3LPDA

Crystal structure of a subtilisin-like protease
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
339
structure length
339
Chain Sequence
APNDQHYREQWHYFDRYGVKADKVWDMGFTGQNVVVAVVDTGILHHRDLNANVLPGYDFISNSQISLDGDGRDADPFDEGDWFDNWACGGYPDPRKERSDSSWHGSHVAGTIAAVTNNRIGVAGVAYGAKVVPVRALGRSGGYDSDISDGLYWAAGGRIAGIPENRNPAKVINMSLGSDGQCSYNAQTMIDRATRLGALVVVAAGNENQNASNTWPTSCNNVLSVGATTSRGIRASFSNYGVDVDLAAPGQDILSTVDSGTRRPVSDAYSFMAGTSMATPHVSGVAALVISAANSVNKNLTPAELKDVLVSTTSPFNGRLDRALGSGIVDAEAAVNSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Subtilisin-Like Protease AprV2 Is Required for Virulence and Uses a Novel Disulphide-Tethered Exosite to Bind Substrates
pubmed doi rcsb
source organism Dichelobacter nodosus
molecule tags Hydrolase
molecule keywords Acidic extracellular subtilisin-like protease AprV2
total genus 118
structure length 339
sequence length 339
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3lpdA00
1TM4E 5AVJA 3PRKE 2WUWE 1SUPA 3TI7A 1SIUA 2ZRQA 3DW1X 5AMXA 2SBTA 1EA7A 1KE1A 2W2PA 1IAVA 4LVNA 5JXJA 1YJBA 5B1EA 1OYOA 1DBIA 1PJ8A 3DE2X 3VHQA 5JXGA 4WOCA 1S2NA 1TK2A 3DVRX 2Z2YA 3QFHA 2HD4A 1Q5PA 2PWAA 3UNXA 4CFZA 1PTKA 3VYVA 1SIOA 1ZVJA 3DVQX 3L1KA 1WMFA 3I34X 2W2NA 1AU9A 1CSEE 4KPGA 1GA4A 2V8BA 4RYDA 4WOBA 5FAXA 3CNQS 2Z57A 1C9NA 1CNMA 3EDYA 2WWTA 2PQ2A 3DE7X 3LPAA 1TM5E 4OMCA 1IC6A 1S02A 3AFGA 2W2QA 5JXIA 2P4EA 4H6WA 1MEEA 5SICE 4HVLA 3DWEX 1GA1A 2WV7A 3TECE 1Y9ZA 1SBHA 4NMXB 1ST2A 1GTL1 2QTWB 1Y3DE 3GCWA 1P8JA 1BE8A 3DE0X 3H42B 3ZXXA 1SUDA 1SH7A 4GI3A 1OT5A 2X8JB 1GNVA 3WIVA 3WHIA 1WSDA 1SBIA 3DYBA 1T1GA 1P7WA 1Y4AE 3T41A 3F49S 5B1DA 4CG0A 2W2OA 3HJRA 1VSBA 1OYVA 1SCBA 1TMGE 2Z30A 3D9QX 1WMDA 1AV7A 4J94A 1XF1A 4M1ZA 4MZDA 2ZWPA 3DE6X 3F7OA 3LPCA 5FBZA 1AH2A 5ARBA 1S01A 1LW6E 1SCAA 1GT91 1DUIA 1SN7A 2Z2XA 1KDYA 5FFNA 1NDQA 3I30X 1GCIA 2ZWOA 3F7MA 4DWWA 4ZARA 3P5BA 3DE5X 4HX2A 1YJCA 2SNIE 5JXHA 1GTJ1 2Z2ZA 3EIFA 3PTLA 2IXTA 4BWGA 1AQNA 1BFUA 1AF4A 4YN3A 1KDZA 4DZTA 5JMOA 3SICE 2PMWB 1ST3A 3A3PA 1HT3A 4KG7A 1SBTA 2X8JA 2SECE 3WQBA 1C3LA 1EGQA 3D43A 2ID4A 3Q5GA 4ZOQI 3TI9A 1BH6A 1AK9A 1Y1KE 1Y33E 1SCNE 3LPDA 5I9SA 1TO1E 1Y34E 3DW3X 3Q40A 3VSBA 3VV3A 1BFKA 2ID8A 1Y3BE 3A3OA 3CO0S 1A2QA 1SUAA 2PKCA 1T1IA 1GNSA 1PEKE 1SELA 3DDZX 4FONA 4OV6B 3I37X 1BE6A 4CFYA 3QMPA 3VV2A 1SIBE 2SICE 3SQOA 1TO2E 1SBNE 1C9JA 5CW1A 3EE6A 3VTAA 4C3VA 1R64A 4H6VA 1TM7E 2G4VA 1GTG1 1SCDA 3GT4A 2DQKA 2GKOA 4B5LA 2E1PA 2HPZA 1KE2A 4KB5A 3A3NA 1P7VA 2B6NA 2XRMA 1R0RE 1YU6A 1V5IA 1WMEA 2DUJA 1Y3FE 1UBNA 1SUEA 4JP8A 1THMA 2Z56A 3WIUA 1NDUA 3LXUX 1Y4DE 2W2MA 1SVNA 1T1EA 3BGOS 4Z2AA 5AQEA 4NE7A 3OSZA 1WVMA 1Y3CE 3AJ9A 5K7SA 1TECE 2Z58A 4OMDA 1TM1E 4AKTA 1MPTA 1V6CA 1BJRE 1SUBA 2DP4E 2PRKA 2PYZA 2WUVA 4K8RB 1JEAA 1SBCA 3BX1A 1SUCA 1SCJA 2XTJA 1R6VA 2IY9A 2PWBA 3GT3A 3QTLA 4NE9A 1NLUA 1GA6A 3GCXA 4H6XA 1KDVA 3I2YX 4I0WB 3DE4X 3ZXYA 3DE3X 1AVTA 1PFGA 2ST1A 3AJ8A 3DVSX 4AKSA 5AVKA 3DE1X 4LVOA 1TM3E 5ARCA 4DJ5X 2TECE 5ARDA 4C3UA 1Y48E 1SPBS 1ZVKA 3BPSA 1YJAA 1C9MA
chains in the Genus database with same CATH superfamily
4YGXB 2P1RA 1HE3A 2I65A 4UEOA 4TVSA 5FX2A 1YB2A 3ZCPA 1WVIA 5J4KA 3WGLA 5JXJA 1RSZA 4GPD1 1T8RA 1A9TA 1UBMS 3QLUC 4H7HA 3T12A 1DC7A 3UNXA 5IM4F 1J09A 1XN1A 1XCPA 3RGGA 4DV6B 5K8UA 3U7JA 1EIWA 1XG5A 3A9RA 1A8HA 2ODEA 2C5EA 2BEVB 1Z15A 4IIGA 4LJAA 3Q3HA 2EJWA 2IIVA 3FNFA 2G40A 5E9QA 3HDQA 1U8UA 5LYJA 3T1VA 1UIMA 3I32A 5DM70 3LA6A 1I4TD 1SOMA 3FSGA 3NI2A 1MX9A 4R5MA 3N2KA 3LXRA 4MGYR 3ZLBA 2IBTA 4DHEA 3ZGOA 3L6EA 4FFVA 2GBIA 1XL0A 3SHQA 1QZXA 4BNLA 4BVKA 1BTOA 5IANA 1YJ5A 3MMSA 1P8JA 3DE0X 3OKCA 3FKQA 4NFSA 4RSMA 3K6SA 3RJ5A 4ZZIA 4P4TA 3RW9A 3WLSA 5LQMA 3QVMA 1TUBB 1B0PA 3BERA 4ZTBA 4ZOBA 3WGOA 4EZEA 2WTXA 1SOVA 4O2AF 4NPCA 1ZR2A 5E6SA 3PFNA 3GQBB 4A5OA 4FMDB 1AV7A 4PLWA 3PXGA 1FW6A 5AKKA 3LUBA 4GOJA 3VC7A 1SCAA 1V7CA 3GEMA 2XUGA 3N76A 1OBOA 4FX2A 4H31A 1P0MA 3SJZA 1EXVA 2XECA 5BW6B 2WTBA 2QI9F 4UKDA 4JI0B 2L19A 2Z2ZA 4Z4IA 1EKXA 1LDNA 3I01M 3Q3CA 5HEKA 4DG5A 3O3MB 4EECA 5J5VA 4DMRA 4AUKA 121PA 2A0UA 3ZDQA 1NVMB 1J07A 3CONA 3G9QA 1A98A 4DLNA 2FGKA 2FX2A 1DXOA 2PJUA 1BWRA 3CUWA 3FG9A 1SMKA 3PPIA 4JFRA 4DA4A 5KHLB 1AZWA 4J1TC 3GVPA 5A06A 3OO0A 4J6EA 2Q9CA 3LT0A 2LKCA 1LBQA 3W5IA 2YNMA 3JD1A 3WAGA 2HDOA 1TRHA 3O7MA 1PWXA 3ZZTA 1BA3A 3CX8A 4BBPA 2GI4A 2QMQA 3C6MA 1CJVC 3HJUA 3V3TA 1EK1A 4TTSA 4BCDA 4IFIA 1XGKA 3UGTA 1NKTA 4BQPA 2OYCA 1C8LA 2ZSKA 3EIOA 3O2QB 5EHNA 2F1JA 2VPZA 1PJTA 1YQTA 3CE6A 3GJ5A 1VL1A 5CX4A 2XLBA 4AMUA 4JGIA 1J2EA 1MJGA 1WZUA 1Y5MA 4LE1A 4QYMA 4BO5A 3STWA 2OFXA 4P80A 3SIXA 3OZEA 2VP0A 3LUAA 4IG9A 4DAOA 1MUUA 3RS5A 1P17A 1G20E 1X0VA 3EGXA 3KTAA 4UATA 2NYUA 1PSZA 2W8BA 1PJRA 4XUGB 1SXJB 3KSRA 1IOWA 5ALMA 3SFTA 4BUJA 3F8WA 5HX7A 4FCTA 1XQYA 1G38A 5ER6A 3DXYA 4LQLA 1PZMA 2AZTA 5IH3A 1O08A 1LLUA 2VRCA 1NX6A 2ZSFA 4JS0A 4LJRA 3G9ZA 2WLTA 2B3DA 3CBQA 3KT8A 2FQWA 5EQTA 4EO4A 1ISSA 2CNLA 1HE4A 4CU5A 3QHAA 4G24A 3G0BA 1EVKA 3ZS9A 3HCEA 4CLOA 1IWBB 4HLDA 1UQTA 2DWUA 3NIDB 1LK0A 2QZ4A 4HEQA 3UHAA 2VBIA 1B6TA 3OEED 1ECCA 3EW7A 3GT0A 1JFTA 4CPDA 1M1YE 1O96A 3D6JA 4N41A 1OOEA 1WCXA 4W63A 1PL7A 