6A 2HW8A 5EZ5A 4D9GA 1GXSA 4GD3Q 5F12A 1N34B 3HYRA 1FP2A 1B8UA 1N0HA 4B46A 4BUZA 2MR6A 4ASUD 1DDOA 2YWHA 1BVRA 1BH6A 1I4LD 3C24A 4MS4B 1N8NA 1OXUA 4FGWA 2Z8XA 4A26A 3T0IA 3HJRA 4IJKA 2OD2A 3VFDA 2C1ZA 2C0CA 3ESZA 4DUZB 2FWIA 2H08A 5HRUA 3RROA 4HKTA 1JDPA 2EKLA 2LXNA 4KXNA 4M21A 1MB4A 4JJ7A 1KZGB 1CUYA 4IDPA 3PK0A 1HDIA 2C2ZA 1OXBB 3DXYA 2AZMA 4EJ0A 1BXGA 4HNRA 2ADOA 1XTZA 3SDZA 3TBHA 2AVDA 3VX3A 4BZXA 5DLEA 5AW6A 2RHTA 3U0VA 3BE6A 3L40A 4BVFA 1J5EB 2QTCA 4MCIA 1AURA 2OO3A 1CP3A 1UKVY 2C1EA 1MAWA 5JD6A 2ZIVB 1G7RA 2FOIA 1SBNE 5L51A 2W2LA 5EP2A 3NTRA 3QVKA 2IWRA 4KXFB 4DDKA 5IWCA 4E31A 1EJ2A 1OUMA 2I66A 3ANLA 3EIQA 4OI4A 4UHEA 1JXQA 2ZIXB 3ECSA 2R1TB 4U7JA 1BH2A 3HA2A 3D3EA 3ON5A 4GWLA 2VPWA 3LQ1A 5B58C 3I9OA 1XQXA 5E3IA 1XWWA 3X2SA 5K3EA 1RRPA 1XJQA 3L46A 2YIVX 2MSLA 3N5KA 1ZFNA 4RXMA 5H9WA 2G71A 3SBOA 4UUBA 3KIPA 4UMVA 4NABA 5ALWA 1U7WA 3NTOA 3WMFA 5A02A 5ES4B 1EWYA 1MZPA 5DSZA 4ZO7A 3BREA 5DKFA 4EHBA 4ZPXA 4A2PA 3BHNA 2V6IA 3IAM1 4V0ME 5AUQA 5JMOA 4CL3A 2IV7A 1WB9A 4DRXB 2B3DA 4TWJA 4HLUA 1KMCA 1AS2A 4KMOA 2QD2A 3FKQA 1P5RA 2X76A 5FQNA 2HA7A 1YBFA 1NXPA 3VHXA 3JQBA 1TTHA 3KV1A 1FDVA 3CZ9A 1L5QA 1QRRA 2E4UA 4IFTA 3KL2A 5ECDA 3QTLA 2H1SA 2JJMA 4DZRA 1KY2A 2H5LA 3HBFA 4UU1A 1YQWA 1NUSA 4NOJA 3U4IA 3BD6A 4QXAA 2G07A 4O4HB 1RHMA 1KVSA 5BQOA 3RKSA 3TCNA 2WPNA 2X0IA 4XH9B 2RHMA 2J6HA 2J0EA 1Y6ZA 4JLSA 1GPUA 5JO9A 1DAMA 2J6BA 3ONVA 2BKUA 3DMPA 3AG6A 3FPFA 2YV1A 1R15A 2H9YA 2FN4A 2GARA 3KAQA 4HO1X 2FP4B 2EYQA 2PX8A 4W7HA 3WLOA 5ALNA 3FDZA 1XMPA 3KJXA 4HZGA 2PL3A 5JW6A 1TI7A 2YYAA 4Q3NA 3BK7A 5DYYA 4FEGA 4YRPA 2YV3A 3HJUA 1DT5A 1M1XB 