3LPSA

Crystal structure of pare
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
364
structure length
347
Chain Sequence
b'GLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLHGVGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Topoisomerase IV subunit B
publication title Crystal structure of parE
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Isomerase/antibiotic
total genus 110
structure length 347
sequence length 364
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3lpsA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3lpsA01
2BM0A 4XTJA 5D7RA 1N34I 3FT8A 1UY6A 3LTOA 4XE2A 2UUCI 3INWA 4L8ZA 1XMQE 4DPYA 4GGLA 4BQGA 1UYMA 2XDXA 4DZYA 1NHHA 2YE7A 1K47A 4USMA 4B3RE 2IWSA 4L90A 1NZ0A 2BU7A 2BU8A 5D6PA 1ZXMA 4DU7A 4LFBE 4XCJA 3RLRA 2HG1A 2V2ZA 4JI0E 1S14A 1UY8A 4BAEA 3A0XA 4DR2E 4U93A 5D7DA 2XHRA 2UUAI 5F5RA 3OTOI 1H73A 4R3MA 2YI0A 5LMNI 1ZXNA 3VHDA 4MP2A 1PKPA 4HY1A 4JI7I 4PRXA 4X65I 4DV5E 2YJXA 5GMDA 1RR9A 4B3SI 3HZ1A 4JAVA 1B63A 4JV5E 2FXSA 4GKKI 2O1VA 3CGZA 1Z0VA 4K0KI 2UXBE 2BU6A 3B27A 1UYLA 4CE2A 5CF0A 4EFUA 1XHKA 1Z5BA 2Q8HA 4ZKIA 3PYGA 2CCTA 4Z7CA 1RREA 1Z0TA 2XDSA 1XMQI 2F4VE 2HK2A 4H81A 3LPSA 4ZVIA 4JI2E 4LF4I 2YKJA 2X7IA 4GT8A 1UYIA 4XCLA 4B3RI 4USKA 4GKJE 4HYPA 3Q5LA 2UUBE 4LFBI 3K99A 1IBME 4DR6I 4CWTA 2BREA 4YKWA 4JI0I 2XHXA 4DR2I 1N36E 3BM9A 4EM7A 2K5BA 4YHHE 3K1JA 4MYUA 3J80C 4FWGA 3WHAA 3VHAA 4E02A 1KIJA 2HFSA 3PYDA 1HNWI 3A0TA 3O2FA 4DV5I 4B3TE 3H80A 3JZ3A 2AJ4A 4XKOA 1XNRE 1PIEA 3QT8A 3BMYA 4LF8I 1IBLE 4JV5I 4ASFA 4NXME 4AS9A 2UXBI 2EFGA 2J7KA 1TH8A 1S4EA 1Z0BA 3M6AA 2AKPA 2CGFA 4P7AA 1Y8OA 4LWHA 4ASGA 4CWQA 2IOPA 3WU3A 3J7AM 2F4VI 4HXZA 2YGFA 4LF5I 1FKAE 4XIQA 2A2CA 4JI2I 4XC0A 4EMVA 1I58A 2YEAA 4GKJI 3R4NA 4MPCA 4O0BA 4QPJA 4MYTA 5L3JA 2HK3A 3EHFA 3EKRA 1I5AA 1BGQA 5CPHA 2UUBI 4I3HA 4PRVA 3QTFA 4DV6E 4L94A 3D2RA 2XK2A 1UYDA 1ZM2A 1N36I 2Q8FA 4DUHA 4LWFA 4YHHI 3R92A 4B7PA 2H55A 4O05A 4BQJA 5M4EA 2HFUA 3HULA 1EI1A 4DUYE 1UY9A 1XNQE 3HHUA 4ASBA 2IORA 2YEEA 2YK2A 2BU2A 5LMNE 4B3TI 3PYFA 4JI8E 4HY6A 2IWUA 4I5SA 1XNRI 1AH8A 1BYQA 2O1UA 4YKXA 4B6CA 2VCJA 4P52A 5BODA 4X65E 1IBLI 4NXMI 2DEJA 5IDMA 4DV4E 4EGKA 4X62E 2BYIA 1ZM3A 4FPPA 1AH6A 1Z59A 1UYHA 4JASA 3U2KA 4LWEA 1UYGA 5D7CA 1N0VC 4LF9E 4XITA 1YS3A 2BTZA 4BXIA 2HKJA 4XDMA 1GJVA 5GGZA 2C2AA 1DARA 2XDLA 5LL6R 2WI5A 4LWIA 1ZW9A 5IWAI 2Q8IA 1WUUA 4UROA 2YECA 4PL9A 4Q20A 4DV1E 2YEGA 4X66E 4DV0E 1QY8A 3GIEA 4FCPA 4LF4E 2XX4A 3GIFA 1ELOA 3B28A 4MPNA 1AMWA 3K60A 4Z7YA 4DV6I 3CRLA 3J80Q 4KSHA 4JI4E 3TZ2A 4DR6E 2WERA 5M4KA 3RLPA 4WUCA 4FCQA 4HYMA 3H4LA 4DUYI 1XNQI 3T0ZA 1QZRA 4LPBA 1Z0WA 2XJGA 3SL2A 4JI8I 2ZKJA 4U7NA 4CWPA 1HNWE 1AJ6A 3K97A 2YKCA 4E01A 1GKZA 3LNUA 5M4NA 1FNMA 4DV4I 1MU5A 4X62I 1VISA 4YKUA 2ZBKB 4LF8E 2YE2A 4DPUA 3B25A 2WI3A 1ZWHA 4LF9I 4V26A 2CH4A 5BR8E 1YETA 4UT4A 3J81C 4OX9E 3OWBA 3TZ4A 2QG0A 1KTVA 1MG7A 4KHPE 2QFOA 2ZDXA 4DV1I 2FYPA 3KE6A 4R3AA 2JJCA 3TZ5A 4X66I 4DV3E 3A0RA 4DV0I 4LF5E 4GCZA 2CCUA 3J7AG 4LP0A 1FI4A 5GMEA 4GQTA 2V8PA 2VF3A 3R91A 2ESAA 1UYCA 2YE9A 2XHTA 1KVKA 3EHJA 4JI4I 2YEHA 4JG4A 3CWVA 3D4JA 2XDUA 1XMOE 1L0OA 3T1YE 2BYHA 3HEKA 4DPTA 2JKIA 3VHCA 4JI3I 4LF7E 1EA6A 4JI1E 1Y4UA 4YKQA 3B26A 2R3VA 5CTXA 3OWDA 2WI7A 4H7QA 2WI2A 2E5LI 2Q8GA 3ZZUA 1KZNA 4AWQA 4DPXA 4LFCE 3T0HA 3FV5A 5BR8I 3IEDA 2V34A 3T1HI 4OX9I 1HNXE 3B8HA 2VQEE 4DU8A 3D36A 2E1RA 4MPEA 2NPFA 4KHPI 3ZKDA 5J6AA 4H85A 3G75A 3K17A 4JI5E 4BIZA 2YEFA 4NXNE 2DEIA 3Q5KA 2HHHE 4YKZA 5IWAE 4X64E 4FMTA 4DV3I 4DUZE 5F3KA 1BXDA 1N33E 2XD6A 1ZM4A 5J71A 5A2QC 2YJWA 3ZXQA 1XMOI 3T1YI 4LF6E 4L93A 4O07A 4KQVA 4JYAE 1THNA 2ZM6E 2VW5A 4LF7I 1FJGE 4AQYE 2IWXA 2YE3A 2YEIA 2YE4A 3DGEA 1UYFA 3PEHA 3U67A 4JI1I 5IT9C 2XX2A 3HYYA 4ED4A 5CTUA 4FCRA 2LJPA 1PVGA 2BT0A 2FWYA 1NHJA 1QYEA 4EGIA 2VWCA 3RLQA 3J81Q 2BZ5A 2VQFI 4LFCI 2YE8A 1TC0A 3GIGA 5FNFA 2O1WA 5C93A 4RPFA 1HNXI 2VQEI 1U2RA 1TC6A 2YGAA 4MP7A 2H8MA 2YK9A 2QG2A 4JI5I 1H7SA 2BM1A 4U7OA 2XCMA 4NXNI 5M4HA 2HHHI 1Y4SA 4X64I 4MB9A 3WU5A 1YC1A 4DUZI 1YT2A 4YKRA 1Z5AA 3T10A 4O04A 4DR1E 3V2UC 2XX5A 4XIRA 3TTZA 2YEJA 1N33I 1YSZA 2YEBA 1ZM9A 3VADA 2R42A 2E0AA 2YEDA 3PYEA 3G7BA 3U2DA 1N0UA 3WU4A 3A0WA 5D6QA 4NH8A 3A0YA 4KFGA 3Q5JA 4KTNA 1Z0CA 4B3ME 4LF6I 2ZDYA 3O0IA 3QT7A 4JYAI 1I5CA 3FT5A 2XEXA 2UXDE 4URNA 3WU6A 2CZ9A 2ZM6I 4DR5E 4HACB 1FJGI 3NMQA 4AQYI 1UYEA 1H74A 4HZ5A 5M4PA 1UY7A 2YE6A 3TZ0A 4ASAA 4JI3E 4BIUA 4M1KA 4JAUA 1IBKE 4WUBA 5FLXC 1YERA 3O6OA 4JQLA 2UXCE 1U2OA 2E5LE 5FNCA 4URLA 3C11A 3QDDA 1A4HA 3A0ZA 2BV3A 4W7TA 5IN9A 3B78A 3R4MA 4FWHA 1H7UA 3MNRP 3Q1QA 2CG9A 4E00A 1FWKA 4EMDA 3T1HE 4GEEA 2QF6A 4HACA 3K98A 4WUDA 3ZM7A 3JAMC 4CWNA 4CWFA 3R4OA 4DR1I 5CTWA 1KKHA 1HR0E 2V2VA 4P8OA 4MOTA 4YY3E 4DR4I 5A2QQ 1B3QA 4X9LA 1TIDA 4FW9A 3PEJA 4DPWA 3QT5A 1I94I 4XD8A 2WI6A 5FNDA 4V25A 4LFAE 1YT1A 2V2QA 1FWLA 5LMUI 1YSRA 4DV2E 3C0EA 3CRKA 2HCHA 4B3MI 2WI4A 1Y8NA 1BKNA 5IT9Q 2UXDI 3T2SA 4PU9A 4XKKA 5CTYA 4DR5I 4DR3I 2CCSA 1OSFA 2YE5A 3OMUA 4DR7E 4DXLA 5BOCA 4NH7A 1I5BA 4YKTA 2A2DA 2EXLA 1IBKI 3HYZA 2UWDA 1S16A 2UXCI 4LWGA 3GONA 3OW6A 2BU5A 1J5EE 4CWSA 1GKXA 2YKIA 1YC3A 1HNZE 2GFDA 2VQFE 4UTGA 1US7A 1Y8PA 4MBCA 3ZZTA 1H72C 1Z5CA 3QT6A 4FWDA 4HXWA 3EKOA 1NHIA 2UU9E 1YESA 2BRCA 1HR0I 3RKZA 1AM1A 4YY3I 1U0ZA 3B24A 4JI6E 4EEHA 3V5RA 2YI5A 4YKYA 4AWPA 3T1KA 4NH9A 4DV7E 4LFAI 2YKEA 5M4MA 4DV2I 2YGEA 3GIGB 1OJ4A 3OPDA 2BSMA 2HKEA 1I59A 4EGHA 5FLXQ 4QPKA 1I5DA 4DR7I 1N32E 3D0BA 2XJXA 2YI6A 3G7EA 4XIPA 5FWKA 3EHHA 2WW4A 1N34E 2XDKA 4AWOA 1JM6A 1UEKA 1A6FA 2IOQA 2UUCE 1J5EI 2GS8A 3ZXOA 1YT0A 5IDJA 2OI2A 1HNZI 4KSGA 3JAMQ 4CWOA 1IBMI 3B82A 4EFTA 2WEQA 2ZITA 1MX0A 2XABA 2PNRA 3EHGA 4GFNA 3INXA 2UU9I 2WI1A 4URMA 2X36A 1Z0GA 4CE3A 2Q2EB 2UUAE 1B62A 1Z0EA 3F0NA 2GQPA 1UYKA 3OTOE 4CWRA 4JI6I 1D6TA 1ID0A 4CE1A 3TUHA 3WQ9A 4DR4E 4O09A 4FN5A 4JI7E 4KP4A 3ZKBA 4DV7I 1TBWA 1I94E 4R1FA 4B3SE 2FWZA 2YKBA 1YC4A 3ZZ0A 3CGYA 3R4PA 4K4OA 4GKKE 5LMUE 1TILA 4L91A 4K0KE 2VCIA 4XKAA 4HZ0A 2YI7A 2WEPA 3HZ5A 2XJJA 1N32I 1R62A 4DR3E
