3LPSA

Crystal structure of pare
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
364
structure length
347
Chain Sequence
GLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLHGVGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of parE
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Isomerase/antibiotic
molecule keywords Topoisomerase IV subunit B
total genus 110
structure length 347
sequence length 364
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3lpsA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3lpsA01
4BQJA 4K0KE 4XITA 2E5LI 4XKAA 1TC6A 1I94I 2CCUA 4LFCI 1Z0EA 4P7AA 5GGZA 5A2QC 4DR4I 2YEAA 1FWKA 1FJGE 4LF4E 1N32E 3K17A 4DV2E 3HZ1A 1KKHA 4X66E 2IOPA 2NPFA 1BKNA 4DR1I 2HHHE 3R4PA 3O6OA 2YGAA 2BU7A 4AS9A 2CCSA 4OX9E 4ASBA 4JV5I 1HNXI 3EHJA 3Q5JA 3VADA 1ZXNA 4JI6E 4FW9A 1Z0VA 2HK2A 1B63A 4GQTA 4LFBI 3GONA 4KSHA 3HEKA 2UXBI 4BXIA 2QFOA 4ZVIA 2CG9A 2UXCI 4LWIA 1ZM3A 4CE3A 4B3RI 5D7RA 4JI8E 1ZW9A 3U2DA 4CE2A 4EGHA 3OWBA 2XHRA 1UYMA 4DXLA 4AQYE 3T0HA 5LMUI 3NMQA 1UY8A 1I5DA 3Q5LA 2O1WA 3V2UC 3T1HI 2VQFI 4DV4E 2VW5A 4X62E 3TTZA 1ELOA 3C11A 4R3AA 3J7AG 4JI7I 4HY6A 3U2KA 3EHHA 2LJPA 1ZM2A 1YSZA 2YE4A 3T1YE 2ZM6I 4DR5I 1FWLA 1PVGA 3LNUA 4GGLA 1Y8OA 3B26A 4KTNA 2VQEE 3K98A 2WERA 2YI5A 4DU8A 4YKRA 1H7UA 2F4VE 3ZKBA 2XCMA 4DV7E 3OTOI 3D4JA 5FNDA 3JZ3A 4DR3E 3A0YA 4DR3I 3A0WA 1U2RA 1OSFA 2XX2A 1MX0A 2X36A 4YY3I 4B3SI 2VF3A 4DU7A 1ZWHA 2CCTA 3JAMQ 3TZ0A 2BU5A 1N34I 1UYKA 4NXNI 4URMA 1YT2A 2Q8IA 4CWTA 1FKAE 1GJVA 1TH8A 2R3VA 1IBME 1YT0A 4JYAE 2BSMA 4FCQA 4QPKA 4W7TA 4WUCA 4XE2A 4NXNE 3K97A 2YEJA 3SL2A 1ZXMA 3Q1QA 1YETA 2WI7A 5M4NA 3LTOA 4CWPA 1AJ6A 1N0VC 2V34A 2YEFA 2BRCA 4FPPA 2WI6A 4JI4E 2UUCE 4DV7I 2YKEA 4H85A 4XCJA 4PL9A 4JI3I 2WI1A 5CF0A 4LF5E 1YC4A 2WEQA 4MOTA 4HACB 4GT8A 2YGFA 2YE7A 2YEDA 1NHIA 4JI3E 4V26A 1I5CA 2QG2A 1XMOI 1I5AA 4LPBA 4PRVA 1B3QA 4QPJA 4L94A 1IBLI 3RLQA 1HNZI 1GKZA 3C0EA 5BOCA 3G7EA 1BXDA 2BTZA 4GKKI 4FWDA 4GKJE 4LF6E 4MB9A 4GCZA 5LMUE 2IORA 2YECA 2FXSA 1N34E 4NXMI 3T1KA 4X64I 4K4OA 1TBWA 1YESA 2DEJA 1UY9A 5BODA 3J80Q 2HHHI 4DV6I 4X65I 3INWA 3OTOE 4FMTA 2UXCE 4DV2I 3D0BA 2QF6A 4KP4A 1Z5CA 2O1UA 1FJGI 4CWQA 4O05A 2BREA 4EMVA 3HHUA 1L0OA 3K60A 1R62A 2VQEI 3ZZTA 4LFCE 2BU2A 2XD6A 1TC0A 5GMEA 1Y4SA 4Q20A 4CE1A 1QY8A 4JAVA 2BM0A 3RLPA 3EKRA 2YKJA 1J5EE 4U7OA 2YEGA 4XKKA 2ZDYA 2YI7A 2BT0A 5M4KA 2YEIA 4MPNA 1Z59A 4DV1E 1H7SA 5CTYA 1TILA 1YS3A 4DR4E 2IWSA 3A0ZA 4EMDA 5LMNI 5M4PA 4DV5I 3HZ5A 3A0TA 2XABA 3OMUA 1I94E 3G75A 3PEJA 1H72C 4DR5E 3B8HA 3PYEA 4GFNA 3LPSA 3U67A 3FT5A 2YKCA 1UY7A 1D6TA 4L90A 2BZ5A 2HFUA 3GIGA 2YE5A 5IWAE 3TUHA 2HKJA 1I5BA 4XD8A 5A2QQ 4JI6I 5FLXQ 2XJXA 2YKBA 1UYHA 2K5BA 1HNWE 2XDKA 1YC3A 4LP0A 1U0ZA 3PYDA 3IEDA 4CWOA 1UYLA 4JASA 4DUZE 4AQYI 1H73A 3O0IA 3FV5A 4BIUA 4JI8I 1A4HA 3WHAA 4EGIA 4GEEA 4LWHA 1N32I 2WW4A 4ASGA 1US7A 2A2DA 4NH9A 4MP7A 1XHKA 4DR6E 4YKUA 2FYPA 4XIQA 1KZNA 5D7CA 3H4LA 1UY6A 1HNXE 1PIEA 1UYFA 3QT5A 3O2FA 4R3MA 4DV0E 1Z0WA 1I59A 4MYTA 5CTXA 3J81Q 4P52A 1YSRA 2ZBKB 4HXWA 5D6PA 4B3TI 1UYDA 4L8ZA 2VCIA 2XHXA 4AWPA 3H80A 4MYUA 4PU9A 2YKIA 5D7DA 4DV5E 3FT8A 5LMNE 3ZXOA 4NH8A 5IDMA 1FI4A 1U2OA 2YEHA 2UU9I 4UROA 2BM1A 2XDXA 2UWDA 1JM6A 5F5RA 4FCRA 1Z5AA 2E5LE 1UYEA 5C93A 1S14A 1HR0E 4JI2I 2EXLA 3CGYA 4YKXA 4JI0I 4K0KI 5CPHA 4JG4A 4YHHI 2QG0A 4DV0I 1FNMA 4JI2E 2J7KA 1B62A 1Z0CA 2JJCA 2WEPA 4DUHA 2CZ9A 1Y8PA 2BYIA 3RKZA 4UTGA 1XNQI 2Q2EB 4DR7I 2A2CA 3TZ2A 2XX5A 1NZ0A 4LWFA 4XCLA 2DEIA 4DR6I 1IBKI 1QYEA 2ESAA 1KVKA 3QT7A 5CTUA 4HYMA 4LWEA 2WI3A 3BMYA 4DV6E 4EFUA 2XX4A 3J81C 3B28A 4LFAI 2XDSA 2Q8FA 4X64E 2CH4A 4H81A 4XKOA 1RR9A 4DUZI 4LF9E 3Q5KA 2C2AA 3QTFA 2Q8GA 2ZKJA 4B7PA 4YKZA 3G7BA 4LF6I 4DZYA 2HCHA 3K1JA 2V2QA 1BGQA 1N36E 2PNRA 5IWAI 4YKYA 1KTVA 2YE3A 2BYHA 3ZM7A 3RLRA 4DV3I 4DUYE 2WI2A 4FWGA 2XK2A 2IOQA 1BYQA 3A0XA 4X65E 4JQLA 2UXDI 1UYGA 1AMWA 5BR8E 2Q8HA 1N33E 4URNA 2IWUA 2XEXA 3HYYA 4NXME 4USMA 3VHAA 5FWKA 4R1FA 1HNWI 1KIJA 1AH6A 4YKWA 1ZM9A 2UUBI 2XHTA 4MPEA 4EGKA 1HNZE 4YKQA 3WU4A 4PRXA 4JI1E 1THNA 2YE2A 3GIGB 5IT9Q 3OW6A 5F3KA 1H74A 1MG7A 1UYIA 3EKOA 3PYGA 1I58A 1DARA 1Z5BA 4WUDA 4WUBA 5LL6R 4JYAI 2HFSA 3T2SA 3B24A 4ED4A 2IWXA 1ID0A 3EHGA 4LF5I 3J80C 3DGEA 1AH8A 4XIPA 4DV1I 3CRKA 3EHFA 4H7QA 2V2VA 2GFDA 3R4OA 4JI4I 4XDMA 2VCJA 3R91A 4ASAA 4E02A 2H8MA 3D2RA 4URLA 3VHCA 4RPFA 1J5EI 2YE9A 2YJXA 4EFTA 2F4VI 4E00A 1OJ4A 4USKA 2AJ4A 4I3HA 1XNRE 3PYFA 3J7AM 3HULA 3M6AA 4GKJI 4GKKE 4AWOA 2FWZA 3B82A 4M1KA 2YE8A 5D6QA 3A0RA 1NHHA 1IBLE 3CWVA 4JI1I 4B3MI 1ZM4A 4XTJA 2XJGA 4O09A 4CWNA 4LF8I 4X62I 2OI2A 2VQFE 5IDJA 2YI0A 4FWHA 4HZ0A 2JKIA 1MU5A 1TIDA 2YEEA 5L3JA 5IN9A 2EFGA 2X7IA 3B25A 3B27A 3HYZA 3WU3A 3ZZUA 2UUCI 1UEKA 2XDUA 1RREA 2H55A 4O04A 1NHJA 4B3RE 2ZM6E 3T1YI 2YK2A 4XC0A 4V25A 4DV3E 1EI1A 2UXBE 4DPUA 3K99A 4MPCA 4FN5A 1XMOE 3T1HE 4BIZA 5IT9C 1IBMI 2UUBE 2VWCA 3GIFA 4MBCA 4E01A 5CTWA 4L93A 3BM9A 1WUUA 1UYCA 1XNRI 4Z7CA 3PEHA 4HYPA 4HACA 1YC1A 5FNFA 4BAEA 4LFAE 1N33I 4B3SE 2YI6A 2YK9A 4CWRA 2BU6A 4L91A 2R42A 4LF8E 4X9LA 3CRLA 1N0UA 4B3ME 4LF4I 4AWQA 3MNRP 3CGZA 2YE6A 2ZDXA 4DPYA 2YEBA 4JAUA 4O07A 1Z0BA 3ZZ0A 4U7NA 3JAMC 4CWFA 1S4EA 4JV5E 4KSGA 1S16A 4LF9I 4OX9I 1YT1A 4YHHE 4YY3E 4DPTA 4XIRA 4DR2E 4Z7YA 1VISA 2E0AA 3B78A 4FCPA 2YJWA 4EM7A 5FLXC 2UU9E 5J6AA 3F0NA 1IBKE 2XJJA 2HKEA 4DR7E 2BU8A 1K47A 3R4MA 4U93A 2V2ZA 4DPXA 4KHPI 4MP2A 4BQGA 3GIEA 4JI7E 2ZITA 3WQ9A 1HR0I 4YKTA 4JI5E 3V5RA 3TZ5A 4HZ5A 4DV4I 1A6FA 1N36I 1GKXA 5GMDA 5M4EA 4DPWA 2V8PA 1EA6A 1Z0GA 1Y8NA 4ASFA 4LF7I 3OPDA 4I5SA 3QT6A 3T10A 4LWGA 5J71A 3KE6A 4UT4A 3ZKDA 3QT8A 2UUAE 4NH7A 5BR8I 4B3TE 2UXDE 2WI5A 2XDLA 4X66I 5M4MA 4DUYI 4P8OA 4HY1A 3WU5A 1XMQE 4LFBE 4EEHA 2YGEA 1XNQE 2HK3A 3QDDA 4CWSA 3ZXQA 1AM1A 1XMQI 3TZ4A 1QZRA 3D36A 1Y4UA 4JI0E 4O0BA 2E1RA 5FNCA 4DR1E 2AKPA 4KHPE 3R92A 4B6CA 2UUAI 1YERA 2FWYA 3WU6A 3INXA 4HXZA 3T0ZA 4KQVA 4LF7E 2O1VA 1PKPA 1Z0TA 2GQPA 2HG1A 2WI4A 2BV3A 2GS8A 3R4NA 5M4HA 4DR2I 4JI5I 4ZKIA 3VHDA 2CGFA 3OWDA 4KFGA
