3LPDA

Crystal structure of a subtilisin-like protease
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
339
structure length
339
Chain Sequence
APNDQHYREQWHYFDRYGVKADKVWDMGFTGQNVVVAVVDTGILHHRDLNANVLPGYDFISNSQISLDGDGRDADPFDEGDWFDNWACGGYPDPRKERSDSSWHGSHVAGTIAAVTNNRIGVAGVAYGAKVVPVRALGRSGGYDSDISDGLYWAAGGRIAGIPENRNPAKVINMSLGSDGQCSYNAQTMIDRATRLGALVVVAAGNENQNASNTWPTSCNNVLSVGATTSRGIRASFSNYGVDVDLAAPGQDILSTVDSGTRRPVSDAYSFMAGTSMATPHVSGVAALVISAANSVNKNLTPAELKDVLVSTTSPFNGRLDRALGSGIVDAEAAVNSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic extracellular subtilisin-like protease AprV2
publication title The Subtilisin-Like Protease AprV2 Is Required for Virulence and Uses a Novel Disulphide-Tethered Exosite to Bind Substrates
pubmed doi rcsb
source organism Dichelobacter nodosus
molecule tags Hydrolase
total genus 118
structure length 339
sequence length 339
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3lpdA00
5AVJA 1WSDA 4DJ5X 1C9NA 4FONA 1GA1A 1Y3BE 2W2MA 5SICE 1GNSA 1GTJ1 2ZRQA 1AVTA 3LPDA 3A3PA 4H6VA 3TECE 3DW3X 3F49S 1P7VA 4K8RB 4LVOA 2SECE 2TECE 2WUWE 1ZVJA 1SELA 4RYDA 1NDQA 1TO1E 1GCIA 5FFNA 1AH2A 2G4VA 3DE7X 3AJ9A 1C9JA 3LPAA 4KG7A 1P8JA 1EA7A 1PJ8A 3D9QX 5B1DA 3GT4A 1OYOA 3T41A 1SBTA 4CFZA 1AK9A 1V6CA 3ZXXA 1SPBS 1Y4AE 1OT5A 1GT91 2X8JB 2PQ2A 1Y4DE 1SUAA 4DZTA 4AKTA 1PTKA 3F7MA 1SIUA 2ST1A 1KDYA 3SQOA 4H6WA 1XF1A 2DUJA 1IAVA 3CO0S 3DE6X 1AV7A 3WIUA 3QFHA 3DE1X 2HD4A 3DYBA 1SH7A 1MEEA 1Y1KE 1SUCA 3A3NA 3GT3A 1TK2A 1ZVKA 2V8BA 1BFKA 2GKOA 1R6VA 3LXUX 1WMEA 3OSZA 3HJRA 3VV2A 1Y9ZA 1DUIA 1NDUA 1SCBA 4I0WB 2WUVA 1P7WA 3VTAA 2PKCA 2B6NA 2IXTA 2PYZA 3BGOS 4OV6B 5ARBA 1HT3A 4NE7A 1VSBA 3DWEX 5AMXA 1ST3A 3D43A 3DVRX 3DE2X 1JEAA 3WQBA 1T1GA 4KB5A 1SVNA 4DWWA 3LPCA 4MZDA 4BWGA 2W2OA 3EDYA 3TI7A 1BH6A 1GTG1 3I30X 1TECE 3DE0X 1S02A 3L1KA 3CNQS 1KDZA 1GA4A 3TI9A 1TM3E 2WV7A 3DVSX 3DW1X 5K7SA 2W2QA 2ID8A 3VYVA 3DVQX 1SCDA 4YN3A 1WMFA 1T1IA 1MPTA 5JMOA 1Y33E 2PWBA 4B5LA 1S01A 2Z56A 1AQNA 1R64A 1SIOA 3WHIA 1SBIA 3BX1A 3Q40A 2E1PA 3QTLA 1Y3DE 2DQKA 4NMXB 1TMGE 3UNXA 2P4EA 2WWTA 1SUDA 1EGQA 1SBHA 1PFGA 1AU9A 4WOCA 5ARDA 2ID4A 1ST2A 1Y3FE 1SN7A 1BFUA 1GA6A 1SCAA 2X8JA 1WMDA 5ARCA 3A3OA 1DBIA 3BPSA 4WOBA 1SUBA 3PTLA 2PWAA 1TM4E 2Z30A 1Y34E 2SBTA 4OMDA 1S2NA 1SUPA 1NLUA 3F7OA 4M1ZA 4CFYA 1C9MA 1Y48E 2XRMA 1V5IA 1SBCA 1KDVA 1TM7E 2Z2XA 3SICE 1SCJA 3DE5X 3AFGA 2SICE 2PMWB 1Y3CE 2Z2ZA 5FBZA 4GI3A 3ZXYA 5JXHA 2PRKA 3WIVA 3I37X 1TM5E 4H6XA 4JP8A 1AF4A 5I9SA 1SBNE 5FAXA 1YU6A 1BJRE 2HPZA 4ZOQI 2XTJA 3EE6A 4C3UA 1YJAA 5CW1A 1C3LA 1R0RE 2IY9A 5B1EA 1BE6A 1GTL1 4J94A 3DE4X 3DDZX 1BE8A 3I34X 1THMA 3VV3A 2Z2YA 1A2QA 1IC6A 1PEKE 3QMPA 3AJ8A 1SIBE 3GCXA 2W2NA 4KPGA 1TM1E 3DE3X 2W2PA 3P5BA 2ZWOA 2SNIE 1CNMA 1SUEA 1UBNA 1TO2E 5JXGA 1Q5PA 4HVLA 4OMCA 4LVNA 1YJBA 1GNVA 2DP4E 2Z58A 4C3VA 1OYVA 3VSBA 4ZARA 4HX2A 3VHQA 5AVKA 1SCNE 4NE9A 5JXJA 2ZWPA 4Z2AA 1LW6E 5JXIA 2Z57A 5AQEA 1T1EA 3GCWA 1WVMA 3I2YX 1KE2A 4CG0A 1KE1A 4AKSA 3PRKE 2QTWB 3H42B 3Q5GA 1CSEE 1YJCA 3EIFA
chains in the Genus database with same CATH superfamily
2VATA 3UXEA 4EY8A 2WSSD 3E8MA 1XTQA 3DMHA 5ENVA 4E12A 1GGNA 1SG9A 4C0SA 3CKMA 1NURA 1FK8A 3R1IA 4RHCA 5ABPA 3MRSA 1GZSA 4K7JA 5AJTA 4KH1A 4B6RA 2QL5A 3ELWA 3O0DA 2AEFA 2VHQA 5DI3A 3FM9A 4AO8A 2MR6A 1CNFA 2AHOA 3OKAA 3B3FA 3A6LA 4NBTA 3I6BA 1YXMA 3X2SA 3C16C 4EZIA 1HETA 5E3HA 2BCGY 1XMQB 3G5TA 4PGAA 4H6VA 1PT5A 2NV2B 5I4IA 1JJAA 1WPXA 3V55A 2H0QA 2WJJA 1Y8AA 1I01A 1BVRA 2VCHA 2OBMA 5BSRA 1H4SA 5K0TA 4DV2B 2I22A 3GROA 4EGFA 1WO8A 3WWCA 2FJ0A 2X7XA 1EH5A 2FEMA 5DNAA 1Y5NA 1U3DA 4QKQA 1ZVJA 1TX4B 3R5FA 5ECGC 2PD3A 5E4YA 2CXTA 1E8DA 1NXVA 4P4GA 7MHTA 2PNJA 4KRGA 1Y1PA 5D6NA 3RVPA 1Z4PX 2WKWA 3M9XA 5HK8A 1N6PA 5DNDA 2AVDA 1WDMA 2ZYRA 3HKCA 4A36A 1PJ3A 1IK4A 1Z26A 4JQCA 1BKDR 4W5HA 1T0BA 5K8LA 3LLMA 4LXGA 1EZ1A 3IEVA 2QRHA 3D54D 1VMAA 1UBGA 2JK0A 3GIDA 3SVZA 1SHTX 1U4NA 3L6BA 3N70A 5JYBA 5EXSA 3ABIA 3QX3A 4YMUA 1W5TA 4Z9AA 2JGDB 1T91A 3MGGA 4CMCA 1BROA 1UMDB 2JI8A 5G1NA 1O95D 1KZ9A 1V6CA 4RJKA 3ST7A 4FD3A 3H2GA 4R0MA 2EHDA 2HCJB 1XN4A 2CDRA 4QVKA 2FWBA 3QUTA 5D2CA 2J3LA 2Z5VA 1JYEA 4Q0MA 4ARCA 3NALA 4IIUA 4B74A 1BX0A 2J8ZA 1C2YA 4I5GA 4YRZA 2J9ZB 1EGMB 1OF1A 4L9RA 1FLAA 2DQ4A 2E0IA 2A1UB 2PVCA 2RKWA 3C3XA 3ECAA 3IUBA 5AJXA 3UGTA 4CU5A 4JI2B 4LOAA 2CK3D 4RVNA 3SBDA 4FYYA 1Q44A 1PTKA 5K8TA 4WOPA 2BGUA 3LUAA 4Q4CA 4FC6A 1JMYA 1AA6A 2UUOA 2QRLA 3RM3A 3NNNA 4FD2A 5C81A 3ZLBA 2DF8A 2QE6A 3PPIA 3QWBA 4JL8A 1MMFB 1UJ6A 2CSXA 1TLTA 3NHWA 3RFVA 1F2TB 2FN3A 2IDKA 2QNIA 4RK0A 1Y3HA 3OKCA 2E6UX 3Q8XB 4MIYA 3G79A 3EQ7A 3B1JA 2WTXA 1V16B 1NU6A 3HKDA 1YRQA 3PR2B 4M89A 4M8KA 3URMA 5J5CA 2HSZA 4E11A 5E6RB 2P0EA 1EIWA 2QRGA 4RTNA 3KDSE 5LXTA 1A69A 2YASA 1BC5A 2QYTA 3MNFA 4ZI2A 4PM4A 1X9IA 4AFNA 2ZSKA 5B4UA 1AG9A 3ZWBA 8ATCA 2OE2A 1II8A 2QVCA 1O5IA 4C0AC 1Y6QA 1CJCA 4P58A 2O8FB 1M72A 1OLXA 1UJMA 4M36A 8GPBA 1RFGE 3LLSA 5DK6A 2BHSA 1ORHA 3EULA 3NOQA 3RIHA 2VAVA 1P7ZA 3C6ZA 4RABA 4V0QA 1T0PA 1ZR2A 4HWOA 3EC2A 4RAQA 2QUJA 1RCTE 3JQFC 1BN6A 1SR8A 1W73A 3K0HA 1YMVA 3DEIA 4F71A 5IXYA 1MJHA 1XZFA 4QVGA 3N2YA 3AHGA 4R40A 2XAUA 