chains in the Genus database with same CATH superfamily
2BM0A 4XTJA 5D7RA 1Y60A 1N34I 4BA1A 3FT8A 1UY6A 3LTOA 1YHCA 4XE2A 2UUCI 2PO2B 3INWA 4L8ZA 1XMQE 4DPYA 4GGLA 4BQGA 1UYMA 2XDXA 4DZYA 1NHHA 2YE7A 1K47A 4USMA 2WP8A 4B3RE 3L7ZB 2PO1B 2IWSA 3P76A 4L90A 1NZ0A 3K85A 2BU7A 2BU8A 5D6PA 1ZXMA 4DU7A 4LFBE 4XCJA 3RLRA 4LCHA 2HG1A 2V2ZA 4QNJA 4JI0E 1S14A 1UY8A 4BAEA 3A0XA 4DR2E 4U93A 5D7DA 2XHRA 2UUAI 5F5RA 3OTOI 1H73A 4R3MA 2YI0A 5LMNI 3GLLA 2PO2A 1ZXNA 3VHDA 4MP2A 2JEAA 1PKPA 4HY1A 4JI7I 4PRXA 4X65I 4DV5E 2YJXA 5JEAB 5GMDA 1RR9A 5DRPA 4B3SI 2PO1A 3HZ1A 2NN6C 4JAVA 1B63A 4JV5E 2FXSA 4GKKI 2O1VA 3CGZA 1Z0VA 4K0KI 2UXBE 2BU6A 3B27A 1UYLA 4CE2A 5CF0A 4EFUA 1XHKA 1Z5BA 5DRQA 2Q8HA 4ZKIA 4IFDB 3PYGA 2CCTA 4Z7CA 1RREA 1Z0TA 2XDSA 1XMQI 2F4VE 2HK2A 4H81A 5K36E 3LPSA 4ZVIA 2Z5EA 4JI2E 4LF4I 2X7IA 2HHIA 5JEAA 1UYIA 2YKJA 4B3RI 4GT8A 4USKA 4GKJE 4HYPA 3Q5LA 5DNLA 2Z5CB 4IZKA 2PNZB 3B4TA 2UUBE 4LFBI 1IBME 4DR6I 3K99A 4IZJB 4CWTA 2BREA 4YKWA 4JI0I 2XHXA 5DROA 4DR2I 1N36E 3BM9A 4EM7A 4AIMA 2K5BA 4OO1E 2C37A 3K1JA 4MYUA 4YHHE 1IXMA 3J80C 4FWGA 3WHAA 3VHAA 4E02A 1KIJA 2FTKA 2HFSA 3PYDA 1USVA 1HNWI 3A0TA 3DD6A 3O2FA 5K36F 4DV5I 4B3TE 3H80A 3JZ3A 2AJ4A 4XKOA 1XNRE 4OZEA 1PIEA 3QT8A 3BMYA 4LF8I 1IBLE 4JV5I 2Z5CA 4NXME 4ASFA 4AS9A 2UXBI 2PNZA 2GQ0A 2EFGA 2J7KA 5C0XB 4IZJA 1TH8A 2CGEA 2IERA 1S4EA 1Z0BA 3M6AA 3M7ND 2AKPA 2CGFA 4OO1F 4P7AA 1Y8OA 4LWHA 2JEBA 4ASGA 4CWQA 2IOPA 3WU3A 3J7AM 2F4VI 4HXZA 2YGFA 1UDOA 4LF5I 1FKAE 2JT2A 4XIQA 2A2CA 4JI2I 4XC0A 4EMVA 1I58A 2YEAA 3LMMA 4GKJI 3R4NA 4MPCA 4O0BA 4QPJA 4MYTA 5L3JA 4QNKA 2HK3A 3EHFA 3EKRA 1I5AA 1BGQA 5CPHA 2UUBI 4I3HA 4PRVA 5C0XA 4DV6E 3QTFA 4L94A 3D2RA 2XK2A 4AM3A 2BA0D 3P06A 1UYDA 1ZM2A 4MQYA 1N36I 2Q8FA 2F1DA 4DUHA 4LWFA 4YHHI 3R92A 4B7PA 2H55A 4O05A 4BQJA 5M4EA 2HFUA 3HULA 1EI1A 4GQUA 4DUYE 1UY9A 1XNQE 3HHUA 4ASBA 2IORA 2YEEA 2YK2A 4AIDA 4LCFA 1Y5YA 2BU2A 5LMNE 4B3TI 3PYFA 4JI8E 4HY6A 2IWUA 4I5SA 2O1UA 1XNRI 1AH8A 1BYQA 4YKXA 4B6CA 2VCJA 4P52A 5BODA 3M85D 4X65E 1IBLI 4NXMI 2DEJA 5IDMA 4DV4E 4EGKA 4X62E 2BYIA 1ZM3A 4FPPA 1AH6A 1Z59A 1UYHA 4JASA 3U2KA 4LWEA 1UYGA 5D7CA 1N0VC 4LF9E 4XITA 3HJCA 1YS3A 2BTZA 4BXIA 2HKJA 4XDMA 1GJVA 5GGZA 2C2AA 1DARA 2XDLA 5LL6R 2WI5A 4LWIA 1ZW9A 5IWAI 2Q8IA 4IFDF 1WUUA 4UROA 4MU4A 2YECA 4PL9A 4Q20A 4DV1E 2GO4A 2YEGA 4X66E 4ISAA 2JEAB 4DV0E 1QY8A 3GIEA 3GMEA 2J65A 4FCPA 4LF4E 2XX4A 3GIFA 1ELOA 3B28A 2O3ZA 4MPNA 1AMWA 3K60A 4Z7YA 4DV6I 3CRLA 3J80Q 4KSHA 4JI4E 3TZ2A 4DR6E 2WERA 4BA2B 5M4KA 3RLPA 3NZKA 4OO1C 4WUCA 4FCQA 4HYMA 3H4LA 4DUYI 1XNQI 2WNRA 3T0ZA 1QZRA 4LPBA 1Z0WA 2XJGA 5JEAD 3SL2A 4JI8I 2ZKJA 4U7NA 4CWPA 1HNWE 1AJ6A 3K97A 3CYGA 2YKCA 4E01A 1GKZA 3LNUA 5M4NA 1FNMA 4DV4I 1MU5A 4X62I 1VISA 4YKUA 2ZBKB 4LF8E 4J3DA 3M7NG 2YE2A 4DPUA 3B25A 2WI3A 1ZWHA 4IZKB 2NN6B 4LF9I 4V26A 2CH4A 4BA2A 4MU0A 5BR8E 4IFDD 1YETA 4UT4A 3J81C 4OX9E 3OWBA 3TZ4A 3PRYA 2C37B 2QG0A 1KTVA 1MG7A 2VESA 4KHPE 2QFOA 2ZDXA 3PS2A 4DV1I 2FYPA 3KE6A 4R3AA 2JJCA 3TZ5A 4X66I 4DV3E 3A0RA 4DV0I 4LF5E 4GCZA 2CCUA 3J7AG 4LP0A 1F51A 1FI4A 2GO3A 2BA0G 5GMEA 5DRRA 4IZJD 4GQTA 2V8PA 2VF3A 3R91A 2ESAA 3U1YA 1UYCA 2YE9A 2XHTA 1KVKA 2NN6A 3EHJA 4JI4I 1UDSA 2YEHA 4U3DA 4JG4A 3PS1A 3CWVA 2IESA 3D4JA 2XDUA 1XMOE 1L0OA 3T1YE 1XXEA 2BYHA 3HEKA 4DPTA 2JKIA 3VHCA 2JEBB 4JI3I 4LF7E 1EA6A 1Y4UA 4JI1E 4YKQA 3B26A 2R3VA 5CTXA 3OWDA 2WI7A 4H7QA 2WI2A 2E5LI 2Q8GA 5C0XD 3ZZUA 1OYRA 1KZNA 4AWQA 4DPXA 2CVEA 4N3OA 4LFCE 3T0HA 4MU1A 3FV5A 1UDQA 5BR8I 3IEDA 2V34A 3T1HI 4OX9I 1HNXE 3B8HA 2VQEE 4DU8A 3D36A 2E1RA 4MPEA 2NPFA 4KHPI 4IS9A 3ZKDA 4H85A 2PNMA 5J6AA 3G75A 3K17A 4JI5E 4BIZA 2YEFA 4NXNE 2DEIA 3Q5KA 2HHHE 4YKZA 5IWAE 4X64E 4FMTA 4DV3I 4DUZE 5F3KA 1BXDA 1N33E 5JEAE 2XD6A 1ZM4A 5J71A 2C39B 5A2QC 2YJWA 3ZXQA 1XMOI 3T1YI 4LF6E 4L93A 1R6LA 4KQVA 4O07A 4JYAE 1VI7A 3H1CA 1THNA 2ZM6E 2VW5A 5EL9A 4LF7I 1FJGE 4AQYE 4IFDE 2IWXA 2YE3A 2YE4A 2YEIA 1UYFA 3DGEA 3PEHA 3U67A 4JI1I 5IT9C 2XX2A 3HYYA 3CDIA 4ED4A 5CTUA 4FCRA 2LJPA 1PVGA 2BT0A 2FWYA 1NHJA 1QYEA 4EGIA 2VWCA 3RLQA 5JEAF 3J81Q 2C39A 2BZ5A 2VQFI 4LFCI 2YE8A 1TC0A 3GIGA 2NN6F 5FNFA 2O1WA 3HKMA 5C93A 4RPFA 1HNXI 2VQEI 1U2RA 1TC6A 2YGAA 4MP7A 2H8MA 2YK9A 2QG2A 3CDJA 1H7SA 2BM1A 4JI5I 2XCMA 4NXNI 4U7OA 5M4HA 2HHHI 1Y4SA 4X64I 4MB9A 2WNRB 3WU5A 1YC1A 4DUZI 1YT2A 4YKRA 1Z5AA 3T10A 4O04A 4DR1E 3V2UC 5K36C 2XX5A 4XIRA 2YEJA 3TTZA 1N33I 3KRNA 5K36B 2Z5BB 1YSZA 2YEBA 1ZM9A 3VADA 2R42A 2C1GA 2E0AA 3PYEA 2YEDA 3G7BA 3U2DA 1N0UA 3WU4A 3A0WA 5D6QA 4NH8A 3A0YA 4KFGA 5EKWA 5C0XE 3Q5JA 4KTNA 1Z0CA 4B3ME 4LF6I 2ZDYA 3O0IA 3QT7A 4JYAI 1I5CA 3FT5A 2XEXA 2UXDE 4URNA 1P42A 3Q6MA 3WU6A 2CZ9A 2ZM6I 4DR5E 4HACB 1FJGI 4OO1B 4AQYI 1UYEA 1H74A 3NMQA 4HZ5A 5M4PA 1UY7A 2YE6A 3TZ0A 4ASAA 4JI3E 4BIUA 4M1KA 4JAUA 1OYSA 1E3PA 1IBKE 4WUBA 5FLXC 4OKGA 4U3BA 5K36A 2Z5BA 1YERA 3O6OA 4JQLA 2UXCE 1U2OA 2NN6D 2E5LE 4FW5A 5FNCA 4URLA 3C11A 3QDDA 1A4HA 3A0ZA 2BV3A 4W7TA 5C0XF 5IN9A 3B78A 3R4MA 4FWHA 1Y6ZA 1H7UA 3MNRP 2CG9A 3Q1QA 4E00A 1FWKA 2BR2A 4EMDA 3T1HE 2QF6A 4HACA 3K98A 4GEEA 4OO1A 5JENA 4WUDA 3ZM7A 3JAMC 4CWNA 4CWFA 3R4OA 2BA1D 4DR1I 5CTWA 1KKHA 3P3CA 2V2VA 1HR0E 4P8OA 4MOTA 4YY3E 4DR4I 5A2QQ 1B3QA 4X9LA 1TIDA 3S5TA 5JEAC 4MU3A 3U1KA 4FW3A 4FW4A 4FW9A 4LCGA 4DPWA 3PEJA 3QT5A 1I94I 5ELWA 2WI6A 4XD8A 3L7ZA 5FNDA 4V25A 