chains in the Genus database with same CATH superfamily
1USUA 3M85G 4BQJA 2PNZB 4K0KE 2NN6B 2PNZA 4XITA 1XXEA 2E5LI 4XKAA 1TC6A 1I94I 2C38A 2CCUA 4LFCI 4OZEA 1Z0EA 4P7AA 5GGZA 5A2QC 4DR4I 2YEAA 2C1GA 3P3EA 1FWKA 3P3CA 1FJGE 1Y6ZA 4LF4E 1N32E 3K17A 4DV2E 3HZ1A 1KKHA 4X66E 2IOPA 2NPFA 3PS2A 1BKNA 4DR1I 2HHHE 3R4PA 3O6OA 2YGAA 2BU7A 3HKMA 4AS9A 2CCSA 2JEBA 4OX9E 4ASBA 4JV5I 1HNXI 5DRRA 3EHJA 3Q5JA 1VI7A 5C0XB 1ZXNA 3VADA 4JI6E 4FW9A 1Z0VA 2HK2A 1B63A 4GQTA 4LFBI 3GONA 4KSHA 3HEKA 2UXBI 4BXIA 2QFOA 4ZVIA 2CG9A 2UXCI 5K36F 4LWIA 1ZM3A 4CE3A 4B3RI 5D7RA 4JI8E 1ZW9A 3U2DA 3GMEA 4CE2A 4EGHA 3OWBA 2XHRA 1UYMA 4DXLA 4IZJA 4AQYE 3T0HA 5LMUI 3NMQA 1UY8A 1I5DA 2C39A 3Q5LA 2O1WA 3V2UC 3S5TA 3T1HI 2VQFI 4DV4E 2VW5A 4X62E 3TTZA 1ELOA 3C11A 4R3AA 3J7AG 4JI7I 4MU0A 4HY6A 3U2KA 2BA0G 3EHHA 2LJPA 2HHIA 1ZM2A 3NZKA 1YSZA 2YE4A 3T1YE 2ZM6I 4DR5I 1FWLA 1PVGA 3LNUA 4GGLA 1HK7A 1Y8OA 3B26A 4KTNA 2VQEE 3K98A 3B4TA 2WERA 1R6LA 2YI5A 4DU8A 4MDTA 4YKRA 1H7UA 2F4VE 3UHMA 4OO1B 5K36D 3ZKBA 2XCMA 4DV7E 3OTOI 3D4JA 5FNDA 3JZ3A 4DR3E 3Q6NA 3A0YA 4DR3I 4AIMA 3A0WA 1U2RA 1OSFA 2XX2A 1MX0A 2X36A 4YY3I 4B3SI 2VF3A 3M7ND 4DU7A 1ZWHA 2CCTA 3JAMQ 3TZ0A 2BU5A 1YH8A 2GO3A 1N34I 4NXNI 1UYKA 4URMA 1YT2A 2Q8IA 4CWTA 4OKGA 1FKAE 1GJVA 1TH8A 1RHYA 2R3VA 1IBME 4JYAE 1YT0A 2BSMA 4FCQA 4QPKA 4WUCA 4W7TA 4XE2A 5DNLA 4NXNE 3K97A 2YEJA 3SL2A 2PNMA 1ZXMA 3Q1QA 4J3DA 1YETA 2WI7A 5M4NA 3LTOA 4CWPA 2BA1G 1AJ6A 1N0VC 2V34A 3PS1A 4IFDA 2NN6F 2YEFA 2BRCA 4FPPA 2WI6A 2C39B 2C38B 2UUCE 4DV7I 4JI4E 4IZKA 2YKEA 4H85A 4PL9A 4XCJA 1UDSA 4JI3I 2WI1A 3K85A 5CF0A 4LF5E 1YC4A 2WEQA 4MOTA 4HACB 4GT8A 2YGFA 1P42A 2YE7A 2YEDA 1NHIA 2Z5CB 4JI3E 4OO1E 1I5CA 2BR2A 4V26A 2QG2A 1XMOI 1I5AA 2PO0A 5JEAE 4LPBA 4PRVA 1B3QA 4U3DA 4L94A 1IBLI 4QPJA 3RLQA 1HNZI 4BA1B 1GKZA 3C0EA 4GQUA 5BOCA 2IERA 3G7EA 1BXDA 5C0XA 2BTZA 4GKKI 4FWDA 4GKJE 5JENA 4LF6E 4MB9A 4GCZA 5LMUE 2IORA 2YECA 4LCFA 1N34E 2FXSA 4NXMI 3T1KA 4X64I 4K4OA 1TBWA 1YESA 2O3ZA 2DEJA 1UY9A 5BODA 2NN6D 3J80Q 4MU3A 4N3OA 2HHHI 4DV6I 4X65I 3INWA 3OTOE 4FMTA 2UXCE 4DV2I 3D0BA 2QF6A 4KP4A 1Z5CA 2O1UA 1FJGI 4CWQA 3H1CA 2BREA 4O05A 4EMVA 3HHUA 4IS9A 1L0OA 3K60A 1R62A 2VQEI 3ZZTA 3Q6MA 4LFCE 2BU2A 1TC0A 5GMEA 1Y4SA 2Z5BA 2XD6A 4Q20A 4CE1A 1QY8A 4JAVA 2CVEA 2BM0A 3RLPA 3EKRA 2YKJA 1J5EE 4U7OA 2YEGA 4XKKA 2ZDYA 2C1IA 2YI7A 2BT0A 5M4KA 2YEIA 4MPNA 1Z59A 3L7ZA 4DV1E 1H7SA 5CTYA 2WP8A 1TILA 1YHCA 2GQ0A 1YS3A 4DR4E 2IWSA 3A0ZA 4EMDA 5LMNI 5M4PA 4DV5I 3HZ5A 3A0TA 2XABA 3OMUA 1I94E 3G75A 3PEJA 1H72C 4DR5E 3B8HA 2JEAB 3PYEA 4GFNA 3LPSA 3U67A 4BA2B 3FT5A 2YKCA 1UY7A 1D6TA 4L90A 3GLLA 4U3BA 2BZ5A 2HFUA 3GIGA 3GCMA 2YE5A 5IWAE 3TUHA 2HKJA 1I5BA 3U1KA 4XD8A 5A2QQ 4JI6I 2O1TA 4QNKA 5FLXQ 2XJXA 2YKBA 1UYHA 2K5BA 1HNWE 5JEAB 4LPFA 1YC3A 5DNXA 1U0ZA 3PYDA 2XDKA 4LP0A 3IEDA 4CWOA 1UYLA 4JASA 4DUZE 3CDIA 4AQYI 1H73A 3O0IA 3FV5A 4BIUA 4JI8I 1A4HA 2NN6A 3WHAA 4AIDA 4EGIA 4GEEA 4LWHA 1N32I 2WW4A 4ASGA 4FW6A 1US7A 1OYPA 2A2DA 4NH9A 4MP7A 1XHKA 4DR6E 4YKUA 2FYPA 4XIQA 1KZNA 5D7CA 3H4LA 1UY6A 1HNXE 1PIEA 1UYFA 3QT5A 3O2FA 4R3MA 4DV0E 1Z0WA 1I59A 4MYTA 5CTXA 2JE6B 3J81Q 4FW5A 4P52A 1YSRA 2ZBKB 2C37B 2PO1B 4HXWA 5D6PA 4B3TI 1UYDA 4L8ZA 2BA0D 2VCIA 2XHXA 4AWPA 3H80A 2PO2A 4MYUA 4PU9A 2YKIA 5D7DA 4DV5E 3FT8A 2IESA 5LMNE 3ZXOA 4NH8A 5IDMA 1FI4A 1U2OA 2YEHA 2UU9I 4UROA 2BM1A 2XDXA 2UWDA 1JM6A 5F5RA 4FCRA 1Z5AA 2E5LE 1UYEA 5C93A 1S14A 1HR0E 4JI2I 2EXLA 3CGYA 4YKXA 4JI0I 4K0KI 5CPHA 4MQYA 4JG4A 4YHHI 2QG0A 4DV0I 1FNMA 4JI2E 2J7KA 1B62A 1Z0CA 2JJCA 2WEPA 4DUHA 2CZ9A 1Y8PA 2BYIA 2J65A 3RKZA 4LCGA 4UTGA 1XNQI 2Q2EB 4FW7A 2A2CA 4DR7I 3TZ2A 2XX5A 1NZ0A 4LWFA 4XCLA 2DEIA 4DR6I 1IBKI 4FW3A 1QYEA 3CDJA 1KVKA 3QT7A 2ESAA 5CTUA 4HYMA 4LWEA 2WI3A 4MU1A 3BMYA 4DV6E 4IFDE 2NN6E 4EFUA 2XX4A 4QNJA 3J81C 3B28A 4LFAI 2XDSA 2Q8FA 1E3HA 4X64E 2CH4A 4H81A 2WNRB 1RR9A 4DUZI 4LF9E 3Q5KA 2C2AA 3QTFA 4XKOA 2ZKJA 2Q8GA 4YKZA 4B7PA 3G7BA 4LF6I 4DZYA 3DD6A 3KRNA 2HCHA 3K1JA 2V2QA 3L7ZB 1BGQA 1N36E 3M7NG 4OO1D 2PNRA 4ISAA 5IWAI 4YKYA 1KTVA 2YE3A 2BYHA 3ZM7A 3RLRA 4DV3I 4DUYE 2WI2A 4FWGA 5EKWA 2XK2A 2IOQA 1BYQA 3A0XA 4X65E 4JQLA 2UXDI 1UYGA 1AMWA 5BR8E 1E3PA 2Q8HA 1N33E 4URNA 2IWUA 2XEXA 3HYYA 4NXME 4USMA 3VHAA 1UDOA 4FW4A 5FWKA 4R1FA 1HNWI 1KIJA 1AH6A 3LMMA 4YKWA 1ZM9A 2UUBI 2NN6C 2XHTA 4MPEA 4EGKA 1HNZE 4YKQA 3WU4A 4PRXA 4JI1E 1THNA 2YE2A 3GIGB 5IT9Q 3OW6A 5F3KA 1H74A 2PO2B 1MG7A 1UYIA 3EKOA 3PYGA 1I58A 1DARA 1Z5BA 4WUBA 4WUDA 3PS3A 5LL6R 4IFDC 2HFSA 3P3GA 4JYAI 2CGEA 3T2SA 3B24A 4OO1F 4ED4A 2IWXA 1ID0A 3EHGA 5EL9A 3J80C 4LF5I 1AH8A 3DGEA 4XIPA 4DV1I 3CRKA 3EHFA 4H7QA 2V2VA 2GFDA 3R4OA 4LOMA 4JI4I 4XDMA 2VCJA 3R91A 4ASAA 4E02A 2H8MA 3D2RA 2PO0B 2JT2A 4URLA 3VHCA 4RPFA 1J5EI 5K36A 2YE9A 2YJXA 2F4VI 4EFTA 4E00A 1OJ4A 2BR2B 3HJCA 4USKA 2AJ4A 2C37A 2WNRA 4I3HA 1XNRE 4E72A 3PYFA 3J7AM 3HULA 2JE6A 3M6AA 4GKJI 4GKKE 2PNLA 4AWOA 2FWZA 3B82A 4M1KA 2YE8A 5D6QA 3A0RA 