4NPHA 2X23A 4HAYA 1P0PA 2WHYA 1ULHA 5JD3A 4LIPD 3OX4A 1IHDA 1BHQ1 4IDQA 1A4RA 5AOBA 1IY9A 5HZKA 4MWEA 3O8CA 3BVPA 3KPVA 3R24A 4TMYA 5K2MA 1HNXB 2ZBVA 2JFNA 2VRNA 1IBSA 1Q7CA 1X87A 2XYHA 4G1UC 2P9CA 3DBHB 4IMJB 3UMBA 3MUNA 3JQAB 1PLJA 3JZFA 4O8CA 3AUXA 4KE9A 4WVLA 5IZ4A 4N0DA 2HK7A 3BMXA 2EYQA 1K2WA 2YIJA 3VC1A 4LCEA 1MRSA 1NF8A 3WK8A 5LYJB 5JJIA 2VSFA 2H0RA 4F1JA 2LCFA 2O48X 1VE3A 3D3JA 1V6SA 3FMIA 3QH4A 4M9ZA 4B34A 2VNKA 2Y6VA 1MHPA 2WW8A 2O7VA 2K7FA 2A1TR 2J6IA 3A7EA 4C0LA 4ARBA 3AONB 2J6CA 1N0IA 1CUEA 3R3JA 4NCNA 2OXIA 3LKBA 3A1TA 4FEAA 1YK0A 5CT4A 2NU8B 1PJSA 5BR7A 3GFOA 4J1TA 3TBFA 2X2OA 2RJOA 3KEOA 1OH8A 3GP3A 3L46A 3GRRA 4AG5A 1CETA 1UAGA 1N32B 1ZJJA 4Q7EA 4QOIA 1SU4A 4LRXA 2Y8EA 1IAQA 1YBAA 2WD7A 3HKBA 4YI3A 1W73A 3NXSA 4IOMA 3ZEAA 3ISJA 5FA8A 5HKBA 1GZDA 4RHUA 1FVOA 2PD3A 1IIBA 1OZGA 2CVZA 1EIZA 4J0IA 3IBFA 2H57A 5EVJA 5EAIA 4KFTA 3VXKA 3I5YA 1IZ9A 4ZO6A 4JH0A 4MS1A 5KNBH 4G36A 3VV3A 1FNBA 1RM0A 1E0SA 5ANRB 3U9TA 1QK3A 2HLDA 4LY6A 5IYZF 4F8YA 2V9ZA 2EC5A 3K2BA 1G291 3OZIA 1R50A 2AJDA 2EJBA 1F3OA 2P9TA 5AI9A 3ZDRA 3LOPA 1GGVA 4KNVA 4ZDWA 3UO8B 1B8NA 3AM4A 3PL5A 1QRTA 2X9LA 2AMLA 3C6QA 4LZWA 2AW5A 4XOIA 1V3VA 5LQDA 3BFPA 3GJXC 1ODTC 3KIPA 4BB9A 1JNYA 5H02A 2VQSA 1G8FA 3HU5A 3N7AA 5K0LA 5H83A 3UAYA 3AEQB 5A3QA 5CVUA 1RVDA 4Q3NA 1CY4A 1LBEA 2WAYA 3L0DA 5B1SA 3JR3A 3EISA 1M6NA 2X4IA 5T64A 4QM7A 1GY8A 5U4XA 4MRMA 5AKYA 1PHRA 3JSXA 4QXAA 1WV0A 1Z3IX 1AHIA 2EGHA 2IOFK 1F8XA 3A6HA 5I4KA 2JLXA 1IEVA 3TTWA 2DFKB 1E3QA 4DSOA 4EQ6A 3I0ZA 2AJLI 1YRYE 2GYUA 4G1VA 4AIIA 4CCSA 4DXAA 4F3RA 4TLDA 1GTRA 3GFVA 4J3NA 3JWGA 2HQSA 4UVEA 5ALNA 2BGTA 1Z0AA 4UU0A 4S24A 4C6SA 5TQVA 1P2BA 4CKEB 4AAYA 3M34A 4W1SA 2ETVA 2XNCA 3ETNA 2UZ1A 3SU8A 4HDNB 2I3GA 3KVNA 1DAKA 5CCEA 2E6UX 4GFDA 2A57A 5KOHA 5KYXB 1NXXA 4H1UA 3VBCA 3NETA 4X7PA 3LY5A 2WWVD 3TLZA 3EAQA 3HDHA 4EQZA 4L6IA 2O3JA 4Y9DA 5E8RA 4P5PA 1WU7A 2ZB2A 1D2AA 1FYEA 1EVIA 1OXTA 2X3UA 2ZRMA 4WZBA 4PIPA 5CH3A 2CLFB 5FPSA 4EF5A 4HDRB 5ITVA 1WMFA 2H2HA 2J67A 3BICA 4C4SA 5KNDH 3JQGB 4UTPA 1QTIA 5L3SB 1HH4A 1SZDA 1HDGO 2WM2A 2ZTUA 2RHLA 3F5FA 3N87A 2WIDA 1TM5E 4OMCA 5ILGA 4F3YA 1S2LA 3T3EA 3DEJA 4Q9LA 1LX6A 1W47A 3JYOA 3LCMA 1WXWA 1V11B 4EDFA 1IHPA 2WKRA 3AR3A 1OFGA 2DFLA 1Z4JA 1JUDA 1RLMA 2WABA 1KC1A 1Z6TA 3E2IA 3LQQA 4J29A 4BP9A 1MHTA 4I3FA 1KGDA 3U7EB 2WHEA 5CLIA 1GRQA 3TRKA 3U81A 3UB4A 4X8OA 3OPYI 1V9LA 3DT6A 1SVOA 1T2AA 1QIMA 4WLFA 2PKQP 4BNDB 4E5SA 2PGLA 2WG1A 4LXYA 2D54A 2IF2A 1K68A 4LDRA 5ARBA 2FU5C 1XX6A 3CVWA 4DCNA 1GUDA 3INRA 3WQQA 3AF6A 4OAOA 5CIWA 4D43A 3W1WA 1W2HA 3AUKA 4DJAA 2JDIA 2VH5R 4XDZA 5LM3A 2Q1YA 1V47A 3PSHA 3GJRA 3WLNA 1AA9A 1JQAA 1TYAE 4AN4A 5KPJA 3KQMA 1NX9A 2CVHA 3TGWA 2PCJA 6YASA 2I54A 5CVCA 1GTVA 5E0KB 1NONA 3NBMA 3I01A 2Q5FA 4C78A 1JIQA 5BSUA 4XEHA 3JV7A 2HN9A 3ER9A 1ZMXA 1NP6A 3BJZA 1QQ7A 3HYTA 3BIXA 5ICEA 4Z86A 4HD8A 3C3EA 1DCFA 4JP3A 4BLPA 4F38A 4PW0A 4BN0A 1BHJA 3A6DA 3HZRA 3B8HA 4X66B 5BYBA 3V1KA 1GPDG 3QMPA 3R75A 4CHGA 1XEXA 2Y1XA 4V02A 2BRUC 3TNDA 3VPBA 3DFIA 4C03A 2WVGA 2RB4A 4H6PA 3I5AA 2ZYUX 5CDFE 1CD5A 2QVXX 4JUAA 1V2GA 4CL3A 1XTQA 3WDSA 4GR9A 4XYMA 5BYAA 2HA3A 2Q4DA 4NMMA 4Z4EA 4I9HA 2GN1A 3B9BA 3I6BA 4GX1A 4TSRA 3JQCA 4ZVOA 3W1VA 2Q9AA 3Q9UA 5E4FA 3KKEA 4DLWA 3B6JA 1XZMA 3M3HA 3VZBA 1ORHA 1OXBB 2FMXA 3X1DA 4NNOA 2AG0A 2EL7A 3BWCA 4KR2A 2YVAA 1AV6A 2NWQA 3I6IA 3WIVA 2JGAA 1JPVA 3IP5A 4UCQA 5A4DA 3LP6A 5B6IA 1DDOA 1CJMA 7MHTA 3NFRA 3K6JA 4OHXA 3A28A 1Z5ZA 2P2SA 3I2YX 5L3QB 3E7PA 1QKKA 4C0JA 4HR7A 4N01A 4Q7MB 4CKCB 2I0FA 3TTXA 3KLMX 2HRDA 3PYXA 5JFGA 4IOJA 4JI8B 4DEVA 4BO0A 4E1AA 3KUKA 5A2GA 2CHUA 4RTOA 4A10A 3PUIA 2QBYB 1D6JA 5DKFA 1E6EA 3ABSB 3ESAA 1RI1A 2FPXA 1PV4A 3PFFA 2I8LA 3GPDG 3IELA 4JUDX 5TDHA 1OYOA 5CT6A 1PZHA 4GMHA 1FS6A 2EFHB 4K1XA 1HT1E 2BCEA 4AP5A 4BFTA 4BX3A 3SDSA 1LV8A 3D7LA 1KS2A 1HT2E 1XMOB 4I55A 1MO2A 5B4UA 2RHRA 2VRCD 1ZVJA 3DMYA 5HZGA 3JYNA 5JS8A 2VHTA 5E1DA 2BF7A 3MIIA 2Z57A 4WINA 2J7PA 4ZVQA 1Z8DA 3ZYZA 5FL7A 2I9PA 4B80A 3MHTA 1R9MA 2HJRA 4PZCA 3ODPA 2BH2A 3ZDCA 5P8WA 3VR0A 1FYVA 4ZYTA 1B74A 1Y9JA 3T9FA 2ADOA 2X1LA 1FMJA 5AUPB 3KBBA 1YCFA 1NW9B 4XQ0A 1O6ZA 4FCVA 5AVRA 1GRCA 4LDJA 3RAFC 1BE0A 4E6PA 3QEMB 1H9BA 5EYPB 3ROFA 3VHXA 2VHJA 4MGEA 2JFXA 1KI7A 1PT8A 3FRHA 3GLTA 1OMOA 3DYIA 1WXEA 5BW5A 1GT91 3AUFA 4F5ZA 3MSCA 1PT5A 2EIHA 2H9AA 4KSBA 2RARA 1H3EA 1M6YA 2X8WA 2C2XA 1Q1EA 3AHHA 3D3EA 3QTBA 4WWHA 5F23A 1CU1A 1IB0A 4NECA 3H8SA 4J1NA 1NM5C 4J2HA 5CXSA 1QTNA 1VJRA 2D7JA 3ZLUA 1J1UA 5ITSA 3ZDEA 5K3CA 2C3YA 2FLVA 3WGJA 2EX4A 2WYOA 3K2IA 4E1VA 1HZZA 4FGZA 3EVTA 4MVJG 4TSFA 3HBNA 1YH3A 2WJHA 4R2JA 1UZAA 1GG5A 2I1VB 3FUCA 4QFCA 2GRAA 1VKNA 1FFAA 2QWXA 3DUWA 4TL7A 3S7TA 1AC5A 1ZONA 5KCZA 5SZHB 3IIEA 4ZVPA 1RKUA 5FKJA 3DPSA 4LFCB 3GA0A 3WWEA 4HOYA 4AMBA 4ZHQA 2AEMA 4XLZA 4S1PA 3LL4A 4HNSA 4L3VA 3RIMA 2A9FA 4GHWA 4BGUA 2ZW9A 4BMCA 4DBLC 1YUMA 2D1SA 2IWHA 4YB8A 1JF8A 2SKDA 2JGFA 3H16A 3OSUA 2ONCA 3PPWA 4LI3X 3UYKA 3ZWDA 4IY1A 3MOGA 3EG9A 3HLKA 1Z2AA 3LO8A 3NRCA 3OMXA 4GPIB 5DK4A 2E3JA 2FJPA 521PA 3AUAA 3SMQA 1S2IA 4G6ZA 3G1WA 4AYTA 4GWKA 2QN6A 2JBWA 1U9YA 1DKMA 1QKIA 1VECA 5LU9A 1JU4A 1NL3A 4CWAA 