4LFAE 1YT1A 2V2QA 1FWLA 5LMUI 1YSRA 4DV2E 3C0EA 3CRKA 2HCHA 4B3MI 2WI4A 1Y8NA 4LPFA 1BKNA 5IT9Q 2UXDI 3T2SA 4PU9A 4XKKA 5CTYA 4DR5I 4DR3I 2CCSA 1OSFA 2YE5A 3OMUA 4DR7E 4DXLA 5BOCA 4IFDC 4NH7A 2C38B 1I5BA 4YKTA 2A2DA 3M85G 1IBKI 1HK7A 2EXLA 3HYZA 1UDNA 2UWDA 1S16A 2UXCI 4LWGA 3GONA 3OW6A 2BU5A 1J5EE 3PS3A 1GKXA 4CWSA 2YKIA 1YC3A 1HNZE 2GFDA 2VQFE 4E72A 4UTGA 1US7A 1Y8PA 4MBCA 3ZZTA 1H72C 1Z5CA 3QT6A 4FWDA 2C1IA 3EKOA 1NHIA 4HXWA 4FW6A 1USUA 2UU9E 2C38A 1YESA 4IFDA 2BRCA 1YH8A 1HR0I 3RKZA 2O1TA 1AM1A 4YY3I 1OYPA 1U0ZA 3B24A 4LOMA 4JI6E 4EEHA 3V5RA 2YI5A 4YKYA 4AWPA 3T1KA 4NH9A 4DV7E 4LFAI 2YKEA 5M4MA 4DV2I 5C0XC 2NN6E 2YGEA 3GIGB 1OJ4A 3Q6NA 2JE6B 2BSMA 3OPDA 2HKEA 3UHMA 1I59A 4EGHA 5FLXQ 4QPKA 1I5DA 4DR7I 1N32E 2PO0B 2XJXA 2YI6A 3D0BA 3G7EA 4XIPA 5FWKA 3GCMA 3EHHA 2WW4A 3P3EA 1N34E 2XDKA 4AWOA 1JM6A 1UEKA 1A6FA 2IOQA 2UUCE 1J5EI 2GS8A 3ZXOA 1YT0A 5IDJA 4XCLA 2OI2A 1HNZI 4KSGA 3JAMQ 4CWOA 1IBMI 1R6MA 3B82A 2JE6A 4EFTA 1RHYA 2WEQA 2BA1G 2ZITA 1MX0A 2XABA 2PNRA 3EHGA 4GFNA 2PO0A 2UU9I 2WI1A 3INXA 4URMA 2X36A 1Z0GA 4CE3A 2Q2EB 2UUAE 1B62A 1Z0EA 3F0NA 5DNXA 5K36D 2GQPA 1UYKA 3OTOE 4BA1B 4FW7A 4CWRA 4JI6I 1E3HA 1D6TA 1ID0A 4CE1A 2AE8A 3TUHA 3WQ9A 4DR4E 4O09A 2PNLA 4FN5A 4JI7E 4KP4A 3ZKBA 4DV7I 4MDTA 1TBWA 2WP8B 1I94E 4R1FA 3P3GA 4B3SE 2FWZA 2YKBA 1YC4A 3ZZ0A 3CGYA 3R4PA 4K4OA 4GKKE 5LMUE 1TILA 4L91A 4K0KE 2VCIA 4OO1D 4XKAA 4NBQA 2YI7A 2WEPA 3HZ5A 4HZ0A 2XJJA 1N32I 1R62A 2BR2B 4DR3E
chains in the Genus database with same CATH topology
2BM0A 4XTJA 5D7RA 1N34I 3FT8A 1UY6A 3LTOA 4XE2A 2UUCI 3INWA 4L8ZA 1XMQE 4DPYA 4GGLA 4BQGA 1UYMA 2XDXA 4DZYA 1NHHA 2YE7A 1K47A 4USMA 4B3RE 2IWSA 4L90A 1NZ0A 3K85A 2BU7A 2BU8A 5D6PA 1ZXMA 4DU7A 4LFBE 4XCJA 3RLRA 2HG1A 2V2ZA 4JI0E 1S14A 1UY8A 4BAEA 3A0XA 4DR2E 4U93A 5D7DA 2XHRA 2UUAI 5F5RA 3OTOI 1H73A 4R3MA 2YI0A 5LMNI 1ZXNA 3VHDA 4MP2A 1PKPA 4HY1A 4JI7I 4PRXA 4X65I 4DV5E 2YJXA 5GMDA 1RR9A 4B3SI 3HZ1A 4JAVA 1B63A 4JV5E 2FXSA 4GKKI 2O1VA 3CGZA 1Z0VA 4K0KI 2UXBE 2BU6A 3B27A 1UYLA 4CE2A 5CF0A 4EFUA 1XHKA 1Z5BA 2Q8HA 4ZKIA 3PYGA 2CCTA 4Z7CA 1RREA 1Z0TA 2XDSA 1XMQI 2F4VE 2HK2A 4H81A 3LPSA 4ZVIA 2Z5EA 4JI2E 4LF4I 2X7IA 2YKJA 1UYIA 4GT8A 4XCLA 4B3RI 4USKA 4GKJE 4HYPA 3Q5LA 2Z5CB 4IZKA 2UUBE 4LFBI 3K99A 1IBME 4DR6I 4CWTA 4IZJB 2BREA 4YKWA 4JI0I 2XHXA 4DR2I 1N36E 3BM9A 4EM7A 2K5BA 4YHHE 3K1JA 4MYUA 3J80C 4FWGA 3WHAA 3VHAA 4E02A 1KIJA 2HFSA 3PYDA 1USVA 1HNWI 3A0TA 3O2FA 4DV5I 4B3TE 3H80A 3JZ3A 2AJ4A 4XKOA 1XNRE 1PIEA 3QT8A 3BMYA 4LF8I 1IBLE 4JV5I 2Z5CA 4NXME 4ASFA 4AS9A 2UXBI 2GQ0A 2EFGA 2J7KA 1TH8A 4IZJA 2CGEA 1S4EA 1Z0BA 3M6AA 2AKPA 2CGFA 4P7AA 1Y8OA 4LWHA 4ASGA 4CWQA 2IOPA 3WU3A 3J7AM 2F4VI 4HXZA 2YGFA 4LF5I 1FKAE 4XIQA 2A2CA 4JI2I 4XC0A 4EMVA 1I58A 2YEAA 4GKJI 3R4NA 4MPCA 4O0BA 4QPJA 4MYTA 5L3JA 2HK3A 3EHFA 3EKRA 1I5AA 1BGQA 5CPHA 2UUBI 4I3HA 4PRVA 3QTFA 4DV6E 4L94A 3D2RA 2XK2A 3P06A 1UYDA 1ZM2A 1N36I 2Q8FA 4DUHA 4LWFA 4YHHI 3R92A 4B7PA 2H55A 4O05A 4BQJA 5M4EA 2HFUA 3HULA 1EI1A 4DUYE 1UY9A 1XNQE 3HHUA 4ASBA 2IORA 2YEEA 2YK2A 2BU2A 5LMNE 4B3TI 3PYFA 4JI8E 4HY6A 2IWUA 4I5SA 2O1UA 1XNRI 1AH8A 1BYQA 4YKXA 4B6CA 2VCJA 4P52A 5BODA 4X65E 1IBLI 4NXMI 2DEJA 5IDMA 4DV4E 4EGKA 4X62E 2BYIA 1ZM3A 4FPPA 1AH6A 1Z59A 1UYHA 4JASA 3U2KA 4LWEA 1UYGA 5D7CA 1N0VC 4LF9E 4XITA 3HJCA 1YS3A 2BTZA 4BXIA 2HKJA 4XDMA 1GJVA 5GGZA 2C2AA 1DARA 2XDLA 5LL6R 2WI5A 4LWIA 1ZW9A 5IWAI 2Q8IA 1WUUA 4UROA 2YECA 4PL9A 4Q20A 4DV1E 2YEGA 4X66E 4DV0E 1QY8A 3GIEA 4FCPA 4LF4E 2XX4A 3GIFA 1ELOA 3B28A 4MPNA 1AMWA 3K60A 4Z7YA 4DV6I 3CRLA 3J80Q 4KSHA 4JI4E 3TZ2A 4DR6E 2WERA 5M4KA 3RLPA 4WUCA 4FCQA 4HYMA 3H4LA 4DUYI 1XNQI 3T0ZA 1QZRA 4LPBA 1Z0WA 2XJGA 3SL2A 4JI8I 2ZKJA 4U7NA 4CWPA 1HNWE 1AJ6A 3K97A 2YKCA 4E01A 1GKZA 3LNUA 5M4NA 1FNMA 4DV4I 1MU5A 4X62I 1VISA 4YKUA 2ZBKB 4LF8E 2YE2A 4DPUA 3B25A 2WI3A 1ZWHA 4IZKB 4LF9I 4V26A 2CH4A 5BR8E 1YETA 4UT4A 3J81C 4OX9E 3OWBA 3TZ4A 3PRYA 2QG0A 1KTVA 1MG7A 4KHPE 2QFOA 2ZDXA 4DV1I 2FYPA 3KE6A 4R3AA 2JJCA 3TZ5A 4X66I 4DV3E 3A0RA 4DV0I 4LF5E 4GCZA 2CCUA 3J7AG 4LP0A 1FI4A 5GMEA 4IZJD 4GQTA 2V8PA 2VF3A 3R91A 2ESAA 1UYCA 2YE9A 2XHTA 1KVKA 3EHJA 4JI4I 2YEHA 4JG4A 3CWVA 3D4JA 2XDUA 1XMOE 1L0OA 3T1YE 2BYHA 3HEKA 4DPTA 2JKIA 3VHCA 4JI3I 4LF7E 1EA6A 1Y4UA 4JI1E 4YKQA 3B26A 2R3VA 5CTXA 3OWDA 2WI7A 4H7QA 2WI2A 2E5LI 2Q8GA 3ZZUA 1KZNA 4AWQA 4DPXA 4N3OA 4LFCE 3T0HA 3FV5A 5BR8I 3IEDA 2V34A 3T1HI 4OX9I 1HNXE 3B8HA 2VQEE 4DU8A 3D36A 2E1RA 4MPEA 2NPFA 4KHPI 3ZKDA 5J6AA 4H85A 2PNMA 3G75A 3K17A 4JI5E 4BIZA 2YEFA 4NXNE 2DEIA 3Q5KA 2HHHE 4YKZA 5IWAE 4X64E 4FMTA 4DV3I 4DUZE 5F3KA 1BXDA 1N33E 2XD6A 1ZM4A 5J71A 5A2QC 2YJWA 3ZXQA 1XMOI 3T1YI 4LF6E 4L93A 4O07A 4KQVA 4JYAE 1THNA 2ZM6E 2VW5A 4LF7I 1FJGE 4AQYE 2IWXA 2YE3A 2YEIA 2YE4A 3DGEA 1UYFA 3PEHA 3U67A 4JI1I 5IT9C 2XX2A 3HYYA 4ED4A 5CTUA 4FCRA 2LJPA 1PVGA 2BT0A 2FWYA 1NHJA 1QYEA 4EGIA 2VWCA 3RLQA 3J81Q 2BZ5A 2VQFI 4LFCI 2YE8A 1TC0A 3GIGA 5FNFA 2O1WA 5C93A 4RPFA 1HNXI 2VQEI 1U2RA 1TC6A 2YGAA 4MP7A 2H8MA 2YK9A 2QG2A 4JI5I 1H7SA 2BM1A 4U7OA 2XCMA 4NXNI 5M4HA 2HHHI 1Y4SA 4X64I 4MB9A 3WU5A 1YC1A 4DUZI 1YT2A 4YKRA 1Z5AA 3T10A 4O04A 4DR1E 3V2UC 2XX5A 4XIRA 3TTZA 2YEJA 1N33I 2Z5BB 1YSZA 2YEBA 1ZM9A 3VADA 2R42A 2E0AA 2YEDA 3PYEA 3G7BA 3U2DA 1N0UA 3WU4A 3A0WA 5D6QA 4NH8A 3A0YA 4KFGA 3Q5JA 4KTNA 1Z0CA 4B3ME 4LF6I 2ZDYA 3O0IA 3QT7A 4JYAI 1I5CA 3FT5A 2XEXA 2UXDE 4URNA 3Q6MA 3WU6A 2CZ9A 2ZM6I 4DR5E 4HACB 1FJGI 3NMQA 4AQYI 1UYEA 1H74A 4HZ5A 5M4PA 1UY7A 2YE6A 3TZ0A 4ASAA 4JI3E 4BIUA 4M1KA 4JAUA 1IBKE 4WUBA 5FLXC 1YERA 3O6OA 2Z5BA 4JQLA 2UXCE 1U2OA 2E5LE 5FNCA 4URLA 3C11A 3QDDA 1A4HA 3A0ZA 2BV3A 4W7TA 5IN9A 3B78A 3R4MA 4FWHA 1Y6ZA 1H7UA 3MNRP 