5HMLA 1J8YF 1Q0RA 2QN9A 3GD5A 2L0XA 3SBXA 1EFUA 1GPYA 4OIFA 3C1UA 3HJUA 2GF9A 1EWRA 1YO6A 1AHIA 1ZCAA 2R1VA 2XPCA 2B5WA 3ZZNA 4UTZA 4HPWA 2BFFA 1ZH0A 5FP0A 1FUUA 2PZFA 2WUVA 3CU5A 4KUHA 1UOEA 4TT8A 3UCEA 4ZGGA 4I1VA 1AKTA 2RARA 4XI9A 4P3KA 1H4VB 4JU9A 3DBRB 5DP1A 2POQX 3UMMA 1JKMA 2JIRA 4OHFA 3TGWA 4IHAA 1F0KA 3I32A 3FMFA 3HY3A 4BAZA 2FEWB 1ZQ1A 3C98A 3QMWA 1UDBA 3CISA 1OI4A 3H1AA 3MN1A 5CAEB 4BB0A 3EEFA 2XH8A 5H7XA 3OFSA 3HCFA 3KM0A 2YXEA 5GONB 4IJ5A 3T3IA 1RRCA 2ZAIA 2Q0QA 2SKCA 5KYVA 3EN0A 3ZWVA 3W1VA 1G5FA 3DWEX 3ZWPA 2ZT5A 1P2BA 4CIVA 4PAQA 1KMHB 4R5HA 1OD6A 4TWZA 4CCSA 2Q1WA 3BWVA 3D43A 2QZSA 1ZC3A 2OFFA 1ZY2A 2D06A 4X90A 4O8ZA 4N82A 2Q3CA 4IUDS 4IILA 3UJ9A 3C70A 1MIOB 2G9QA 3E84A 3JQPA 1D5WA 3SVLA 4YMTA 4BWGA 3KEMA 4R2HA 3KYBA 1H93A 221PA 4LPSA 1LVUA 2WTBA 4JMPA 1LWNA 4D96A 1IHDA 1ORWA 3PV0A 2DULA 4FEYA 3U4HA 3GGGA 3NJ4A 2OFXA 4O4JB 3CNQS 3G0DA 2CMKA 3GT0A 3I8SA 3QLTA 4GVLA 4HEHA 4LJ9A 1CDDA 4PCUA 3BQMB 3TI9A 2F55A 2P8JA 2WV7A 2H4JA 3Q8LA 1ISGA 2PH7A 2WJVA 4GU5A 5IUNC 5BPFA 4GWKA 1UDCA 3PXEA 1W0JA 1ISMA 2AOWA 1T6YA 3H6GA 3OC0A 4LGMA 4O1IA 4XDHA 4XJSA 3UMFA 4BNJA 4BZQA 4EF4A 3CH4B 1A8PA 2RJOA 3H11B 4IRMA 4IVQA 4JUDX 4RWEA 4TLLB 5GJWC 3CFYA 3GDOA 2NU9A 3F7NA 2V6MA 2WHRA 1E1LA 1J70A 3IOEA 1P2TA 1WAMA 2XAAA 3JQ9A 4FEGA 2YJZA 2ZTSA 3KTOA 5DNCA 1QPGA 1GIAA 2E2WA 3ZJ4A 4B5LA 4QG3A 3R7FA 3MS7A 3KLMX 3LY7A 3K2QA 4C21A 3GFOA 4EGCB 1LZLA 3HXKA 5LDGA 5H9WA 3Q40A 4JLKA 4UOZA 1LPSA 2ZUSA 1JG6A 1SVLA 3F97A 2ETXA 3OHMA 3OJWA 2JFZA 3EEIA 4QSHA 4CZ2A 2GOYA 3CVXA 4YT2A 1Z8NA 1FF9A 2CFCA 2DQKA 2QR3A 5DNWA 4RTOA 2A5DA 2B2NA 4M1MA 3ANYB 1ZUWA 3NIBA 4F2DA 5AIBA 3CLRC 4P7FA 5K3DA 2HA3A 3GW8A 4LHSA 1VHJA 3B78A 5KS2A 4B9EA 1IXKA 1PR5A 1BTOA 3BMOA 4GPD1 5IT9A 1N7GA 3U31A 2IQIA 2FETA 3UJ6A 1ZN8A 1Z0AA 2B9VA 4HQOA 2CWDA 3GV0A 2IE8A 3ZHZA 4HGOA 2Q4OA 5DCWA 5AVSA 3CS3A 1XZLA 3DKRA 3OIWA 1ADJA 1JQLB 3Q9NA 4JS0A 3BRCA 1UFVA 2JHGA 1G3UA 1YIDA 1ZIXA 1V3UA 4FOPA 3FF4A 4CV0A 3NAZA 4M1SA 3FJOA 2AS0A 5HIAA 2AEJA 3PGKA 4L4XA 1FTWA 3WGVA 3O03A 4EF5A 1QP7A 5I47A 1UFKA 4BKUA 1ZITA 4Q3KA 2YJTD 1TCUA 2CXRA 2ECKA 3FPSA 3CEAA 3UJ8A 4BGIA 5AVYA 4DEYA 3I23A 3JPWA 1YC2A 1CUDA 2W0MA 3L92A 2AQIA 3AGPA 4FXOA 3LKVA 1EM6A 1PGQA 3IEXA 2VCYA 1MAWA 3ORYA 2ZJ3A 4I8IA 3EIHA 5KQRA 4MWSA 3TD9A 3IHLA 1TD1A 3EGIA 1OKKA 5D5PA 4DJJA 2IIBA 2NM0A 4MCHA 1Y98A 3GAFA 3U81A 4X6UA 5C32A 3BMQB 1J4AA 2PKEA 4Q3CA 5KNDA 1T6ZA 3K6JA 1UM9B 621PA 1YZGA 4HBZA 4E7PA 4ERXA 3KNZA 3NRCA 4HRVA 3NEPX 5E9WA 4QPDA 4EA7A 1O5TA 1NOJA 3VR5D 4E5KA 1WXQA 4E4YA 4HAWA 2AD5A 1JLHA 1AURA 3H4MA 3NBFA 2EWMA 2QD2A 4IFBA 2C82A 4ZQHA 4F12A 1HK7A 2OCDA 5JAZA 1DG3A 4IX9A 5AI5A 4FGJA 2YINC 2I2DA 3H9QA 3B52X 4CE6A 3IHWA 2YWRA 3S29A 4INAA 3DL4A 1V5IA 4UU1A 4ENRA 4RPHA 4PG6A 3D2BA 5GOTA 1IUKA 3AY3A 3IAUA 1P4RA 2W93A 3O26A 5DTRA 4KP7A 1K7XB 4UJ5A 4KIGA 1DE0A 4IDOA 5IM5A 4ZCSA 5TGDA 1N1GA 4FYHA 1A8QA 3UJCA 4N5HX 2WAMA 3DZKA 3FI0A 4GYJA 4LKRA 3O9ZA 2XB9A 4UHKA 4LS3A 5KZMB 3A6KA 4FT2A 1B93A 1Y3CE 2A30A 5AXBA 1AZLA 2A78A 1MQ8B 2VQFB 1YS4A 2JGFA 3FYTA 4HEQA 1XAJA 1A9ZA 1KVSA 3G2HA 4RKQA 1HM5A 1EX7A 1MB0A 1VFNA 1NI4A 3QVXA 4HWKA 4A1FA 4E46A 3AOEA 1BOOA 1ZD1A 3LCRA 4BLTA 1V3QE 2R00C 3QHPA 3WGZA 1FVFA 1XQVA 1EVEA 4BGEA 4ER3A 4F2PA 3O3CA 1N6OA 1ORRA 1S2GA 2VQ6A 5GY7A 16PKA 4KI0A 2FOIA 1L1EA 3M34A 2ZBQA 4IRUB 2HBZA 1RRKA 2FZCA 1EFVB 1H1LB 1E64A 2Z3VA 3B36A 4PFSA 4Q4DA 3FFWA 5IVDA 1NA5A 1UKAA 1XEWX 2J6IA 3UM9A 4CG3A 1YS2X 1G8KA 2X6RA 2QGZA 2LWIA 2JAPA 1EP1B 3E2PA 3WLLA 5JWHA 3K96A 5JAHA 1T24A 3SI7A 3QA3E 4B87A 5CCEA 3IV6A 5K0FA 4LY3A 3BJMA 4I9HA 2SCUB 2O2JA 4ZK6A 1DJLA 4JKOA 2V74B 1TL7C 3KEQA 1KXZA 3IVRA 3R6WA 3A25A 1NRIA 5HF6A 4W9NA 2C98A 2CFOA 2BGRA 3Q85A 3T3EA 3NPMA 1DAPA 1PZHA 2CZQA 3L7IA 1OFTA 2VYQA 3T7DA 3NO4A 2WILA 4BFVA 1FXWF 1QRAA 3A8TA 1HFEL 2QU7A 3TZ6A 3I45A 1A4UA 1XLUA 1KJJA 2KPOA 1ZMOA 2H3EA 2ZFUA 4GE3A 3BZWA 2W6ID 4RPJA 3ZR4B 3IQDB 1IN7A 1Q3HA 3MWYW 4G56A 3WLKX 2KMLA 4S05A 4UREA 3SQDA 1XPUA 4W1RA 5CB6A 4RFSA 4R1PA 2OHFA 3G7NA 4HWGA 3IDQA 4BMXA 1L7PA 2YIJA 2I3BA 3TL6A 4NOJA 4S1TA 4MUHA 2W2NA 4ENWA 1NIPA 4HXFB 5KAPA 3DE3X 4MR7A 1ZXLA 2BTQA 2JFBA 9GPBA 4GZMA 4R84A 4B46A 5IAAA 1GQRA 2V8OA 4WKOA 4I3FA 1E6CA 3PE6A 5ER6A 1ODTC 1X8XA 4IVNA 4PWZA 4D6XA 3L0ZA 4ZEVA 3CXUA 9LDBA 1XQ9A 1TO2E 1Q0HA 5KOJB 4M86A 2H4XA 4P80A 4WK6A 5DJ5A 3UWOA 3N2GA 8LDHA 3FCYA 3HVJA 3VPDA 3GHHA 4D4HA 3KVRA 5KJ1A 2GPBA 3CYFA 3ED5A 4FMPA 3K1AA 3MJRA 4H16A 4GEGA 5KSWB 1RYBA 5K0SA 2FCAA 2J0EA 4PRLA 3UZUA 4IIHA 4KXXA 5E3IA 1HDGO 4Q48A 1KI4A 2D1RA 1ZD4A 2JIQA 2QLMA 2WK1A 3GZNA 3OD1A 2IHNA 3NWOA 2DUNA 1TUEA 3MD0A 3S2ZA 3OT5A 4OUKX 2GBCA 2N42A 1L7RA 4YBZA 3TZBA 3VPBA 4DQUA 5HGXA 2QMZA 3IMEA 5TIIA 5AXDA 4O4LA 3R77A 3IQEA 4HWRA 5G3YA 3HN2A 4RJTA 2GAOA 4TXNA 5TQ0B 1JDTA 4HT3B 1XZAA 2WF8A 2Z6VA 1EBUA 4O2AB 4MPRA 3EZ7A 5AW9A 3ENNA 4ZHQF 4NOKA 4RV4A 4HYYA 2FPUA 4CETA 2IITA 4DY6A 2BGNA 2UYYA 4DQKA 3V4ZA 3K35A 4UHBA 3VGJA 3EYWA 1E2IA 3MA0A 1FFGA 2FB9A 2X7JA 1XZBA 4ZC1A 3UTDA 3VRHA 4F5YA 3N87A 1P72A 3I2KA 3TB4A 4URYR 5DNUA 4P86A 4ZRNA 1R6XA 2W9XA 1JEOA 3IPLA 1A98A 1QGUA 2NTNA 3JZDA 4Q37A 2I4LA 2JIZD 4DCCA 2O2CA 1SXJA 2P77A 