1NHHA 1IBLE 4IFDB 4AM3A 3CWVA 4JI1I 4B3MI 1ZM4A 4XTJA 2XJGA 4O09A 4CWNA 4LF8I 4X62I 2Z5EA 2OI2A 2VQFE 5IDJA 2YI0A 4FWHA 2AE8A 1UDNA 4HZ0A 2JKIA 1MU5A 5C0XE 1TIDA 5DROA 5L3JA 2YEEA 4BA2A 5IN9A 2EFGA 2X7IA 2JEAA 3B25A 3B27A 3HYZA 1IXMA 3WU3A 3ZZUA 2UUCI 1UEKA 2XDUA 1UDQA 1RREA 2H55A 4O04A 1NHJA 4B3RE 2ZM6E 3T1YI 5K36C 2YK2A 5K36B 4XC0A 4V25A 4DV3E 1EI1A 2UXBE 4DPUA 3K99A 4MPCA 2BA1D 3P76A 4FN5A 1XMOE 3T1HE 4BIZA 5IT9C 1IBMI 2UUBE 2VWCA 3GIFA 4MBCA 4E01A 4NBQA 5CTWA 2FTKA 4L93A 3BM9A 1WUUA 1UYCA 1XNRI 4Z7CA 3PEHA 4HYPA 4HACA 5C0XD 1YC1A 5FNFA 4BAEA 4LFAE 1N33I 4B3SE 2YI6A 2YK9A 4CWRA 2BU6A 2WP8B 4L91A 2R42A 2F1DA 4LF8E 4IFDD 4X9LA 3CRLA 1N0UA 5K36E 4B3ME 4LF4I 4AWQA 3MNRP 3CGZA 2YE6A 2ZDXA 4DPYA 5JEAD 2YEBA 1Y5YA 4JAUA 4O07A 1F51A 1Z0BA 3ZZ0A 4U7NA 3JAMC 4IZJD 4CWFA 3U1YA 1S4EA 4JV5E 4KSGA 1S16A 4LF9I 2Z5BB 4OX9I 1YT1A 4YHHE 5ELWA 4DPTA 4YY3E 4XIRA 1OYSA 5JEAA 4DR2E 4Z7YA 1VISA 2E0AA 3B78A 4FCPA 2YJWA 4EM7A 4OO1A 5FLXC 2UU9E 5J6AA 3F0NA 4LCHA 1IBKE 2XJJA 3PRYA 5C0XF 2HKEA 1USVA 4DR7E 2JEBB 2BU8A 1K47A 1Y60A 3R4MA 4U93A 2PO1A 2V2ZA 4DPXA 4KHPI 4MP2A 4IFDF 3GIEA 4MU4A 4BQGA 5C0XC 4JI7E 2ZITA 3WQ9A 4IZKB 5JEAF 1HR0I 4YKTA 4JI5E 3V5RA 3TZ5A 4HZ5A 1R6MA 1A6FA 4DV4I 1N36I 2VESA 1GKXA 5GMDA 5M4EA 4DPWA 2V8PA 1EA6A 1Z0GA 1Y8NA 4ASFA 4LF7I 3OPDA 4I5SA 3QT6A 3T10A 4LWGA 5J71A 3KE6A 2Z5CA 4UT4A 4IZJB 3ZKDA 3QT8A 2UUAE 4NH7A 5BR8I 4B3TE 2UXDE 2GO4A 5DRPA 2WI5A 2XDLA 4X66I 5M4MA 4DUYI 1OYRA 4P8OA 4HY1A 3WU5A 1XMQE 3P06A 4LFBE 4EEHA 2YGEA 5DRQA 1XNQE 3CYGA 5JEAC 2HK3A 3QDDA 4CWSA 3ZXQA 1AM1A 1XMQI 3TZ4A 1QZRA 3D36A 4OO1C 1Y4UA 4JI0E 4O0BA 2E1RA 5FNCA 4DR1E 2AKPA 4KHPE 3R92A 4B6CA 3M85D 2UUAI 1YERA 2FWYA 3WU6A 3INXA 4HXZA 3T0ZA 4KQVA 4BA1A 4LF7E 2O1VA 1PKPA 1Z0TA 2GQPA 2HG1A 2WI4A 2BV3A 2GS8A 3R4NA 5M4HA 4DR2I 4JI5I 4ZKIA 3VHDA 2CGFA 3OWDA 4KFGA
chains in the Genus database with same CATH topology
1USUA 4BQJA 4K0KE 4XITA 2E5LI 4XKAA 1TC6A 1I94I 2CCUA 4LFCI 1Z0EA 4P7AA 5GGZA 5A2QC 4DR4I 2YEAA 1FWKA 1FJGE 1Y6ZA 4LF4E 1N32E 3K17A 4DV2E 3HZ1A 1KKHA 4X66E 2IOPA 2NPFA 1BKNA 4DR1I 2HHHE 3R4PA 3O6OA 2YGAA 2BU7A 4AS9A 2CCSA 4OX9E 4ASBA 4JV5I 1HNXI 3EHJA 3Q5JA 3VADA 1ZXNA 4JI6E 4FW9A 1Z0VA 2HK2A 1B63A 4GQTA 4LFBI 3GONA 4KSHA 3HEKA 2UXBI 4BXIA 2QFOA 4ZVIA 2CG9A 2UXCI 4LWIA 1ZM3A 4CE3A 4B3RI 5D7RA 4JI8E 1ZW9A 3U2DA 4CE2A 4EGHA 3OWBA 2XHRA 1UYMA 4DXLA 4IZJA 4AQYE 3T0HA 5LMUI 3NMQA 1UY8A 1I5DA 3Q5LA 2O1WA 3V2UC 3T1HI 2VQFI 4DV4E 2VW5A 4X62E 3TTZA 1ELOA 3C11A 4R3AA 3J7AG 4JI7I 4HY6A 3U2KA 3EHHA 2LJPA 1ZM2A 1YSZA 2YE4A 3T1YE 2ZM6I 4DR5I 1FWLA 1PVGA 3LNUA 4GGLA 1HK7A 1Y8OA 3B26A 4KTNA 2VQEE 3K98A 2WERA 2YI5A 4DU8A 4YKRA 1H7UA 2F4VE 3ZKBA 2XCMA 4DV7E 3OTOI 3D4JA 5FNDA 3JZ3A 4DR3E 3Q6NA 3A0YA 4DR3I 3A0WA 1U2RA 1OSFA 2XX2A 1MX0A 2X36A 4YY3I 4B3SI 2VF3A 4DU7A 1ZWHA 2CCTA 3JAMQ 3TZ0A 2BU5A 1N34I 1UYKA 4NXNI 4URMA 1YT2A 2Q8IA 4CWTA 1FKAE 1GJVA 1TH8A 2R3VA 1IBME 1YT0A 4JYAE 2BSMA 4FCQA 4QPKA 4W7TA 4WUCA 4XE2A 4NXNE 3K97A 2YEJA 3SL2A 2PNMA 1ZXMA 3Q1QA 1YETA 2WI7A 5M4NA 3LTOA 4CWPA 1AJ6A 1N0VC 2V34A 2YEFA 2BRCA 4FPPA 2WI6A 4JI4E 2UUCE 4DV7I 2YKEA 4IZKA 4H85A 4XCJA 4PL9A 4JI3I 2WI1A 3K85A 5CF0A 4LF5E 1YC4A 2WEQA 4MOTA 4HACB 4GT8A 2YGFA 2YE7A 2YEDA 1NHIA 2Z5CB 4JI3E 4V26A 1I5CA 2QG2A 1XMOI 1I5AA 4LPBA 4PRVA 1B3QA 4QPJA 4L94A 1IBLI 3RLQA 1HNZI 1GKZA 3C0EA 5BOCA 3G7EA 1BXDA 2BTZA 4GKKI 4FWDA 4GKJE 4LF6E 4MB9A 4GCZA 5LMUE 2IORA 2YECA 2FXSA 1N34E 4NXMI 3T1KA 4X64I 4K4OA 1TBWA 1YESA 2DEJA 1UY9A 5BODA 3J80Q 4N3OA 2HHHI 4DV6I 4X65I 3INWA 3OTOE 4FMTA 2UXCE 4DV2I 3D0BA 2QF6A 4KP4A 1Z5CA 2O1UA 1FJGI 4CWQA 4O05A 2BREA 4EMVA 3HHUA 1L0OA 3K60A 1R62A 2VQEI 3ZZTA 3Q6MA 4LFCE 2BU2A 1TC0A 5GMEA 1Y4SA 2Z5BA 2XD6A 4Q20A 4CE1A 1QY8A 4JAVA 2BM0A 3RLPA 3EKRA 2YKJA 1J5EE 4U7OA 2YEGA 4XKKA 2ZDYA 2YI7A 2BT0A 5M4KA 2YEIA 4MPNA 1Z59A 4DV1E 1H7SA 5CTYA 1TILA 1YS3A 2GQ0A 4DR4E 2IWSA 3A0ZA 4EMDA 5LMNI 5M4PA 4DV5I 3HZ5A 3A0TA 2XABA 3OMUA 1I94E 3G75A 3PEJA 1H72C 4DR5E 3B8HA 3PYEA 4GFNA 3LPSA 3U67A 3FT5A 2YKCA 1UY7A 1D6TA 4L90A 2BZ5A 2HFUA 3GIGA 2YE5A 5IWAE 3TUHA 2HKJA 1I5BA 4XD8A 5A2QQ 4JI6I 2O1TA 5FLXQ 2XJXA 2YKBA 1UYHA 2K5BA 1HNWE 2XDKA 1YC3A 4LP0A 1U0ZA 3PYDA 3IEDA 4CWOA 1UYLA 4JASA 4DUZE 4AQYI 1H73A 3O0IA 3FV5A 4BIUA 4JI8I 1A4HA 3WHAA 4EGIA 4GEEA 4LWHA 1N32I 2WW4A 4ASGA 1US7A 2A2DA 4NH9A 4MP7A 1XHKA 4DR6E 4YKUA 2FYPA 4XIQA 1KZNA 5D7CA 3H4LA 1UY6A 1HNXE 1PIEA 1UYFA 3QT5A 3O2FA 4R3MA 4DV0E 1Z0WA 1I59A 4MYTA 5CTXA 3J81Q 4P52A 1YSRA 2ZBKB 4HXWA 5D6PA 4B3TI 1UYDA 4L8ZA 2VCIA 2XHXA 4AWPA 3H80A 4MYUA 4PU9A 2YKIA 5D7DA 4DV5E 3FT8A 5LMNE 3ZXOA 4NH8A 5IDMA 1FI4A 1U2OA 2YEHA 2UU9I 4UROA 2BM1A 2XDXA 2UWDA 1JM6A 5F5RA 4FCRA 1Z5AA 2E5LE 1UYEA 5C93A 1S14A 1HR0E 4JI2I 2EXLA 3CGYA 4YKXA 4JI0I 4K0KI 5CPHA 4JG4A 4YHHI 2QG0A 4DV0I 1FNMA 4JI2E 2J7KA 1B62A 1Z0CA 2JJCA 2WEPA 4DUHA 2CZ9A 1Y8PA 2BYIA 3RKZA 4UTGA 1XNQI 2Q2EB 4DR7I 2A2CA 3TZ2A 2XX5A 1NZ0A 4LWFA 4XCLA 2DEIA 4DR6I 1IBKI 1QYEA 2ESAA 1KVKA 3QT7A 5CTUA 4HYMA 4LWEA 2WI3A 3BMYA 4DV6E 4EFUA 2XX4A 3J81C 3B28A 4LFAI 2XDSA 2Q8FA 4X64E 2CH4A 4H81A 4XKOA 1RR9A 4DUZI 4LF9E 3Q5KA 2C2AA 3QTFA 2Q8GA 2ZKJA 4B7PA 4YKZA 3G7BA 4LF6I 4DZYA 2HCHA 3K1JA 2V2QA 1BGQA 1N36E 2PNRA 5IWAI 4YKYA 1KTVA 2YE3A 2BYHA 3ZM7A 3RLRA 4DV3I 4DUYE 2WI2A 4FWGA 2XK2A 2IOQA 1BYQA 3A0XA 4X65E 4JQLA 2UXDI 1UYGA 1AMWA 5BR8E 2Q8HA 1N33E 4URNA 2IWUA 2XEXA 3HYYA 4NXME 4USMA 3VHAA 5FWKA 4R1FA 1HNWI 1KIJA 1AH6A 4YKWA 1ZM9A 2UUBI 2XHTA 4MPEA 4EGKA 1HNZE 