2CG9A 3Q1QA 4E00A 1FWKA 4EMDA 3T1HE 4GEEA 2QF6A 4HACA 3K98A 4WUDA 3ZM7A 3JAMC 4CWNA 4CWFA 3R4OA 4DR1I 5CTWA 1KKHA 2V2VA 1HR0E 4P8OA 4MOTA 4YY3E 4DR4I 5A2QQ 1B3QA 4X9LA 1TIDA 4FW9A 3PEJA 4DPWA 3QT5A 1I94I 4XD8A 2WI6A 5FNDA 4V25A 4LFAE 1YT1A 2V2QA 1FWLA 5LMUI 1YSRA 4DV2E 3C0EA 3CRKA 2HCHA 4B3MI 2WI4A 1Y8NA 1BKNA 5IT9Q 2UXDI 3T2SA 4PU9A 4XKKA 5CTYA 4DR5I 4DR3I 2CCSA 1OSFA 2YE5A 3OMUA 4DR7E 4DXLA 5BOCA 4NH7A 1I5BA 4YKTA 2A2DA 2EXLA 1IBKI 1HK7A 3HYZA 2UWDA 1S16A 2UXCI 4LWGA 3GONA 3OW6A 2BU5A 1J5EE 4CWSA 1GKXA 2YKIA 1YC3A 1HNZE 2GFDA 2VQFE 4UTGA 1US7A 1Y8PA 4MBCA 3ZZTA 1H72C 1Z5CA 3QT6A 4FWDA 4HXWA 3EKOA 1NHIA 1USUA 2UU9E 1YESA 2BRCA 1HR0I 3RKZA 2O1TA 1AM1A 4YY3I 1U0ZA 3B24A 4JI6E 4EEHA 3V5RA 2YI5A 4YKYA 4AWPA 3T1KA 4NH9A 4DV7E 4LFAI 2YKEA 5M4MA 4DV2I 2YGEA 3GIGB 1OJ4A 3Q6NA 3OPDA 2BSMA 2HKEA 1I59A 4EGHA 5FLXQ 4QPKA 1I5DA 4DR7I 1N32E 3D0BA 2XJXA 2YI6A 3G7EA 4XIPA 5FWKA 3EHHA 2WW4A 1N34E 2XDKA 4AWOA 1JM6A 1UEKA 1A6FA 2IOQA 2UUCE 1J5EI 2GS8A 3ZXOA 1YT0A 5IDJA 2OI2A 1HNZI 4KSGA 3JAMQ 4CWOA 1IBMI 3B82A 4EFTA 2WEQA 2ZITA 1MX0A 2XABA 2PNRA 3EHGA 4GFNA 3INXA 2UU9I 2WI1A 4URMA 2X36A 1Z0GA 4CE3A 2Q2EB 2UUAE 1B62A 1Z0EA 3F0NA 2GQPA 1UYKA 3OTOE 4CWRA 4JI6I 1D6TA 1ID0A 4CE1A 3TUHA 3WQ9A 4DR4E 4O09A 2PNLA 4FN5A 4JI7E 4KP4A 3ZKBA 4DV7I 1TBWA 1I94E 4R1FA 4B3SE 2FWZA 2YKBA 1YC4A 3ZZ0A 3CGYA 3R4PA 4K4OA 4GKKE 5LMUE 1TILA 4L91A 4K0KE 2VCIA 4XKAA 4HZ0A 2YI7A 2WEPA 3HZ5A 2XJJA 1N32I 1R62A 4DR3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM0 A;  4XTJ A;  5D7R A;  1N34 I;  3FT8 A;  1UY6 A;  3LTO A;  4XE2 A;  2UUC I;  3INW A;  4L8Z A;  1XMQ E;  4DPY A;  4GGL A;  4BQG A;  1UYM A;  2XDX A;  4DZY A;  1NHH A;  2YE7 A;  1K47 A;  4USM A;  4B3R E;  2IWS A;  4L90 A;  1NZ0 A;  2BU7 A;  2BU8 A;  5D6P A;  1ZXM A;  4DU7 A;  4LFB E;  4XCJ A;  3RLR A;  2HG1 A;  2V2Z A;  4JI0 E;  1S14 A;  1UY8 A;  4BAE A;  3A0X A;  4DR2 E;  4U93 A;  5D7D A;  2XHR A;  2UUA I;  5F5R A;  3OTO I;  1H73 A;  4R3M A;  2YI0 A;  5LMN I;  1ZXN A;  3VHD A;  4MP2 A;  1PKP A;  4HY1 A;  4JI7 I;  4PRX A;  4X65 I;  4DV5 E;  2YJX A;  5GMD A;  1RR9 A;  4B3S I;  3HZ1 A;  4JAV A;  1B63 A;  4JV5 E;  2FXS A;  4GKK I;  2O1V A;  3CGZ A;  1Z0V A;  4K0K I;  2UXB E;  2BU6 A;  3B27 A;  1UYL A;  4CE2 A;  5CF0 A;  4EFU A;  1XHK A;  1Z5B A;  2Q8H A;  4ZKI A;  3PYG A;  2CCT A;  4Z7C A;  1RRE A;  1Z0T A;  2XDS A;  1XMQ I;  2F4V E;  2HK2 A;  4H81 A;  3LPS A;  4ZVI A;  4JI2 E;  4LF4 I;  2YKJ A;  2X7I A;  4GT8 A;  1UYI A;  4XCL A;  4B3R I;  4USK A;  4GKJ E;  4HYP A;  3Q5L A;  2UUB E;  4LFB I;  3K99 A;  1IBM E;  4DR6 I;  4CWT A;  2BRE A;  4YKW A;  4JI0 I;  2XHX A;  4DR2 I;  1N36 E;  3BM9 A;  4EM7 A;  2K5B A;  4YHH E;  3K1J A;  4MYU A;  3J80 C;  4FWG A;  3WHA A;  3VHA A;  4E02 A;  1KIJ A;  2HFS A;  3PYD A;  1HNW I;  3A0T A;  3O2F A;  4DV5 I;  4B3T E;  3H80 A;  3JZ3 A;  2AJ4 A;  4XKO A;  1XNR E;  1PIE A;  3QT8 A;  3BMY A;  4LF8 I;  1IBL E;  4JV5 I;  4ASF A;  4NXM E;  4AS9 A;  2UXB I;  2EFG A;  2J7K A;  1TH8 A;  1S4E A;  1Z0B A;  3M6A A;  2AKP A;  2CGF A;  4P7A A;  1Y8O A;  4LWH A;  4ASG A;  4CWQ A;  2IOP A;  3WU3 A;  3J7A M;  2F4V I;  4HXZ A;  2YGF A;  4LF5 I;  1FKA E;  4XIQ A;  2A2C A;  4JI2 I;  4XC0 A;  4EMV A;  1I58 A;  2YEA A;  4GKJ I;  3R4N A;  4MPC A;  4O0B A;  4QPJ A;  4MYT A;  5L3J A;  2HK3 A;  3EHF A;  3EKR A;  1I5A A;  1BGQ A;  5CPH A;  2UUB I;  4I3H A;  4PRV A;  3QTF A;  4DV6 E;  4L94 A;  3D2R A;  2XK2 A;  1UYD A;  1ZM2 A;  1N36 I;  2Q8F A;  4DUH A;  4LWF A;  4YHH I;  3R92 A;  4B7P A;  2H55 A;  4O05 A;  4BQJ A;  5M4E A;  2HFU A;  3HUL A;  1EI1 A;  4DUY E;  1UY9 A;  1XNQ E;  3HHU A;  4ASB A;  2IOR A;  2YEE A;  2YK2 A;  2BU2 A;  5LMN E;  4B3T I;  3PYF A;  4JI8 E;  4HY6 A;  2IWU A;  4I5S A;  1XNR I;  1AH8 A;  1BYQ A;  2O1U A;  4YKX A;  4B6C A;  2VCJ A;  4P52 A;  5BOD A;  4X65 E;  1IBL I;  4NXM I;  2DEJ A;  5IDM A;  4DV4 E;  4EGK A;  4X62 E;  2BYI A;  1ZM3 A;  4FPP A;  1AH6 A;  1Z59 A;  1UYH A;  4JAS A;  3U2K A;  4LWE A;  1UYG A;  5D7C A;  1N0V C;  4LF9 E;  4XIT A;  1YS3 A;  2BTZ A;  4BXI A;  2HKJ A;  4XDM A;  1GJV A;  5GGZ A;  2C2A A;  1DAR A;  2XDL A;  5LL6 R;  2WI5 A;  4LWI A;  1ZW9 A;  5IWA I;  2Q8I A;  1WUU A;  4URO A;  2YEC A;  4PL9 A;  4Q20 A;  4DV1 E;  2YEG A;  4X66 E;  4DV0 E;  1QY8 A;  3GIE A;  4FCP A;  4LF4 E;  2XX4 A;  3GIF A;  1ELO A;  3B28 A;  4MPN A;  1AMW A;  3K60 A;  4Z7Y A;  4DV6 I;  3CRL A;  3J80 Q;  4KSH A;  4JI4 E;  3TZ2 A;  4DR6 E;  2WER A;  5M4K A;  3RLP A;  4WUC A;  4FCQ A;  4HYM A;  3H4L A;  4DUY I;  1XNQ I;  3T0Z A;  1QZR A;  4LPB A;  1Z0W A;  2XJG A;  3SL2 A;  4JI8 I;  2ZKJ A;  4U7N A;  4CWP A;  1HNW E;  1AJ6 A;  3K97 A;  2YKC A;  4E01 A;  1GKZ A;  3LNU A;  5M4N A;  1FNM A;  4DV4 I;  1MU5 A;  4X62 I;  1VIS A;  4YKU A;  2ZBK B;  4LF8 E;  2YE2 A;  4DPU A;  3B25 A;  2WI3 A;  1ZWH A;  4LF9 I;  4V26 A;  2CH4 A;  5BR8 E;  1YET A;  4UT4 A;  3J81 C;  4OX9 E;  3OWB A;  3TZ4 A;  2QG0 A;  1KTV A;  1MG7 A;  4KHP E;  2QFO A;  2ZDX A;  4DV1 I;  2FYP A;  3KE6 A;  4R3A A;  2JJC A;  3TZ5 A;  4X66 I;  4DV3 E;  3A0R A;  4DV0 I;  4LF5 E;  4GCZ A;  2CCU A;  3J7A G;  4LP0 A;  1FI4 A;  5GME A;  4GQT A;  2V8P A;  2VF3 A;  3R91 A;  2ESA A;  1UYC A;  2YE9 A;  2XHT A;  1KVK A;  3EHJ A;  4JI4 I;  2YEH A;  4JG4 A;  3CWV A;  3D4J A;  2XDU A;  1XMO E;  1L0O A;  3T1Y E;  2BYH A;  3HEK A;  4DPT A;  2JKI A;  3VHC A;  4JI3 I;  4LF7 E;  1EA6 A;  4JI1 E;  1Y4U A;  4YKQ A;  3B26 A;  2R3V A;  5CTX A;  3OWD A;  2WI7 A;  4H7Q A;  2WI2 A;  2E5L I;  2Q8G A;  3ZZU A;  1KZN A;  4AWQ A;  4DPX A;  4LFC E;  3T0H A;  3FV5 A;  5BR8 I;  3IED A;  2V34 A;  3T1H I;  