4FKBA 5EMMA 1DJMA 5I45A 4CM7A 4INOA 2IIBA 5DIZA 3JQFA 1A7AA 1U2DA 4CCAA 1QVZA 4TSFD 2BP7B 2IYOA 1OLUB 3FTCA 1DQYA 3V7FA 4YCCA 2FLKA 4N3GA 1SR8A 3KWJA 2WM3A 1U3CA 4CBVA 4A0FA 4E94A 3D6TB 3NTLA 1B8OA 1N3YA 2IWRA 5GPBA 4CMHA 2IXFA 2TSYB 5CPFA 3W90A 3CF4A 3ZXYA 4F6RB 3K35A 5DM60 4E30A 4NCJA 3LXXA 4AQYB 1YRWA 1Z5VA 5HFNA 1H22A 3E35A 3ICPA 2UXCB 2C4MA 3PT9A 3V97A 4X0EA 2V7XA 4B79A 5LR6A 2ACVA 3A25A 3M1AA 3ASVA 5EFOA 4E5YA 1BJKA 3CF4G 4RH1A 4H0FA 4F5DA 3LTNC 2CXHA 3M7IA 3QLEA 1IAVA 4RAOA 1JFVA 1JQDA 2PX8A 2ZYRA 4JLMA 2ZQ5A 4NEHB 4JEUA 4WTOA 4YWHA 5JFTA 2AQKA 3PQ8A 2Q50A 5IC4A 4ZGWA 3U6KA 3W3AD 1B23P 1TUIA 1E6LA 2ATXA 2XTZA 5KX5F 1Q1AA 4XIJA 4QATA 1LQTA 2BFCA 1M2GA 2FPUA 821PA 2XWPA 1KVRA 5ERGB 3DWIA 3CEHA 3JQPA 1EX6A 1RFLA 3KV1A 2FWNA 3UUEA 4BMOB 4B73A 2BSQA 3I62A 3LPAA 1SKUA 3Q5EA 5J2UA 2FPRA 1N2XA 2Y1GA 4KQ9A 4YAIA 1Z6QA 3E1KA 3HM9A 1YQGA 1GTL1 3ZKAA 1XNJA 2WOOA 3GH1A 4DARA 3IEIA 2O0LA 2PVSA 1GG2A 3QXCA 4PX5A 4CCYB 1D2MA 3JU3A 5EQFA 4FHCA 1KRWA 1U2DC 1KVTA 3I9V6 4LBVA 3ZJVA 1JR2A 3HK2A 2OO3A 3OFND 1AN0A 1GPYA 1J0AA 1I3KA 4EJ0A 1M1NB 1QUFA 5CA0A 1GADO 2P78A 4ZKEA 4REOA 2O14A 3UG6A 4PTYA 5MFPA 5KTMA 4HX2A 4M99A 3MRVA 3UF0A 16PKA 4KYVA 3FTFA 2R97A 2Z0MA 1BO6A 2D5LA 4BMYA 4MS3B 3PTZA 1W35A 1OWPA 1Q50A 2DG2A 3ECCA 4PLPA 3E7XA 3VR4D 3S8MA 2E85A 1T36B 1GPAA 2IBMA 1H65A 3L8MA 4MHOA 1UEIA 2F3RA 2OXRA 3RFVA 4FDVA 1OYWA 2W70A 5IZCA 1WCYA 4LOJA 2VZLA 4D0SA 2QEQA 3LWBA 1Z29A 3H2KA 3PC3A 4QECA 4GYWA 3FD8A 4PTLA 4TVOA 5HE8A 1UC4B 3H9GA 1Y6JA 1DB3A 4LS3A 3RTAA 4M1EA 2G4LA 2GN2A 4NHOA 4B82A 4F97A 2OYRA 3U4DA 3AVVA 2V0GA 2C58A 1CLEA 1ECFA 2WDPA 3AHDA 1TVKA 2VHEA 3DEIA 1IPFA 4IJWA 3NHFA 1I30A 2QNIA 1RPZA 5CNKA 5G0TA 1TLFA 4IIJF 5HXAA 2EIXA 1KO7A 1JQ5A 4C5BA 3JS5A 4PPYA 3LPNA 5JCOA 1YS2X 4C0HA 3H2JA 4MW7A 3H5AA 2HKIA 4KBFA 2NU9A 4X90A 1TUEA 2ZB7A 3FR7A 2FMFA 3A4NA 3FZQA 3PGJA 4YAOA 1EUQA 1YZVA 2HWKA 1GAEO 3C98A 3HJNA 3MYYA 4FFWA 1X70A 4NOMA 1QIJA 4IDPA 3ZXUB 4S04A 1QBGA 4U7JA 1ENOA 5JWOA 3ZZMA 1BSVA 3AL2A 3O6VA 3RVPA 1RWVA 1SUWA 1FDSA 3IT2A 3CH6A 2FR8C 3KOOA 1DJLA 2BI8A 4L4UA 4ND8A 2P6RA 3KVRA 2QRMA 3LYLA 3R6GA 2ISQA 1TYDE 2VRWA 3AI7A 3KKKA 3PX3A 4NFLA 3L7KA 4DWJA 2V59A 5M34A 2H1IA 3M6IA 3H2HA 3OCXA 3RHZA 1XA4A 4RVHA 2CXOA 2BGLA 2C5HA 1ZJ4A 3A6JA 2OWEA 4BO7A 1RT9A 3ENKA 2HUPA 1L3IA 1Y1TA 2J0UA 4OB8A 3WWCA 5JMWA 1HLPA 3U5TA 1M7GA 3E9NA 4AZVA 4ZVUA 4I50F 3V8MA 3WLHA 3NYWA 1KEEB 1RLUA 1SIOA 3IOYA 1F51E 2BHTA 3T7RA 3O4HA 4UBLA 4XW2A 5FYQA 4ETMA 3L8ZA 2LZ0A 3OETA 1ZINA 2QK4A 3BXXA 1QGDA 3H9EO 7ADHA 5L6LB 3JQ9C 2IY7A 3NIGB 3W4JA 5JD4A 1J8DA 2GESA 4JEIA 4ZC1A 3IOBA 5TEWA 3HJAA 4BNDA 2A3RA 2A84A 4WAUA 4EKDA 1MNAA 1YB7A 1EHYA 4X1KA 4MIYA 4RMGA 2B8JA 1VG0B 4LV6A 5D5QA 3ZGXA 3MJDA 4IIHA 5JSQA 1TAGA 2XMPA 1BWQA 2OCPA 3EIWA 4WIAA 4UM8B 3RS2A 4NCAA 1G5HA 2G36A 4PX9A 1PGJA 3HXLA 1FX1A 1XVTA 2ZE7A 2OBNA 4MDYA 5BPHA 4EJSC 3HJGA 3KT3A 1ZA2A 3VBEA 4CLRA 5F3WB 1CPYA 4D0NA 2ZIGA 3LYUA 1E3EA 1XZAA 2FE1A 3KEMA 2RH9B 3NCTA 3PR2B 4ML3A 4Y7CA 4BLSA 5KOYA 2O5CA 4F5YA 3MLAA 1J5XA 1WR8A 3GFBA 3OU6A 2VJNA 5BV1A 4HDRA 3AVYA 3FBGA 4DR5B 2Q2VA 4IP0A 4Y7DA 4OQFA 4EUNA 2D2VA 1UXOA 4A3SA 3ICCA 1X7ZA 2ZROA 1DSSG 3IA7A 2ADMA 3RNOA 2D7CA 2VIIA 1SK8A 3OJFA 1SA0A 2WUDA 1LI4A 3RIYA 3BSSA 3H5LA 1HM5A 1RIIA 3B6MA 4L75A 1D04A 4IXDA 4U9IS 1QS0A 3Q0TA 2X86A 4IBOA 4HYTA 1Z39A 4O4LB 4OV6B 3DZIA 4PQYA 3CGWA 3DAPA 4BO4A 2CHGA 3P7MA 4YRRA 3D8BA 4ABYA 4U2KA 2X0RA 2GM4A 4BJ3A 3WFZA 1J2JA 1IHUA 2GSDA 3N2NA 2PSDA 3ZHQA 2GERA 1KWGA 3K7EA 2QE6A 1E69A 3OF2A 4YRJA 2J9GA 2X0KA 3ZV4A 4N12A 2XYRA 5IF3A 3SBDA 2CFOA 3IAS6 3PIDA 1ACLA 5AW6A 1UJCA 4GKKB 5ICSA 1T3TA 1M2OA 1SUEA 1NQUA 1T9ZA 4KX3A 4YHBA 2OBFA 1P3DA 1VCHA 5JCJA 3GGCA 3DR5A 4E2XA 2CV2A 4MW4A 1Q19A 1USKA 1JQJC 5CMLA 3PNKA 4QPJC 2OAQ1 1D09A 3HDYA 1XNQB 2H2GA 4FBMA 1WXQA 1N57A 2AI3A 4LG1A 5I9MA 2NT3A 1PWZA 3NNNA 1KR2A 1FNSA 5ED0A 3GH3A 4BGVA 1CK4A 1VKRA 3LQKA 4S1WA 2IY9A 2PWBA 3DPUA 3IKMB 5CGZA 4DMUB 3E7WA 3G0HA 2MSNA 2KPOA 2G9UA 2PZBA 1I01A 1V3UA 4OI2A 4IWXA 2I91A 2C0QA 4UDNA 3RUIA 4QPDA 5FWXB 1PUIA 2AN5A 3H1AA 3BC1A 1Z0IA 3KOYA 1ZD2P 3FHLA 4FXPA 3DE1X 2IHJA 3FI9A 3RS7A 2YOFA 4JMLA 5TY0A 2I8AA 4C04A 4C4ZA 3PPXA 4B4WA 1BEEA 3PQDA 2I2XB 2EQAA 1H23A 3H5NA 1XPRA 1TQHA 3HADA 1LBHA 1ZUIA 2UVQA 1V5EA 1K88A 2QR3A 2XVYA 2NIPA 4L9RA 4ZI2A 5GIPE 3LZ6A 1VPDA 3HVKA 2FW8A 3IR7A 3VU0A 1OX5A 1R4AA 3R0IA 5LP6C 5AUNB 4DT1B 1B4DA 1XQVA 2C9YA 1VGVA 5IULC 3DE7X 1NIPA 4I9GA 5EZ6B 4MYUA 1ICIA 2YVLA 4NCIA 4NK5A 2XRYA 1RYHA 4JBNA 1ISJA 5CA0B 2H3HA 2C7PA 1RKXA 2V97A 2BMEA 2ZRLA 1KP3A 5TS2A 2C61A 4IWYA 4NQRA 4LDNA 3V80A 1QVRA 4WNYA 1QBKC 3FPLA 4WZ6A 3GDFA 2AW3A 4LMBA 1F4PA 4RPHA 4QAJA 2FSVC 1KQOA 3T5TA 3WP0A 3ZQUA 2PX4A 4GPBA 4DR7B 4DOMA 5D51S 3BSFA 3GJ7A 1E7WA 3P96A 1YZUA 3OLWA 3WK7A 4EMUA 1SNYA 2HPVA 3AR2A 4M8KA 2QAGC 5DMXA 5F52A 1N2ZA 5SY9A 4Q93A 5AK5A 4A6EA 3DBRB 2CW5A 1Y5NA 5ES4B 1PUJA 3IMGA 2AJTA 4DQDA 2F8LA 5A0VA 3B5JA 2P1DA 1EWQA 3D3NA 3OPYB 4DPMA 3M33A 1JAXA 2YRFA 4QREA 3LA8A 1U81A 1O5IA 1P19A 3OU7A 1T26A 3H84A 4OQLA 1FVXA 2R8XA 4PF1A 4RVUA 5TQ2A 2JEYA 3WWZA 3H2ZA 4TV9A 2P7HA 5EHGA 3ABIA 1GL9B 3MUOA 1YCGA 1FY2A 1HQYE 1CDOA 1NJFA 