4YKQA 3WU4A 4PRXA 4JI1E 1THNA 2YE2A 3GIGB 5IT9Q 3OW6A 5F3KA 1H74A 1MG7A 1UYIA 3EKOA 3PYGA 1I58A 1DARA 1Z5BA 4WUDA 4WUBA 5LL6R 4JYAI 2HFSA 3T2SA 2CGEA 3B24A 4ED4A 2IWXA 1ID0A 3EHGA 4LF5I 3J80C 3DGEA 1AH8A 4XIPA 4DV1I 3CRKA 3EHFA 4H7QA 2V2VA 2GFDA 3R4OA 4JI4I 4XDMA 2VCJA 3R91A 4ASAA 4E02A 2H8MA 3D2RA 4URLA 3VHCA 4RPFA 1J5EI 2YE9A 2YJXA 4EFTA 2F4VI 4E00A 1OJ4A 3HJCA 4USKA 2AJ4A 4I3HA 1XNRE 3PYFA 3J7AM 3HULA 3M6AA 4GKJI 4GKKE 2PNLA 4AWOA 2FWZA 3B82A 4M1KA 2YE8A 5D6QA 3A0RA 1NHHA 1IBLE 3CWVA 4JI1I 4B3MI 1ZM4A 4XTJA 2XJGA 4O09A 4CWNA 4LF8I 4X62I 2Z5EA 2OI2A 2VQFE 5IDJA 2YI0A 4FWHA 4HZ0A 2JKIA 1MU5A 1TIDA 2YEEA 5L3JA 5IN9A 2EFGA 2X7IA 3B25A 3B27A 3HYZA 3WU3A 3ZZUA 2UUCI 1UEKA 2XDUA 1RREA 2H55A 4O04A 1NHJA 4B3RE 2ZM6E 3T1YI 2YK2A 4XC0A 4V25A 4DV3E 1EI1A 2UXBE 4DPUA 3K99A 4MPCA 4FN5A 1XMOE 3T1HE 4BIZA 5IT9C 1IBMI 2UUBE 2VWCA 3GIFA 4MBCA 4E01A 5CTWA 4L93A 3BM9A 1WUUA 1UYCA 1XNRI 4Z7CA 3PEHA 4HYPA 4HACA 1YC1A 5FNFA 4BAEA 4LFAE 1N33I 4B3SE 2YI6A 2YK9A 4CWRA 2BU6A 4L91A 2R42A 4LF8E 4X9LA 3CRLA 1N0UA 4B3ME 4LF4I 4AWQA 3MNRP 3CGZA 2YE6A 2ZDXA 4DPYA 2YEBA 4JAUA 4O07A 1Z0BA 3ZZ0A 4U7NA 3JAMC 4IZJD 4CWFA 1S4EA 4JV5E 4KSGA 1S16A 4LF9I 2Z5BB 4OX9I 1YT1A 4YHHE 4YY3E 4DPTA 4XIRA 4DR2E 4Z7YA 1VISA 2E0AA 3B78A 4FCPA 2YJWA 4EM7A 5FLXC 2UU9E 5J6AA 3F0NA 1IBKE 2XJJA 3PRYA 2HKEA 1USVA 4DR7E 2BU8A 1K47A 3R4MA 4U93A 2V2ZA 4DPXA 4KHPI 4MP2A 4BQGA 3GIEA 4JI7E 2ZITA 3WQ9A 4IZKB 1HR0I 4YKTA 4JI5E 3V5RA 3TZ5A 4HZ5A 4DV4I 1A6FA 1N36I 1GKXA 5GMDA 5M4EA 4DPWA 2V8PA 1EA6A 1Z0GA 1Y8NA 4ASFA 4LF7I 3OPDA 4I5SA 3QT6A 3T10A 4LWGA 5J71A 3KE6A 2Z5CA 4UT4A 4IZJB 3ZKDA 3QT8A 2UUAE 4NH7A 5BR8I 4B3TE 2UXDE 2WI5A 2XDLA 4X66I 5M4MA 4DUYI 4P8OA 4HY1A 1XMQE 3WU5A 3P06A 4LFBE 4EEHA 2YGEA 1XNQE 2HK3A 3QDDA 4CWSA 3ZXQA 1AM1A 1XMQI 3TZ4A 1QZRA 3D36A 1Y4UA 4JI0E 4O0BA 2E1RA 5FNCA 4DR1E 2AKPA 4KHPE 3R92A 4B6CA 2UUAI 1YERA 2FWYA 3WU6A 3INXA 4HXZA 3T0ZA 4KQVA 4LF7E 2O1VA 1PKPA 1Z0TA 2GQPA 2HG1A 2WI4A 2BV3A 2GS8A 3R4NA 5M4HA 4DR2I 4JI5I 4ZKIA 3VHDA 2CGFA 3OWDA 4KFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQJ A;  4K0K E;  4XIT A;  2E5L I;  4XKA A;  1TC6 A;  1I94 I;  2CCU A;  4LFC I;  1Z0E A;  4P7A A;  5GGZ A;  5A2Q C;  4DR4 I;  2YEA A;  1FWK A;  1FJG E;  4LF4 E;  1N32 E;  3K17 A;  4DV2 E;  3HZ1 A;  1KKH A;  4X66 E;  2IOP A;  2NPF A;  1BKN A;  4DR1 I;  2HHH E;  3R4P A;  3O6O A;  2YGA A;  2BU7 A;  4AS9 A;  2CCS A;  4OX9 E;  4ASB A;  4JV5 I;  1HNX I;  3EHJ A;  3Q5J A;  3VAD A;  1ZXN A;  4JI6 E;  4FW9 A;  1Z0V A;  2HK2 A;  1B63 A;  4GQT A;  4LFB I;  3GON A;  4KSH A;  3HEK A;  2UXB I;  4BXI A;  2QFO A;  4ZVI A;  2CG9 A;  2UXC I;  4LWI A;  1ZM3 A;  4CE3 A;  4B3R I;  5D7R A;  4JI8 E;  1ZW9 A;  3U2D A;  4CE2 A;  4EGH A;  3OWB A;  2XHR A;  1UYM A;  4DXL A;  4AQY E;  3T0H A;  5LMU I;  3NMQ A;  1UY8 A;  1I5D A;  3Q5L A;  2O1W A;  3V2U C;  3T1H I;  2VQF I;  4DV4 E;  2VW5 A;  4X62 E;  3TTZ A;  1ELO A;  3C11 A;  4R3A A;  3J7A G;  4JI7 I;  4HY6 A;  3U2K A;  3EHH A;  2LJP A;  1ZM2 A;  1YSZ A;  2YE4 A;  3T1Y E;  2ZM6 I;  4DR5 I;  1FWL A;  1PVG A;  3LNU A;  4GGL A;  1Y8O A;  3B26 A;  4KTN A;  2VQE E;  3K98 A;  2WER A;  2YI5 A;  4DU8 A;  4YKR A;  1H7U A;  2F4V E;  3ZKB A;  2XCM A;  4DV7 E;  3OTO I;  3D4J A;  5FND A;  3JZ3 A;  4DR3 E;  3A0Y A;  4DR3 I;  3A0W A;  1U2R A;  1OSF A;  2XX2 A;  1MX0 A;  2X36 A;  4YY3 I;  4B3S I;  2VF3 A;  4DU7 A;  1ZWH A;  2CCT A;  3JAM Q;  3TZ0 A;  2BU5 A;  1N34 I;  1UYK A;  4NXN I;  4URM A;  1YT2 A;  2Q8I A;  4CWT A;  1FKA E;  1GJV A;  1TH8 A;  2R3V A;  1IBM E;  1YT0 A;  4JYA E;  2BSM A;  4FCQ A;  4QPK A;  4W7T A;  4WUC A;  4XE2 A;  4NXN E;  3K97 A;  2YEJ A;  3SL2 A;  1ZXM A;  3Q1Q A;  1YET A;  2WI7 A;  5M4N A;  3LTO A;  4CWP A;  1AJ6 A;  1N0V C;  2V34 A;  2YEF A;  2BRC A;  4FPP A;  2WI6 A;  4JI4 E;  2UUC E;  4DV7 I;  2YKE A;  4H85 A;  4XCJ A;  4PL9 A;  4JI3 I;  2WI1 A;  5CF0 A;  4LF5 E;  1YC4 A;  2WEQ A;  4MOT A;  4HAC B;  4GT8 A;  2YGF A;  2YE7 A;  2YED A;  1NHI A;  4JI3 E;  4V26 A;  1I5C A;  2QG2 A;  1XMO I;  1I5A A;  4LPB A;  4PRV A;  1B3Q A;  4QPJ A;  4L94 A;  1IBL I;  3RLQ A;  1HNZ I;  1GKZ A;  3C0E A;  5BOC A;  3G7E A;  1BXD A;  2BTZ A;  4GKK I;  4FWD A;  4GKJ E;  4LF6 E;  4MB9 A;  4GCZ A;  5LMU E;  2IOR A;  2YEC A;  2FXS A;  1N34 E;  4NXM I;  3T1K A;  4X64 I;  4K4O A;  1TBW A;  1YES A;  2DEJ A;  1UY9 A;  5BOD A;  3J80 Q;  2HHH I;  4DV6 I;  4X65 I;  3INW A;  3OTO E;  4FMT A;  2UXC E;  4DV2 I;  3D0B A;  2QF6 A;  4KP4 A;  1Z5C A;  2O1U A;  1FJG I;  4CWQ A;  4O05 A;  2BRE A;  4EMV A;  3HHU A;  1L0O A;  3K60 A;  1R62 A;  2VQE I;  3ZZT A;  4LFC E;  2BU2 A;  2XD6 A;  1TC0 A;  5GME A;  1Y4S A;  4Q20 A;  4CE1 A;  1QY8 A;  4JAV A;  2BM0 A;  3RLP A;  3EKR A;  2YKJ A;  1J5E E;  4U7O A;  2YEG A;  4XKK A;  2ZDY A;  2YI7 A;  2BT0 A;  5M4K A;  2YEI A;  4MPN A;  1Z59 A;  4DV1 E;  1H7S A;  5CTY A;  1TIL A;  1YS3 A;  4DR4 E;  2IWS A;  3A0Z A;  4EMD A;  5LMN I;  5M4P A;  4DV5 I;  3HZ5 A;  3A0T A;  2XAB A;  3OMU A;  1I94 E;  3G75 A;  3PEJ A;  1H72 C;  4DR5 E;  3B8H A;  3PYE A;  4GFN A;  3LPS A;  3U67 A;  3FT5 A;  2YKC A;  1UY7 A;  1D6T A;  4L90 A;  2BZ5 A;  2HFU A;  3GIG A;  2YE5 A;  5IWA E;  3TUH A;  2HKJ A;  1I5B A;  4XD8 A;  5A2Q Q;  4JI6 I;  5FLX Q;  2XJX A;  2YKB A;  1UYH A;  2K5B A;  1HNW E;  2XDK A;  1YC3 A;  4LP0 A;  1U0Z A;  3PYD A;  3IED A;  4CWO A;  1UYL A;  4JAS A;  4DUZ E;  4AQY I;  1H73 A;  3O0I A;  3FV5 A;  