4OX9 I;  1HNX E;  3B8H A;  2VQE E;  4DU8 A;  3D36 A;  2E1R A;  4MPE A;  2NPF A;  4KHP I;  3ZKD A;  5J6A A;  4H85 A;  3G75 A;  3K17 A;  4JI5 E;  4BIZ A;  2YEF A;  4NXN E;  2DEI A;  3Q5K A;  2HHH E;  4YKZ A;  5IWA E;  4X64 E;  4FMT A;  4DV3 I;  4DUZ E;  5F3K A;  1BXD A;  1N33 E;  2XD6 A;  1ZM4 A;  5J71 A;  5A2Q C;  2YJW A;  3ZXQ A;  1XMO I;  3T1Y I;  4LF6 E;  4L93 A;  4O07 A;  4KQV A;  4JYA E;  1THN A;  2ZM6 E;  2VW5 A;  4LF7 I;  1FJG E;  4AQY E;  2IWX A;  2YE3 A;  2YEI A;  2YE4 A;  3DGE A;  1UYF A;  3PEH A;  3U67 A;  4JI1 I;  5IT9 C;  2XX2 A;  3HYY A;  4ED4 A;  5CTU A;  4FCR A;  2LJP A;  1PVG A;  2BT0 A;  2FWY A;  1NHJ A;  1QYE A;  4EGI A;  2VWC A;  3RLQ A;  3J81 Q;  2BZ5 A;  2VQF I;  4LFC I;  2YE8 A;  1TC0 A;  3GIG A;  5FNF A;  2O1W A;  5C93 A;  4RPF A;  1HNX I;  2VQE I;  1U2R A;  1TC6 A;  2YGA A;  4MP7 A;  2H8M A;  2YK9 A;  2QG2 A;  4JI5 I;  1H7S A;  2BM1 A;  4U7O A;  2XCM A;  4NXN I;  5M4H A;  2HHH I;  1Y4S A;  4X64 I;  4MB9 A;  3WU5 A;  1YC1 A;  4DUZ I;  1YT2 A;  4YKR A;  1Z5A A;  3T10 A;  4O04 A;  4DR1 E;  3V2U C;  2XX5 A;  4XIR A;  3TTZ A;  2YEJ A;  1N33 I;  1YSZ A;  2YEB A;  1ZM9 A;  3VAD A;  2R42 A;  2E0A A;  2YED A;  3PYE A;  3G7B A;  3U2D A;  1N0U A;  3WU4 A;  3A0W A;  5D6Q A;  4NH8 A;  3A0Y A;  4KFG A;  3Q5J A;  4KTN A;  1Z0C A;  4B3M E;  4LF6 I;  2ZDY A;  3O0I A;  3QT7 A;  4JYA I;  1I5C A;  3FT5 A;  2XEX A;  2UXD E;  4URN A;  3WU6 A;  2CZ9 A;  2ZM6 I;  4DR5 E;  4HAC B;  1FJG I;  3NMQ A;  4AQY I;  1UYE A;  1H74 A;  4HZ5 A;  5M4P A;  1UY7 A;  2YE6 A;  3TZ0 A;  4ASA A;  4JI3 E;  4BIU A;  4M1K A;  4JAU A;  1IBK E;  4WUB A;  5FLX C;  1YER A;  3O6O A;  4JQL A;  2UXC E;  1U2O A;  2E5L E;  5FNC A;  4URL A;  3C11 A;  3QDD A;  1A4H A;  3A0Z A;  2BV3 A;  4W7T A;  5IN9 A;  3B78 A;  3R4M A;  4FWH A;  1H7U A;  3MNR P;  3Q1Q A;  2CG9 A;  4E00 A;  1FWK A;  4EMD A;  3T1H E;  4GEE A;  2QF6 A;  4HAC A;  3K98 A;  4WUD A;  3ZM7 A;  3JAM C;  4CWN A;  4CWF A;  3R4O A;  4DR1 I;  5CTW A;  1KKH A;  1HR0 E;  2V2V A;  4P8O A;  4MOT A;  4YY3 E;  4DR4 I;  5A2Q Q;  1B3Q A;  4X9L A;  1TID A;  4FW9 A;  3PEJ A;  4DPW A;  3QT5 A;  1I94 I;  4XD8 A;  2WI6 A;  5FND A;  4V25 A;  4LFA E;  1YT1 A;  2V2Q A;  1FWL A;  5LMU I;  1YSR A;  4DV2 E;  3C0E A;  3CRK A;  2HCH A;  4B3M I;  2WI4 A;  1Y8N A;  1BKN A;  5IT9 Q;  2UXD I;  3T2S A;  4PU9 A;  4XKK A;  5CTY A;  4DR5 I;  4DR3 I;  2CCS A;  1OSF A;  2YE5 A;  3OMU A;  4DR7 E;  4DXL A;  5BOC A;  4NH7 A;  1I5B A;  4YKT A;  2A2D A;  2EXL A;  1IBK I;  3HYZ A;  2UWD A;  1S16 A;  2UXC I;  4LWG A;  3GON A;  3OW6 A;  2BU5 A;  1J5E E;  4CWS A;  1GKX A;  2YKI A;  1YC3 A;  1HNZ E;  2GFD A;  2VQF E;  4UTG A;  1US7 A;  1Y8P A;  4MBC A;  3ZZT A;  1H72 C;  1Z5C A;  3QT6 A;  4FWD A;  4HXW A;  3EKO A;  1NHI A;  2UU9 E;  1YES A;  2BRC A;  1HR0 I;  3RKZ A;  1AM1 A;  4YY3 I;  1U0Z A;  3B24 A;  4JI6 E;  4EEH A;  3V5R A;  2YI5 A;  4YKY A;  4AWP A;  3T1K A;  4NH9 A;  4DV7 E;  4LFA I;  2YKE A;  5M4M A;  4DV2 I;  2YGE A;  3GIG B;  1OJ4 A;  3OPD A;  2BSM A;  2HKE A;  1I59 A;  4EGH A;  5FLX Q;  4QPK A;  1I5D A;  4DR7 I;  1N32 E;  3D0B A;  2XJX A;  2YI6 A;  3G7E A;  4XIP A;  5FWK A;  3EHH A;  2WW4 A;  1N34 E;  2XDK A;  4AWO A;  1JM6 A;  1UEK A;  1A6F A;  2IOQ A;  2UUC E;  1J5E I;  2GS8 A;  3ZXO A;  1YT0 A;  5IDJ A;  2OI2 A;  1HNZ I;  4KSG A;  3JAM Q;  4CWO A;  1IBM I;  3B82 A;  4EFT A;  2WEQ A;  2ZIT A;  1MX0 A;  2XAB A;  2PNR A;  3EHG A;  4GFN A;  3INX A;  2UU9 I;  2WI1 A;  4URM A;  2X36 A;  1Z0G A;  4CE3 A;  2Q2E B;  2UUA E;  1B62 A;  1Z0E A;  3F0N A;  2GQP A;  1UYK A;  3OTO E;  4CWR A;  4JI6 I;  1D6T A;  1ID0 A;  4CE1 A;  3TUH A;  3WQ9 A;  4DR4 E;  4O09 A;  4FN5 A;  4JI7 E;  4KP4 A;  3ZKB A;  4DV7 I;  1TBW A;  1I94 E;  4R1F A;  4B3S E;  2FWZ A;  2YKB A;  1YC4 A;  3ZZ0 A;  3CGY A;  3R4P A;  4K4O A;  4GKK E;  5LMU E;  1TIL A;  4L91 A;  4K0K E;  2VCI A;  4XKA A;  4HZ0 A;  2YI7 A;  2WEP A;  3HZ5 A;  2XJJ A;  1N32 I;  1R62 A;  4DR3 E; 
#chains in the Genus database with same CATH topology
 2BM0 A;  4XTJ A;  5D7R A;  1Y60 A;  1N34 I;  4BA1 A;  3FT8 A;  1UY6 A;  3LTO A;  1YHC A;  4XE2 A;  2UUC I;  2PO2 B;  3INW A;  4L8Z A;  1XMQ E;  4DPY A;  4GGL A;  4BQG A;  1UYM A;  2XDX A;  4DZY A;  1NHH A;  2YE7 A;  1K47 A;  4USM A;  2WP8 A;  4B3R E;  3L7Z B;  2PO1 B;  2IWS A;  3P76 A;  4L90 A;  1NZ0 A;  3K85 A;  2BU7 A;  2BU8 A;  5D6P A;  1ZXM A;  4DU7 A;  4LFB E;  4XCJ A;  3RLR A;  4LCH A;  2HG1 A;  2V2Z A;  4QNJ A;  4JI0 E;  1S14 A;  1UY8 A;  4BAE A;  3A0X A;  4DR2 E;  4U93 A;  5D7D A;  2XHR A;  2UUA I;  5F5R A;  3OTO I;  1H73 A;  4R3M A;  2YI0 A;  5LMN I;  3GLL A;  2PO2 A;  1ZXN A;  3VHD A;  4MP2 A;  2JEA A;  1PKP A;  4HY1 A;  4JI7 I;  4PRX A;  4X65 I;  4DV5 E;  2YJX A;  5JEA B;  5GMD A;  1RR9 A;  5DRP A;  4B3S I;  2PO1 A;  3HZ1 A;  2NN6 C;  4JAV A;  1B63 A;  4JV5 E;  2FXS A;  4GKK I;  2O1V A;  3CGZ A;  1Z0V A;  4K0K I;  2UXB E;  2BU6 A;  3B27 A;  1UYL A;  4CE2 A;  5CF0 A;  4EFU A;  1XHK A;  1Z5B A;  5DRQ A;  2Q8H A;  4ZKI A;  4IFD B;  3PYG A;  2CCT A;  4Z7C A;  1RRE A;  1Z0T A;  2XDS A;  1XMQ I;  2F4V E;  2HK2 A;  4H81 A;  5K36 E;  3LPS A;  4ZVI A;  2Z5E A;  4JI2 E;  4LF4 I;  2X7I A;  2HHI A;  5JEA A;  1UYI A;  2YKJ A;  4B3R I;  4GT8 A;  4USK A;  4GKJ E;  4HYP A;  3Q5L A;  5DNL A;  2Z5C B;  4IZK A;  2PNZ B;  3B4T A;  2UUB E;  4LFB I;  1IBM E;  4DR6 I;  3K99 A;  4IZJ B;  4CWT A;  2BRE A;  4YKW A;  4JI0 I;  2XHX A;  5DRO A;  4DR2 I;  1N36 E;  3BM9 A;  4EM7 A;  4AIM A;  2K5B A;  4OO1 E;  2C37 A;  3K1J A;  4MYU A;  4YHH E;  1IXM A;  3J80 C;  4FWG A;  3WHA A;  3VHA A;  4E02 A;  1KIJ A;  