2E89A 3B3QA 2BE9A 1WZ2A 4CM8B 4XRGA 1DC8A 2VF7A 1Y1RA 3UJ3X 3GUYA 3T1TA 3DL4A 3EVDA 3H65A 3SSNA 4UTVA 1DIHA 2P5SA 4S1NA 4FZVA 2XQJA 4AZSA 3OOJA 1A7JA 3D8UA 4EB6B 4O8ZA 3TL3A 4RKQA 4BFUA 5I8WA 4UUNA 5CTAA 2F43B 3RFXA 4TRJA 1LDYA 4ECAA 1E20A 3B3AA 4GMXA 4KUHA 5LP6B 4CMEA 1XP5A 2GKOA 1Q91A 2HPZA 3P2YA 3RFFA 1P7VA 3RK1A 1E2NA 3FZYA 1B6SA 3PD7A 5K6RA 2K5UA 3FZNA 5EMJA 3TGLA 1S0UA 2FP4B 4PM4A 2MYUA 3I1JA 3U7QA 5C53B 1W0KA 2FG7C 3CKKA 4C1NA 1QJ4A 1IG0A 2FZVA 2X1VA 4O0MA 2IGBA 3PDIA 3C41J 4XX0B 5K0SA 3D8HA 2Q7OE 1NW7A 2JARA 3KFLA 1GGJA 1PTJA 1SUBA 4IIJA 4NR0A 1JJFA 4C6TB 5LDHA 4AMYA 1SOAA 1GQFA 1RBZA 3PYLA 3QTLA 4RY2A 4UCXA 3T5DA 5BMOA 1RWPA 3IGFA 1KFJB 5H3CA 5BYKA 4FWTA 1LFAA 4DCUA 2OCKA 2J30A 3DULA 2ZAGA 2PXAA 1Y1QA 3GN1A 3QPCA 1K7EB 4UBNA 4V38A 1HSZA 3VVCA 4CXMA 3CZ4A 3WC4A 2IUSA 5DULA 3EZNA 2YXNA 1PNTA 1M2FA 2W9XA 3TQOA 4ZTZB 3MPUA 2O20A 1ZH0A 2H18A 4XYLA 1SOWA 1FTYA 2OCXA 4J7UA 3ILYA 1KSFX 1NI5A 1P5HA 1W1UA 2IVFA 3IPRA 1PQPA 4IJ5A 2J4CA 4XSHA 3T4UA 4UAUA 2PYIA 3FNEA 1TK2A 1EDZA 1GZSA 1ZM3A 3C16C 3EQ9A 4QTZA 1QX4A 1P4SA 3HDTA 3DQZA 4HI0E 3MAJA 4X7BA 1DEXA 5LP6A 2GSWA 1H8ED 4KQWA 3TW8B 1H4VB 1ZJYA 2G8LA 2W2NA 4KIFA 3U1TA 2C82A 5B7PA 1K08A 2NAFA 2O23A 1L7VC 3E4DA 1QFJA 2BJVA 3NZEA 2IP2A 3O8QA 4WN9A 2DB3A 3OIGA 4GI5A 1P1CA 2CYAA 5H5JA 1P61B 3LUCA 4L0QA 4LI0A 4Q00A 3IPCA 3JQ8B 4WLEA 2E49A 4C30A 1BDHA 1AZLA 2RH5A 3IT0A 1IIRA 2IH4A 1DEKA 2B78A 3NWBA 2WTUA 3AP3A 1W85B 1MR3F 1TUBA 1M8JA 4JLUA 2PZAA 2WG0A 3G0OA 1Z5OA 2XD9A 3L6RA 4DM4A 1CZLA 4EARA 3E7FA 3MJFA 2Q3MA 1Z2PX 3FA2A 3FVVA 3SN6A 2H52A 4DEYA 3F2VA 4J75A 4Q7LA 1YFLA 1CLUA 2OE2A 2W2KB 1WA5A 3B7WA 1EWVA 1U7XA 2XT6A 3B2NA 3EUEA 4K1LA 4QAQA 5FP0A 4DIKA 2YV3A 1CUXA 3RS9A 3WYNA 3VJKA 3QEMA 4Z53A 2JHCA 2GETA 3EQ7A 3MA0A 3GFGA 4IUDS 1X94A 2F9LA 2WIJA 4MVJD 2AK3A 2I8CA 3QU9A 3UCEA 2NP7A 3T9AA 1E5DA 3KJFA 3L7JA 3MTEA 3TLEA 5DHUA 2FW0A 1C1XA 1WVGA 3KXIA 2ZRPA 1QOQB 2FRDA 2PQMA 6PFKA 3EGIA 3RRXA 5KSOA 2YIDA 5DHRA 2JH9A 3JZIA 1EX1A 2CDBA 1JTVA 3MWEB 3GWGA 5KYNA 3UAOA 3UXEA 4K0RA 3UWOA 2OXCA 5K05A 5HJ2A 4Y98A 5ICFA 3Q3IA 4OU4A 1FP1D 3CVVA 2H07A 4JT9A 1K5PA 1ZC3A 3A9CA 4AJNA 1NPDA 4H08A 3MXOA 1VPLA 3BSWA 2ZM5A 1C80A 1ZUNA 4FR2A 4O1HA 4YVFA 5TGZA 5CLFA 1VCMA 2G8NA 3W05A 5GONB 4Q3LA 2O3RA 2BMVA 1FOEB 4L02A 1JEQA 4PG5A 3ZQJA 5F7XA 1ZVVA 3CFYA 4YK7A 4JP8A 2JK1A 2QBYA 1THZA 3A1EA 5DF1A 2R6JA 2W7TA 1VQ1A 2E37A 3UJ7A 5GM2A 4KTVE 3CGGA 4RGBA 3A1DA 4MJ7A 2ZREA 4R16A 3R7LA 4L2IA 3NGLA 5JROA 1U02A 5AKZA 4C20A 3SSAA 4D9JA 4CF3A 2ENWA 4J16C 1RBYA 2YWHA 1WHSB 1GUBA 1VOTA 1HYGA 2ZWAA 1XDUA 5JHHB 1VLQA 2JLYA 5G02A 1AZTA 1LDGA 2YWEA 1Q0UA 3OFNA 1QU3A 2IH2A 1SCKA 4EKYA 1XRSB 4TYQA 4WXYB 5F76A 2D3WA 3ZWMA 1NRJB 1W75A 3AERB 3PFIA 3SM9A 3QBEA 5A4KA 4J0JA 1KFBB 3QWFA 4GM0A 2MYTA 4ER6A 3ZEIA 4R71A 3RI3A 4EUEA 1MNQA 3OMLA 1J0EA 1LBTA 1NY6A 2P41A 5B58C 1L5HA 3QU2A 4BVAA 2C5AA 5AJXA 1B0AA 2JGMA 4BJHB 1TA4A 1GN9A 3OLVA 2A94A 2AS0A 2JGNA 5DGCA 4PNEA 3O8RA 1IRIA 3GR6A 3W8RA 2Q29A 1F2TB 3VJMA 1L1RA 1Q0RA 4BKQA 3MWYW 4KPGA 1FA9A 1EP1B 1H1DA 5KU7A 2C5GA 3DD1A 2LKDA 1Q1NA 2PT6A 4DLVA 1SA0B 2F6RA 3I5XA 2Z6VA 3D8SA 3R09A 4F9FA 2R7AA 1QG6A 1KEPA 2WE7A 5A7HA 1TJ3A 3QWBA 1NTRA 1D0IA 3KEGA 4YUYA 2O4UX 3KELA 4UASA 4KPEC 3V5NA 3OIUA 2QTWB 4KN8A 3P71T 5EP3A 4OX9B 2G25A 4FLEA 5FTNA 5ILQA 1SUDA 4DCPA 3S8EA 2QD2A 1T1GA 3CLUC 4D3ZA 4MX8A 3AOGA 3IQFA 4MVJI 1XNHA 4NU5A 2HMSA 3EH2A 4IJVA 5JAHA 1A2KC 1D2GA 4OMUA 1AE1A 4CM5A 5TF4A 1A4UA 2OENG 1EU1A 2GAFA 3KVYA 5EXTA 5HSGA 5K45A 1I4WA 1PK7A 1XDZA 1RWXA 1VKJA 5A4JA 2XYPA 1V11A 5IG2A 3ENVA 3QVGA 1AK1A 2FHPA 5C51B 1XWFA 2EJCA 4P2GA 4Q3KA 5JBQA 2WYHA 4J91A 4GF5A 4ZYLA 1GPNA 1T4DA 4IDHA 5AYVA 1YUNA 2AV6A 2HHAA 4GI1A 3TJZA 3TK1A 2FSPA 4EG8A 3UV3A 2YN0A 4BJ6A 1EFAA 4GRDA 4YBRA 5WRFA 4ZYUA 4UNIA 1XCGB 5CFMA 3OJ0A 4AWXA 5LSAA 2DR0A 2YNMD 1AHHA 2O1XA 3EFBA 4UEKA 4AW9A 1T5IA 1UL1X 1I3LA 4P2BA 1J2RA 4Z4GA 1E2PA 4HQLA 3B13B 1IQRA 3RARA 1GPUA 4MIKA 1KI8A 4B7AA 2BFFB 2XUOA 1Y89A 3WMXA 4JLPA 4INJA 3I05A 4HDNA 1D2EA 3U3XA 1QCCA 5LZ9A 2WJVA 2YXBA 1U90A 5C3UA 3SNKA 3TVTA 1W1IA 5DNEA 5C3MA 1F17A 1QR6A 3CCFA 3LT2A 4DV3B 1BMTA 5JSYA 2NYAA 3AXSA 3EIHA 3Q6NA 1R64A 4UVHA 4MVJE 4PVCA 2YZKA 2R11A 1Z4MA 3HJCA 4R05A 2OB1A 1VYHA 1TQDA 3C97A 1FDRA 2VR1A 3DZBA 5KVCA 3O0DA 1GP2A 4D5GA 1DDIA 4N3CA 2XYGA 1OY1A 1E62A 3MN1A 3FPEA 3SQNA 3VVLA 4CM9A 3K1TA 3RUPA 2ZPUA 2QN7A 2MIIA 3TNYA 2WZCA 3TW4A 2Q0HA 4DMLA 1QP0A 3OPXA 3QKUA 2P9YA 3D6MA 4P7JA 2G67A 1U0OC 3EC7A 4GYYA 1QZZA 2G3YA 4LQDA 3QYPA 2GRUA 4OSOA 4UPEA 5BNWA 2HXSA 2DETA 5IZCC 2OM2A 3NRJA 4XUCA 2KSQA 2BJWA 1GU0A 3WYDA 1OX4A 3GGOA 2PFGA 1UZNA 5BP7A 5KMGB 3QFCA 1JHYA 2Q46A 2B2XA 3OT1B 4FGLA 2DFDA 3FOCA 1OPRA 5I5GA 3BMOA 1K6IA 3S1SA 4PINA 4GPZA 3QFFA 3RC7A 4AUNA 2HCRA 4OJNA 5ETJA 1QWOA 4ZVLA 2QW8A 4MKHA 3UC5A 4RH0A 2Y1EA 3JYLA 1PNOA 4IVNA 1P77A 4M55A 1D9XA 221PA 2OB2A 2J7KA 4M1QA 2FW7A 4RJIA 1XELA 2ZYHA 1KE1A 1QMGA 2L0XA 4G0WA 5BSVA 4LZNA 4QTTB 1I36A 3KEFA 1PK8A 1ZOIA 3LFTA 3GNLA 5ALKA 5KWEA 2AN3A 3M0EA 3CRNA 3W9BA 3G2PA 4MV1A 4BQIA 2R1TB 1N2CA 1OHHD 3T3PB 1L5OA 3OZXA 5CLLA 2RDMA 2WD7B 1P2TA 3C3MA 2EZ4A 3EB9A 3FCCA 1X1EA 1EGHA 4PHCA 1FS4A 