5KC9A 4KNYA 1GKKA 4KBGA 5BWMA 2F3QA 2AH5A 4GP9A 1AMOA 3BGVA 4LRXA 2HHAA 3QVKA 1XA0A 1C30B 1Z2EA 3LF1A 2NT3A 4XIIA 2XXAA 1T4CB 4CR6A 4GBGA 4NFHA 5T4HA 2JBWA 1NP6A 4KQIA 4XWYA 3RYHB 3RADC 3B5EA 2VP2A 2R85A 2QM3A 3JQ7B 5FUBA 2ZTLA 4R0NA 4EB0A 1J2RA 3FFBA 1YUBA 2I4TA 1VB5A 3FZEA 3LCJA 5CIWA 2GUWA 3OCZA 3UT6A 4CKBA 4EJFA 2CB9A 1C9NA 1A4XA 3NMUF 1RKBA 2AE1A 1Y3BE 2ODTX 3B1VA 5BOSB 3PB3A 1XSEA 3ABSB 3CE9A 1SD5A 3CINA 2QW1A 1IUOA 2MSLA 2H31A 1Y8QA 4ZQBA 1A2KC 2HF8A 2IYUA 4D81A 1JEDA 4XA8A 3TD2A 2VRBA 3LQ1A 1Y8CA 4IGIA 3DFZA 1EXMA 2VSYA 1P7VA 2JBAB 1ZOIA 4ER6A 2OL4A 3H04A 4MVJF 2BMFA 2IYAA 1PR0A 3CO5A 4P83A 3TIIA 5AHXA 1CULC 1IATA 3B1YA 3SF0A 4DDWA 4D9EA 2FXIA 1XRSB 1NJ6A 1RZ3A 1C8VB 2RK6A 3SX0A 5JZ9A 5JVDF 4QUGA 1L7DA 2X2FA 2V1UA 4NZPA 1VXRA 2GPTA 3ZD9A 1POXA 3JYOA 4LECA 1FNCA 1TXGA 3UK7A 3WIDA 1ECJA 1NN0A 2N75A 4YRCA 4C7KA 2A94A 4RYDA 1TO1E 2R84A 2R96A 4MP8A 1MNQA 4BJ1A 4DCMA 1W34A 3I2FA 1H2AS 5JWOA 4ZT4A 3O0TA 2AFIE 3AJ9A 3K5IA 4B4OA 5M5BA 3JXEA 4BVGA 2XKBA 4D41A 3KOUA 4LRTB 1QGDA 4EATA 2V5AA 4J2OA 2VJDA 3HCCA 1TTQB 3EVAA 3OM0A 4GPBA 4M1QA 3IDAA 4CHTA 1GFWA 3RF7A 1DMSA 3GRCA 4GQBA 2WFLA 3QV1A 1I36A 4YRPA 1P31A 2A5JA 5CVUA 5EJFA 3IEPA 3T41A 5BUZA 5EJ8A 1HZJA 4KXMA 2XUZA 3AR6A 2A58A 2F1OA 3NP7A 2CHGA 1KERA 4BPBA 4E03A 3EWAA 4JVNA 1EM8B 2JFWA 7YASA 3A4LA 4C9BA 3EASA 1P2SA 2IEDA 3S2IA 3A37A 3IT3A 4FYPA 3H7AA 2FSIA 1LPAB 3BGDA 5HEKA 1G8MA 1B16A 4WY8A 1U8AA 3GDGA 1KDYA 2I6FA 3GIWA 3PHIA 1LC3A 2HDHA 3C45A 4BQFA 1Z0IA 1LTHR 1XCOA 2QPAA 5ESXA 1GVNB 4YRKA 1S3GA 3MMPA 2DUJA 1SB8A 2JK1A 2QY6A 1R6UA 3ICCA 3QKWA 1GN8A 3RHSA 3OFND 3VU9B 1T35A 2NTYC 4NDAA 1G16A 1XL0A 1AKVA 2XQGA 5EIOA 5CHEA 4DT1A 1IBRA 2JA1A 4ZZ1A 3E0QA 4NZZA 2FPIB 2IV3A 2BGKA 3A4VA 3IAAA 4H4EA 2WNSA 3L4BA 3LBYA 3TVYA 1UBJS 1USKA 4P7JA 5KQMA 4PAWA 4BX0A 2VG8A 5COQA 2OZPA 1DELA 3QFCA 4IUBS 5D7BA 4ZT3A 5KNLA 5E2IA 3UICA 2NZ8A 4KO8A 3LRPA 1PFKA 4N5MA 2NU6B 4JXXA 5BUCA 2QE7D 4KACA 1FU7A 1TK2A 4NYJQ 3UEOA 1SKMA 1Z36A 3PFKA 2JGIA 4Q01A 5DM70 1PQYA 1QRUA 2DQYA 4FOLA 4TROA 3K6SB 1EK0A 4NBRA 3HXQA 1KSHA 3P4YA 1DZ3A 2QBYB 1LA2A 2Q3JA 2VJMA 1RI1A 3N6XA 1EK5A 2BDEA 5F78A 5IJ0A 1L3IA 5EZYF 3NWBA 2GKOA 4OM7A 5JJBA 1JHVA 3DFIA 1RC1A 2Z43A 4L1KA 2LR0A 3QVGA 4DLAA 1TU4A 4BVEA 5ED0A 4D8XA 1KH2A 2NO7A 3BXZA 1Q17A 2OHJA 5T8KA 1PZEA 5J4YA 4ZKEA 1CV2A 3KVYA 5FNZA 3ZKAA 2VF2A 4MICA 1PL6A 1V8OA 4ZCLA 1H6DA 2C4MA 5JSYA 3EXG2 4DCGA 2A0UA 1UJ2A 3JAKB 1C7FA 1NGSA 4L15A 3CCFA 4OXKA 4Y1RB 4I9FA 1I51A 1AQUA 1I7PA 1ZYUA 1GZHB 1K9VF 1U7HA 2LXNA 3GRVA 2G82A 1SCQA 2VDJA 3PXBA 2OFOA 2HTFA 3UFBA 1RRPA 4P35A 4HDOB 1MAHA 3ESYA 3O2NA 3VH2A 2YX1A 5JDCA 2YFHA 5AO9A 1B8UA 2WTUA 2JLXA 1HEYA 5ARBA 1XPOA 3AI1A 4ZCIA 3IQZA 1OAOC 1WXDA 3CX3A 2XYHA 3GVXA 3Q3GE 4MB2A 2ACWA 4MW7A 3L7NA 4Q03A 4EVIA 1T8YA 2DZDA 3GRKA 3FLBA 2PA0A 4NNOA 3VHRA 2WBLC 1OBFO 3IBYA 3U60B 4RF5A 3HABA 4QA9A 1VLQA 3NATA 4MGZR 3Q7IA 3DHVA 3I12A 4KTVE 2R5WA 3IUPA 5SY9A 2OV1A 4F45A 2WMYA 4Q12A 4YRGA 3O4RA 5CCXA 4PFQA 3PE3A 3EIOA 3PGLA 3KQVA 4PC6A 4QTUB 2PUDA 3EGOA 1WQ1R 4I19A 3GPBA 3K9LA 1U4OA 2OORC 3THWB 4QREA 3UT0A 3OZGA 4AJHA 4CKCB 4BVAA 1JW9B 5KO2A 4ZCQA 3D4PA 3I6MA 4EWLA 3E3MA 1T1GA 3Q41A 4KN5A 1RJ9B 3KJQA 3KFLA 4MYDA 2QTBA 3A2LA 3I2IA 1EBBA 1VE5A 4WEQA 1LQTA 2ZIEA 2BELA 3M1IA 1XLTC 4AG6A 3EDYA 4WKBA 1GQYA 3FUUA 3IP8A 3ITKA 5HIJA 5IF9A 2ZBVA 2I9PA 5JYDA 1PJBA 1FNNA 2IDZA 3SPXA 4BO5A 4EDFA 3L1KA 1SCUA 4BNDA 1TW2A 3LXMA 3MS2A 5F1PA 1U6IA 2NZYA 4B6PA 2VDUE 3GRRA 4H7HA 3THYA 2CNWD 5EMMA 3TUIC 4A8PA 4P53A 2B37A 2OG1A 1HH4A 2QJRA 2EKZA 3ICPA 3DVQX 3T6KA 4DTIA 4PFJA 2NV0A 2XGGA 4W1PA 4EQZA 1C0LA 4W7IA 2C9OA 3N2KA 3IQGX 1JWLA 4NMLA 1MPTA 4IG9A 1NULA 5JMOA 1H2BA 2BT4A 2NU7B 1JS1X 3SC2A 3MWDB 4GFDA 3MJ4A 4LJRA 1AKEA 1XAIA 1UBEA 4R9RA 4A8TA 4Q4JA 4CEHB 5CDYA 2FQXA 1VBNA 2Z2IA 2FUNB 5L4SA 4NV3A 4Q7EA 2BLLA 4NECA 3U4GA 3UJAA 1QGZA 2VJBA 1C4WA 1KK2A 4UAGA 4HNTA 5CXQA 1E9VA 3THXB 1GL3A 1E2GA 1RAAA 4EK9A 3GA7A 2RSLA 2DMRA 1YJQA 2IRWA 1PT7A 5B37A 3ND5A 1AO3A 2WTMA 2WYUA 4LJ5A 3BORA 3DPIA 4AJLA 4CWAA 2AXNA 1NU8A 1JRLA 2UXBB 1A3CA 1OIWA 2D2XA 2XYGA 3FLEA 5G0UA 3STTA 3UQYS 1MA0A 3V00A 4QGSA 4ZYTA 1P3Y1 2D5AA 3NGXA 2DT8A 3R8XA 4MAAA 1RYFA 1KAMA 1V7ZA 2JCVA 4G01B 4QJBA 4RXTA 4UFOA 2VUIB 2QMOA 3HJHA 4IDPA 4INZA 1TEHA 3FF1A 4ND2A 3SX2A 3ZZUA 5F52A 2IA5A 4HLCA 1YGPA 1PFGA 1KOJA 2QP3A 3HYRA 3WADA 1N8NA 2J87A 1AU9A 3FWPA 3V8MA 3GAAA 3IVAA 1E79D 2O1WA 2X0KA 3KPVA 5LZ5A 5SY4A 2NVWA 3ETLA 3T5TA 1XWIA 2HRZA 4KN9S 1BW9A 3BJIC 3TNJA 3TSOA 4EFMA 3PUIA 4ZQEA 4YJHB 4BKRA 3JYQA 5DPMA 4BBJA 2P3LA 2O2GA 1FDTA 1Y3FE 4DB2A 2HMAA 5EP1A 5BNFA 1CWUA 2IX9A 4KDFA 2PUJA 4FNAA 3UIEA 3OESA 2MINA 1C41A 4WKCA 2ERXA 1M2GA 3V3KA 3A6FA 1X1SA 2AFIB 5F2KA 1Z88A 4QBTA 3O1IC 1IHOA 3HP7A 3Q3HA 1HTTA 5LYYA 1DINA 3ILHA 5AK4A 1Q91A 2B3TA 3IUEA 5HFJA 4EHDA 2VYND 4NONA 3KL4A 3UGKA 3ZI0A 4RZSA 4KTTE 5K0ZA 1DO8A 5FWYB 1T6XA 3CUKA 4OYLA 4H7IA 4OP2A 4YAUA 5B7PA 4Z9BA 4HMQA 3ZBUA 1CDOA 1RM4A 3LI2A 2ZUVA 2JFXA 1OAKA 1JZTA 3EHDA 3HYSA 3GJ0A 3UOAB 4EG6A 4ZAVA 4DANA 3S8YA 1JR3A 2AC7A 3DP9A 3Q7TA 5CU7A 5TMDA 2DFNA 2VDOB 1NAIA 3A04A 4G5OA 1QC5A 1NVTA 2HC9A 1HXHA 2PSSA 3AERA 1BWPA 3DHNA 