2FTK A;  2HFS A;  3PYD A;  1USV A;  1HNW I;  3A0T A;  3DD6 A;  3O2F A;  5K36 F;  4DV5 I;  4B3T E;  3H80 A;  3JZ3 A;  2AJ4 A;  4XKO A;  1XNR E;  4OZE A;  1PIE A;  3QT8 A;  3BMY A;  4LF8 I;  1IBL E;  4JV5 I;  2Z5C A;  4NXM E;  4ASF A;  4AS9 A;  2UXB I;  2PNZ A;  2GQ0 A;  2EFG A;  2J7K A;  5C0X B;  4IZJ A;  1TH8 A;  2CGE A;  2IER A;  1S4E A;  1Z0B A;  3M6A A;  3M7N D;  2AKP A;  2CGF A;  4OO1 F;  4P7A A;  1Y8O A;  4LWH A;  2JEB A;  4ASG A;  4CWQ A;  2IOP A;  3WU3 A;  3J7A M;  2F4V I;  4HXZ A;  2YGF A;  1UDO A;  4LF5 I;  1FKA E;  2JT2 A;  4XIQ A;  2A2C A;  4JI2 I;  4XC0 A;  4EMV A;  1I58 A;  2YEA A;  3LMM A;  4GKJ I;  3R4N A;  4MPC A;  4O0B A;  4QPJ A;  4MYT A;  5L3J A;  4QNK A;  2HK3 A;  3EHF A;  3EKR A;  1I5A A;  1BGQ A;  5CPH A;  2UUB I;  4I3H A;  4PRV A;  5C0X A;  4DV6 E;  3QTF A;  4L94 A;  3D2R A;  2XK2 A;  4AM3 A;  2BA0 D;  3P06 A;  1UYD A;  1ZM2 A;  4MQY A;  1N36 I;  2Q8F A;  2F1D A;  4DUH A;  4LWF A;  4YHH I;  3R92 A;  4B7P A;  2H55 A;  4O05 A;  4BQJ A;  5M4E A;  2HFU A;  3HUL A;  1EI1 A;  4GQU A;  4DUY E;  1UY9 A;  1XNQ E;  3HHU A;  4ASB A;  2IOR A;  2YEE A;  2YK2 A;  4AID A;  4LCF A;  1Y5Y A;  2BU2 A;  5LMN E;  4B3T I;  3PYF A;  4JI8 E;  4HY6 A;  2IWU A;  4I5S A;  2O1U A;  1XNR I;  1AH8 A;  1BYQ A;  4YKX A;  4B6C A;  2VCJ A;  4P52 A;  5BOD A;  3M85 D;  4X65 E;  1IBL I;  4NXM I;  2DEJ A;  5IDM A;  4DV4 E;  4EGK A;  4X62 E;  2BYI A;  1ZM3 A;  4FPP A;  1AH6 A;  1Z59 A;  1UYH A;  4JAS A;  3U2K A;  4LWE A;  1UYG A;  5D7C A;  1N0V C;  4LF9 E;  4XIT A;  3HJC A;  1YS3 A;  2BTZ A;  4BXI A;  2HKJ A;  4XDM A;  1GJV A;  5GGZ A;  2C2A A;  1DAR A;  2XDL A;  5LL6 R;  2WI5 A;  4LWI A;  1ZW9 A;  5IWA I;  2Q8I A;  4IFD F;  1WUU A;  4URO A;  4MU4 A;  2YEC A;  4PL9 A;  4Q20 A;  4DV1 E;  2GO4 A;  2YEG A;  4X66 E;  4ISA A;  2JEA B;  4DV0 E;  1QY8 A;  3GIE A;  3GME A;  2J65 A;  4FCP A;  4LF4 E;  2XX4 A;  3GIF A;  1ELO A;  3B28 A;  2O3Z A;  4MPN A;  1AMW A;  3K60 A;  4Z7Y A;  4DV6 I;  3CRL A;  3J80 Q;  4KSH A;  4JI4 E;  3TZ2 A;  4DR6 E;  2WER A;  4BA2 B;  5M4K A;  3RLP A;  3NZK A;  4OO1 C;  4WUC A;  4FCQ A;  4HYM A;  3H4L A;  4DUY I;  1XNQ I;  2WNR A;  3T0Z A;  1QZR A;  4LPB A;  1Z0W A;  2XJG A;  5JEA D;  3SL2 A;  4JI8 I;  2ZKJ A;  4U7N A;  4CWP A;  1HNW E;  1AJ6 A;  3K97 A;  3CYG A;  2YKC A;  4E01 A;  1GKZ A;  3LNU A;  5M4N A;  1FNM A;  4DV4 I;  1MU5 A;  4X62 I;  1VIS A;  4YKU A;  2ZBK B;  4LF8 E;  4J3D A;  3M7N G;  2YE2 A;  4DPU A;  3B25 A;  2WI3 A;  1ZWH A;  4IZK B;  2NN6 B;  4LF9 I;  4V26 A;  2CH4 A;  4BA2 A;  4MU0 A;  5BR8 E;  4IFD D;  1YET A;  4UT4 A;  3J81 C;  4OX9 E;  3OWB A;  3TZ4 A;  3PRY A;  2C37 B;  2QG0 A;  1KTV A;  1MG7 A;  2VES A;  4KHP E;  2QFO A;  2ZDX A;  3PS2 A;  4DV1 I;  2FYP A;  3KE6 A;  4R3A A;  2JJC A;  3TZ5 A;  4X66 I;  4DV3 E;  3A0R A;  4DV0 I;  4LF5 E;  4GCZ A;  2CCU A;  3J7A G;  4LP0 A;  1F51 A;  1FI4 A;  2GO3 A;  2BA0 G;  5GME A;  5DRR A;  4IZJ D;  4GQT A;  2V8P A;  2VF3 A;  3R91 A;  2ESA A;  3U1Y A;  1UYC A;  2YE9 A;  2XHT A;  1KVK A;  2NN6 A;  3EHJ A;  4JI4 I;  1UDS A;  2YEH A;  4U3D A;  4JG4 A;  3PS1 A;  3CWV A;  2IES A;  3D4J A;  2XDU A;  1XMO E;  1L0O A;  3T1Y E;  1XXE A;  2BYH A;  3HEK A;  4DPT A;  2JKI A;  3VHC A;  2JEB B;  4JI3 I;  4LF7 E;  1EA6 A;  1Y4U A;  4JI1 E;  4YKQ A;  3B26 A;  2R3V A;  5CTX A;  3OWD A;  2WI7 A;  4H7Q A;  2WI2 A;  2E5L I;  2Q8G A;  5C0X D;  3ZZU A;  1OYR A;  1KZN A;  4AWQ A;  4DPX A;  2CVE A;  4N3O A;  4LFC E;  3T0H A;  4MU1 A;  3FV5 A;  1UDQ A;  5BR8 I;  3IED A;  2V34 A;  3T1H I;  4OX9 I;  1HNX E;  3B8H A;  2VQE E;  4DU8 A;  3D36 A;  2E1R A;  4MPE A;  2NPF A;  4KHP I;  4IS9 A;  3ZKD A;  4H85 A;  2PNM A;  5J6A A;  3G75 A;  3K17 A;  4JI5 E;  4BIZ A;  2YEF A;  4NXN E;  2DEI A;  3Q5K A;  2HHH E;  4YKZ A;  5IWA E;  4X64 E;  4FMT A;  4DV3 I;  4DUZ E;  5F3K A;  1BXD A;  1N33 E;  5JEA E;  2XD6 A;  1ZM4 A;  5J71 A;  2C39 B;  5A2Q C;  2YJW A;  3ZXQ A;  1XMO I;  3T1Y I;  4LF6 E;  4L93 A;  1R6L A;  4KQV A;  4O07 A;  4JYA E;  1VI7 A;  3H1C A;  1THN A;  2ZM6 E;  2VW5 A;  5EL9 A;  4LF7 I;  1FJG E;  4AQY E;  4IFD E;  2IWX A;  2YE3 A;  2YE4 A;  2YEI A;  1UYF A;  3DGE A;  3PEH A;  3U67 A;  4JI1 I;  5IT9 C;  2XX2 A;  3HYY A;  3CDI A;  4ED4 A;  5CTU A;  4FCR A;  2LJP A;  1PVG A;  2BT0 A;  2FWY A;  1NHJ A;  1QYE A;  4EGI A;  2VWC A;  3RLQ A;  5JEA F;  3J81 Q;  2C39 A;  2BZ5 A;  2VQF I;  4LFC I;  2YE8 A;  1TC0 A;  3GIG A;  2NN6 F;  5FNF A;  2O1W A;  3HKM A;  5C93 A;  4RPF A;  1HNX I;  2VQE I;  1U2R A;  1TC6 A;  2YGA A;  4MP7 A;  2H8M A;  2YK9 A;  2QG2 A;  3CDJ A;  1H7S A;  2BM1 A;  4JI5 I;  2XCM A;  4NXN I;  4U7O A;  5M4H A;  2HHH I;  1Y4S A;  4X64 I;  4MB9 A;  2WNR B;  3WU5 A;  1YC1 A;  4DUZ I;  1YT2 A;  4YKR A;  1Z5A A;  3T10 A;  4O04 A;  4DR1 E;  3V2U C;  5K36 C;  2XX5 A;  4XIR A;  2YEJ A;  3TTZ A;  1N33 I;  3KRN A;  5K36 B;  2Z5B B;  1YSZ A;  2YEB A;  1ZM9 A;  3VAD A;  2R42 A;  2C1G A;  2E0A A;  3PYE A;  2YED A;  3G7B A;  3U2D A;  1N0U A;  3WU4 A;  3A0W A;  5D6Q A;  4NH8 A;  3A0Y A;  4KFG A;  5EKW A;  5C0X E;  3Q5J A;  4KTN A;  1Z0C A;  4B3M E;  4LF6 I;  2ZDY A;  3O0I A;  3QT7 A;  4JYA I;  1I5C A;  3FT5 A;  2XEX A;  2UXD E;  4URN A;  1P42 A;  3Q6M A;  3WU6 A;  2CZ9 A;  2ZM6 I;  4DR5 E;  4HAC B;  1FJG I;  4OO1 B;  4AQY I;  1UYE A;  1H74 A;  3NMQ A;  4HZ5 A;  5M4P A;  1UY7 A;  2YE6 A;  3TZ0 A;  4ASA A;  4JI3 E;  4BIU A;  4M1K A;  4JAU A;  1OYS A;  1E3P A;  1IBK E;  4WUB A;  5FLX C;  4OKG A;  4U3B A;  5K36 A;  2Z5B A;  1YER A;  3O6O A;  4JQL A;  2UXC E;  1U2O A;  2NN6 D;  2E5L E;  4FW5 A;  5FNC A;  4URL A;  3C11 A;  3QDD A;  1A4H A;  