2V4UA 3EEQA 4Z7OB 1M76A 3PU6A 1Y1TA 4Y1GA 4RTMA 3FPGA 3WQRA 4YJ2F 1E7SA 5AVTA 1N77A 3VPDA 4KL8S 3HZOA 2G72A 4RMIA 4D4KA 1EX1A 4BB6A 5HGXA 2E37A 1Y6GA 1NHWA 3EAQA 3F6PA 3R44A 4ZC1A 4JEHA 3IYLW 1EA5A 4N0EA 5DCLA 3C3DA 4A03A 1ND5A 1Q22A 2BEUA 2DCUA 1AC5A 3FHOA 1ECFA 3PVSA 3W9SA 1JR3E 1ONBA 1UK7A 1Y4SA 3GC6A 3GDOA 5H59A 3PQDA 2Q8QA 2V74B 5ALEA 4QEKA 4M9RA 1NVMB 2FZEA 3RYFA 1DQSA 3WKBA 4I36A 2N46A 5BMVF 1BIFA 1KH1A 5A5GA 1DQZA 5F98A 3PQ5A 2DFVA 3DAOA 1UKCA 3CINA 1IE3A 2I6TA 3B5EA 3IVAA 1ZW6A 1JU9A 2WYVA 1CY8A 5M7EA 5JJLA 2G6BA 1DKPA 1E32A 3BH0A 3EDRA 3B9RA 3GGPA 3RUEA 3WDLA 3MZ0A 1GAWA 4I14A 1FUUA 1JDVA 5ALKA 2OM6A 3RRMA 3VPGA 4OH1A 4OGFA 3S2SA 1PL7A 4J91A 4L7QA 3RUIA 4AP6A 5K6AA 2AT1A 3PG5A 1K3TA 3BWCA 4L5AA 4HNQA 3HGTA 3E8MA 1QKIA 4GYKA 2JDIA 3DD5A 3ITEA 2V3CC 3EQZA 3SVLA 3AETA 3OKAA 4M0EA 2H2IA 1X1QA 3A4NA 4PS1A 4QXPA 2Y1LA 2CF5A 2IKSA 2AG0A 5ECYA 2H0AA 5TQ0B 1M2WA 2FR0A 3ZDXB 4AW9A 1C3OA 3G5TA 5THQA 5FFFA 5JMWA 13PKA 1HE8B 3ZDEA 5DLDA 4X65B 2ZT5A 1W30A 4EJMA 1IWPB 4IDOA 5EIBC 3VC1A 2WF6A 3WLQA 3Q5GA 5LZ8A 5LQSA 4OAOA 4TT8A 5GPBA 3O8QB 1II0A 3ZQJA 3S81A 4H3HB 3CM0A 2Y1XA 3BSFA 2BKAA 4L51A 4R2MA 4LRYA 1X92A 3VGPA 4AF6A 5BMOA 1NOIA 2VJBA 2XNCA 1U7PA 2B4TO 2PJDA 2F9MA 1YZLA 3MTAA 5DLYA 5EKUA 2IBSA 3DDUA 4YIHA 2X0EA 4JI8B 3GCDA 1P6UA 5C37A 3RH0A 1KI6B 3MG9A 4KN6A 1OSNA 4RHFA 5EJ5A 3D43A 3PC7A 1MEEA 5DTQA 4Q7QA 1ENPA 5ARDA 4CDRA 2ZJFA 3FNQA 4IJVA 4B4OA 4JB8A 1JILA 2C5AA 3CWZA 4DM7A 2O3SA 3VKFA 4JJ8A 1E58A 3JYNA 5TRTA 5E2IA 5BNZA 3AUUA 1B15A 2PBZA 3CE6A 4M9ZA 4Y7CA 4GKJB 4S24A 5TB5A 3N39C 1PR5A 4I4NA 1PUJA 5CVTA 3KHTA 4MPTA 3KZOA 5JY6A 