4HDCA 3R7SA 3ZS9A 1A7AA 4V0KA 1ENYA 3C85A 2D5LA 2PU7A 4UMVA 1WY5A 1ZCBA 3CC8A 3QEJA 4MW6A 4GP7A 1QHIA 4X6LA 5LLSA 2PGOA 1QZXA 2X76A 1FJ2A 1SRQA 3PI6A 3V2UA 3D8SA 4C89A 4DC1A 1BD3A 2ZI9A 3CN7A 4NV0A 3HDYA 3P2KA 4IAOA 4CFYA 2F1KA 2J4DA 2DPMA 3IV7A 3W1EA 4NQZA 4GMKA 3ZU2A 3RWOA 1R8QA 4ZYZA 4EABA 4QTXA 1NONA 3O47A 4JEIA 1DBPA 1FQKA 4IV5A 4JENA 1TM7E 4KSCA 2O0KA 4G5XA 1L3BA 3FTDA 5CHYA 4DSAA 2MSEB 4PX2A 5JAIA 2IUEA 5LYJA 2CLDX 1DV2A 2X6QA 2DPXA 1CRZA 2PJRA 3B6ZA 5LP6F 1YU9A 2Y6VA 2V54A 3K9HA 4PWYA 1BEZA 2AF4C 2OCLA 2WE7A 3BULA 3BL6A 4EYQA 2RHTA 5F21A 2BJVA 3HTXA 1FNSA 3C1TA 3A9CA 3GEIA 3I0NA 3U9SA 4OOFA 2Y0BA 1FX1A 1DAMA 3GUYA 5JH7A 4BBAA 2X19A 4FGSA 2WSYB 1C0EA 3O5AA 3EUFA 3ZHRA 4ENTA 1KH3A 3VKUA 3I37X 3TMKA 5GZ1A 2AN5A 3R0XA 2B20A 4FHGA 4NK4A 4Q9KA 4YREA 3T9EA 2YH2A 3B9BA 2FZ5A 1FDIA 2Q2QA 3ZY2A 421PA 2OGWA 1P1RA 2CC2A 1QIJA 2N9UA 2H9IA 3G9TA 1WVGA 3LDFA 1ZSYA 1KDOA 2XWQA 3D1JA 2C92A 3RODA 1JL3A 3EQ2A 1V37A 1IQ0A 2V4ZA 2H1CA 4DLVA 3I3OA 2A1TR 3CJQA 2HJWA 3GRFA 1SC4A 2C5SA 2DVMA 2Z5LA 3OE4A 2OVFA 3L79A 4PO8A 3BD7A 4TTIA 4F8JA 3KVOA 2ZUWA 3TM4A 1VJRA 3TEJA 2O2DA 3HADA 4J0JA 2Y3IA 5HUHA 3U4QA 1OXTA 2KI5A 2INGX 2JAXA 2P30A 2WVJA 3P9ZA 4LHXA 4RGQA 5D7NA 4BGDA 3AB8A 4NULA 3EPPA 5CA1B 1XHLA 1PT9A 1GSIA 4YFVA 2H16A 2E5LB 3MCUA 3WFZA 1ND6A 1W8IA 1WEHA 5JAPA 5ALNA 1SOWA 2J4FA 1L4YA 3DUFB 1KKLA 3L7LA 1GGMA 1WNFA 1XZGA 3CZ9A 4OJNA 5AI8A 4D43A 4ZVNA 4L02A 1CQIB 4F56A 3H2SA 3N74A 3DHEA 4YHBA 5EE9A 5DBGA 1GG8A 2AJLI 1SURA 1Y82A 2C88A 1RWMA 1XP8A 1IUPA 2Q2VA 4JP2A 5CNIA 1UCFA 1LK7A 3L49A 4L5JA 4BWVA 1KGSA 1Y7PA 1L5SA 1JQKA 1U9ZA 1DC5A 1WUHS 1O0SA 3BRSA 1EJ6A 3KQTA 3ZDAA 1U3FA 1GEEA 4OEHA 2DAPA 1SOVA 4NENA 1FYWA 5H9VA 3E3LA 4DDHA 4PIPA 1DV1A 1E59A 3C3DA 3JZMA 3FY4A 5IZCA 2ZYGA 5DHFA 3TSAA 3ZQ6A 5EHGA 1DDOA 2QNRA 2XBLA 3FKQA 1KP3A 4KSYA 2FUG6 1C7QA 1G8YA 2HRBA 2Z0MA 3HZZA 4WBXC 3UJDA 4BLRA 4Q19A 1UBNA 2BFMA 1P7CA 4HAUA 1AN0A 2P6PA 1Q5PA 4FR0A 1ZX1A 4D6YA 2HT6A 3CVYA 4MVJP 3TAXA 2JFQA 5HQ3B 1JFFB 2BPOA 1SHJA 3RBAA 3GYGA 1Q11A 3CLTC 1WW8A 3L1JA 4L0CA 5LBTA 1G8FA 3FHCB 2Z58A 4EAAA 1X92A 1OYVA 2IUSA 4HDRB 2JZCA 3B70A 1U1CA 1RMQA 1YTLA 1MH1A 2DPLA 1QQAA 2P9GA 1HDRA 2ECPA 1JIJA 1WWKA 3FBGA 1ZL0A 2BMJA 4LXTA 1CT9A 3BCHA 1ODCA 5JUWA 2O8DB 1YR8A 2HKIA 1AZTA 2L82A 4MGKR 4E7OA 4DUZB 3JR3A 3KJFA 5CX4A 3ADPA 4QO8A 1E4OA 1IG0A 1B3RA 4RF4A 3DKVA 2B4KA 2OXRA 2RBGA 3L9XA 2XT0A 2F8SA 4RFLA 1WV1A 3FDZB 4JUIA 1XALA 3EEBA 2AZ4A 5BNZA 1FLNA 4XWKA 2BGGA 5DGCA 4URZR 2Y4OA 3MIZA 4HTFA 2HMTA 2VBFA 4RFVA 5IS2A 4FE3A 2R8BA 5IAGA 1UWVA 5B30A 5AVVA 1NUTA 1ZSNA 3IAS6 3PRKE 4HF7A 4B6OA 4YCLA 2F59A 3WJAA 2PIDA 3PWTA 3QTBA 3KZOA 2AK2A 2BI8A 1CJTC 2H2WA 1U65A 1XRRA 1FDWA 1ZGJA 2QRZA 3C74A 4JGGA 3ON5A 2A0XA 1GGKA 3AUKA 3GU3A 3STXA 5CH8A 2YCLA 4GMDA 3RIXA 1U7DA 2QTVB 1YKSA 2HWXA 2AOVA 1HO3A 3NRJA 4DBVO 3KBOA 2Q1XA 1UPTA 2OMKA 3B48A 4G5RA 5IDYA 2ACVA 1N2EA 1HYGA 5F12A 3B6IA 1GGHA 2GRAA 3NB0A 1YVDA 2GN6A 4IS2A 4UHFA 4NICA 4QO7A 4PYJA 3U1TA 3COJA 1NJ2A 2FPWA 7REQA 4HEJA 3KVNA 1HOTA 4MR8B 1W0KD 4DJ5X 3ZDBA 5LIPA 2JKYA 1R0KA 2QXTA 3E9CA 3ESXA 1NVVQ 4P0TA 1BE0A 3ACCA 3PUKA 4Z4QA 1E1CA 1URPA 2OOSA 3W2HA 4CPDA 3HJGA 2X1MA 4Q82A 1YK0A 2DETA 1H5QA 1O6FA 1W581 2NUPB 3DO8A 1DBSA 2Z8YA 3VYSB 4OP1A 5FPTA 4C4RA 1JDJA 3L4JA 2HSEA 1K1EA 1VXOA 2RAFA 2VEDA 3OBIA 4JJGA 5JYCA 2H7VA 1PJ4A 5KTYA 2AI3A 1JILA 4CTKA 3P9SA 4NBUA 3ACDA 2W2LA 5AJVB 1FFEA 4Y2QA 3R9XA 3P26A 4PHGA 1W4LA 1E6WA 4RK4A 4RA9A 3UGQA 4LGCA 2V7TA 1CZHA 3K9NA 2H29A 3MGAA 4NZOA 5U4QA 3TZCA 2NSJA 1J0EA 1U0LA 2A33A 1T8TA 3SZOA 2MHCA 3ADBA 2FPKA 1VIMA 2QN8A 3BJEA 3JQQA 2CD7A 3ROTA 1C9EA 1D2CA 1TRKA 4CQLA 5BMVF 5FH9A 1NVEA 4X41A 4HUQA 3O8BA 5CLFA 2CNNA 2WQ6A 2VJCA 4M1TA 2OKCA 3KHUA 3JVVA 4EG4A 1RXYA 1PLLA 4K46A 1CPYA 1BVYF 2W83A 1I4DD 2FLWA 4ZHSA 3B8HA 1O96A 3HEBA 4EUFA 3QA9A 4FQ7A 4O4IB 5EUBA 4RAOA 4KR9A 1VBFA 1NXTA 2PZJA 1AK9A 2O9JA 2VN8A 2A5GA 4LY6A 4GPZA 4M2LA 1JPUA 4FW9A 4QQNA 1L4FA 4E22A 1WW3A 1QM5A 4FXPA 4DL9A 4QC2A 4RZQA 1R4NB 4ZTUB 5CM2Z 1C4KA 1A76A 4NU0A 2BKUA 5D5QA 2HBRA 1QK4A 4C05A 2JHCA 3D4NA 1BDHA 3DTVB 3QEMB 3IE0A 4ZKDA 4K0RA 3LD9A 2C99A 4BX3A 4D4IA 2QSUA 4M53A 1P18A 4DIMA 3MCZA 4DA7A 3OPYI 5FLKA 4GOKA 3P71T 3ACBA 2E4WA 3CF2A 2IXAA 4IO0A 2HT1A 2E37A 2CBZA 2AKEA 1T34A 5GM2A 1IAQA 3K0FB 3DOUA 1U4SA 4JYBA 1N9GB 1RC0A 1YBMA 5JNVA 3OE7D 4KQ9A 3CF6R 1JDPA 2JEZA 3DXXA 3K30A 1E1RD 4FU0A 2NNWB 3QXJA 1Z7YA 4RD4A 5G4KB 2C31A 2DOKA 3UKJA 3Q1KA 2W22A 3F5FA 2D8MA 4GYKA 1QS0B 1P4GA 2R2GA 3EY9A 2WTAA 5JCXA 4C76A 2EG9A 3NYIA 4CLOB 1W19A 3OQMA 4IF4A 5FORA 4UM5A 1KNXA 1XTTA 4FLFA 4QOFA 4HFNA 4MHSA 5U9CA 3E53A 2AW5A 4ZFNA 3KC2A 1E63A 3LP6A 3ABRB 3R41A 2Z9DA 4ZANA 1AV6A 4M1YA 1FS4A 1QUEA 4P1ZA 5DT9A 4I5EA 3F6SA 3GJRA 4HWSA 5B12A 3CR7A 1GAQA 1ZD9A 2EFEB 3VI4B 1M54A 3ZK9A 2FRXA 1LFDB 5ALXA 3KT0A 1VPWA 4EY6A 4ZJPA 4Q3NA 5ILOA 1J8MF 1VCIA 2FWPA 2Q1TA 3AXSA 4HB0A 4DV5B 5FBVB 4W6ZA 4IHQA 1Z16A 2G76A 3UW3A 2P9ZA 3KR0A 4YR7A 2DRIA 1LZKA 2Y71A 1MF7A 2FEAA 2YV1A 3JYHA 4ABYA 4ZVMA 2VF8A 3O8QB 3SR4A 1RAHA 3PC8A 4BZZA 1OHHA 1IIBA 2XVXA 4JXKA 1NTOA 4TPKA 5E8RA 2IHZA 4EFKA 1Y6FA 3C3MA 5I7HA 3OU6A 3WK7A 4M1EA 1L5LA 1UFOA 