3A0Z A;  2BV3 A;  4W7T A;  5C0X F;  5IN9 A;  3B78 A;  3R4M A;  4FWH A;  1Y6Z A;  1H7U A;  3MNR P;  2CG9 A;  3Q1Q A;  4E00 A;  1FWK A;  2BR2 A;  4EMD A;  3T1H E;  2QF6 A;  4HAC A;  3K98 A;  4GEE A;  4OO1 A;  5JEN A;  4WUD A;  3ZM7 A;  3JAM C;  4CWN A;  4CWF A;  3R4O A;  2BA1 D;  4DR1 I;  5CTW A;  1KKH A;  3P3C A;  2V2V A;  1HR0 E;  4P8O A;  4MOT A;  4YY3 E;  4DR4 I;  5A2Q Q;  1B3Q A;  4X9L A;  1TID A;  3S5T A;  5JEA C;  4MU3 A;  3U1K A;  4FW3 A;  4FW4 A;  4FW9 A;  4LCG A;  4DPW A;  3PEJ A;  3QT5 A;  1I94 I;  5ELW A;  2WI6 A;  4XD8 A;  3L7Z A;  5FND A;  4V25 A;  4LFA E;  1YT1 A;  2V2Q A;  1FWL A;  5LMU I;  1YSR A;  4DV2 E;  3C0E A;  3CRK A;  2HCH A;  4B3M I;  2WI4 A;  1Y8N A;  4LPF A;  1BKN A;  5IT9 Q;  2UXD I;  3T2S A;  4PU9 A;  4XKK A;  5CTY A;  4DR5 I;  4DR3 I;  2CCS A;  1OSF A;  2YE5 A;  3OMU A;  4DR7 E;  4DXL A;  5BOC A;  4IFD C;  4NH7 A;  2C38 B;  1I5B A;  4YKT A;  2A2D A;  3M85 G;  1IBK I;  1HK7 A;  2EXL A;  3HYZ A;  1UDN A;  2UWD A;  1S16 A;  2UXC I;  4LWG A;  3GON A;  3OW6 A;  2BU5 A;  1J5E E;  3PS3 A;  1GKX A;  4CWS A;  2YKI A;  1YC3 A;  1HNZ E;  2GFD A;  2VQF E;  4E72 A;  4UTG A;  1US7 A;  1Y8P A;  4MBC A;  3ZZT A;  1H72 C;  1Z5C A;  3QT6 A;  4FWD A;  2C1I A;  3EKO A;  1NHI A;  4HXW A;  4FW6 A;  1USU A;  2UU9 E;  2C38 A;  1YES A;  4IFD A;  2BRC A;  1YH8 A;  1HR0 I;  3RKZ A;  2O1T A;  1AM1 A;  4YY3 I;  1OYP A;  1U0Z A;  3B24 A;  4LOM A;  4JI6 E;  4EEH A;  3V5R A;  2YI5 A;  4YKY A;  4AWP A;  3T1K A;  4NH9 A;  4DV7 E;  4LFA I;  2YKE A;  5M4M A;  4DV2 I;  5C0X C;  2NN6 E;  2YGE A;  3GIG B;  1OJ4 A;  3Q6N A;  2JE6 B;  2BSM A;  3OPD A;  2HKE A;  3UHM A;  1I59 A;  4EGH A;  5FLX Q;  4QPK A;  1I5D A;  4DR7 I;  1N32 E;  2PO0 B;  2XJX A;  2YI6 A;  3D0B A;  3G7E A;  4XIP A;  5FWK A;  3GCM A;  3EHH A;  2WW4 A;  3P3E A;  1N34 E;  2XDK A;  4AWO A;  1JM6 A;  1UEK A;  1A6F A;  2IOQ A;  2UUC E;  1J5E I;  2GS8 A;  3ZXO A;  1YT0 A;  5IDJ A;  4XCL A;  2OI2 A;  1HNZ I;  4KSG A;  3JAM Q;  4CWO A;  1IBM I;  1R6M A;  3B82 A;  2JE6 A;  4EFT A;  1RHY A;  2WEQ A;  2BA1 G;  2ZIT A;  1MX0 A;  2XAB A;  2PNR A;  3EHG A;  4GFN A;  2PO0 A;  2UU9 I;  2WI1 A;  3INX A;  4URM A;  2X36 A;  1Z0G A;  4CE3 A;  2Q2E B;  2UUA E;  1B62 A;  1Z0E A;  3F0N A;  5DNX A;  5K36 D;  2GQP A;  1UYK A;  3OTO E;  4BA1 B;  4FW7 A;  4CWR A;  4JI6 I;  1E3H A;  1D6T A;  1ID0 A;  4CE1 A;  2AE8 A;  3TUH A;  3WQ9 A;  4DR4 E;  4O09 A;  2PNL A;  4FN5 A;  4JI7 E;  4KP4 A;  3ZKB A;  4DV7 I;  4MDT A;  1TBW A;  2WP8 B;  1I94 E;  4R1F A;  3P3G A;  4B3S E;  2FWZ A;  2YKB A;  1YC4 A;  3ZZ0 A;  3CGY A;  3R4P A;  4K4O A;  4GKK E;  5LMU E;  1TIL A;  4L91 A;  4K0K E;  2VCI A;  4OO1 D;  4XKA A;  4NBQ A;  2YI7 A;  2WEP A;  3HZ5 A;  4HZ0 A;  2XJJ A;  1N32 I;  1R62 A;  2BR2 B;  4DR3 E; 
#chains in the Genus database with same CATH homology
 2BM0 A;  4XTJ A;  5D7R A;  1N34 I;  3FT8 A;  1UY6 A;  3LTO A;  4XE2 A;  2UUC I;  3INW A;  4L8Z A;  1XMQ E;  4DPY A;  4GGL A;  4BQG A;  1UYM A;  2XDX A;  4DZY A;  1NHH A;  2YE7 A;  1K47 A;  4USM A;  4B3R E;  2IWS A;  4L90 A;  1NZ0 A;  3K85 A;  2BU7 A;  2BU8 A;  5D6P A;  1ZXM A;  4DU7 A;  4LFB E;  4XCJ A;  3RLR A;  2HG1 A;  2V2Z A;  4JI0 E;  1S14 A;  1UY8 A;  4BAE A;  3A0X A;  4DR2 E;  4U93 A;  5D7D A;  2XHR A;  2UUA I;  5F5R A;  3OTO I;  1H73 A;  4R3M A;  2YI0 A;  5LMN I;  1ZXN A;  3VHD A;  4MP2 A;  1PKP A;  4HY1 A;  4JI7 I;  4PRX A;  4X65 I;  4DV5 E;  2YJX A;  5GMD A;  1RR9 A;  4B3S I;  3HZ1 A;  4JAV A;  1B63 A;  4JV5 E;  2FXS A;  4GKK I;  2O1V A;  3CGZ A;  1Z0V A;  4K0K I;  2UXB E;  2BU6 A;  3B27 A;  1UYL A;  4CE2 A;  5CF0 A;  4EFU A;  1XHK A;  1Z5B A;  2Q8H A;  4ZKI A;  3PYG A;  2CCT A;  4Z7C A;  1RRE A;  1Z0T A;  2XDS A;  1XMQ I;  2F4V E;  2HK2 A;  4H81 A;  3LPS A;  4ZVI A;  2Z5E A;  4JI2 E;  4LF4 I;  2X7I A;  2YKJ A;  1UYI A;  4GT8 A;  4XCL A;  4B3R I;  4USK A;  4GKJ E;  4HYP A;  3Q5L A;  2Z5C B;  4IZK A;  2UUB E;  4LFB I;  3K99 A;  1IBM E;  4DR6 I;  4CWT A;  4IZJ B;  2BRE A;  4YKW A;  4JI0 I;  2XHX A;  4DR2 I;  1N36 E;  3BM9 A;  4EM7 A;  2K5B A;  4YHH E;  3K1J A;  4MYU A;  3J80 C;  4FWG A;  3WHA A;  3VHA A;  4E02 A;  1KIJ A;  2HFS A;  3PYD A;  1USV A;  1HNW I;  3A0T A;  3O2F A;  4DV5 I;  4B3T E;  3H80 A;  3JZ3 A;  2AJ4 A;  4XKO A;  1XNR E;  1PIE A;  3QT8 A;  3BMY A;  4LF8 I;  1IBL E;  4JV5 I;  2Z5C A;  4NXM E;  4ASF A;  4AS9 A;  2UXB I;  2GQ0 A;  2EFG A;  2J7K A;  1TH8 A;  4IZJ A;  2CGE A;  1S4E A;  1Z0B A;  3M6A A;  2AKP A;  2CGF A;  4P7A A;  1Y8O A;  4LWH A;  4ASG A;  4CWQ A;  2IOP A;  3WU3 A;  3J7A M;  2F4V I;  4HXZ A;  2YGF A;  4LF5 I;  1FKA E;  4XIQ A;  2A2C A;  4JI2 I;  4XC0 A;  4EMV A;  1I58 A;  2YEA A;  4GKJ I;  3R4N A;  4MPC A;  4O0B A;  4QPJ A;  4MYT A;  5L3J A;  2HK3 A;  3EHF A;  3EKR A;  1I5A A;  1BGQ A;  5CPH A;  2UUB I;  4I3H A;  4PRV A;  3QTF A;  4DV6 E;  4L94 A;  3D2R A;  2XK2 A;  3P06 A;  1UYD A;  1ZM2 A;  1N36 I;  2Q8F A;  4DUH A;  4LWF A;  4YHH I;  3R92 A;  4B7P A;  2H55 A;  4O05 A;  4BQJ A;  5M4E A;  2HFU A;  3HUL A;  1EI1 A;  4DUY E;  1UY9 A;  1XNQ E;  3HHU A;  4ASB A;  2IOR A;  2YEE A;  2YK2 A;  2BU2 A;  5LMN E;  4B3T I;  3PYF A;  4JI8 E;  4HY6 A;  2IWU A;  4I5S A;  2O1U A;  1XNR I;  1AH8 A;  1BYQ A;  4YKX A;  4B6C A;  2VCJ A;  4P52 A;  5BOD A;  4X65 E;  1IBL I;  4NXM I;  2DEJ A;  5IDM A;  4DV4 E;  4EGK A;  4X62 E;  2BYI A;  1ZM3 A;  4FPP A;  1AH6 A;  1Z59 A;  1UYH A;  4JAS A;  3U2K A;  4LWE A;  1UYG A;  5D7C A;  1N0V C;  4LF9 E;  4XIT A;  3HJC A;  1YS3 A;  2BTZ A;  4BXI A;  2HKJ A;  4XDM A;  1GJV A;  5GGZ A;  2C2A A;  1DAR A;  2XDL A;  5LL6 R;  2WI5 A;  4LWI