4BIU A;  4JI8 I;  1A4H A;  3WHA A;  4EGI A;  4GEE A;  4LWH A;  1N32 I;  2WW4 A;  4ASG A;  1US7 A;  2A2D A;  4NH9 A;  4MP7 A;  1XHK A;  4DR6 E;  4YKU A;  2FYP A;  4XIQ A;  1KZN A;  5D7C A;  3H4L A;  1UY6 A;  1HNX E;  1PIE A;  1UYF A;  3QT5 A;  3O2F A;  4R3M A;  4DV0 E;  1Z0W A;  1I59 A;  4MYT A;  5CTX A;  3J81 Q;  4P52 A;  1YSR A;  2ZBK B;  4HXW A;  5D6P A;  4B3T I;  1UYD A;  4L8Z A;  2VCI A;  2XHX A;  4AWP A;  3H80 A;  4MYU A;  4PU9 A;  2YKI A;  5D7D A;  4DV5 E;  3FT8 A;  5LMN E;  3ZXO A;  4NH8 A;  5IDM A;  1FI4 A;  1U2O A;  2YEH A;  2UU9 I;  4URO A;  2BM1 A;  2XDX A;  2UWD A;  1JM6 A;  5F5R A;  4FCR A;  1Z5A A;  2E5L E;  1UYE A;  5C93 A;  1S14 A;  1HR0 E;  4JI2 I;  2EXL A;  3CGY A;  4YKX A;  4JI0 I;  4K0K I;  5CPH A;  4JG4 A;  4YHH I;  2QG0 A;  4DV0 I;  1FNM A;  4JI2 E;  2J7K A;  1B62 A;  1Z0C A;  2JJC A;  2WEP A;  4DUH A;  2CZ9 A;  1Y8P A;  2BYI A;  3RKZ A;  4UTG A;  1XNQ I;  2Q2E B;  4DR7 I;  2A2C A;  3TZ2 A;  2XX5 A;  1NZ0 A;  4LWF A;  4XCL A;  2DEI A;  4DR6 I;  1IBK I;  1QYE A;  2ESA A;  1KVK A;  3QT7 A;  5CTU A;  4HYM A;  4LWE A;  2WI3 A;  3BMY A;  4DV6 E;  4EFU A;  2XX4 A;  3J81 C;  3B28 A;  4LFA I;  2XDS A;  2Q8F A;  4X64 E;  2CH4 A;  4H81 A;  4XKO A;  1RR9 A;  4DUZ I;  4LF9 E;  3Q5K A;  2C2A A;  3QTF A;  2Q8G A;  2ZKJ A;  4B7P A;  4YKZ A;  3G7B A;  4LF6 I;  4DZY A;  2HCH A;  3K1J A;  2V2Q A;  1BGQ A;  1N36 E;  2PNR A;  5IWA I;  4YKY A;  1KTV A;  2YE3 A;  2BYH A;  3ZM7 A;  3RLR A;  4DV3 I;  4DUY E;  2WI2 A;  4FWG A;  2XK2 A;  2IOQ A;  1BYQ A;  3A0X A;  4X65 E;  4JQL A;  2UXD I;  1UYG A;  1AMW A;  5BR8 E;  2Q8H A;  1N33 E;  4URN A;  2IWU A;  2XEX A;  3HYY A;  4NXM E;  4USM A;  3VHA A;  5FWK A;  4R1F A;  1HNW I;  1KIJ A;  1AH6 A;  4YKW A;  1ZM9 A;  2UUB I;  2XHT A;  4MPE A;  4EGK A;  1HNZ E;  4YKQ A;  3WU4 A;  4PRX A;  4JI1 E;  1THN A;  2YE2 A;  3GIG B;  5IT9 Q;  3OW6 A;  5F3K A;  1H74 A;  1MG7 A;  1UYI A;  3EKO A;  3PYG A;  1I58 A;  1DAR A;  1Z5B A;  4WUD A;  4WUB A;  5LL6 R;  4JYA I;  2HFS A;  3T2S A;  3B24 A;  4ED4 A;  2IWX A;  1ID0 A;  3EHG A;  4LF5 I;  3J80 C;  3DGE A;  1AH8 A;  4XIP A;  4DV1 I;  3CRK A;  3EHF A;  4H7Q A;  2V2V A;  2GFD A;  3R4O A;  4JI4 I;  4XDM A;  2VCJ A;  3R91 A;  4ASA A;  4E02 A;  2H8M A;  3D2R A;  4URL A;  3VHC A;  4RPF A;  1J5E I;  2YE9 A;  2YJX A;  4EFT A;  2F4V I;  4E00 A;  1OJ4 A;  4USK A;  2AJ4 A;  4I3H A;  1XNR E;  3PYF A;  3J7A M;  3HUL A;  3M6A A;  4GKJ I;  4GKK E;  4AWO A;  2FWZ A;  3B82 A;  4M1K A;  2YE8 A;  5D6Q A;  3A0R A;  1NHH A;  1IBL E;  3CWV A;  4JI1 I;  4B3M I;  1ZM4 A;  4XTJ A;  2XJG A;  4O09 A;  4CWN A;  4LF8 I;  4X62 I;  2OI2 A;  2VQF E;  5IDJ A;  2YI0 A;  4FWH A;  4HZ0 A;  2JKI A;  1MU5 A;  1TID A;  2YEE A;  5L3J A;  5IN9 A;  2EFG A;  2X7I A;  3B25 A;  3B27 A;  3HYZ A;  3WU3 A;  3ZZU A;  2UUC I;  1UEK A;  2XDU A;  1RRE A;  2H55 A;  4O04 A;  1NHJ A;  4B3R E;  2ZM6 E;  3T1Y I;  2YK2 A;  4XC0 A;  4V25 A;  4DV3 E;  1EI1 A;  2UXB E;  4DPU A;  3K99 A;  4MPC A;  4FN5 A;  1XMO E;  3T1H E;  4BIZ A;  5IT9 C;  1IBM I;  2UUB E;  2VWC A;  3GIF A;  4MBC A;  4E01 A;  5CTW A;  4L93 A;  3BM9 A;  1WUU A;  1UYC A;  1XNR I;  4Z7C A;  3PEH A;  4HYP A;  4HAC A;  1YC1 A;  5FNF A;  4BAE A;  4LFA E;  1N33 I;  4B3S E;  2YI6 A;  2YK9 A;  4CWR A;  2BU6 A;  4L91 A;  2R42 A;  4LF8 E;  4X9L A;  3CRL A;  1N0U A;  4B3M E;  4LF4 I;  4AWQ A;  3MNR P;  3CGZ A;  2YE6 A;  2ZDX A;  4DPY A;  2YEB A;  4JAU A;  4O07 A;  1Z0B A;  3ZZ0 A;  4U7N A;  3JAM C;  4CWF A;  1S4E A;  4JV5 E;  4KSG A;  1S16 A;  4LF9 I;  4OX9 I;  1YT1 A;  4YHH E;  4YY3 E;  4DPT A;  4XIR A;  4DR2 E;  4Z7Y A;  1VIS A;  2E0A A;  3B78 A;  4FCP A;  2YJW A;  4EM7 A;  5FLX C;  2UU9 E;  5J6A A;  3F0N A;  1IBK E;  2XJJ A;  2HKE A;  4DR7 E;  2BU8 A;  1K47 A;  3R4M A;  4U93 A;  2V2Z A;  4DPX A;  4KHP I;  4MP2 A;  4BQG A;  3GIE A;  4JI7 E;  2ZIT A;  3WQ9 A;  1HR0 I;  4YKT A;  4JI5 E;  3V5R A;  3TZ5 A;  4HZ5 A;  4DV4 I;  1A6F A;  1N36 I;  1GKX A;  5GMD A;  5M4E A;  4DPW A;  2V8P A;  1EA6 A;  1Z0G A;  1Y8N A;  4ASF A;  4LF7 I;  3OPD A;  4I5S A;  3QT6 A;  3T10 A;  4LWG A;  5J71 A;  3KE6 A;  4UT4 A;  3ZKD A;  3QT8 A;  2UUA E;  4NH7 A;  5BR8 I;  4B3T E;  2UXD E;  2WI5 A;  2XDL A;  4X66 I;  5M4M A;  4DUY I;  4P8O A;  4HY1 A;  3WU5 A;  1XMQ E;  4LFB E;  4EEH A;  2YGE A;  1XNQ E;  2HK3 A;  3QDD A;  4CWS A;  3ZXQ A;  1AM1 A;  1XMQ I;  3TZ4 A;  1QZR A;  3D36 A;  1Y4U A;  4JI0 E;  4O0B A;  2E1R A;  5FNC A;  4DR1 E;  2AKP A;  4KHP E;  3R92 A;  4B6C A;  2UUA I;  1YER A;  2FWY A;  3WU6 A;  3INX A;  4HXZ A;  3T0Z A;  4KQV A;  4LF7 E;  2O1V A;  1PKP A;  1Z0T A;  2GQP A;  2HG1 A;  2WI4 A;  2BV3 A;  2GS8 A;  3R4N A;  5M4H A;  4DR2 I;  4JI5 I;  4ZKI A;  3VHD A;  2CGF A;  3OWD A;  4KFG A; 
#chains in the Genus database with same CATH topology