1IB0A 4TMFA 4M8SA 4KIFA 3MTAA 1A9SA 2O8NA 1UPXA 2CEKA 2XD4A 3QOYA 3ZDYB 4AS1A 2PV7A 3DZJA 3KXDA 1NXSA 1MN6A 3E7DA 2QRVB 1KO8A 3WGHA 5CH3A 5EWLA 3GCGA 5T4EA 4URXR 2WDZA 4ZCPA 3KYCB 3ZGLA 5AMXA 5F98A 1GGEA 1S1MA 1SMKA 3HB9A 2Q6KA 5K6RA 2KBEA 3P2IA 2FMTA 3NEJA 3R5TA 4LRUA 7ADHA 2VRCD 2COKA 5CT5A 4Y6LA 3WDLA 1W0CA 4KO1S 3M6VA 1SVKA 1ZH8A 2Y9PB 2N47A 3ZX5A 4PRZA 1R6BX 3O74A 5JARA 1ZISA 1FUEA 4L27A 3VMFA 1CCWA 5F1YA 1KHTA 1M2VA 2ZVDA 2IEYA 3BK2A 2ZAYA 2QHXA 2WJIA 4J90A 1K5PA 3G5MA 1JG1A 2NXNA 2WJ4A 4UAVA 3RHZA 3TOCA 4ML3A 2EJUA 1T9CA 1ECBA 1U5BB 1QG0A 2QX7A 4R1OA 1U3CA 3H6KA 4A6DA 5CB4F 1I4OA 3MERA 1AKNA 2AW3A 4GM0A 2YV2A 1U98A 2PU5A 1IZ0A 1A96A 4ZVUA 5ERGB 4GZ6A 4TLCA 4ZA2A 1JPJA 2GJ8A 5IU6A 3FUVA 2AN3A 4LV5B 4ND4A 4I14A 4UTVA 3GPLA 2QQ0A 1R0SA 2AMVA 4KC0A 1QHGA 2C59A 4A7PA 3K0AA 2QZPA 5DO9A 3G1WA 1YD7A 1DWPA 1MZVA 2VF5X 2F62A 4JMLA 1NYRA 3EIWA 2VJYA 2YXDA 2DLNA 4RHTA 3RJTA 5KI6A 1Z22A 5ALSA 3FTPA 2AOTA 4J2TA 1CIVA 1G4HA 2P9HA 3WISA 2M1ZA 5DRTA 1JU3A 1B0UA 3HCAA 3OZFA 5E4FA 1CRLA 1ID1A 4UNPA 4B0PA 3RVLA 1KFEB 3LBNA 1IXSB 1AQNA 4DMMA 3ICWA 3PIDA 1CQJB 3A6ZA 4LBVA 4ZI7F 5KYTA 3LTEA 3OBBA 1DO0A 2GD2A 3TL3A 3P0HA 3TQCA 3PQ5A 3UUWA 1V2GA 2ZVQX 4AZ0B 2E1PA 4N01A 2AR7A 4DLWA 5F23A 2DFLA 3A9TA 4JOCA 3BE4A 1L5VA 3B20A 1VJCA 2R48A 2QF7A 4D4LA 3H86A 3SLKA 4I50A 1MV5A 3UNXA 2V3CC 3FVVA 2A9RA 4KZKA 1P1BA 4RKRA 3GLVA 5CFMA 3G8DA 1DRJA 3PXCX 3R2JA 4G25A 1J9GA 1NPTO 1E2HA 2F7SA 1YWGO 2FRDC 3AVQA 1NBAA 4QQRA 1THTA 2YJ3A 2Z3WA 2H1IA 5IH3A 1CNEA 4AJPA 4DV0B 1YVUA 2ZQ5A 5C7OO 1CD5A 5BWLA 3AEKA 4LDZA 4HUJA 1O95A 4HSGA 4CDMA 3IAHA 5EP4A 4OU5A 1VE6A 3EZYA 5CTAA 3WIOA 4AKEA 1RM0A 3P9KA 1EHCA 2XD9A 3GBPA 1WBBA 2A0WA 3B5IA 4IQ0A 4KJXA 3DFMA 3P2MA 1GY8A 3AVVA 3NLLA 4X94A 3P0JA 1XTZA 2C3YA 5EJMA 3OY7A 5GIOE 3E8XA 3FH0A 4FT4A 4I6JA 4H15A 5F76A 1JXMA 1O5OA 2QMQA 3MB5A 3M70A 1FYXA 2KWIA 3A1VA 3N6RA 4JLSA 4QJ5A 5I9LA 3CJRA 4MGIR 1A9RA 1C3XA 4TTRA 4MWEA 4H1VA 2OECA 3QUCA 4PO3X 1O58A 1KK1A 2BZGA 2WOOA 2DY0A 1TZCA 3K2EA 3GFPA 2V7XA 3K1TA 5L9AA 1L4HA 1H3FA 1JA0A 4IVRA 5J43A 4P4SB 3I83A 1GZDA 3G6WA 1ORTA 4E6PA 4PC3A 1NWCA 3E3OA 3U16A 3A9UA 3FPJA 1DLIA 1DAOA 3F3SA 3KHTA 1VL8A 3NOOA 1X7WA 4GLJA 1SK8A 3PHGA 3T7TA 4MCJA 3WK4A 1E1NA 1Z4JA 2PJZA 4TV8A 4WPGA 4WCFC 1EUDB 4LZZA 3UMCA 4BNNA 4DC0A 2C2HA 3PC7A 4AUKA 2FK8A 4PZUA 2BFPA 3HCEA 1QH1B 2B1GA 4FKBA 5HG0A 1T4DA 3V1TC 1JLKA 3VHXB 3G89A 2HU5A 2PXAA 4PE5B 5CURA 1IVYA 5DCUA 4YUYA 4PVCA 5H68A 1FTNA 2OAGA 1YIOA 1OJ7A 1E0SA 2VA9A 4HNRA 1NLUA 4XUCA 5IKXA 4I1PA 2WJ3A 1RZRD 2Q5LA 3OO1A 2NX2A 1C9MA 2GSDA 1FFXB 3CRVA 2LUOA 3NT5A 4E21A 3K9CA 4MS1A 2JHPA 2YVAA 3GJ6A 4BN5A 4ZOCA 1QRSA 4CCAA 3C4VA 2PXHA 2HWKA 3PNKA 4CV2A 1EFLA 2JGKA 1JLMA 1FZTA 3JAWB 4BOYA 1L8OA 4YQZA 1KQ3A 3C3CA 1R0CA 3V9PA 3R0JA 2VBCA 4E30A 3HJFA 3I01M 2A5YB 2ZSDA 1NW7A 4JT8A 4C6HA 1QE0A 2VJAA 4NFYA 3RAGA 2X0NA 4ARUA 1XZDA 1Z7BA 3ERCA 2SICE 3HUUA 4YAEA 2VO1A 1PDOA 2JRCA 3U5ZB 5CIQA 4MDFA 2Y9MB 4QICA 3WMRA 4D3SA 1DJQA 2QQFA 1CP2A 1HSZA 2QG9A 4NBVA 1N6RA 1Z37A 1EZZA 3EVDA 3F4KA 3PHHA 2FX5A 1EBFA 2BMEA 1FVHA 3OIDA 1N1EA 2WF7A 2V98A 4OL9A 2VLIA 2Z4SA 5KX5F 4E2FA 2BHLA 3A6EA 3IS3A 5REQA 1A5AB 2NTEA 5AHKA 5AM1A 5CNKA 4LZOA 5C52B 1G21A 5FAXA 3WB9A 1T9DA 3ZW7A 4XPZA 4PVDA 1JKJA 1UZMA 3HU3A 4OG2A 3OOEA 1ETUA 3NC4A 4L9SA 5E9AA 5JSZA 4FGLA 2V45A 4UFPA 1SQ0A 2R25B 4IOJA 4QDUA 1MTOA 2HX1A 5CLQA 5CW1A 3PE4A 2DERA 2H63A 1QAMA 4G8BA 4A0QA 3DDCA 4JHLA 2NO6A 1ZH4A 3R5KA 3VMMA 2BP7A 4M1WA 1EFPB 1P6UA 5FWAA 3AF2A 1YA4A 2CZCA 5FD8A 1U2TA 4RANA 3ECCA 4UMEA 2I6TA 2YZNA 3P0FA 5FOTA 1T5IA 2H1FA 2ONCA 3K92A 5B3LA 4EY5A 4BUCA 2I4OA 3SQXA 2HBQA 2OM2A 3IP3A 1K66A 5IKEA 3E5NA 3N0XA 1TJ5A 4N7JA 4X7PA 1THMA 2NYRA 1DBWA 4FEAA 5IBPA 4BFWA 5DN6D 1H1DA 3HFJA 2JATA 1LNZA 4QULA 4BJ3A 1EA5A 2BF7A 1ADCA 5FL3A 3SQLA 1IY8A 1OVGA 3HYNA 3HK2A 2Z2YA 2C95A 1QCDA 3U5TA 1BJKA 2VNHA 2C7RA 2V7VA 3PFGA 1WPRA 3NGLA 4PLTA 3DZIA 3QOWA 4G2TA 4EY7A 1KEEA 5L6LB 1SIBE 3LT4A 1DC7A 1DEXA 2Q9AA 3DV0A 3GFBA 3BRWD 4FX5A 4HNAB 4RGBA 4UE6A 2W70A 5C7LO 5JNTA 4MVJE 5INTA 1VL2A 4II2A 1LI7A 1Q83A 1KVQA 1CJSA 2QMYA 1FP4A 5GJBA 1LLCA 4KV7A 4LDRA 3B38A 4PPGA 3RQSA 1U2GA 1BYIA 2CNOA 2I4IA 1NXQA 1XJCA 4RHXA 2P9CA 2C03A 5IYZF 3W5VA 1JKFA 1ZA1A 2NYVA 1XCPA 4GVPA 2WJHA 4JJEA 2P9JA 3AF0A 3ESAA 4OAQA 3ZDFA 1VPVA 1JV2B 5J2TA 1X1DA 4B35A 4H1HA 1FP6A 3QUQA 2YW2A 1SUWA 5A6SB 5E6SA 4G4SO 4CTOA 3VKVA 1PKXA 1JP7A 4FDTA 3NT4A 4YR9A 2Y0EA 2H8KA 2JW5A 2PL1A 2XB6A 2GLUA 2Q0XA 4N3GA 3SYTA 2FSPA 2O3RA 3L1UA 4DY4A 5K0LA 1QDUA 3X43A 4A73A 1IOZA 3I04A 1XOIA 3FWYA 2WJPA 3LCUA 4KN6A 4LSMA 4MS4B 2NO4A 1T0UA 4TOIA 1WOMA 3G88A 1XCMA 4X1OA 2B98A 4DLTA 4EF6A 2O3JA 1XIVA 3ELYA 3RFFA 2IODA 3O75A 4IIBA 5LWQA 4YI5A 2OAEA 1H0SA 4ITRC 2MT9A 1XDBA 4J9VA 1AK1A 5HMMA 2GK4A 2REQA 2XGSA 4J4HA 5ALUA 2GK3A 1NX9A 2C5LA 4JJFA 4R1TA 2DHRA 2V7GA 3R8FA 1Q1BA 1EFHA 1KE2A 3NKLA 3CRNA 3D2CA 1R12A 2C8JA 4X8OA 1IM5A 4JDUA 4AKSA 3L7CA 2CYAA 1CUXA 2ZRPA 3F3KA 4BO9A 3E3NA 3KOZA 2I6SA 3UH0A 1K4YA 5LL6P 2B7BA 2UYHA 1RADA 1XJQA 1L2TA 5HGJA 1ZWLA 2J9GA 3IQIX 8ADHA 1O08A 3ZKWA 2WB2A 4U2GA 3EXHC 5BQOA 2C5GA 3PQ6A 4YJ3A 1BXZA 4I66A 4EQ6B 5GMOA 5HQTA 