2ECFA 1PBTA 2QPOA 2NQTA 4Q6BA 4RYLA 4MWGA 3GLIA 3FCYA 1PG0A 5FTWA 4BNWA 2NTEA 4YT2A 2PLFA 2B30A 4C14A 1QG0A 1U31A 2VYQA 3KQTA 1NXWA 2KBEA 2XW6A 4LTMA 2Y3IA 4RAQA 2B9VA 3IUYA 2V98A 2P9GA 3FFWA 5CTJA 1Z13A 1BD4A 3EY4A 2XNDD 1K66A 5K0NA 2JRLA 4DREA 3I28A 4RDHA 2L17A 3UA3A 4N9QA 3D4LA 1SCIA 3ANLA 3IB3A 2AF3C 4ITVA 3RKUA 1NJSA 3A1SA 2IJGX 4RKWA 2FVXA 3PR3A 3TIVA 4I9NA 2FWBA 3OCVA 3FDJA 1FTSA 3PYMA 4KE8A 3RJ9A 4DIBA 4R8VA 4ZEXA 4HN9A 3QUCA 3RVLA 4L72A 3LKDA 4LA4A 1YL7A 1GSIA 1Q77A 1FBTA 1SXGA 5BQFA 3LECA 2ODWA 3HABA 2W2VA 4DUZB 2Y77A 4L5IA 2X15A 4YRGA 3RLIA 3O1JC 3HVUA 1Z17A 1N6NA 5JNLA 5KDLA 5KWSA 4MGZR 3VZCA 1II8A 2YC4C 4UZFA 1X7WA 4GQAA 4BGDA 1J5EB 2FXVA 2XQGA 3RJZA 1WL8A 3NHBA 4REMA 5JARA 1NJ6A 2G0AA 3A6PC 1TLLA 1V9SA 3NTRA 2AXNA 2W48A 3WWOA 1GILA 1ORIA 4IGAA 4EY6A 1SQ6A 2CZGA 3QV1A 3B1XA 4DSZA 3SHWA 1YB5A 4W5NA 4UUAA 1OIWA 1G2IA 1VJ1A 2M98A 3HZHA 4KLRA 3E6AA 4KQ2A 4WOPA 4E5DA 2PXCA 3PNLA 1KRHA 4X20B 3FX2A 4IXMA 3L7CA 1GAXA 2CB0A 1QF7A 3NHAA 3CZ5A 3MUFA 4OAPA 5FULA 1OYYA 2Z56A 1PDOA 3N0VA 1CEXA 1YZNA 1XCJA 2JS7A 3W6OA 3KJQA 5AK3A 1VGRA 1WKCA 1JWLA 2ZYDA 3WHPA 1JG3A 1VG9B 1XVLA 1R0LA 2VOJA 4RQAA 3EGXB 3KTAB 4Y18A 3HUEA 4AXXA 4QUKA 3K70D 4C7OB 2FA9A 5CW2A 1VJDA 4BZZA 2IF0A 4F6LA 1PJCA 3BRCA 4RTNA 2A7XA 2QT1A 2V9CA 4FFOA 1XZIA 2DYKA 3PQ7A 4MWDA 4P3KA 3M3DA 3CX4A 5K4HA 4MVJF 3RNLA 3K9WA 2BEUB 2QZPA 4B43A 3IERA 1VCOA 4H3VA 1CBUA 2FSUA 4DLXA 2CLMB 4H4EA 2TECE 4J3JA 1TW2A 3VTFA 3CRVA 4TQUS 5EIBD 2FR8A 3CPEA 5G53C 3V7WA 3TPZA 1L2TA 2WJYA 3H9UA 4NG4A 4GDMA 1G20A 3TI7A 4AWAA 3QHPA 1ZAKA 2I6GA 3SCZA 3PXEA 3RTGA 3KZNA 5GP1A 3OZ7A 4GYKA 3D0KA 1JALA 4FYIA 3IP3A 5JVDA 4AM8A 4MOWA 4HQFA 4NL4H 1EVEA 1Y3IA 3G2KA 3L6CA 2NV2B 2B4TO 3PWZA 4P3YA 4WSOA 3GLSA 5B3AA 5JI3E 1ODFA 4PWYA 5EEGA 1MB2A 2HNKA 3Q98A 4P98A 4DR1B 1WXGA 4O4JA 4RDXA 4L74A 3GCZA 4AJ2A 2VCHA 4W7IA 4Q4JA 2B69A 3N28A 4MKRA 1TJYA 3SIPA 3WR5A 5M5BA 2IZ0A 3F3MA 3RD5A 2DY0A 2ZJ0A 3TRHA 3BHNA 3VU3A 3V3KA 2P4QA 4HQRA 3V1NA 2POCA 1H0KA 3T7DA 4TMWA 5BQXA 4Z7JA 1Z2CA 1E3JA 3BUSA 2N9UA 1SKYB 3BHIA 1CC1S 2EP7A 1F12A 2O8VA 1T8SA 4OFWA 4BCCA 3GDWA 2ZDQA 1JE1A 3EASA 4B2IA 5LXTA 4FEEA 2ISSD 5BT9A 3G3EA 2NZVG 3GNSA 4B8ZA 1KO5A 1DTWA 1UMDA 2FN9A 2XE4A 1E2HA 3KKZA 1SVSA 1GGHA 4HCJA 1NBME 5I01A 5K01A 5EHZA 2AF4C 5DCYA 2XRZA 4EYOA 4GKVA 2PD4A 1HKHA 1I4EB 1UBSB 2H4XA 2R5FA 2VJAA 2V7VA 4EFDA 3K71B 4ZO7A 1YASA 1OTHA 2JH8A 4PLVA 1ZOOA 3IAFA 3DDHA 4FE3A 4PSUA 1E7MA 4DBLE 5A3JA 3S4YA 4M7OA 3FHOA 2H4ZA 3HYLA 3I42A 2PV0A 4KVAA 4P7BA 1T8WA 4XD7A 1NVKA 1Y34E 2XQVA 3WX0A 3TVDA 2NM0A 1YDGA 2C4NA 5IJXA 3U2QA 9MHTA 3ANMA 4WCDA 3FYUB 1TT5B 1G42A 3QP9A 4OCZA 4EJMA 4YPVA 3PEFA 3TLYA 5H4GA 1GRRA 3AEKB 4OQXA 2I6UA 3C3AA 1NNEA 1KI3A 1Z73A 2HWUA 1L7DA 5CX1B 1IDOA 1T6YA 3ZCXA 1QONA 3ZK8A 3MIZA 3QOYA 2DCUA 1IZYA 3ULKA 3WWPA 3GDHA 5CDSA 3EY9A 1RHQA 5BWNA 3RADC 3Q0IA 2PH7A 3BE8A 1JGTA 3LNCA 4B4DA 3GLFB 3ZHYA 1R4NB 1C1DB 2YZ2A 3GLIB 1RYYA 4WADA 2G76A 2C92A 3H18A 3TW0A 3A6KA 1GNTA 1XZNA 1RHUA 3LLVA 3C74A 3KO8A 4Y9TA 3BWVA 3HSYA 3UG7A 3CU5A 5F1PA 2C0PA 1WXFA 3BN3A 3E23A 1Y7IA 1YA6A 1ZCFA 3HXQA 1SHJA 3TX2A 2XMSA 3RE1A 1S4MA 2A92A 2HLHA 2OK8A 3EDOA 4DILA 2VHZA 1N9ZA 4IJMA 5E3IA 1NN3A 4M1KA 5EWMB 5G0SA 1E0KA 1ZICA 2DQYA 2YW2A 4EW1A 2PDAA 1MABB 3VTZA 3PJEA 4I6JA 5EZQA 3WIOA 1Y3AA 4HDKA 2EF0A 1UJ5A 3V9PA 4CTJA 5C18A 5I47A 2QOEA 1OLXA 4M9RA 3R6DA 5THXA 1TM4E 2F1OA 3WADA 2NXNA 1BVYF 1CV2A 5DWQA 1CIVA 1BWSA 1P6XA 3E2MA 2WIKA 5G0VA 1OROA 2FQXA 3VO9A 2REQB 5KIAA 4C7JA 2ZYSA 1KEVA 4KQGA 3MJVA 3OT1A 1D2HA 2CMGA 3N53A 4DCMA 1M0WA 2NSDA 3BL8A 3NT5A 4XVCA 1BHO1 5H8WA 4TKVB 2I6FA 2V65A 1I6MA 5DISB 1AQLA 1P2GA 2A88A 3C14C 1O58A 4JWKA 3TB4A 5I7HA 4D42A 3GJTA 4KAAA 4G9BA 2DBVO 2XZDA 3IAM1 5PNTA 3DLCA 3AF4A 3VR2A 2J3MA 4QG7A 2V1XA 1MXFA 4TLEA 1JS1X 4PBTA 3DZDA 3GGGA 3EAFA 3NS7A 1OU0A 1QSGA 2OZLA 4M0FA 2O8BB 3MELA 5AJZA 2AOTB 2BM9A 3HJTA 4B87A 3AESB 1W2GA 2VRBA 1G8YA 1NMEA 1H0SA 1V1MA 3G7UA 5LQAA 2JGKA 3PXDA 2ZITA 2GHQA 1QHGA 5J43A 3ZBUA 1DHRA 4PZAA 3CUVA 1QH9A 1EE9A 3BG5A 5BORA 1DPFA 3L4BC 4UNNA 4CE6A 4MW0A 4JHLA 3E2PA 2R8BA 5FWYA 3O2JA 1RWBA 2L18A 4WZBE 4BLUA 1BQ4A 3U17A 2PU7A 3JVDA 2OG1A 3N9IA 3RSZA 2WAMA 4EENA 1MVNA 5EZYA 3UAZA 1NNI1 2PVPA 2ZWOA 2BYTA 1M2NA 3P5BA 4O2AA 5BXQC 4N47A 4Q03A 1OVGA 3ESCA 3QXHA 4DDKA 1C3OA 3WL6A 4IIUA 4NAUA 4PE5B 3PKIA 1W46A 2HMVA 4OHRA 3WB0A 4MH0R 2EXXA 3GLHB 3A9TA 1EVYA 1Y5IA 5JNTA 1GU7A 3CRW1 3L0BA 3NDBB 2WWIA 2ZRKA 1DARA 2XQIA 3AFHA 1KHHA 4D4MA 3CT6A 2FOXA 2ZUDA 2HMWA 2X42A 5JS1A 3LT5A 2QA5A 1N3BA 2G9QA 2MSLA 4I5DA 3DNMA 1CUYA 4EPRA 1U9ZA 3GZ4A 2ID8A 5GZ1A 4J94A 5JS7A 5L3SA 2BBSA 5TR9A 1USVA 2FSVA 4MJLA 4BNTA 4XM1A 1Y6GA 2BM0A 1WBBA 3EDRA 3NBKA 1OW3B 4JNKA 3VTAA 3WAKA 2HSEA 4YJGB 1GNPA 2GXQA 1R0KA 2AG5A 4U39A 3ZTYA 5BWOA 2WU1A 3HCPA 1Z28A 1EFLA 3O95A 4GLOA 4ZA2A 5GY7A 5KYXA 5MF6A 1GRVA 4HDOB 4IF6A 2OZLB 1Z6PA 4RZHA 1N6KA 1R0YA 1F9EA 1S8FA 4YJFB 2XAAA 2C99A 2QR5A 2FE4A 1E58A 1T24A 1A5AB 1CW2B 1TB4A 2W6MA 3P0RA 4HB3A 3HLYA 4UU7A 1TM1E 2NN3C 1HL7A 5CXXA 3RYIB 3SHFA 1YVDA 1Z68A 1G21A 1G1MA 1ZMOA 2QY6A 3BX1A 3NONA 1L4HA 3OLCX 4GXQA 4XPIA 1CEYA 1OB2A 3LUJA 5ABPA 4PS1A 1C41A 