A;  1ZW9 A;  5IWA I;  2Q8I A;  1WUU A;  4URO A;  2YEC A;  4PL9 A;  4Q20 A;  4DV1 E;  2YEG A;  4X66 E;  4DV0 E;  1QY8 A;  3GIE A;  4FCP A;  4LF4 E;  2XX4 A;  3GIF A;  1ELO A;  3B28 A;  4MPN A;  1AMW A;  3K60 A;  4Z7Y A;  4DV6 I;  3CRL A;  3J80 Q;  4KSH A;  4JI4 E;  3TZ2 A;  4DR6 E;  2WER A;  5M4K A;  3RLP A;  4WUC A;  4FCQ A;  4HYM A;  3H4L A;  4DUY I;  1XNQ I;  3T0Z A;  1QZR A;  4LPB A;  1Z0W A;  2XJG A;  3SL2 A;  4JI8 I;  2ZKJ A;  4U7N A;  4CWP A;  1HNW E;  1AJ6 A;  3K97 A;  2YKC A;  4E01 A;  1GKZ A;  3LNU A;  5M4N A;  1FNM A;  4DV4 I;  1MU5 A;  4X62 I;  1VIS A;  4YKU A;  2ZBK B;  4LF8 E;  2YE2 A;  4DPU A;  3B25 A;  2WI3 A;  1ZWH A;  4IZK B;  4LF9 I;  4V26 A;  2CH4 A;  5BR8 E;  1YET A;  4UT4 A;  3J81 C;  4OX9 E;  3OWB A;  3TZ4 A;  3PRY A;  2QG0 A;  1KTV A;  1MG7 A;  4KHP E;  2QFO A;  2ZDX A;  4DV1 I;  2FYP A;  3KE6 A;  4R3A A;  2JJC A;  3TZ5 A;  4X66 I;  4DV3 E;  3A0R A;  4DV0 I;  4LF5 E;  4GCZ A;  2CCU A;  3J7A G;  4LP0 A;  1FI4 A;  5GME A;  4IZJ D;  4GQT A;  2V8P A;  2VF3 A;  3R91 A;  2ESA A;  1UYC A;  2YE9 A;  2XHT A;  1KVK A;  3EHJ A;  4JI4 I;  2YEH A;  4JG4 A;  3CWV A;  3D4J A;  2XDU A;  1XMO E;  1L0O A;  3T1Y E;  2BYH A;  3HEK A;  4DPT A;  2JKI A;  3VHC A;  4JI3 I;  4LF7 E;  1EA6 A;  1Y4U A;  4JI1 E;  4YKQ A;  3B26 A;  2R3V A;  5CTX A;  3OWD A;  2WI7 A;  4H7Q A;  2WI2 A;  2E5L I;  2Q8G A;  3ZZU A;  1KZN A;  4AWQ A;  4DPX A;  4N3O A;  4LFC E;  3T0H A;  3FV5 A;  5BR8 I;  3IED A;  2V34 A;  3T1H I;  4OX9 I;  1HNX E;  3B8H A;  2VQE E;  4DU8 A;  3D36 A;  2E1R A;  4MPE A;  2NPF A;  4KHP I;  3ZKD A;  5J6A A;  4H85 A;  2PNM A;  3G75 A;  3K17 A;  4JI5 E;  4BIZ A;  2YEF A;  4NXN E;  2DEI A;  3Q5K A;  2HHH E;  4YKZ A;  5IWA E;  4X64 E;  4FMT A;  4DV3 I;  4DUZ E;  5F3K A;  1BXD A;  1N33 E;  2XD6 A;  1ZM4 A;  5J71 A;  5A2Q C;  2YJW A;  3ZXQ A;  1XMO I;  3T1Y I;  4LF6 E;  4L93 A;  4O07 A;  4KQV A;  4JYA E;  1THN A;  2ZM6 E;  2VW5 A;  4LF7 I;  1FJG E;  4AQY E;  2IWX A;  2YE3 A;  2YEI A;  2YE4 A;  3DGE A;  1UYF A;  3PEH A;  3U67 A;  4JI1 I;  5IT9 C;  2XX2 A;  3HYY A;  4ED4 A;  5CTU A;  4FCR A;  2LJP A;  1PVG A;  2BT0 A;  2FWY A;  1NHJ A;  1QYE A;  4EGI A;  2VWC A;  3RLQ A;  3J81 Q;  2BZ5 A;  2VQF I;  4LFC I;  2YE8 A;  1TC0 A;  3GIG A;  5FNF A;  2O1W A;  5C93 A;  4RPF A;  1HNX I;  2VQE I;  1U2R A;  1TC6 A;  2YGA A;  4MP7 A;  2H8M A;  2YK9 A;  2QG2 A;  4JI5 I;  1H7S A;  2BM1 A;  4U7O A;  2XCM A;  4NXN I;  5M4H A;  2HHH I;  1Y4S A;  4X64 I;  4MB9 A;  3WU5 A;  1YC1 A;  4DUZ I;  1YT2 A;  4YKR A;  1Z5A A;  3T10 A;  4O04 A;  4DR1 E;  3V2U C;  2XX5 A;  4XIR A;  3TTZ A;  2YEJ A;  1N33 I;  2Z5B B;  1YSZ A;  2YEB A;  1ZM9 A;  3VAD A;  2R42 A;  2E0A A;  2YED A;  3PYE A;  3G7B A;  3U2D A;  1N0U A;  3WU4 A;  3A0W A;  5D6Q A;  4NH8 A;  3A0Y A;  4KFG A;  3Q5J A;  4KTN A;  1Z0C A;  4B3M E;  4LF6 I;  2ZDY A;  3O0I A;  3QT7 A;  4JYA I;  1I5C A;  3FT5 A;  2XEX A;  2UXD E;  4URN A;  3Q6M A;  3WU6 A;  2CZ9 A;  2ZM6 I;  4DR5 E;  4HAC B;  1FJG I;  3NMQ A;  4AQY I;  1UYE A;  1H74 A;  4HZ5 A;  5M4P A;  1UY7 A;  2YE6 A;  3TZ0 A;  4ASA A;  4JI3 E;  4BIU A;  4M1K A;  4JAU A;  1IBK E;  4WUB A;  5FLX C;  1YER A;  3O6O A;  2Z5B A;  4JQL A;  2UXC E;  1U2O A;  2E5L E;  5FNC A;  4URL A;  3C11 A;  3QDD A;  1A4H A;  3A0Z A;  2BV3 A;  4W7T A;  5IN9 A;  3B78 A;  3R4M A;  4FWH A;  1Y6Z A;  1H7U A;  3MNR P;  2CG9 A;  3Q1Q A;  4E00 A;  1FWK A;  4EMD A;  3T1H E;  4GEE A;  2QF6 A;  4HAC A;  3K98 A;  4WUD A;  3ZM7 A;  3JAM C;  4CWN A;  4CWF A;  3R4O A;  4DR1 I;  5CTW A;  1KKH A;  2V2V A;  1HR0 E;  4P8O A;  4MOT A;  4YY3 E;  4DR4 I;  5A2Q Q;  1B3Q A;  4X9L A;  1TID A;  4FW9 A;  3PEJ A;  4DPW A;  3QT5 A;  1I94 I;  4XD8 A;  2WI6 A;  5FND A;  4V25 A;  4LFA E;  1YT1 A;  2V2Q A;  1FWL A;  5LMU I;  1YSR A;  4DV2 E;  3C0E A;  3CRK A;  2HCH A;  4B3M I;  2WI4 A;  1Y8N A;  1BKN A;  5IT9 Q;  2UXD I;  3T2S A;  4PU9 A;  4XKK A;  5CTY A;  4DR5 I;  4DR3 I;  2CCS A;  1OSF A;  2YE5 A;  3OMU A;  4DR7 E;  4DXL A;  5BOC A;  4NH7 A;  1I5B A;  4YKT A;  2A2D A;  2EXL A;  1IBK I;  1HK7 A;  3HYZ A;  2UWD A;  1S16 A;  2UXC I;  4LWG A;  3GON A;  3OW6 A;  2BU5 A;  1J5E E;  4CWS A;  1GKX A;  2YKI A;  1YC3 A;  1HNZ E;  2GFD A;  2VQF E;  4UTG A;  1US7 A;  1Y8P A;  4MBC A;  3ZZT A;  1H72 C;  1Z5C A;  3QT6 A;  4FWD A;  4HXW A;  3EKO A;  1NHI A;  1USU A;  2UU9 E;  1YES A;  2BRC A;  1HR0 I;  3RKZ A;  2O1T A;  1AM1 A;  4YY3 I;  1U0Z A;  3B24 A;  4JI6 E;  4EEH A;  3V5R A;  2YI5 A;  4YKY A;  4AWP A;  3T1K A;  4NH9 A;  4DV7 E;  4LFA I;  2YKE A;  5M4M A;  4DV2 I;  2YGE A;  3GIG B;  1OJ4 A;  3Q6N A;  3OPD A;  2BSM A;  2HKE A;  1I59 A;  4EGH A;  5FLX Q;  4QPK A;  1I5D A;  4DR7 I;  1N32 E;  3D0B A;  2XJX A;  2YI6 A;  3G7E A;  4XIP A;  5FWK A;  3EHH A;  2WW4 A;  1N34 E;  2XDK A;  4AWO A;  1JM6 A;  1UEK A;  1A6F A;  2IOQ A;  2UUC E;  1J5E I;  2GS8 A;  3ZXO A;  1YT0 A;  5IDJ A;  2OI2 A;  1HNZ I;  4KSG A;  3JAM Q;  4CWO A;  1IBM I;  3B82 A;  4EFT A;  2WEQ A;  2ZIT A;  1MX0 A;  2XAB A;  2PNR A;  3EHG A;  4GFN A;  3INX A;  2UU9 I;  2WI1 A;  4URM A;  2X36 A;  1Z0G A;  4CE3 A;  2Q2E B;  2UUA E;  1B62 A;  1Z0E A;  3F0N A;  2GQP A;  1UYK A;  3OTO E;  4CWR A;  4JI6 I;  1D6T A;  1ID0 A;  4CE1 A;  3TUH A;  3WQ9 A;  4DR4 E;  4O09 A;  2PNL A;  4FN5 A;  4JI7 E;  4KP4 A;  3ZKB A;  4DV7 I;  1TBW A;  1I94 E;  4R1F A;  4B3S E;  2FWZ A;  2YKB A;  1YC4 A;  3ZZ0 A;  3CGY A;  3R4P A;  4K4O A;  4GKK E;  5LMU E;  1TIL A;  4L91 A;  4K0K E;  2VCI A;  4XKA A;  4HZ0 A;  2YI7 A;  2WEP A;  3HZ5 A;  2XJJ A;  1N32 I;  1R62 A;  4DR3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...