4PLHA 4YJFB 4MYUA 5BMVB 3OZAA 4LCEA 1K9SA 5CRIA 3OOHA 4P3YA 4HBZA 2ZRDA 3GEHA 1G98A 1BVYF 1XDSA 1GR0A 4C6SA 4M1TA 1WDMA 3IOCA 3UMSA 1XLTA 2VF2A 2RC5A 3WLKX 4C4RA 3LT2A 5EPEA 1VPTA 3UT6A 4MUIA 2VATA 3SFVA 3IHLA 2PQMA 2WABA 1EK5A 3ESXA 3C98A 2XXAB 5D1NA 1T26A 1U2SA 5A7GA 1FDIA 3GDFA 2M2IA 1C7JA 2P9ZA 3ORFA 3IEKA 5DHFA 4B09A 1U6JA 4EI2A 5ICMA 1FX1A 1OFVA 2EX4A 2OV8A 4H3SA 5M29A 2BMWA 1JTVA 2IPOA 4WOKA 1IAVA 1KU0A 1WO8A 3HEAA 4BMOB 2XR1A 3QFSA 2VSFA 5C53B 1W1IA 1PGPA 4C2BA 4JMPA 3RLFA 1S8FA 1Z4MA 1Z8HA 3DDWA 3KEOA 1KS2A 5G3ZA 4V2IA 3ZWBA 4CLEA 3IEXA 4XAQA 1SOUA 4GXQA 2AOWA 4RVGA 1MA3A 2DAPA 2W4QA 3CB2A 3IURA 4YMIA 3TKAA 3WWPA 4KC0A 1JIXA 3GLIA 5KYXA 4AG5A 2DWUA 4NY1A 1HRDA 4E88A 4OJTA 3L9XA 4RHEA 2VTVA 2C8JA 2AUNA 4QXRA 4P81A 3VSEA 5DT9A 5LWHA 4UMDA 2ODTX 5DRYA 2YUTA 1KI2A 1T1IA 1WS6A 1YU6A 3IUMA 3QKRA 2IDMA 3U3OA 1N6IA 3AEYA 4NVRA 3RYCB 4D4IA 3HCFA 3K0AA 3H18A 5GGYA 1DC4A 1EXNA 1YZYA 3MW8A 1FJXA 2QLLA 3ZHQA 5JNVA 3V8QA 2VT3A 1WA5A 5B1SA 3CV3A 3WMEA 4WESB 5LA6A 1Z4LA 4EHNA 1XELA 1S7CA 4XSVA 3NBMA 3RFUA 1X1SA 2GNPA 2UU9B 1ESZA 1WZCA 2YRXA 3FPAA 3HHEA 5CGZA 3ZIAD 1QP4A 3WZMA 1Z3IX 3L2OB 4O2AF 4ZZ1A 2IGBA 3BMNA 5J1SB 3NVMB 1XCJA 1DTWB 3AEKA 4U3JA 4UAVA 1PR4A 1C8VB 2HQOA 3TTXA 3R3VA 2FUCA 3K4PA 4QATA 3LKZA 4LJYA 3A9RA 1FSFA 4I9GA 2DHCA 3OC0A 2HJVA 1X7HA 4RMNA 3DL4A 2GJAA 3RSZA 1MFZA 1STOA 3T06B 4H1HA 5DW3A 5K3FB 4YRJA 1CF9A 1W36B 2IS6A 4IDGA 2HTEA 5IZ4A 1GGFA 1AHIA 1UMCB 1W8IA 4OQMA 2NU8A 2DHDA 1BS2A 3HKCA 3IH5A 1H94A 3GFQA 4OHFA 4ZT7A 5ALGA 3UAZA 3ZCQA 4D8YA 1KHTA 2C9OA 3PUYA 4GQAA 4RE5A 2DY0A 1LJ8A 2LTAA 1X1RA 3E2PA 3G8AA 4ENTA 3K6SA 1ATIA 1L4NA 4ZU6X 1VLVA 3ITDA 3STXA 3MWYW 3BGVA 4H27A 5EP1A 5TPWA 2F8MA 3BMQB 3H9JA 1FRZA 1IWBB 1KEPA 1T1EA 1T2DA 2PZJA 3GUUA 1QKJA 4II3A 2DUWA 4JA0A 5AJUA 3BORA 1CJUC 5KJEA 1EK1A 2YJTD 4LJKA 5JWOA 3IUQA 5JBQA 1YR8A 1WY7A 4BUCA 3HSKA 3QA9A 1XMJA 4JJIA 1D1TA 1NQXA 2XGSA 3OKCA 2FG7C 4RM3A 4COKA 3DBLA 2C82A 2VR1A 4CN9A 1JT9A 1YOVA 4GBED 1H0SA 4IY1A 2FW7A 3S2IA 4CF3A 3BVPA 4K46A 4ETWA 1QONA 1LH0A 3D4BA 3HUFA 4DV2B 3AM1A 1KYYA 4IUYA 1II9A 1RAIA 1UFRA 1YKGA 2LCFA 4LC0A 4B74A 2H17A 3P9YA 4I5FA 5F33A 4C1NA 1FDUA 3RYTC 2C0PA 1E5LA 3KQMA 2H1VA 2Y27A 3GVCA 4EA7A 5KKNB 3FWNA 2L2QA 4X7PA 1JLKA 2PMWB 3VX4A 1H3NA 1XMQB 1N9KA 1P8AA 2QSJA 5TMDA 3FNHA 3SU8A 3Q7QA 2AE1A 2CY0A 2I6QA 4Z4EA 2HQ1A 8GPBA 2CSXA 1DX9A 4PO9A 5E7JA 3RS5A 2R79A 4Q4LA 1S8AA 2G9RA 3W8NA 4EG8A 3CX4A 1OWLA 3E82A 3QFHA 4UBKA 2OCLA 2AW3A 1YQDA 2H11A 3KZKA 3SJ7A 1PW7A 4HNAA 5JRJA 1XROA 2VRCA 4ZO6A 4F6RB 4OFXA 2H1HA 1S96A 1ZJ5A 2BJWA 2Y0EA 3LXMA 5BSMA 2ORED 2Z6VA 3AERB 4DJAA 4DSZA 1LF0A 2NM0A 2GJKA 2I4MA 3OT1A 5B7GA 2XECA 2XYQA 4YJHB 4ZXPA 1V71A 3EOZA 4DA0A 1Z8NA 3RBZA 4AM8A 1HR0B 1ZH4A 3AVVA 2O7SA 4E5KA 2BTEA 3NG1A 4FCWA 4XCVA 2ZYWX 1J1ZA 4MMZB 2FKAA 1I7DA 2IW3A 3ND9A 4DJTA 1JHXA 3GO4A 1LLUA 3NOXA 4M9CA 3AI2A 1LW6E 5DB4A 2PH7A 3DV0A 1V2HE 2DECA 2O14A 2CEAA 1BROA 1UOOA 1WXQA 3LLUA 3PFBA 4R1OA 3W2FA 4YLYA 3HJHA 4NPAA 3RTGA 1FSZA 4UNNA 2R6ZA 1E62A 2BZGA 3DPUA 4CNBA 2F1RA 3B89A 3KT6A 2A5LA 5KSOA 3BWXA 1JFSA 1YNSA 3ZWYA 4XWOA 3FLMA 3L49A 1K6MA 4XPIB 2HSZA 2R6HA 3PF9A 4QBTA 2F7SA 3JARB 1I5OA 2XAAA 3OX1A 4CMCA 1ZD5A 3E70C 2X9VA 3ZEIA 2VJKA 2FXVA 2QM0A 3KLPX 3ROGA 3Q3JB 2JARA 3H83A 