2FZ4A 2QW0X 5LYJF 5I7WA 3OY7A 4I8DA 3VSAA 3PEVA 3EZ2A 4UDOA 4D57A 1EDDA 4A2WA 1H2ZA 2PG3A 3IKTA 1UJNA 3KQWA 4CM3A 3OQIA 2W6ID 4P5EA 4CM1A 4ZOLB 2AX4A 5KAPA 5DT2A 3B5IA 4AUMA 1X2EA 2NW6A 4MUNA 2QTVA 3PXAA 1KPGA 1NBAA 3TQRA 4IWNA 3ZE7A 4PYRA 4MCIA 4MCAA 3K09A 3NHKA 1I5RA 1CDDA 2BSXA 4TX1A 4ZVMA 3RBZA 4WESA 4AY4A 5HF8A 4JP5A 2MINA 4S1OA 4DVGA 4JA0A 1KU6A 3JZDA 3EZ9A 4CMAA 1U9IC 2WKPA 3O91A 1UBEA 4EX6A 1AKVA 1L4BA 4JC0A 4NYMQ 4R2LA 4MDFA 4UXHA 1HOTA 1EX9A 2OLEA 4HAUA 3RSCA 5L51A 2D8AA 4NXNB 1KKLA 2R1ZA 1DC3A 2RGDA 3G5MA 3R41A 2YZ7A 4H17A 4J03A 4LJ7A 4NMXB 4OYHA 5CYPA 2A1TS 4YPFA 4DKXA 4LEIA 5JH7A 3GLFA 5GWXA 2CN1A 3TMAA 2PN1A 5LQJA 1KS9A 1Z08A 3CRRA 4U9HS 2I87A 1EWYA 4URFA 4W1PA 1L5FA 2CEAA 4WK6A 4MW9A 2JZNA 4H4DA 4O0LA 4WK4B 2HA5A 3JR7A 4NE2A 2D5AA 1VSBA 2BKLA 2IP1A 4QULA 2VF2A 4E11A 2GZ2A 3AF2A 3SXUB 1G4UR 5TC4A 3D59A 1H2XA 3IAEA 1LKZA 4QYXA 3DG9A 3FYTA 2DBRA 3WYBA 4EFNA 5JSZB 3TG8A 1RYDA 3MWKA 1R6BX 2DPHA 5E1MA 4F2WA 2YJGA 5HJ7A 1IG3A 2C2YA 3BRQA 2LTAA 4UZEA 5JO0A 2I4MA 4FOLA 1ENYA 5CAEA 2J3JA 3ZGLA 2C7RA 1RDFA 3IXLA 3K53A 4A8JA 5LNK1 4LOHA 5E9WA 5A71A 1N92A 3WRVA 4IGIA 5EJEA 5K0EA 5GAJA 1KY5A 3AP2A 4BV3A 2FSIA 5BVGB 1KZ9A 1UDAA 1VE5A 4JJ6A 4C0KA 4YROA 4GZ5A 4MQLA 2P2NA 3VYSB 2XXJA 3E9MA 1CP3A 3QVSA 4RK7A 4L8VA 1AQYA 4EZBA 2BFDB 5ELLA 1H2YA 4CHTA 3ORSA 4ETWA 1E94E 3A3OA 2QRVA 4AMGA 1RJ9B 4CEHB 1K9SA 3AW9A 3PB3A 4KRGA 4GSLA 4MMXB 4QOEA 3ZU5A 1MOPA 4FT2A 2DKNA 4A6DA 2QB5A 4BAGA 2QMUA 3EE6A 4ZGBA 5BSKA 1R00A 3GT4A 3N7UA 1D4ZA 1WCWA 3F2IA 4D4JA 4YRAA 3SSOA 2H3EA 4AN0A 2A3NA 4ZD6A 4D8XA 2UYGA 2PMKA 1ZXLA 3BSYA 3AR6A 4BKOA 3KQUA 3DV2A 2ZU6A 1EDOA 1ORDA 2PTGA 3C8ZA 4YMVA 2QMZA 3WIUA 3DLIA 4PAGA 4QOFA 4A4DA 4AKGA 1HETA 1IXSB 2PGOA 3N2GB 1D3AA 3FCUB 1Y3HA 3U4MA 2NUTB 2FWIA 4CLOB 2PL9A 4WZAE 5IK2A 1EGVB 3LC2O 4KFSA 1HDIA 1L7MA 1YA4A 1NYRA 4R69A 2WMNB 3E22A 5TT1A 1O9HA 2NYVA 1A8PA 4R2KA 1CJUC 1SXJE 4PVDA 2BR4A 3WGNA 3P2EA 2P4HX 1RBQA 3AUYA 1WZIA 1K63A 3CNNA 4QDTA 1WV1A 1NG9A 2A5DA 4W9MC 1XZGA 4G67A 4WLUA 4ZQFA 4B3FX 3TIGA 1XHEA 3OUTA 4BQEA 3MQ4A 5DN9A 1RKVA 4NIMA 3MMXA 2PZLA 4UFPA 3HEAA 5IMBA 2AC7A 5AMXA 4LSMA 1YJBA 1KI6B 1C9EA 3JWHA 3C5VA 1U2ZA 1M2EA 2AZDA 4MULA 4MQEB 2DHDA 5EKSA 2Z2YA 1FXUA 4KO3S 5JUWA 1LBSA 1YZFA 3DBVO 2FG6C 1WETA 3QSYA 2CKMA 3NCHA 3QU7A 2JFOA 5A05A 3B82A 2BTOA 2VHQA 4EKEA 1PE0A 1UKYA 5LA6F 2QD4A 3LT4A 4C7VA 3G85A 1W5TA 2HOQA 3G2QA 3O84A 4EBBA 3FGNA 3TECE 4E09A 4MWCA 3BWMA 1P4AA 4X8HA 1L7BA 1E9RA 3L8GA 2LV8A 3G2NA 2IUYA 1XPOA 1A9SA 1ETUA 5C8DA 4TLCA 5CLGA 2VUTA 4KTTE 4M53A 4V0SA 4Z99A 4MUKA 3OE5A 1V95A 5TMEA 4BASA 1QO0A 3BXOA 3F4BA 3ZWOA 4RH3A 4Y2XA 3GV0A 4HY3A 2PUWA 1OLOA 2R8YA 3UMCA 1IBLB 2DWOA 1TFUA 3HBMA 4I2NA 5JSFA 3M4NA 2JW5A 3EFOB 5BMVF 2OV8A 2XMDA 1CJCA 1JEEA 2ZAOA 3DO8A 3DZGA 3DM9B 4IDFA 2YWBA 4RVGA 3GPBA 4NH4A 4YV2A 3I9KA 1P1HA 4OM8A 3PQCA 1U0BB 3IXMA 4KPUB 3RC8A 1AF4A 2Z3WA 1M76A 4B3XA 3AZQA 4RD1A 4EUFA 5JD5A 2D2IA 3HDJA 5AM0A 1ATZA 4DFDA 1HC7A 3UXMA 3JQ6A 4CTMA 3AVUA 1KEWA 1FTQA 2VHUA 3MWJA 3NJ4A 3RS0A 3TSZA 2D59A 5AHRA 3ZE0B 2IHTA 2Q5LA 4ZOQI 3ESDA 4YCDA 4ZI3A 2FOLA 1U0HC 3EQ8A 3OHMA 1VLVA 3WO1A 1C0KA 1J0XO 5LKAA 3FCOA 4CV3A 1LQUA 4F5WA 1ND5A 2OMKA 2CVFA 4M9CA 2YV1A 2FEXA 2Z98A 2BEVA 2ZSIA 4G2NA 2ZZMA 1YOVA 1JDNA 2CHVA 2NVUA 5CW1A 5K8VA 3RVKA 4C3VA 1UDXA 3Q3EA 1PL0A 2X2PA 3ND9A 5K8LA 3AG5A 1E8MA 1JLKA 1KE2A 4I5IA 1VSVA 4FFBA 3M6XA 3BK7A 3AWDA 2CEKA 2EW1A 1MVLA 5FI1B 2VNJA 4LGCA 2B4KA 5JHGB 3GZTB 3ZN2A 2ZWMA 3MJ4A 3QSGA 5DDIP 5EP4A 1VMIA 3TRIA 3EEBA 4LZOA 2VDJA 5ESDA 4TXJA 4QYTA 2P6MA 2ZIXB 4P3PA 3ZDAA 1W52X 2NTYC 4CMJA 3ELYA 4G1EB 4MPDA 4TKLA 1UC9A 1GKIA 2HDHA 2EQ5A 1V3QE 4DV1B 3KXLA 5IJ9A 2O3QA 2C9BA 2R1TA 2BSAA 2DQSA 4JA2A 2O2IA 1D7AA 1JVNA 3JWPA 2VXOA 1QM5A 2B4QA 2VF8A 3NUZA 2O0KA 2O1WA 1HWYA 3A6LA 3QOXA 4M60A 5C35A 1Y6FA 3LPMA 4X6XA 3A4VA 5ALXA 4AT1A 3C7AA 1F2UB 3K1AB 4N7RA 3DZKA 1NI3A 2ES4A 2DBZA 1SPBS 3Q7RA 3G2JA 3IQDB 4MAMA 2X19A 4GNRA 4ENPA 2A7QA 5C34B 3I9MA 3Q1LA 1G63A 1G8KA 4M9SA 1T3LA 3OFSA 4X64B 4DR4B 4WXHA 1XCLA 2J5KA 3ILXA 3QMWA 4RHCA 3ZNOA 4ARAA 3E4CA 4YQFA 1IVNA 4FKZA 4JJ8A 4K40A 2XEDA 4ESHA 3V8EA 1C8VB 2JA1A 1P91A 3IUNA 3TUZC 3OWXA 2O7RA 3V8NA 5ICMA 5B3JC 2PT5A 5CURA 2Q21A 1OWMA 4UHEA 4A0RA 1X1RA 2C97A 3IUQA 2XE8A 1U2QA 1V8OA 1NUTA 1ZD4A 2QTAA 3JASB 3PVSA 4IGFA 4LRYA 1G8AA 4WNCA 2L82A 2CFRA 2IQIA 2RIPA 4L9WA 4PAQA 4YUAA 3T1HB 4RD2A 2C7QA 1YVRA 5J40A 1EFPB 3MJCA 4RZUA 2ZLBA 1BA2A 2C9DA 5CCXA 2AKYA 2BFNA 4N0MA 1RRPA 2HA0A 3S8YA 2MOKA 3V2UA 3PWTA 4TLLB 2DVMA 4BRSA 4D6XA 2GAOA 4Q24A 2OV2A 3TH5A 5F78A 2OKGA 1F6WA 1PFVA 1JT2A 1QGUA 4TMTA 2J08A 3QEKA 1VSUA 4QUAA 1OB5A 2D00A 4RD0A 5FI5A 5A3VA 1W36B 5HKLA 1BU8A 2H5EA 1GKUB 3I53A 3QWHA 3FPGA 4F6CA 1WXXA 1R4MB 1ZUWA 2H85A 4Q39A 5G1PA 4ZXFA 3UATA 3WI7A 1B15A 4B3SB 2GD2A 3ZIDA 3R40A 5F1KA 2W90A 3MWDA 3H3JA 4I8XA 2CXXA 1XA3A 1CF9A 1UPXA 2VYFA 1K5DA 4XCXA 2DE0X 3CB4A 3ASYA 2R8RA 4IV8A 4FX5A 4X97A 4LGMA 4UUBA 5AK6A 2B1JA 1QOPB 2A5GA 2HC9A 3NR2A 1T0UA 4J16A 3D5TA 5ER9A 1CHDA 4M0KA 1ZK2A 2FQQA 2QLNA 3NWEA 1P7CA 1VSQA 1JEYB 4DCCA 1IMOA 2Y05A 1SELA 2Y1OA 4CF5A 2SKCA 4MUFA 2RH4A 1N4AA 1ITZA 3ABQB 3PTAA 4CEJB 1F3LA 