3T5PA 3TLKA 1HC7A 2UUAB 3KKEA 4UUBA 1COWD 3OT4A 2XLCA 4TWBA 3RARA 4C03A 1N5KA 4F6CA 2VQEB 3RC8A 4RLHA 1NTRA 4GX1A 3ZDEA 4Y2SA 3I9LA 4JP1A 2A4MA 1PQPA 1Y3AA 3RR2A 2WPDD 2I87A 2OBLA 1LV8A 1UAYA 3HB7A 4OXQA 5E9QA 2YTZA 3S44A 3SDZA 2WVAA 1CIPA 4B75A 2YWEA 3GOQA 5KJFA 1R4MB 1DEAA 2AG1A 4HDMB 4UVGA 4AN1A 4PSKA 3KYDA 4AQYB 2YQZA 1V5GA 1XCBA 5DNEA 2PYIA 1GR1A 2VBIA 3LNCA 4FP9A 4M7OA 4YROA 5L3SA 2OCXA 4G5YA 1JSRA 3PU6A 1U0NA 2ZAOA 3OZDA 1NXWA 1H85A 2OBBA 2CFIA 4PPNA 5ELXA 3T1OA 5HCIA 3LKDA 3VZQA 1G8SA 1M1YE 2PKQP 3TAUA 4UCFA 3LPDA 4F2WA 4RZ2A 2IYSA 1Y8ZA 1UEIA 2AFHA 5LR6A 4PQRA 3PKJA 2JJ8A 4QAJA 5CD9A 1PD1A 1R6DA 3GNQA 1CEQA 3AEQA 1F06A 4CKWB 1OAOA 1KFKB 2O2EA 3UWSA 1GGVA 4UVHA 4JIGA 1NJ8A 4G9EA 2O5EA 2PZLA 3A10A 4KJZA 1BJTA 4RA6B 2Z95A 3G2OA 3SF8B 4QXAA 1TYCA 4JELA 3KYIB 3U3DA 3RFTA 3UMJA 4BUZA 4ZOLF 2TECE 4KITB 3JQCA 1DXOA 1FUYB 3AMVA 3LUCA 2Q8NA 1IZ7A 1SPXA 3HCNA 5KOYA 3S2UA 2I65A 3WKBA 4JQYA 2PL3A 1YMQA 4YDRA 5DHRA 4RKYA 4FS3A 3NYWA 4AJNA 3F8WA 1I4EB 2JLAA 5FFNA 3RGGA 1YKGA 2NV6A 4CI0B 1WSBA 1OUMA 2H57A 4YCJA 4HY3A 3HS3A 1QFYA 4IDNA 5AK6A 1G1AA 9LDTA 3M6WA 1Y9JA 4KQ2A 2IGTA 1TVKA 1R6TA 3GLHA 3TTTA 1RE0A 2XZLA 1NLFA 1QU3A 5JNSA 3DPSA 5H3LA 2GYUA 2JIOA 4J1NA 4IICA 4RVFA 4UNQA 1EK6A 3RQIA 4ZXPA 2C9CA 1J33A 5E1BA 5DBHX 3PFCA 4GD3Q 4EI2A 2JGAA 4ZCTA 2V5VA 3DDHA 2DU8A 1MUUA 4RTSA 3A1SA 1YHNA 1KY5A 4YHHB 3BMCA 2REBA 1DIRA 1UMKA 2EF1A 3N0RA 2CMGA 1WCV1 3OZ7A 4PQFA 4UUAA 5KU1A 2GEKA 4RACA 2YJNA 3VSAA 3WG9A 1R18A 3ZVLA 2P4HX 2GPNA 3HE3A 3P9RA 4HQLA 3QV2A 1BQ3A 4HL6A 5IT0A 3GBVA 2BKLA 2E6KA 1Q1QA 4KX3A 1B43A 2A35A 3CPHA 1YS1X 3VVLA 5I7FA 4ZHQB 2FPGB 3DOOA 4M38A 4TXMA 3REQA 1HE4A 2OKGA 2G4LA 2QM8A 2GAJA 2ZRJA 4NPAA 2ESRA 1AKUA 3JWHA 4UUNA 2XTAA 1UBKS 4L85A 5DIFA 3V8QA 3VGPA 1YI8A 2JCBA 3FYUA 3M82A 4OM8A 1U02A 4H18A 4A6PA 3NIGB 5A03A 2XRFA 3PLRA 3RRFA 1WY7A 1IE3A 2AYXA 3SC3A 1JEYA 3DVAA 4M8IA 1PYDA 3PD7A 1B6GA 1NLMA 4ETWA 4DPLA 4J7XA 3T9BA 1OXSC 4G5SA 4B3CA 2HD4A 1YQWA 3KOXA 4TXHA 5L3QA 3AFMA 1WUYA 3BSSA 2EARA 4ITVA 3JALA 4R3UC 3HXOA 4MROA 1KRHA 2RHHA 1R0BA 2Q8QA 4MI3A 4BQPA 4R4JA 2XI4A 1TA4A 3OFKA 5B2EA 5LQJA 3I9KA 3GT3A 4O4HA 1QAQA 3KUKA 1R16A 1ZVKA 1TUGA 1O4WA 1YDGA 4QUBA 2DQSA 3LZ6A 5KNBH 4OXIA 1V71A 2BRUC 3IUYA 3N8IA 4IGAA 4PU0A 1LI5A 3P45A 1WDTA 5ERXA 3B1WA 2WT4A 1OBCA 4WW0A 4C14A 3A4YA 1SFRA 1W5BA 3BEDA 3JWIA 3KHKA 4A91A 4B0OA 2BDUA 4Z5XA 1QR6A 4WKPA 5AHWA 3MWJA 4IH1A 4KOAA 1HR0B 4JT9A 2FFAA 4FZ3A 3VKGA 1P60A 1WZCA 2EKBA 5EJ9A 4BNHA 1B8PA 3CEJA 4L7QA 5KWEA 2VDPB 2X1LA 4R1MA 1B0ZA 2JFPA 3EC1A 4JGIA 1RWOA 2QD1A 1A2OA 4YWHA 4ZEXA 2DY1A 4P81A 4MWDA 2D2VA 5FBKA 1EDZA 3NCTA 4O63O 3WRVA 1W6UA 2FTKE 1Q21A 3S1LA 1ONNA 4M54A 1E89A 3H19A 4IIXA 1RWNA 5KYYA 3T1VA 1L5NA 1DFIA 1JSXA 4MRVA 4NJMB 3SHTA 3SYMA 1CQXA 1TKRA 2CYCA 1EHIA 1RWBA 2R4UA 4BE4A 4Y9TA 5JVDB 1XEXB 3P5SA 1N9ZA 1N6IA 3TO5A 5A3QA 3UJPA 4ICIA 1OFUX 4I1SA 1SEPA 5LPNA 3G59A 1PW5A 3IIIA 1RYDA 3OEWA 4JB3A 4HH1A 5DLQC 1L7BA 1MAAA 4ESEA 2YHSA 4WZBE 3FFTA 2Q0SA 2WE8A 1OR8A 2RBEA 1XD2B 3WLJA 3BTOA 2JCXA 2Y92A 3S2YA 5HPYB 1EKXA 3U7RA 4OH7A 3T0IA 3DDWA 4FMDF 1XRLA 5FEMA 3ISTA 2O5RA 3EZ6A 1B6SA 2PEYA 3ZH9B 2MMGA 1E9AA 3UQZA 3HVKA 2WW8A 5EFOA 4LHZA 3S99A 2BC9A 3FCSB 4KB5A 5DZSA 5EXXA 3RCBA 3C3BA 1U1IA 2YNMD 1QDEA 5AICA 2Q3HA 2ICAA 4LSGA 5EMJA 1U3WA 3IO5A 3CPEA 1U7TA 3KXIA 3E03A 3ADCA 4MVJM 3O93A 4YP6A 1QO7A 1MENA 3EC7A 4V0MA 5EYPB 2XF8A 1KFBB 3ANMA 2XYVA 1T6NA 1X42A 3PQ2A 2IWRA 4AF6A 4DA4A 5AH0A 5A0TA 4BO3A 2WICA 4BLWA 2GTIA 4ZT6A 4KQMA 4WQMA 2D4HA 2Q7DA 4EJMA 2CDNA 3OU7A 3RS9A 3RC7A 3HY4A 4FBGA 4EEXA 4ZK2A 4NU8X 1LJLA 5F64A 4YTEA 1R00A 1C1DA 1JQJC 4K88A 4KQGA 1JIUA 3RVOA 1WRBA 4KX5A 3SBEA 4US1R 3NANA 4AWBA 2ZRNA 5JV5A 1XK6A 3M89A 4RH1A 2Q8PA 1N8SA 3OQIA 1LK0A 2RI1A 2V7PA 2XDWA 4CUZA 3N76A 4OK5A 4EKEA 1QVWA 1F4VA 1PDVA 4K05A 4BVBA 2PWBA 3A0RB 4LTDA 1J00A 4PAGA 4NCIA 1DEOA 4B8YA 3OX1A 4PYIA 5C37A 2PY6A 3REFA 3MJHA 3NR2A 3C3JA 4UATA 5LZ8A 4MUNA 2J5RA 3A6JA 4Q24A 2AN9A 4UEQA 5DM0A 4W5RA 3KJIA 2JHFA 4L6CA 5LN1A 2P90A 3ASYA 3O3MB 1QYXA 4GMFA 2WWIA 3QTLA 1ZOOA 1CJMA 1DTSA 1Z2CA 1E3TA 3HBFA 2EIHA 2EV9A 4M87A 2PT5A 1SVOA 4FZRA 2OYSA 3QU9A 4CGYA 3LXRA 2P68A 4YJKA 2CLCX 2P4EA 4L78A 5J4KA 4V38A 1UODA 1M1UA 3QU4A 4P2GA 1X1EA 4U3JB 1TYEB 2NADA 1M1YB 2QLFA 4U9HS 4DXHA 1M0SA 4B83A 1JZQA 3KKQA 2GPSA 3M6FA 1COZA 3V8RA 5IJ9A 4L5CA 4F6RA 1AS2A 5EZYB 2R0QC 3G5LA 2QVYX 2IH2A 4ZALA 1VJTA 1HT0A 4UBNA 4BNIA 2WU3A 5LXTF 4C6TB 1FXUA 4NG5A 1N3LA 3RYCA 3HACA 2H08A 5COBA 3O91A 1JG4A 2DHQA 2IL1A 2GO1A 3PA8A 1L7QA 1U0RA 2HRDA 1OA1A 4UAUA 4BMNA 4QPPA 3LDAA 1FTQA 3TLGB 5KVSA 4UHCA 1JA9A 4UM8B 1E18A 4Y2YA 1Y5LA 2QL9A 3LPNA 1CE8B 4OLFA 3SHFA 4IY1A 3K05A 4TKUA 1IZ9A 4R3WA 2CXUA 4YRTA 2DR2A 4BIIA 2G1PA 1KYIA 1W5FA 1K3FA 3JV7A 2C3OA 5MGNA 4LIPD 4XCQA 2R6JA 1CS0A 3M5WA 3MINA 2H1SA 4FFNA 2WZDA 4J1QA 4OFZA 4DMLA 5CDFE 3N59A 2HTEA 3CMCO 4B7XA 4BLVA 4UPEA 3WWZA 3OFNA 3PFWO 1SC3A 1TCCA 1G3IA 1W1UA 2BM9A 1H2FA 2WAXA 1O8CA 1L7XA 3MWKA 1REQA 4UC0A 2O05A 1DPGA 2B36A 3F78A 3UJBA 3VPHA 3EVTA 3E6AA 3FTCA 1EXNA 4RKEA 4XVUA 1E6LA 2VC2B 1C29B 1W4CA 4H35A 4LHEA 2XDQA 5A1TA 4BVJA 4TGLA 3OOWA 1E2PA 2VVTA 1RD4A 