3HBMA 1GWNA 4N3GA 4EJSC 4N0DA 4YCJA 1W73A 1Z16A 5P21A 3M1IA 5F3RA 3OLYA 1XTBA 1XZDA 2LZ0A 2FN9A 3K15A 3NAQA 4Z8YA 2BRUC 2CMFA 2H2GA 3W7AA 1I32A 1ML4A 2YXEA 4E32A 5B3KA 3U3JA 1LQUA 2DTXA 1EIWA 4DPMA 4B71A 3KSRA 5HPYB 3DE7X 3CVVA 2XDQA 3UPTA 3KT8A 5CGQB 3HI4A 1YFJA 2ECPA 1RYMA 3QBVA 1NXTA 1HG0A 2GWHA 1EGVB 1OBVA 1BMFD 3E9RA 3FW1A 3HI6A 3I2GA 3IQHX 4G4IA 3FZNA 4QJ4A 2VJYA 4MPJA 3RI3A 4F11A 5F21A 1FMTA 1PL0A 1P4HA 3DMRA 4QEZA 1MA0A 2Y4NA 1R8YA 5KNBD 2WPDD 4MIYA 3T1QA 5AUOB 1P9WA 2G08A 5K0JA 1VC2A 4MVJI 4X20A 1Y4AE 5L3RA 1T9ZA 4PLVA 3SZLA 1WBBA 1PVDA 5HKOA 4CIWA 1B4DA 1MG5A 1UPAA 4YRGA 5JG7A 4E7PA 1FZTA 1D4AA 3H4TA 1T0JB 1UDXA 5J4YA 4WXEA 1KR5A 1PYGA 1IL0A 2Q3EA 3QKSA 2FI1A 2M9MA 4MW2A 5ALTA 3WNQA 5C52B 3A36A 2IE0A 4J2HA 2FMIA 2HA4A 2ZIEA 3QHQA 4IQ4A 4KQFA 3FMOB 3JWIA 3LY7A 1VXOA 3QQ5A 4MW7A 3SHFA 3OOSA 3ONDA 3QNUA 2OD9A 2NV2B 2Q0QA 4LUCA 4TMVA 5DHSA 4D5EA 4EUFA 2M6SA 4B7ZA 4WN3A 3EQ9A 1QH8A 1VMEA 4IZIA 3TSAA 3WY9A 2EFCB 4Q4CA 2QLJA 3Q3VA 4MIKA 5HTOA 2H29A 2ZJZA 3NUQA 1CFJA 4ID9A 4NI5A 2YVQA 3JASB 3KKMA 4TL7A 4D4HA 3MRXA 1ADGA 1FYEA 1KVRA 1NOKA 3JQRA 3KJIA 1VI6A 4YHBA 4AY3A 5IX8A 3KLBA 1W19A 2JW5A 1RMTA 3CXRA 4M8KA 1YRWA 1X74A 2B30A 3GRYA 2VZLA 3MAJA 2IYQA 4Y2PA 5AQ1A 1H6CA 2XQKA 3D8RA 3TGWA 3EGWA 3HJTA 3FR7A 2OD7A 3F4BA 5LXTB 2HLHA 4YFVA 1YRBA 2D74A 2WHRA 2X2FA 4GM4A 1KFCB 4IIBA 5KHAA 1US8B 5BWNA 5FH9A 1VJCA 5H7XA 2QK4A 2H0QA 2RHOA 3PFNA 3MJRA 1UFQA 1IJEA 2NAPA 3OOYA 1DBWA 2P27A 5EKSA 2C31A 1THMA 1JWBB 1JS1X 2R68A 1WQ1R 4QPDA 5CA0A 4R2HA 4CLDA 1KEVA 1SY7A 2VXBA 3D7MA 3LUBA 3C1TA 4N4AA 1ZAKA 2HTFA 5IG2A 2OORA 5AI0A 5LQUA 2NSYA 1L5ZA