1Z22A 2LD4A 4FD3A 4YJ2B 3ZU4A 4ZI7F 1S4QA 1PFUA 1SBNE 5FLXA 4OHYA 4R40A 4WNAA 4B3JA 3JQDA 2IYRA 1CY6A 4Z7NB 2I29A 1GZ5A 4QA9A 3ZOKA 4JOCA 3IVCA 4JVNA 4G1FA 1W5EA 4R8MA 4Z9XA 3V4SA 3DKPA 1L1FA 3DT9A 2SCUA 4OHMA 1GCOA 1HBJA 1T5TA 3NW9A 1AGRA 5HS4A 3LNTA 1AUQA 5AQEA 4OREX 5BYJA 1CERA 1D8TA 1Y3CE 3S1AA 4EHBA 3K0KA 3LYAA 1TGYA 1XXLA 4D9NA 1VJCA 3SF8A 4A92A 2X5KO 1N7JA 2I7TA 1XQ9A 4LYDA 1F2TA 3T9CA 3OEEA 5KQGA 3EMVA 3A36A 3V2HA 3VDXA 3Q7QA 5CB6A 1BZYA 3EA5A 5IFLA 1K3TA 1GYQA 1RQPA 4G81A 3IHTA 5EESA 2WEKA 2P9HA 4CM4B 4EAQA 4YR7A 2IHYA 3DVSX 1GCGA 4EOGA 1TM3E 4YNBA 1YE5A 3PP8A 1SZJG 1CQWA 4FMCB 5LOVA 4HQKA 1T8UA 4DLZA 3G1UA 4Z51A 5DK6A 3GZNA 3IB6A 2PKWA 2WUWE 2YBDA 2WZBA 3WKCA 2B7CA 1KK3A 2Q28A 4ER3A 1LK5A 3ZWBA 7REQA 1IVSA 3JAMA 3VHQA 4O4JF 4Q4AB 1HSOA 4TS1A 2JKZA 4ASUD 3ACBA 3TFOA 3TVYA 3SVLA 1QE0A 2XBMA 2G9VA 3NKVA 4IHJF 4L85A 5ENDA 1RU3A 5JQGA 2FX3A 4LNAA 2RK3A 1EK5A 1Q20A 3C1UA 1JIUA 3DEFA 3EXIA 3WIEA 4ZRMA 4YUVA 4ISCA 4ER5A 5C1IA 4V0NA 4GKJB 4GL2A 3L84A 2GBFA 1BW9B 1FUIA 5KTNA 1ST2A 4O08A 4M9XA 2XE7A 1OXMA 4NICA 1PWHA 3M1IA 5LBUA 3ZE9A 3K92A 2ZYWX 1I4OA 4M9UA 2WICA 1ECBA 2C1ZA 2A5YB 3MG9A 2R4QA 3H1TA 3L41A 1ZO8A 2R6HA 3DFUA 3F98A 4XZ3A 2Q7DA 3PC6A 1U6IA 3U61B 3NT2A 2WKSA 4BP1A 2UVDA 2IW3A 3E9ZA 2GD6A 3ROMA 1XTRA 4QHTA 4JVLA 4EYGA 1UMKA 2Q1SA 4PCUA 5DNDA 3MMPA 1C7JA 4JKOA 2J85A 2PUHA 1Q0LA 3RASA 1L8AA 1P0QA 3OEYA 3VI3B 3GMDA 4B3MB 2A14A 1CUSA 1YULA 3FF4A 3RUCA 4DLBA 3A31A 4MQ5A 4ZQEA 4DRXA 2SKEA 3C8DA 3AIKA 3KD2A 4RFSB 1CUZA 1G4HA 3F8TA 5BMVA 2VPYA 3VZSA 5B7NA 3MINA 1HDYA 4JMPA 5EE5B 3RQIA 4MR8B 1HI9A 3TLGA 5B1YA 5IYZB 4KE6A 2IU4A 3WRXA 1U80A 5K6AC 1ONNA 2A9JA 4NARA 2WUFA 3S6JA 4YV1A 4P0QB 1KOJA 2EX1A 2MR5A 4G4JA 2BHLA 3FTEA 3ZLTA 4ND1A 1UBOS 4P08A 3AO0B 3KUCA 3VFDA 2I4IA 2O2YA 2R1UA 3MVEA 1VHDA 5BW8A 1BE6A 4N39A 2IPLA 2JIZD 4Z2YA 4MKZA 1H2WA 4FIDA 1V26A 5LIRA 2AR0A 3KYCA 2GXSA 3RBXA 4P4UA 1ZISA 4JN6B 4HTFA 4YX9A 2QTCA 3OE7A 3IIKA 3L82B 2Z4TA 4R3NA 3THRA 3QE0A 1QH8A 1T5DX 4X3PA 8OHMA 5JJBA 1MEJA 3K16A 1QG4A 2ENUA 4MKFA 4ZT5A 5DPMA 1WDMA 3QE2A 3KOMA 4HHEA 4TZKA 1RBMA 1KQNA 3WK6A 1ODCA 1Z6GA 2EBFX 5FA5A 4D3DA 2IXDA 2VP2A 1JEYA 3W06A 1O97C 1TECE 1T9HA 5IT5A 2NP6A 2LRHA 3W2IA 2NSJA 1GAQA 4AJLA 3AV3A 2BFCB 1J2TA 3HLTA 1FYDA 3FPHA 1JDJA 5F2EA 3PCTA 3SC6A 3NGMA 1ISMA 1V1RB 4KSYA 5AOVA 3EZ7A 3X1ZA 2YZGA 1NLFA 2CNKA 1E1LA 3KPWA 4TQAA 2WYVA 3DDSA 4IHQA 4KHZA 4FM9A 2ZIZA 4FFPA 2JIDA 2OV4A 1LWNA 5FBWB 4UQPA 2GPAA 1Q7BA 4O3MA 4HMOA 4OSPA 1YCHA 1HYEA 5FJJA 2R2AA 1X1TA 3CIOA 4F4JA 1WW2A 4DIOA 2IE0A 3ME5A 3OQ6A 4LZJA 4G0YA 3W2TA 2BL4A 1KYQA 3GEBA 2OXFA 3MWGA 4TTPA 5K20A 4PS0A 2UUBB 2HPAA 2Y1FA 2KLHA 5LBIA 1ABEA 4AZTA 4KK4A 3LBIA 4C21A 5CXQA 2QDKA 5JXGA 8ADHA 3H6GA 4MR9A 5JRZA 1H4SA 3HB0A 1QYCA 5DBOA 3O2NA 1Z2OX 1O4VA 4PZLA 3L40A 4RHEA 4KN9S 3U3RA 1G3QA 2H4YA 4UE3S 1GL7A 1K3FA 1E6CA 3EDYA 1R5OA 2GJSA 4MQFB 3QV2A 1EM8A 4KX5A 2JCGA 3PDIB 4FTWA 4NBRA 4XX0A 4YP1A 4D80A 1AHPA 1IRXA 1MA0A 4TL6A 2ZANA 1YOBA 4KMOA 1DAGA 1H8EA 1W88A 3GCWA 2TMGA 4KZKA 3PNQA 1CUCA 3DEKA 4X8LA 1X39A 2Y27A 4JLOA 2QUAA 2OHHA 2JLWA 3QLJA 4M0EA 3U44B 3WMRA 1EBFA 1W49A 3ZY5A 1I10A 3GFFA 2KX7A 3GFSA 4FINA 6REQA 3U4QA 2ZCJA 4Y6QA 3DB2A 1RD4A 3AIMA 2VNAA 3N86A 5D5HA 2P6UA 5EJ6A 1OC4A 3OIDA 1DIRA 1DRKA 2ODAA 3OQPA 3IJRA 2RBKA 1KJYA 1EGAA 1U0LA 3ZCTA 9ATCA 2X0IA 5EXPA 2Z9BA 5H9WA 1Z2DA 3RRNA 1D4OA 2AUNA 3K4HA 2YINC 3ODGA 3GVCA 4RWEA 3UK0A 1MKYA 2JI8A 5ALVA 1CY7A 3X2FA 1E5QA 3GRKA 3TZEA 2AFIA 2H9IA 1YB1A 2I2FA 1PU2A 5HFJA 1RZVA 1PX0A 1QP8A 4BO8A 3SX0A 1C4KA 4OXNA 5DHQA 4C06A 1WZCA 3AHEA 3BGVA 5FA6A 1GKYA 3ZKWA 5T67A 1KSHA 1V4BA 4HADA 4BPRA 2AT1A 3DBRA 1VPEA 4KBYA 4KQHA 421PA 5HHTA 3VPHA 4E3WA 4HB2A 1IE3A 3WG9A 4AZ0A 4EI8A 5C81A 1IZ8A 2ZZNA 3DV0B 4ZT2A 1OH5A 3Q9NA 3DCYA 1W4LA 4OHKA 2VDWA 4FDMA 4LMPA 3ZJTA 1BXZA 3DL2A 3E5NA 4JDPA 1MG5A 1XEWY 2WHQA 3IBSA 1G2QA 1QYRA 1EG7A 2Z08A 3H6KA 1DL5A 4LF9B 3A3NA 4CTKA 4D0GA 2YWRA 1PSWA 4PYJA 5BN5A 4OBWA 3HM2A 3DGFC 5E6RB 5CLQA 4OYRA 1UJMA 2NVUB 1PW5A 1QWSA 1RW4A 1Y8RA 5E8JA 4AF6A 4P4NA 4WK2B 1R16A 1XTTA 2J4FA 3FB4A 2ERXA 4MPJA 1L8XA 5C7YA 1E8NA 1ZK3A 3C8UA 4D8WA 3JCZA 4E4RA 5K7SA 1HXHA 3P2JA 5BSWA 1UK9A 2EVWX 3LFUA 4QJ4A 1K6EA 1E66A 1AG9A 1BXRB 1RRKA 1TZJA 2RH8A 4YAKA 1IBMB 3ORHA 5AICA 4YQYA 4WCFC 5E6UB 3FDZB 3QBDA 4NBSA 2I22A 3Q8KA 3S44A 5JT1A 3ET5A 2A8YA 5JR3A 4DUGD 4YYEA 2IDMA 3OZWA 4JLWA 3S2EA 2B8WA 5AESA 1E1RD 4WKOA 2QHXA 4OP2A 1MRZA 4GX0A 4FJ0A 1D07A 2B5OA 2HBYA 4PYMA 3DYVA 3ROGA 3ZHSA 4D1YA 3BREA 2JCYA 2AEEA 2Q3EA 4O4HF 4FW9A 4TS3A 3SZOA 1P4RA 1WZEA 1T4BA 2Q8PA 2FFQA 5GJWC 6REQB 1RXEA 1HDXA 1E2IA 4OHUA 1FXWA 1ENPA 2ZDHA 3IMKA 3LUKA 4JL6A 3SZ3A 3V1UA 4BCBA 2R0QC 3U6BA 3ZVKA 5ALDA 3ZNNA 4PO9A 1XRMA 3QLTA 1D7OA 3WJ7A 4LV8B 2POQX 1PZGA 3H97A 1BEZA 3RJMA 1UP4A 1JQBA 4MYCA 1XKLA 4QNMA 1QQTA 4B31A 4IS2A 1LNZA 5FO1A 1EM8B 3I3OA 4JZYA 3BDAA 3S68A 1TKRA 3U0VA 1LRJA 3FFAA 2JAWA 3AKDA 3CCBA 2YXDA 3OLYA 1JIJA 1JKFA 3G23A 4OQMA 3VAAA 3D7MA 2QUIA 5B53A 2X8JB 3C3KA 2XNDA 2XGGA 2QW1A 2F1HA 2D1TA 3EVFA 1IQPA 3LCRA 2WQ7A 4LYFA 4MR9B 3SHTA 4DLYA 3DMHA 5IXYA 2QTGA 3BTVA 1H6DA 3NDIA 4JJFA 4EKGA 3A1NA 1E2QA 1ZGBA 