 1USU A;  3M85 G;  4BQJ A;  2PNZ B;  4K0K E;  2NN6 B;  2PNZ A;  4XIT A;  1XXE A;  2E5L I;  4XKA A;  1TC6 A;  1I94 I;  2C38 A;  2CCU A;  4LFC I;  4OZE A;  1Z0E A;  4P7A A;  5GGZ A;  5A2Q C;  4DR4 I;  2YEA A;  2C1G A;  3P3E A;  1FWK A;  3P3C A;  1FJG E;  1Y6Z A;  4LF4 E;  1N32 E;  3K17 A;  4DV2 E;  3HZ1 A;  1KKH A;  4X66 E;  2IOP A;  2NPF A;  3PS2 A;  1BKN A;  4DR1 I;  2HHH E;  3R4P A;  3O6O A;  2YGA A;  2BU7 A;  3HKM A;  4AS9 A;  2CCS A;  2JEB A;  4OX9 E;  4ASB A;  4JV5 I;  1HNX I;  5DRR A;  3EHJ A;  3Q5J A;  1VI7 A;  5C0X B;  1ZXN A;  3VAD A;  4JI6 E;  4FW9 A;  1Z0V A;  2HK2 A;  1B63 A;  4GQT A;  4LFB I;  3GON A;  4KSH A;  3HEK A;  2UXB I;  4BXI A;  2QFO A;  4ZVI A;  2CG9 A;  2UXC I;  5K36 F;  4LWI A;  1ZM3 A;  4CE3 A;  4B3R I;  5D7R A;  4JI8 E;  1ZW9 A;  3U2D A;  3GME A;  4CE2 A;  4EGH A;  3OWB A;  2XHR A;  1UYM A;  4DXL A;  4IZJ A;  4AQY E;  3T0H A;  5LMU I;  3NMQ A;  1UY8 A;  1I5D A;  2C39 A;  3Q5L A;  2O1W A;  3V2U C;  3S5T A;  3T1H I;  2VQF I;  4DV4 E;  2VW5 A;  4X62 E;  3TTZ A;  1ELO A;  3C11 A;  4R3A A;  3J7A G;  4JI7 I;  4MU0 A;  4HY6 A;  3U2K A;  2BA0 G;  3EHH A;  2LJP A;  2HHI A;  1ZM2 A;  3NZK A;  1YSZ A;  2YE4 A;  3T1Y E;  2ZM6 I;  4DR5 I;  1FWL A;  1PVG A;  3LNU A;  4GGL A;  1HK7 A;  1Y8O A;  3B26 A;  4KTN A;  2VQE E;  3K98 A;  3B4T A;  2WER A;  1R6L A;  2YI5 A;  4DU8 A;  4MDT A;  4YKR A;  1H7U A;  2F4V E;  3UHM A;  4OO1 B;  5K36 D;  3ZKB A;  2XCM A;  4DV7 E;  3OTO I;  3D4J A;  5FND A;  3JZ3 A;  4DR3 E;  3Q6N A;  3A0Y A;  4DR3 I;  4AIM A;  3A0W A;  1U2R A;  1OSF A;  2XX2 A;  1MX0 A;  2X36 A;  4YY3 I;  4B3S I;  2VF3 A;  3M7N D;  4DU7 A;  1ZWH A;  2CCT A;  3JAM Q;  3TZ0 A;  2BU5 A;  1YH8 A;  2GO3 A;  1N34 I;  4NXN I;  1UYK A;  4URM A;  1YT2 A;  2Q8I A;  4CWT A;  4OKG A;  1FKA E;  1GJV A;  1TH8 A;  1RHY A;  2R3V A;  1IBM E;  4JYA E;  1YT0 A;  2BSM A;  4FCQ A;  4QPK A;  4WUC A;  4W7T A;  4XE2 A;  5DNL A;  4NXN E;  3K97 A;  2YEJ A;  3SL2 A;  2PNM A;  1ZXM A;  3Q1Q A;  4J3D A;  1YET A;  2WI7 A;  5M4N A;  3LTO A;  4CWP A;  2BA1 G;  1AJ6 A;  1N0V C;  2V34 A;  3PS1 A;  4IFD A;  2NN6 F;  2YEF A;  2BRC A;  4FPP A;  2WI6 A;  2C39 B;  2C38 B;  2UUC E;  4DV7 I;  4JI4 E;  4IZK A;  2YKE A;  4H85 A;  4PL9 A;  4XCJ A;  1UDS A;  4JI3 I;  2WI1 A;  3K85 A;  5CF0 A;  4LF5 E;  1YC4 A;  2WEQ A;  4MOT A;  4HAC B;  4GT8 A;  2YGF A;  1P42 A;  2YE7 A;  2YED A;  1NHI A;  2Z5C B;  4JI3 E;  4OO1 E;  1I5C A;  2BR2 A;  4V26 A;  2QG2 A;  1XMO I;  1I5A A;  2PO0 A;  5JEA E;  4LPB A;  4PRV A;  1B3Q A;  4U3D A;  4L94 A;  1IBL I;  4QPJ A;  3RLQ A;  1HNZ I;  4BA1 B;  1GKZ A;  3C0E A;  4GQU A;  5BOC A;  2IER A;  3G7E A;  1BXD A;  5C0X A;  2BTZ A;  4GKK I;  4FWD A;  4GKJ E;  5JEN A;  4LF6 E;  4MB9 A;  4GCZ A;  5LMU E;  2IOR A;  2YEC A;  4LCF A;  1N34 E;  2FXS A;  4NXM I;  3T1K A;  4X64 I;  4K4O A;  1TBW A;  1YES A;  2O3Z A;  2DEJ A;  1UY9 A;  5BOD A;  2NN6 D;  3J80 Q;  4MU3 A;  4N3O A;  2HHH I;  4DV6 I;  4X65 I;  3INW A;  3OTO E;  4FMT A;  2UXC E;  4DV2 I;  3D0B A;  2QF6 A;  4KP4 A;  1Z5C A;  2O1U A;  1FJG I;  4CWQ A;  3H1C A;  2BRE A;  4O05 A;  4EMV A;  3HHU A;  4IS9 A;  1L0O A;  3K60 A;  1R62 A;  2VQE I;  3ZZT A;  3Q6M A;  4LFC E;  2BU2 A;  1TC0 A;  5GME A;  1Y4S A;  2Z5B A;  2XD6 A;  4Q20 A;  4CE1 A;  1QY8 A;  4JAV A;  2CVE A;  2BM0 A;  3RLP A;  3EKR A;  2YKJ A;  1J5E E;  4U7O A;  2YEG A;  4XKK A;  2ZDY A;  2C1I A;  2YI7 A;  2BT0 A;  5M4K A;  2YEI A;  4MPN A;  1Z59 A;  3L7Z A;  4DV1 E;  1H7S A;  5CTY A;  2WP8 A;  1TIL A;  1YHC A;  2GQ0 A;  1YS3 A;  4DR4 E;  2IWS A;  3A0Z A;  4EMD A;  5LMN I;  5M4P A;  4DV5 I;  3HZ5 A;  3A0T A;  2XAB A;  3OMU A;  1I94 E;  3G75 A;  3PEJ A;  1H72 C;  4DR5 E;  3B8H A;  2JEA B;  3PYE A;  4GFN A;  3LPS A;  3U67 A;  4BA2 B;  3FT5 A;  2YKC A;  1UY7 A;  1D6T A;  4L90 A;  3GLL A;  4U3B A;  2BZ5 A;  2HFU A;  3GIG A;  3GCM A;  2YE5 A;  5IWA E;  3TUH A;  2HKJ A;  1I5B A;  3U1K A;  4XD8 A;  5A2Q Q;  4JI6 I;  2O1T A;  4QNK A;  5FLX Q;  2XJX A;  2YKB A;  1UYH A;  2K5B A;  1HNW E;  5JEA B;  4LPF A;  1YC3 A;  5DNX A;  1U0Z A;  3PYD A;  2XDK A;  4LP0 A;  3IED A;  4CWO A;  1UYL A;  4JAS A;  4DUZ E;  3CDI A;  4AQY I;  1H73 A;  3O0I A;  3FV5 A;  4BIU A;  4JI8 I;  1A4H A;  2NN6 A;  3WHA A;  4AID A;  4EGI A;  4GEE A;  4LWH A;  1N32 I;  2WW4 A;  4ASG A;  4FW6 A;  1US7 A;  1OYP A;  2A2D A;  4NH9 A;  4MP7 A;  1XHK A;  4DR6 E;  4YKU A;  2FYP A;  4XIQ A;  1KZN A;  5D7C A;  3H4L A;  1UY6 A;  1HNX E;  1PIE A;  1UYF A;  3QT5 A;  3O2F A;  4R3M A;  4DV0 E;  1Z0W A;  1I59 A;  4MYT A;  5CTX A;  2JE6 B;  3J81 Q;  4FW5 A;  4P52 A;  1YSR A;  2ZBK B;  2C37 B;  2PO1 B;  4HXW A;  5D6P A;  4B3T I;  1UYD A;  4L8Z A;  2BA0 D;  2VCI A;  2XHX A;  4AWP A;  3H80 A;  2PO2 A;  4MYU A;  4PU9 A;  2YKI A;  5D7D A;  4DV5 E;  3FT8 A;  2IES A;  5LMN E;  3ZXO A;  4NH8 A;  5IDM A;  1FI4 A;  1U2O A;  2YEH A;  2UU9 I;  4URO A;  2BM1 A;  2XDX A;  2UWD A;  1JM6 A;  5F5R A;  4FCR A;  1Z5A A;  2E5L E;  1UYE A;  5C93 A;  1S14 A;  1HR0 E;  4JI2 I;  2EXL A;  3CGY A;  4YKX A;  4JI0 I;  4K0K I;  5CPH A;  4MQY A;  4JG4 A;  4YHH I;  2QG0 A;  4DV0 I;  1FNM A;  4JI2 E;  2J7K A;  1B62 A;  1Z0C A;  2JJC A;  2WEP A;  4DUH A;  2CZ9 A;  1Y8P A;  2BYI A;  2J65 A;  3RKZ A;  4LCG A;  4UTG A;  1XNQ I;  2Q2E B;  4FW7 A;  2A2C A;  4DR7 I;  3TZ2 A;  2XX5 A;  1NZ0 A;  4LWF A;  4XCL A;  2DEI A;  4DR6 I;  1IBK I;  4FW3 A;  1QYE A;  3CDJ A;  1KVK A;  3QT7 A;  2ESA A;  5CTU A;  4HYM A;  4LWE A;  2WI3 A;  4MU1 A;  3BMY A;  4DV6 E;  4IFD E;  2NN6 E;  4EFU A;  2XX4 A;  4QNJ A;  3J81 C;  3B28 A;  4LFA I;  2XDS A;  2Q8F A;  1E3H A;  4X64 E;  2CH4 A;  4H81 A;  2WNR B;  1RR9 A;  4DUZ I;  4LF9 E;  3Q5K A;  2C2A A;  3QTF A;  4XKO A;  2ZKJ A;  2Q8G A;  4YKZ A;  4B7P A;  3G7B A;  4LF6 I;  4DZY A;  3DD6 A;  3KRN A;  2HCH A;  3K1J A;  2V2Q A;  3L7Z B;  1BGQ A;  1N36 E;  3M7N G;  4OO1 D;  2PNR A;  4ISA A;  5IWA I;  4YKY A;  1KTV A;  2YE3 A;  2BYH A;  3ZM7 A;  3RLR A;  4DV3 I;  4DUY E;  2WI2 A;  4FWG A;  5EKW A;  2XK2 A;  2IOQ A;  1BYQ A;  3A0X A;  4X65 E;  4JQL A;  2UXD I;  1UYG A;  1AMW A;  5BR8 E;  1E3P A;  2Q8H A;  1N33 E;  4URN A;  2IWU A;  2XEX A;  3HYY A;  4NXM E;  4USM A;  3VHA A;  1UDO A;  4FW4 A;  5FWK A;  4R1F A;  1HNW I;  1KIJ A;  1AH6 A;  3LMM A;  4YKW A;  1ZM9 A;  2UUB I;  2NN6 C;  2XHT A;  4MPE A;  4EGK A;  1HNZ E;  4YKQ A;  3WU4 A;  4PRX A;  4JI1 E;  1THN A;  2YE2 A;  3GIG B;  5IT9 Q;  3OW6 A;  5F3K A;  1H74 A;  2PO2 B;  1MG7 A;  1UYI A;  3EKO A;  3PYG A;  1I58 A;  1DAR A;  1Z5B A;  4WUB A;  4WUD A;  3PS3 A;  5LL6 R;  4IFD C;  2HFS A;  3P3G A;  4JYA I;  2CGE A;  3T2S A;  3B24 A;  4OO1 F;  4ED4 A;  2IWX A;  1ID0 A;  3EHG A;  5EL9 A;  3J80 C;  4LF5 I;  1AH8 A;  3DGE A;  4XIP A;  4DV1 I;  3CRK A;  3EHF A;  4H7Q A;  2V2V A;  2GFD A;  3R4O A;  4LOM A;  4JI4 I;  4XDM A;  2VCJ A;  3R91 A;  4ASA A;  4E02 A;  2H8M A;  3D2R A;  2PO0 B;  2JT2 A;  4URL A;  3VHC A;  4RPF A;  1J5E I;  5K36 A;  2YE9 A;  2YJX A;  2F4V I;  4EFT A;  4E00 A;  1OJ4 A;  2BR2 B;  3HJC A;  4USK A;  2AJ4 A;  2C37 A;  2WNR A;  4I3H A;  1XNR E;  4E72 A;  3PYF A;  3J7A M;  3HUL A;  2JE6 A;  3M6A A;  4GKJ I;  4GKK E;  2PNL A;  4AWO A;  2FWZ A;  3B82 A;  4M1K A;  2YE8 A;  5D6Q A;  3A0R A;  1NHH A;  1IBL E;  4IFD B;  4AM3 A;  3CWV A;  4JI1 I;  4B3M I;  1ZM4 A;  4XTJ A;  2XJG A;  4O09 A;  4CWN A;  4LF8 I;  4X62 I;  2Z5E A;  2OI2 A;  2VQF E;  5IDJ A;  2YI0 A;  4FWH A;  2AE8 A;  1UDN A;  4HZ0 A;  2JKI A;  1MU5 A;  5C0X E;  1TID A;  5DRO A;  5L3J A;  2YEE A;  4BA2 A;  5IN9 A;  2EFG A;  2X7I A;  2JEA A;  3B25 A;  3B27 A;  3HYZ A;  1IXM A;  3WU3 A;  3ZZU A;  2UUC I;  1UEK A;  2XDU A;  1UDQ A;  1RRE A;  2H55 A;  4O04 A;  1NHJ A;  4B3R E;  2ZM6 E;  3T1Y I;  5K36 C;  2YK2 A;  5K36 B;  4XC0 A;  4V25 A;  4DV3 E;  1EI1 A;  2UXB E;  4DPU A;  3K99 A;  4MPC A;  2BA1 D;  3P76 A;  4FN5 A;  1XMO E;  3T1H E;  4BIZ A;  5IT9 C;  1IBM I;  2UUB E;  2VWC A;  3GIF A;  4MBC A;  4E01 A;  4NBQ A;  5CTW A;  2FTK A;  4L93 A;  3BM9 A;  1WUU A;  1UYC A;  1XNR I;  4Z7C A;  3PEH A;  4HYP A;  4HAC A;  5C0X D;  1YC1 A;  5FNF A;  4BAE A;  4LFA E;  1N33 I;  4B3S E;  2YI6 A;  2YK9 A;  4CWR A;  2BU6 A;  2WP8 B;  4L91 A;  2R42 A;  2F1D A;  4LF8 E;  4IFD D;  4X9L A;  3CRL A;  1N0U A;  5K36 E;  4B3M E;  4LF4 I;  4AWQ A;  3MNR P;  3CGZ A;  2YE6 A;  2ZDX A;  4DPY A;  5JEA D;  2YEB A;  1Y5Y A;  4JAU A;  4O07 A;  1F51 A;  1Z0B A;  3ZZ0 A;  4U7N A;  3JAM C;  4IZJ D;  4CWF A;  3U1Y A;  1S4E A;  4JV5 E;  4KSG A;  1S16 A;  4LF9 I;  2Z5B B;  4OX9 I;  1YT1 A;  4YHH E;  5ELW A;  4DPT A;  4YY3 E;  4XIR A;  1OYS A;  5JEA A;  4DR2 E;  4Z7Y A;  1VIS A;  2E0A A;  3B78 A;  4FCP A;  2YJW A;  4EM7 A;  4OO1 A;  5FLX C;  2UU9 E;  5J6A A;  3F0N A;  4LCH A;  1IBK E;  2XJJ A;  3PRY A;  5C0X F;  2HKE A;  1USV A;  4DR7 E;  2JEB B;  2BU8 A;  1K47 A;  1Y60 A;  3R4M A;  4U93 A;  2PO1 A;  2V2Z A;  4DPX A;  4KHP I;  4MP2 A;  4IFD F;  3GIE A;  4MU4 A;  4BQG A;  5C0X C;  4JI7 E;  2ZIT A;  3WQ9 A;  4IZK B;  5JEA F;  1HR0 I;  4YKT A;  4JI5 E;  3V5R A;  3TZ5 A;  4HZ5 A;  1R6M A;  1A6F A;  4DV4 I;  1N36 I;  2VES A;  1GKX A;  5GMD A;  5M4E A;  4DPW A;  2V8P A;  1EA6 A;  1Z0G A;  1Y8N A;  4ASF A;  4LF7 I;  3OPD A;  4I5S A;  3QT6 A;  3T10 A;  4LWG A;  5J71 A;  3KE6 A;  2Z5C A;  4UT4 A;  4IZJ B;  3ZKD A;  3QT8 A;  2UUA E;  4NH7 A;  5BR8 I;  4B3T E;  2UXD E;  2GO4 A;  5DRP A;  2WI5 A;  2XDL A;  4X66 I;  5M4M A;  4DUY I;  1OYR A;  4P8O A;  4HY1 A;  3WU5 A;  1XMQ E;  3P06 A;  4LFB E;  4EEH A;  2YGE A;  5DRQ A;  1XNQ E;  3CYG A;  5JEA C;  2HK3 A;  3QDD A;  4CWS A;  3ZXQ A;  1AM1 A;  1XMQ I;  3TZ4 A;  1QZR A;  3D36 A;  4OO1 C;  1Y4U A;  4JI0 E;  4O0B A;  2E1R A;  5FNC A;  4DR1 E;  2AKP A;  4KHP E;  3R92 A;  4B6C A;  3M85 D;  2UUA I;  1YER A;  2FWY A;  3WU6 A;  3INX A;  4HXZ A;  3T0Z A;  4KQV A;  4BA1 A;  4LF7 E;  2O1V A;  1PKP A;  1Z0T A;  2GQP A;  2HG1 A;  2WI4 A;  2BV3 A;  2GS8 A;  3R4N A;  5M4H A;  4DR2 I;  4JI5 I;  4ZKI A;  3VHD A;  2CGF A;  3OWD A;  4KFG A; 
#chains in the Genus database with same CATH homology
 1USU A;  4BQJ A;  4K0K E;  4XIT A;  2E5L I;  4XKA A;  1TC6 A;  1I94 I;  2CCU A;  4LFC I;  1Z0E A;  4P7A A;  5GGZ A;  5A2Q C;  4DR4 I;  2YEA A;  1FWK A;  1FJG E;  1Y6Z A;  4LF4 E;  1N32 E;  3K17 A;  4DV2 E;  3HZ1 A;  1KKH A;  4X66 E;  2IOP A;  2NPF A;  1BKN A;  4DR1 I;  2HHH E;  3R4P A;  3O6O A;  2YGA A;  2BU7 A;  4AS9 A;  2CCS A;  4OX9 E;  4ASB A;  4JV5 I;  1HNX I;  3EHJ A;  3Q5J A;  3VAD A;  1ZXN A;  4JI6 E;  4FW9 A;  1Z0V A;  2HK2 A;  1B63 A;  4GQT A;  4LFB I;  3GON A;  4KSH A;  3HEK A;  2UXB I;  4BXI A;  2QFO A;  4ZVI A;  2CG9 A;  2UXC I;  4LWI A;  1ZM3 A;  4CE3 A;  4B3R I;  5D7R A;  4JI8 E;  1ZW9 A;  3U2D A;  4CE2 A;  4EGH A;  3OWB A;  2XHR A;  1UYM A;  4DXL A;  4IZJ A;  4AQY E;  3T0H A;  5LMU I;  3NMQ A;  1UY8 A;  1I5D A;  3Q5L A;  2O1W A;  3V2U C;  3T1H I;  2VQF I;  4DV4 E;  2VW5 A;  4X62 E;  3TTZ A;  1ELO A;  3C11 A;  4R3A A;  3J7A G;  4JI7 I;  4HY6 A;  3U2K A;  3EHH A;  2LJP A;  1ZM2 A;  1YSZ A;  2YE4 A;  3T1Y E;  2ZM6 I;  4DR5 I;  1FWL A;  1PVG A;  3LNU A;  4GGL A;  1HK7 A;  1Y8O A;  3B26 A;  4KTN A;  2VQE E;  3K98 A;  2WER A;  2YI5 A;  4DU8 A;  4YKR A;  1H7U A;  2F4V E;  3ZKB A;  2XCM A;  4DV7 E;  3OTO I;  3D4J A;  5FND A;  3JZ3 A;  4DR3 E;  3Q6N A;  3A0Y A;  4DR3 I;  3A0W A;  1U2R A;  1OSF A;  2XX2 A;  1MX0 A;  2X36 A;  4YY3 I;  4B3S I;  2VF3 A;  4DU7 A;  1ZWH A;  2CCT A;  3JAM Q;  3TZ0 A;  