2HXGA 4LRQA 1T3ZA 4DREA 5ITZA 1MJGA 3K5PA 2QE7A 1BD4A 3L46A 4QXPA 4KRFA 3P0RA 4Q9IA 1GNQA 3DLBA 5K2OA 2H2HA 3OX4A 2OO3A 1H0HA 2VOJA 3RUDA 3GMIA 1Q1NA 1QYCA 1M73E 2DWPA 2J30A 3SHOA 3AV3A 5ICEA 4K9RA 4CN9A 2G7MC 4PZDA 4BEVA 5H81A 3T5DA 4G0QA 2PK3A 4Y6PA 3GG9A 1MJ5A 3INTA 3RROA 1ADBA 2QRQA 3U7QA 4DA0A 1I94B 4WXMA 5MFZA 5DSTA 4J75A 2XCUA 4KODA 5E1MA 1JFSA 4ZRMA 3SG0A 4O25A 4ESOA 5JS7A 1KWKA 3V7NA 2NAPA 3GP5A 1MABB 2PMWB 2V6BA 3ZQKA 4HC4A 5FI0B 3DDUA 5EI5A 3T4EA 4OJQA 1AKRA 1QMPA 4LYYA 1TT5B 3HVHA 2C2BA 4R2WA 4ZPJA 5H3CA 4J0EA 4P8RA 3ZXYA 2C9BA 2PRKA 4DUGD 1S2MA 3MQFA 4KNWA 1KBQA 1XHFA 4MWGA 2XUQA 4YDSA 2F8LA 1TM5E 2DTXA 5IBQA 3RS4A 5GTDA 1U2SA 1FFSA 3K4HA 1UKCA 1Z7EA 4AZ3B 2YZ2A 1WZUA 1E4EA 4UM7A 4ZT7A 4KGDA 1C8LA 2EFYA 1W4ZA 3KEGA 3TQSA 1BHQ1 1SBNE 1BZYA 2BKAA 2RHLA 1P29A 4X63A 1J06A 1HDEA 1JJFA 4MWBA 2W2TA 4M0LA 1KR5A 1ZGGA 5A5GA 1XMPA 2QJWA 1C9KA 4PLGA 3J80A 3MOIA 4PPYA 4YT5A 3FZGA 2ILVA 5K3CA 3N86A 3PGJA 3ZJUA 4WV3A 5EIAA 1XE3A 2ZIGA 2XUPA 4LTMA 2IYNA 2X4GA 3GI1A 3V4SA 1JB9A 1QIEA 2Q50A 3JW8A 1FSGA 3ER9A 1LBQA 2OLKA 5MN4A 4Z7NB 1PX0A 5CJ2A 1TK9A 4OSPA 4WUVA 4NCBA 1AF7A 1YCGA 4J0GA 3C3YA 3CKYA 1KDPA 3A27A 4R8KA 5K4GA 4KGVA 2ZR8A 1MPXA 1XPJA 4URHA 4E2ZA 4EO7A 1GLVA 2ZJ8A 3MWLA 4EY4A 1AZSC 1RI4A 2GYVA 4L51A 1U9JA 4Q4AB 5FXMA 1PX2A 3ZHQA 1MHPA 1F1JA 5I7UA 1F5SA 4ZAZA 1YA6A 3ROKA 2CMHA 4F46A 1IM8A 2OWEA 1GITA 1NP7A 4LBZA 2BBWA 1J5XA 4MINA 3TW6A 2CNWA 2MSKA 3FPHA 2P3OA 4WZBB 1A8HA 1ZXXA 3GCXA 3EQ9A 4KPGA 1NR1A 1QX3A 2RGWA 4GGPA 1SD1A 3SZ3A 1FX0A 3GNSA 1HQDA 4EFNA 2W2PA 4NJEB 5FO0A 5H5JA 4QGHA 4HN2A 1U0GA 1R15A 1SAYA 2AFVA 1H8HA 2HUNA 3AR8A 1V1RB 4HX5A 4OLJA 4WWHA 3WAKA 2XR1A 5EUQB 4OHZA 4HLQB 1US8B 3S1SA 4HVLA 1L5ZA 3RKRA 5KYXB 1AXGA 2HQOA 1SKUA 2FEXA 2VZ9A 4G81A 1JQBA 1KPGA 3P7MA 1PO7A 2WWHA 1YJBA 1SIWA 3L4SO 4XARA 4B48A 3D5QA 4GHWA 3LHFA 2B25A 5DYGA 3RUEA 4YALA 1GT6A 4MJLA 4C3VA 5JD4A 2VP0A 2MWMA 2XCSB 4JUBA 3DHWC 2CE7A 2J5BA 3PNBA 3BTUA 1K4MA 2HA4A 3FPCA 2IYRA 5AT1A 3G0HA 2B34A 2ZWPA 2Q99A 1WXXA 2PKQO 3TQHA 1YB7A 3LPLA 1OFUA 4FK8A 3UF0A 4FWBA 1P5FA 1T9ZA 4GMHA 2OYRA 3JQBC 4L3OA 5B36A 3FCEA 4MUGA 5JFTA 3DTYA 3RTGA 1JR6A 5BV0A 3WIBA 3KEOA 1TDJA 2GJ4A 2HO5A 1AS0A 3FAKA 3RANA 3U44B 1TEZA 5KTSA 2QTMA 4EGSA 2NSDA 2GCNA 3TVTA 3VJRA 2FEKA 4KEAA 1ZHHA 1EE9A 1ZN2A 1E79A 2W4IA 4OATA 2PH1A 2YMQA 4FSXA 4X85A 5LP6B 1X8KA 1UEJA 1KQGA 2GEDA 1PWEA 5IARA 2Z1NA 4ER0A 1G5TA 2YIMA 3H0KA 1T1JA 3EF3A 4PHTA 1UC5B 4P93A 3AR7A 5KQSA 5LJLA 2P5YA 1MRSA 2E5WA 4HQ0A 3PBKA 4ZMRA 5IDVA 2UV8A 4U2CA 4DMHA 4I1UA 3UMSA 3WHLA 1I5EA 3DQQA 3QJYA 4FMBB 4N0DA 5BXQC 4N7MA 4LFBB 1M6VA 2VP6A 5KYKA 1CSEE 2XQKA 1Q3TA 2VYNA 1HYBA 4DA8A 2BD0A 1UK8A 2GBIA 2WM8A 1CERA 3W3AA 2E82A 2VK4A 2HV8A 3PUZA 2D0PB 3BTSA 4GICA 3E22B 1WSDA 4P3PA 4E6EA 3H5TA 2F9MA 4GRAA 4I99A 3TWOA 3VJLA 9ATCA 3L06A 4L8VA 3RG2A 2XXJA 4BY9E 4MV7A 2PT6A 1XA4A 2CCKA 4OPMA 1JALA 3DGFC 3QUSA 5LQAA 1GRRA 1YFKA 3RWBA 1H05A 4X1IB 4IQ8A 3DULA 2AEEA 2R65A 3DCNA 1L1FA 3R9IA 1GQ2A 3EGCA 1IWBB 1RI3A 1QV6A 3WMFA 4D02A 1ATZA 2C9ZA 4BIMA 2DBVO 2OK7A 2C7BA 4S1NA 3BCRA 4WXEA 3T3PB 1WU7A 4MV0A 4PLFA 5C34B 3WP1B 2Y76A 3NDJA 3W7AA 2CCGA 3TECE 3W6NA 2IDJA 3RUCA 5JO9A 3HYCA 1WKCA 4BJHB 4MEBA 3L0BA 2YOGA 4DRYA 3KQWA 2XNJA 3VR0A 4RBNA 5CAEA 4EMSA 1L4EA 2Z4TA 1PR4A 4P3XA 1MW9X 4PXSA 1WHTB 3DL2A 4RH3A 1V11B 2GM5A 4HDKA 3H7IA 4FYVA 3WGQA 1MB4A 3ZUPA 2QW8A 2O8BB 2J6CA 1DG9A 2QXUA 4C7MA 4AYTA 1ZEMA 2F90A 3AUSA 1SWWA 2QX6A 3H1TA 4FOTA 4LDNA 3BDIA 3TKYA 3GOHA 4BMDA 1O6ZA 3AI7A 1BCRA 2ZYAA 4C7BA 2VHWA 3RSHA 5B55A 4QWWA 3KV1A 2C9MA 4Z0NA 2C83A 4GMXA 5AW4A 2HK6A 3F6EX 4CV1A 2YOFA 3K32A 5H4GA 1UBMS 3S6JA 4IFTA 1VJ1A 4R6WA 4Q4LA 2VUTA 3KWLA 3BICA 1JNYA 3PRHA 2UYQA 3ITEA 4Y2TA 5KOIA 1DKOA 4ZVTA 5COAA 1K8QA 5C4IA 1W88A 2O5VA 1P2DA 5A7HA 4K87A 3ZBQA 1Y4AE 1CUHA 1T5LA 4PLVA 4R1SA 3WZLA 2OXEA 2Q5CA 2ZXEA 3OQOA 2A9OA 3ILSA 4Z4CA 5FOXA 2IYFA 2XE7A 3ANTA 5J23A 4I46A 2W4QA 3B53X 2YBEA 5ALPA 1GU7A 3I6IA 3FOAA 4GOOD 4UQLA 1CEYA 1N5OX 1YQEA 1Z33A 1DZIA 2B0JA 3HCWA 2IZ0A 2PS0A 5EP3A 1E5QA 3D0QA 3FD8A 2YKGA 3BN3A 4NY1A 4UMFA 3RJ5A 3LGXA 3ZHXA 1GHTA 2D3WA 2I54A 2JAQA 3CX4A 4IQGA 3LL7A 4QUJA 4ZAYA 4E5NA 3QVUA 2ODNA 3JARA 2JS7A 2VP4A 1RPTA 3E8SA 4RW0A 5F2OA 1NXOA 1P9NA 1MGPA 4LXQA 3OLCX 5CRIA 2IV7A 1S8NA 2GF0A 3VO8A 3FWKA 5AM4A 3TNFA 4MWOA 5DTQA 3PNMA 4XTRA 3QFHA 3I1IA 1CB7A 3A0UA 1M74A 1I0ZA 4JSYA 5SY6A 5KKCA 1YIAA 3IP5A 3LW8A 1NBEA 4E3WA 4BKPA 2FWRA 4O4LF 3BE6A 3GG2A 2J0QA 2AG8A 2J3MA 5BWCA 1W48A 2Y67A 5EJGA 2W2KB 1QCCA 1S1CA 3O83A 3ZI4A 1I33A 1L7OA 1CQPA 1N5LA 1JTFA 2VDRB 5FFMA 5KCZA 1S4MA 2FRDA 3GP3A 4ASUD 5AOCA 2ODEA 2X0EA 1Z73A 2OOKA 3H87A 3L82B 4PONA 1QLWA 1NNEA 3O92A 1BFKA 3VOAA 3WKAA 2I6GA 4I3GA 1ZD5A 4EJ0A 5BSEA 1LC0A 3O8OB 5CDHA 2J31A 2PVPA 3DS8A 3QNUA 2HNBA 3TX6A 3OKPA 3LZCA 4RV9A 3EVBA 4I6GA 2GWRA 1NDUA 4DJEC 2ZM5A 3JYPA 2DE0X 2WHYA 3O3NB 4KK4A 1VC2A 2ZBRA 1GRQA 4RPKA 5FUVA 5K0JA 2IEGA 2I8AA 2HGZA 3DJYA 2FJPA 1SKQA 3E9ZA 1VKRA 1XNHA 3VAAA 3DYVA 4A16A 1UT5A 1TUIA 1E3JA 4FI3C 4B3MB 2BUCA 2PYZA 3LC0A 5T4BA 2VHZA 2ZYTX 1I1HA 5JDIC 4XGKA 4ZMBA 3OPNA 3U3ZA 1SUSA 3ZE7A 1KQFA 3UJ7A 4XIGS 1OV6A 1YUNA 2A9QA 