4OJKA 5J2UF 4U7HA 4CKWA 4HNAB 1GO2A 3OWOA 1RFGE 3ZJ4A 4H1WA 1FFBA 2QD5A 4US1R 1TMOA 1XP8A 4UUOA 2YJTD 3G6WA 2BY4A 1P3JA 2HYIC 3FNHA 4P4GA 4WUTA 3PNOA 1US8B 5JTTA 1CZHA 3R9KA 3HA2A 4BC0A 3KAQA 1GGFA 1VPTA 3GRPA 4L28A 3IH5A 2CL5A 3EQ6A 4FQ5A 1WW3A 4BXOA 1EFUA 4I46A 3NNSA 5DLPA 3E22B 3DVLA 4L9AA 3ZUGA 1V3TA 3MTJA 1IUPA 4L8FA 4PNZA 1IQUA 1F6DA 2EARA 2NUPA 4DNQA 5HBRA 5JJ5A 2JGDA 3VNUA 4K9DA 1YRBA 3ZZNA 1B8UA 4PEVA 2JBAA 1QC5B 3PVZA 5IVKA 2GNOA 1JH8A 4FDLA 1Z6ZA 3VKGA 5KWIA 2KMLA 1O03A 2R7NA 1FQWA 2A1IA 4C7OA 1DT3A 5JQGF 5JI2E 2E5WA 1SKQA 5T7BA 3RU2A 2JRCA 4OFXA 3N8NA 4OY3A 2IOHA 3VR6A 2HMAA 3K4PA 1DKOA 1A8SA 4JYBA 1C0LA 1C30A 2AOXA 2QZ9A 2V8OA 4JR2A 5I7AA 4Z4QA 2IK8A 3KTDA 3U3JA 1YUBA 5FTJA 1W4ZA 3RDPA 2HU8A 3M4ZA 2GRJA 5BSTA 5KZMB 1BX3A 1NQXA 2YV5A 1SJ9A 1Z8HA 5EINA 4DS3A 2BBOA 2QUZA 4OLHA 4JJEA 4QPZA 3T3DA 1KVSA 2E4UA 3BE5A 3K0HA 5D85A 1RPJA 4HB0A 2YDXA 3GLQA 3JQGA 3QUSA 3U4GA 4ZJYA 7AT1A 5IDXA 4DPLA 2YQ4A 4ZYZA 1KEEA 3NHYA 4XVRA 2EFYA 5DH9A 1GZ3A 2ZJ3A 3TQFA 1DAIA 4E51A 4V1CI 3AEUA 2R6R1 1SBZA 1SBYA 2ZEJA 2CXQA 1C8KA 2VDRB 3C4JA 1UBGA 3OJWA 5DNVA 5HNKA 3KQQA 4HDMB 4TOIA 2J3DA 1KA9H 1MRNA 1RI5A 1Y48E 2Q3JA 3KTFA 2ZI6A 3OQVA 3Q9LA 3UAWA 1CF2O 1E5XA 3GMSA 1AKRA 3T15A 4FWIB 3VR5D 1ZK1A 3P0IA 1EP2B 3UW3A 1ZA1A 2H1RA 2QN2A 3JW8A 4INAA 3JQ9A 1EA7A 4C4OA 3HDVA 3PFGA 5C9ZA 1VBMA 3GFPA 4RDIA 3EBLA 3V7YA 5FAKA 1YF3A 3WA7A 3PDUA 2PWAA 3JRXA 1TMKA 3OF5A 2XQFA 2FH5B 3H2IA 4IAOA 4TQGA 5IDYA 3WNBA 1XLWA 3I9FA 3NWJA 1RLJA 3ZXSA 5JH7B 2WA1A 3RVOA 4DQXA 4EF4A 1NHWA 1U8TA 4OHBA 4JL5A 4QODA 2NXWA 4QG3A 2XVXA 1MZVA 5FV4A 1M1XB 3HY6A 3OX2A 4Y1RA 3PDJA 3WLEA 3X0DA 5BT8A 5J2TA 4JZKA 1G3RA 3GBPA 4WKGA 5JWHA 3EMBA 3TZQA 2FN4A 3KB8A 1ADJA 1PQYA 4FHFA 3AEZA 4J4HA 4UBKA 1Z33A 3I6MA 3EN0A 4QOGA 1OV6A 2R7LA 3RVSA 3PCXA 3KZMA 3D4NA 3BS4A 5ALEA 2X4DA 2R6AA 2XCOA 5EJAA 1PZNA 2GF9A 3G8YA 1UAYA 3M5WA 4K6KA 2ZJBA 4HAVA 1NRWA 3N2IA 1OILA 4ERXA 4D3XA 1Q0PA 4PV7A 2B7BA 1QV6A 3LPCA 4DA8A 2ZVQX 3UN1A 2VJMB 2NVOA 2F8MA 4RC9A 2BLNA 1IXZA 3AL3A 2TRSB 3SMVA 2QYOA 3JXEA 4W99A 4ZYXA 3RVMA 1RABA 1ZGJA 5ELXA 3NYRA 3WYCA 3ZHTA 4ZJUA 3ELUA 3IA2A 4JJGA 4NENB 4IZHA 1LX7A 2PZKA 4RCZA 2EDAA 2VDKB 2AOUA 1JSCA 2XUAA 4J6FA 3WNVA 1E3TA 3HKDA 4TMKA 2PNFA 3UANA 2NO1A 2IEDA 1PZFA 3E0XA 2IT1A 1TJPB 3IP9A 4OI0A 2AUTA 2DMRA 4Y9UA 2FK7A 4EPXA 2A4KA 2B1IA 4IDBA 1X1CA 4I19A 4N5NA 1I6WA 3SF8B 4BGEA 5KDDA 2GHTA 1FSPA 2IXBA 2VH2A 2LR0A 4EHFA 2WFAA 4YJFA 1A5TA 1WLYA 2PXXA 2X6QA 2XH8A 4ADSG 1HO3A 4ITUA 3PX2A 4L4SA 1OQAA 1L4YA 5C32A 1J7KA 1KR5A 3KK0A 2AMVA 5D3MB 3UCXA 2OWDA 1JILA 1ZN9A 1UFKA 5IH7A 2I76A 2FUKA 3UH1A 4IZ6A 3A27A 3A11A 1RM5A 2ZRJA 4LTNA 1W0JD 4C07A 3WGHA 4DXHA 5HM6A 2BEKA 2QRHA 4CMIA 2ZFUA 3ANXA 1V5IA 4TV8B 4US0R 1SZCA 3DOEA 4CEJA 1TZKA 2WK1A 3C6YA 4UZSA 3F6RA 3G49A 1Z5PA 4AL4A 2UYOA 4PO8A 2PUFA 4ID3A 2C9MA 4D56A 3HCCA 4HZUB 5U4QA 3CVYA 3HKEA 4FEGA 4Y6LA 5J47A 1HGXA 4XSVA 2C8KA 3IO5A 3WAJA 1SBCA 2ODQA 2RGUA 1XSEA 3FN4A 3K2EA 1DBQA 1JL3A 4DC0A 2JLRA 4Q3CA 5TMBA 3T9EA 1C9DB 1YHYA 1ZGZA 2H00A 4L5AA 1MCZA 2CLHB 1VIAA 1PFKA 4FB5A 2GWHA 3QY9A 1C3OB 3FPSA 5BNFA 4LY0A 2GN0A 3IMFA 2GLTA 3GEPA 4IEIA 3QY0A 3RREA 1FMFA 4F45A 4RZ3A 3HZOA 1N2CE 3WZMA 1C9MA 3HWX1 1QRAA 4JV5B 2GILA 5AVJA 2HO5A 1M9NA 2AMFA 3X1JA 1GYPA 3M5DA 3ZBTA 1XV5A 2ZUEA 2C8JA 3GOHA 3O3NB 5IAKA 3NC4A 2NSLA 1A5SB 1TADA 1BROA 1BYUA 3TJRA 4JYZA 3EF1A 3CW8X 2C78A 1DQSA 4MEAA 4R31A 5FOVA 1RXUA 4RK5A 3FNRA 4Q1BA 4R5HA 4QYIA 4RPLA 1N2BA 3AQIA 4I1VA 5CDYA 5CT9A 1T34A 1CQJA 3MOSA 2W8BB 3ADPA 3JASA 4JDUA 4IIXA 3ZE8A 1A97A 3A1UA 5F7OA 5CG1A 1HZJA 1UXIA 1AGXA 3D7SA 4KLCA 4EY4A 4AFNA 3PC2A 2Q6KA 5AP9A 4DMFA 2QL9A 1W34A 2PRIA 3QA9A 4I1RA 2ZP1A 3C1OA 1OF1A 1NOJA 2HIAA 3KR1A 2HU2A 4RLQA 4II7A 2V3VA 4KV9A 3R9WA 1H2BA 3KZ1E 1YB4A 2QX7A 3C5HA 3CWQA 2DUWA 3S2YA 4NH0A 4EY5A 3AF1A 1M0SA 3T99A 4YASA 4AY6A 5GOZA 1QLWA 1XALA 2REQA 4KR7A 5L3ZA 1JB1A 2BF4A 1Z4KA 4RTMA 1K27A 2J9FB 3A3KA 2E4XA 4GEGA 2NYRA 1JG4A 3H1FA 1B76A 1IEQA 3SDZA 4MIEA 2ICAA 1F48A 3WRYC 1VL0A 4CNBA 2CVPA 2X7JA 3BD9A 5BW4A 5CBPB 2CF5A 3SJCA 4QUBA 3FSEA 2QMHA 2VQ3A 2ZCVA 1R0ZA 2VH1A 4RA6B 5CP8A 1DC6A 1MAAA 4G8JA 3QYAA 2I62A 3WFJA 2QLFA 4HLCA 2PSFA 3LO5A 3L3BA 2WWRA 3HB1A 3BHMA 1ID8A 3TD9A 5M7EA 1EFCA 2GDJA 3CO5A 4N0EA 1WDKA 2PX3A 1GQ2A 1AUVA 5K3FA 1YNSA 2Q3LA 1VI2A 3SOZA 3EWNA 4LRTB 2YMPA 1OD6A 1VKZA 4N03A 1E3LA 3NOQA 2O5EA 4I1OA 1PEKE 3EODA 3KM0A 1EUYA 4ZDIA 3REGA 1ML4A 1XZ8A 3SQDA 3LXMA 3Q11A 3U3MA 5ECWA 4Q21A 1AKQA 2P7IA 1ZZEA 3VGPA 2UUCB 3S2IA 3EGVA 4HLNA 4QU0A 4W8HA 4IHAA 1YIAA 3ZCVA 4YJHA 1JPUA 5BN4A 4HAOA 1MJFA 2GB4A 4A2PA 2D13A 3DXXA 1YIDA 6GPBA 3HS3A 1QH1A 1IN6A 2ZJOA 3AEKA 3FR8A 2J9RA 4JBIA 1ISRA 1OBCA 1OFIA 1WCV1 2O0HA 1Y1PA 1V2HE 3BCRA 5E7IA 1FJXA 1J2YA 2XCIA 1CRLA 3NFYA 1MTOA 2ZULA 2WNHA 1RWWA 4L5JA 3R7NA 3VOSA 1GPJA 2Z83A 1ZRMA 3N2LA 1QGZA 3UJBA 4F3CA 1LPAB 1X7YB 4QEZA 4AJHA 1UKAA 1ND6A 1QK5A 3V42A 2H5JA 2AWOA 2AK2A 3VNVA 5IARA 2QAGB 3FDIA 2QJFA 2B21A 3VR2D 5EGNA 4RQBA 4U5QA 5I7EA 4PHFA 1GCUA 1FSFA 3DKVA 3E9EA 2APJA 3MCZA 3M2TA 1B1CA 3THOA 2QM8A 4GVPA 3U3OA 1N6LA 2WHXA 2I71A 2ZJ2A 3D64A 2O8DA 5J58A 3DAGA 2A9VA 1L1QA 2FI1A 1XMQB 4RA9B