3D8UA 5K9ZA 1FQJA 3EMVA 1D09A 1VSBA 2Z4RA 2QD5A 4YAIA 3X2EA 1N5DA 2HZ7A 1DGQA 2VNJA 2ZDHA 3JD0A 4F4IA 3PWZA 1Q92A 2QVZX 3SHWA 1RQLA 3GJ3A 1DKPA 3EY4A 4XIJA 5KQPA 2RI6A 4WCFA 2QKYA 5LQSA 2CBXA 4X1KB 4BUJA 2FZWA 5EIBC 3TXAA 5BMVB 1U1DA 3W79A 4N5DA 2DXIA 3I73A 3D64A 1SK9A 1H9BA 1MVOA 1XMIA 1SVNA 1PZGA 2VYVD 1I7DA 4NBSA 1BKSB 1U8EA 3L8MA 4K03A 4Z7QB 4GR4A 4IJVA 2LPMA 3RIYA 4TS9A 5ESWA 2WT8A 2HM7A 2FR1A 1N32B 3I30X 1CG6A 2V65A 3KTAB 3S1AB 3GJ5A 2QVBA 1ZU5A 3PS9A 4YMIA 5TE9A 3RIMA 1Q57A 3LWNA 1R3DA 1FDRA 3PGMA 4KR7A 4F38A 5DYYA 1AN9A 1T8PA 4DJAA 3R6DA 4LX8A 1FBNA 2WTEA 1CZUA 4MMYB 3I9JA 5D3QA 4OH1A 2UYCA 1PK7A 4JCCA 4E4TA 1YONA 3PQ3A 4AJIA 2GASA 3B3QA 3O1LA 2ZVJA 4OGGA 3CRRA 1FVOA 3RYIB 3U7EB 4YN3A 2OO5A 4JSTA 4LUCA 1CQWA 1X77A 2YYAA 4G97A 1R0WA 4R98A 2D2EA 4XEHA 5C5CA 2ZULA 5JAUA 1ML4A 3EOZA 3KJGA 3LLUA 1PEAA 4H77A 4HADA 4LZLA 5A3VA 1XZIA 1U2DA 2REOA 3AY7A 1YR6A 1ZJ5A 1HA3A 4QDXA 2Q4DA 2LKDA 3R6TA 4C01A 3IVGA 1TUBA 1ZRMA 3ESZA 1NBOA 3I39X 4N6OA 4DFDA 5JECA 2OG2A 1T9KA 2OENG 3KT8A 4RD2A 1H1LA 1KZ6A 1E5TA 1X94A 4M7PA 2HWUA 4LVUA 3OTWA 4DSTA 4IWYA 3ZWWA 3NAMA 3NJ8A 4Q4HA 4KXNA 2FW0A 4AM8A 1NMSA 5F1OA 1DC8A 1PKEA 1ZAYA 4I2NA 3D7RA 1Z6ZA 3PITA 5FR1A 2R8PA 3AONB 3O4VA 1JXAA 5SV2A 1J39A 1GDTA 1PNTA 3UA3A 3V7WA 3WOHA 2VTDA 1EE1A 4LN1A 4JBIA 1BKYA 2YIVX 4IDGA 2IOFA 2WU4A 5D84A 1LLFA 2QAGC 3E48A 3M2PA 1QQBA 4GEKA 4BGUA 4D79A 4OB7A 3QW2A 2HA0A 2RK4A 1A7KA 2NNLD 3V4RA 4JOBA 1EUCB 1KIFA 2Q3LA 3A05A 5AOAA 2GZAA 3HUTA 2YMPA 2ZJAA 4DRXA 3M6MD 1HRDA 2GD0A 3WGMA 5EZ6B 1DI0A 2W6OA 2Z04A 2ZB7A 2FLVA 1J8VA 1M1NA 1U04A 3EARA 4W8HA 3HYTA 5LQUA 4KFRA 1CKEA 3LFHA 1GRVA 4AS2A 4BLSA 2VBGA 4HLUC 2GA9A 3K0SA 3KT3A 2JH9A 4KFTA 2ERCA 2D2FA 1X1AA 2X9VA 3MUFA 2AZMA 4JR1A 1IPEA 3KDPA 4WXYB 3F90A 1XA3A 2J3HA 3AL3A 1S2IA 4LSZA 1KPIA 1ZUHA 2VRWA 1CUEA 4RD6A 4U0KA 5I9NA 4RO0A 2POCA 4JZKA 3U3RA 3ZTYA 1O0BA 4LYGA 4Y2PA 3ZJTA 3M1LA 4YMVA 2Z5FA 3DWIA 4DQVA 3PDIB 1SUIA 4FOSA 4UKDA 4HPXB 3N8HA 4ZD6A 3WOVA 5C1PA 3M4ZA 5GV8A 4CKEB 1W96A 1HQCA 3NV9A 4LOJA 2FH5B 2WIGA 4YACA 5BQXA 2ECFA 1HFKA 2ZCVA 3HCPA 5EQJB 1BXGA 1XL1A 4I3HA 1VKOA 1S2NA 1AA9A 3S4YA 1OXBB 1PD0A 5CK4A 2QX8A 4YLGA 2CCJA 3IO3A 2LDXA 3NQ41 1J25A 2R5FA 4JR2A 4PXYA 5AM5A 4D8VA 1X38A 4LWPA 3X2FA 4L8WB 2JD2A 3F7OA 3WNQA 4O6VA 1MQ9A 3D6HA 1WHSA 1RXCA 3ZZTA 1AQYA 4FHZA 4MVJD 3ZQUA 1ACJA 1PYGA 2Q3MA 1LH0A 2BGLA 3PQCA 1T0IA 3DBHB 3QSYA 3P8ZA 3LE8A 4X8MA 1L3CA 1JEQB 1I1OA 3HYLA 3QKIA 4MP6A 5AI4A 2COUA 1M6YA 1RTTA 5EXTA 1MAVA 3OZBA 1JG2A 1G5HA 2ZB4A 1IY0A 1UWLA 3T7RA 2C7GA 2PMDA 3C5VA 3ZK7A 4EHIA 2XCLA 2EERA 4JP5A 3SWWA 1H1TA 1E69A 2GTHA 4UVDA 1TJ4A 4G09A 5JOQA 3EXHA 1V5WA 4OA5A 2Z6AA 1YJ5A 2ORYA 4KWEA 3ZGZA 2C4TA 1F3LA 4N40A 3EG9B 2H4ZA 4PPFA 5TEVA 1JT2A 3PD0A 3FTFA 2Q2WA 2C4WA 3M6IA 4H6XA 2RGNA 3FGZA 3WTBA 3E23A 4YYEA 4CM1A 5FYQA 3HBMA 5JI2E 2JLRA 4UHJA 4ZI7B 3E5HA 1MXFA 3A58B 4G4GA 1P7PA 3LDUA 1W9HA 4BFLA 1J8QA 4DUPA 1AMNA 1XVLA 4N6GA 5IH7A 1FRNA 5FWXB 2C00A 3RG8A 3S0JA 3VAYA 5TS3A 5IRCD 3U80A 4WXPA 1EB9A 4F4CA 1JR2A 2UZAA 3VYUB 1NVDA 4LK3A 5BQ5A 5CK5A 3VR6D 4ZO9A 1DP4A 1OC4A 2H9AA 3MAJA 3UPDA 2XWSA 3Q8MA 1WP4A 2V4UA 2PLAA 4GR5A 1UT8A 3GFVA 4J94A 5TQJA 2I3DA 4DLXA 1LDYA 1ZIYA 4LE0A 1ORDA 4EENA 2YN4A 1KI6B 4R8VA 3VKWA 2P2SA 1ZI8A 2O7RA 1YQGA 4I5IA 4NYIQ 1C8KA 5DK4A 2HV9A 5C35A 1VG1A 4Y6OA 3TSWA 3SVTA 3QEAZ 2Z09A 1EX6A 3UB3A 4DG8A 4DS3A 3CT4A 1X13A 3IL2A 4XQ9A 2D0OB 2ZYIA 5CLLA 1YDMA 4QQKA 3P9IA 4F60A 4ARAA 1Z25A 3FB4A 4PQYA 2OB2A 4QPCA 2A14A 4RPLA 4C78A 1PEKE 4D46A 5ALVA 5E6UA 2FW1A 1W6RA 3OA2A 2PIAA 2V6IA 3I09A 1OYYA 3G9UA 4I4TF 4XOUA 1JFLA 2PYDA 2E4XA 3RJMA 4CR7A 1VJ5A 1T4MA 1YH3A 4RELA 4AY5A 4A6XA 1OXVA 6Q21A 3CF0A 1T13A 2J6HA 3B1FA 3P5BA 1PNVA 4OHPA 2PCJA 1TEXA 1X3SA 3P9CA 4FKZA 4JKIA 1UOPA 2OHIA 4IIJA 4ZOBA 5LUBA 2Q1UA 3IULA 1GV0A 3RAJA 1ETHA 3K0CC 3WIEA 5M29A 1O0CA 5IBRA 4P98A 1KOGA 2X3UA 3FW1A 3GUCA 3BERA 4N9QA 5EJ4A 2KLBA 3V1KA 1K2VN 4LVNA 2NO0A 4F93B 3P52A 1K5DA 4HJRA 2ZJ6A 2QTTA 4J1TA 2DP4E 3EGDA 4V03A 2QUIA 4DB4A 3BJRA 3WMEA 1ZH6A 4YUAA 1GYQA 4KXWA 4KMMA 2OZVA 1YZTA 4YP0A 3FLMA 3EAFA 2QPTA 4XLZA 1SC9A 2WJAA 4EPRA 3SNHA 4TMZA 2WP0A 5AKLA 4K86A 3W77A 1PFUA 1A95A 2XADA 4Q6BA 1U7OA 2EBUA 4DUYB 5FA5A 3CX8A 3ZD8A 2CJFA 3LCMA 2Z57A 4FM9A 2ISCA 1T5OA 2O2YA 4AYXA 3NEAA 4IMJB 2FFBA 5A4JA 3TG8A 3OLXA 2P5TB 3N8NA 5D3ZA 2O8CB 2OGTA 5EL0A 1L7NA 1T5HX 2ODBA 4PZAA 5ELMA 1R10A 5KMGA 2W5UA 3OIYA 4CIBA 2QP4A 2P4UA 4FIDA 3DLPX 5EJIA 3UXMA 2HEIA 3FJ1A 3ULKA 5JTUA 4ZZIA 4EA9A 1SD2A 1RE1A 3HR8A 1YTUA 2EAUA 2ETVA 3UC5A 3DNMA 3RRBA 5HKOA 2FWJA 1I3MA 3UATA 3FIJA 5HJEA 2SHKA 1ORIA 4KOEC 3AKYA 1M2WA 1MEJA 1QKIA 3QFTA 4G1BA 4LRWA 5ALWA 1DCFA 1T2EA 2OFPA 1VLZA 3OF5A 3JZFA 2IPMA 4KE9A 1E20A 1M6NA 2BJHA 4Q7LA 3KJNA 1UMCA 2KQUA 5KX5B 3DBIA 4QLAA 5G1OA 3KD2A 1YHZA 3AWIA 1K8XB 3SDBA 3EVZA 5LYJF 2VWGA 1DRUA 2JJ2D 1SCKA 3I5MA 3U7IA 1N2XA 2C4KA 1CVIA 3CG0A 3L40A 4R8LA 4K3UA 2IYPA 2ZOSA 2O52A 5AKGA 4N3CA 1D6MA 1VSTA 2GNPA 2RH8A 3GGCA 1P39A 1RHKA 2DQZA 2E85A 2P9YA 3HJAA 4IMRA 4URUR 3J7TA 5DCYA 4GNKA 4DM7A 1ZQ9A 5AKXA 1RQRA 1CDEA 4ZV7A 4EPTA 4BKOA 4HV4A 3CTMA 1WB5A 2HHJA 3FVTA 3TDNA 3C6YA 1J42A 4XE5A 3VBEA