2BU5 A;  1N34 I;  1UYK A;  4NXN I;  4URM A;  1YT2 A;  2Q8I A;  4CWT A;  1FKA E;  1GJV A;  1TH8 A;  2R3V A;  1IBM E;  1YT0 A;  4JYA E;  2BSM A;  4FCQ A;  4QPK A;  4W7T A;  4WUC A;  4XE2 A;  4NXN E;  3K97 A;  2YEJ A;  3SL2 A;  2PNM A;  1ZXM A;  3Q1Q A;  1YET A;  2WI7 A;  5M4N A;  3LTO A;  4CWP A;  1AJ6 A;  1N0V C;  2V34 A;  2YEF A;  2BRC A;  4FPP A;  2WI6 A;  4JI4 E;  2UUC E;  4DV7 I;  2YKE A;  4IZK A;  4H85 A;  4XCJ A;  4PL9 A;  4JI3 I;  2WI1 A;  3K85 A;  5CF0 A;  4LF5 E;  1YC4 A;  2WEQ A;  4MOT A;  4HAC B;  4GT8 A;  2YGF A;  2YE7 A;  2YED A;  1NHI A;  2Z5C B;  4JI3 E;  4V26 A;  1I5C A;  2QG2 A;  1XMO I;  1I5A A;  4LPB A;  4PRV A;  1B3Q A;  4QPJ A;  4L94 A;  1IBL I;  3RLQ A;  1HNZ I;  1GKZ A;  3C0E A;  5BOC A;  3G7E A;  1BXD A;  2BTZ A;  4GKK I;  4FWD A;  4GKJ E;  4LF6 E;  4MB9 A;  4GCZ A;  5LMU E;  2IOR A;  2YEC A;  2FXS A;  1N34 E;  4NXM I;  3T1K A;  4X64 I;  4K4O A;  1TBW A;  1YES A;  2DEJ A;  1UY9 A;  5BOD A;  3J80 Q;  4N3O A;  2HHH I;  4DV6 I;  4X65 I;  3INW A;  3OTO E;  4FMT A;  2UXC E;  4DV2 I;  3D0B A;  2QF6 A;  4KP4 A;  1Z5C A;  2O1U A;  1FJG I;  4CWQ A;  4O05 A;  2BRE A;  4EMV A;  3HHU A;  1L0O A;  3K60 A;  1R62 A;  2VQE I;  3ZZT A;  3Q6M A;  4LFC E;  2BU2 A;  1TC0 A;  5GME A;  1Y4S A;  2Z5B A;  2XD6 A;  4Q20 A;  4CE1 A;  1QY8 A;  4JAV A;  2BM0 A;  3RLP A;  3EKR A;  2YKJ A;  1J5E E;  4U7O A;  2YEG A;  4XKK A;  2ZDY A;  2YI7 A;  2BT0 A;  5M4K A;  2YEI A;  4MPN A;  1Z59 A;  4DV1 E;  1H7S A;  5CTY A;  1TIL A;  1YS3 A;  2GQ0 A;  4DR4 E;  2IWS A;  3A0Z A;  4EMD A;  5LMN I;  5M4P A;  4DV5 I;  3HZ5 A;  3A0T A;  2XAB A;  3OMU A;  1I94 E;  3G75 A;  3PEJ A;  1H72 C;  4DR5 E;  3B8H A;  3PYE A;  4GFN A;  3LPS A;  3U67 A;  3FT5 A;  2YKC A;  1UY7 A;  1D6T A;  4L90 A;  2BZ5 A;  2HFU A;  3GIG A;  2YE5 A;  5IWA E;  3TUH A;  2HKJ A;  1I5B A;  4XD8 A;  5A2Q Q;  4JI6 I;  2O1T A;  5FLX Q;  2XJX A;  2YKB A;  1UYH A;  2K5B A;  1HNW E;  2XDK A;  1YC3 A;  4LP0 A;  1U0Z A;  3PYD A;  3IED A;  4CWO A;  1UYL A;  4JAS A;  4DUZ E;  4AQY I;  1H73 A;  3O0I A;  3FV5 A;  4BIU A;  4JI8 I;  1A4H A;  3WHA A;  4EGI A;  4GEE A;  4LWH A;  1N32 I;  2WW4 A;  4ASG A;  1US7 A;  2A2D A;  4NH9 A;  4MP7 A;  1XHK A;  4DR6 E;  4YKU A;  2FYP A;  4XIQ A;  1KZN A;  5D7C A;  3H4L A;  1UY6 A;  1HNX E;  1PIE A;  1UYF A;  3QT5 A;  3O2F A;  4R3M A;  4DV0 E;  1Z0W A;  1I59 A;  4MYT A;  5CTX A;  3J81 Q;  4P52 A;  1YSR A;  2ZBK B;  4HXW A;  5D6P A;  4B3T I;  1UYD A;  4L8Z A;  2VCI A;  2XHX A;  4AWP A;  3H80 A;  4MYU A;  4PU9 A;  2YKI A;  5D7D A;  4DV5 E;  3FT8 A;  5LMN E;  3ZXO A;  4NH8 A;  5IDM A;  1FI4 A;  1U2O A;  2YEH A;  2UU9 I;  4URO A;  2BM1 A;  2XDX A;  2UWD A;  1JM6 A;  5F5R A;  4FCR A;  1Z5A A;  2E5L E;  1UYE A;  5C93 A;  1S14 A;  1HR0 E;  4JI2 I;  2EXL A;  3CGY A;  4YKX A;  4JI0 I;  4K0K I;  5CPH A;  4JG4 A;  4YHH I;  2QG0 A;  4DV0 I;  1FNM A;  4JI2 E;  2J7K A;  1B62 A;  1Z0C A;  2JJC A;  2WEP A;  4DUH A;  2CZ9 A;  1Y8P A;  2BYI A;  3RKZ A;  4UTG A;  1XNQ I;  2Q2E B;  4DR7 I;  2A2C A;  3TZ2 A;  2XX5 A;  1NZ0 A;  4LWF A;  4XCL A;  2DEI A;  4DR6 I;  1IBK I;  1QYE A;  2ESA A;  1KVK A;  3QT7 A;  5CTU A;  4HYM A;  4LWE A;  2WI3 A;  3BMY A;  4DV6 E;  4EFU A;  2XX4 A;  3J81 C;  3B28 A;  4LFA I;  2XDS A;  2Q8F A;  4X64 E;  2CH4 A;  4H81 A;  4XKO A;  1RR9 A;  4DUZ I;  4LF9 E;  3Q5K A;  2C2A A;  3QTF A;  2Q8G A;  2ZKJ A;  4B7P A;  4YKZ A;  3G7B A;  4LF6 I;  4DZY A;  2HCH A;  3K1J A;  2V2Q A;  1BGQ A;  1N36 E;  2PNR A;  5IWA I;  4YKY A;  1KTV A;  2YE3 A;  2BYH A;  3ZM7 A;  3RLR A;  4DV3 I;  4DUY E;  2WI2 A;  4FWG A;  2XK2 A;  2IOQ A;  1BYQ A;  3A0X A;  4X65 E;  4JQL A;  2UXD I;  1UYG A;  1AMW A;  5BR8 E;  2Q8H A;  1N33 E;  4URN A;  2IWU A;  2XEX A;  3HYY A;  4NXM E;  4USM A;  3VHA A;  5FWK A;  4R1F A;  1HNW I;  1KIJ A;  1AH6 A;  4YKW A;  1ZM9 A;  2UUB I;  2XHT A;  4MPE A;  4EGK A;  1HNZ E;  4YKQ A;  3WU4 A;  4PRX A;  4JI1 E;  1THN A;  2YE2 A;  3GIG B;  5IT9 Q;  3OW6 A;  5F3K A;  1H74 A;  1MG7 A;  1UYI A;  3EKO A;  3PYG A;  1I58 A;  1DAR A;  1Z5B A;  4WUD A;  4WUB A;  5LL6 R;  4JYA I;  2HFS A;  3T2S A;  2CGE A;  3B24 A;  4ED4 A;  2IWX A;  1ID0 A;  3EHG A;  4LF5 I;  3J80 C;  3DGE A;  1AH8 A;  4XIP A;  4DV1 I;  3CRK A;  3EHF A;  4H7Q A;  2V2V A;  2GFD A;  3R4O A;  4JI4 I;  4XDM A;  2VCJ A;  3R91 A;  4ASA A;  4E02 A;  2H8M A;  3D2R A;  4URL A;  3VHC A;  4RPF A;  1J5E I;  2YE9 A;  2YJX A;  4EFT A;  2F4V I;  4E00 A;  1OJ4 A;  3HJC A;  4USK A;  2AJ4 A;  4I3H A;  1XNR E;  3PYF A;  3J7A M;  3HUL A;  3M6A A;  4GKJ I;  4GKK E;  2PNL A;  4AWO A;  2FWZ A;  3B82 A;  4M1K A;  2YE8 A;  5D6Q A;  3A0R A;  1NHH A;  1IBL E;  3CWV A;  4JI1 I;  4B3M I;  1ZM4 A;  4XTJ A;  2XJG A;  4O09 A;  4CWN A;  4LF8 I;  4X62 I;  2Z5E A;  2OI2 A;  2VQF E;  5IDJ A;  2YI0 A;  4FWH A;  4HZ0 A;  2JKI A;  1MU5 A;  1TID A;  2YEE A;  5L3J A;  5IN9 A;  2EFG A;  2X7I A;  3B25 A;  3B27 A;  3HYZ A;  3WU3 A;  3ZZU A;  2UUC I;  1UEK A;  2XDU A;  1RRE A;  2H55 A;  4O04 A;  1NHJ A;  4B3R E;  2ZM6 E;  3T1Y I;  2YK2 A;  4XC0 A;  4V25 A;  4DV3 E;  1EI1 A;  2UXB E;  4DPU A;  3K99 A;  4MPC A;  4FN5 A;  1XMO E;  3T1H E;  4BIZ A;  5IT9 C;  1IBM I;  2UUB E;  2VWC A;  3GIF A;  4MBC A;  4E01 A;  5CTW A;  4L93 A;  3BM9 A;  1WUU A;  1UYC A;  1XNR I;  4Z7C A;  3PEH A;  4HYP A;  4HAC A;  1YC1 A;  5FNF A;  4BAE A;  4LFA E;  1N33 I;  4B3S E;  2YI6 A;  2YK9 A;  4CWR A;  2BU6 A;  4L91 A;  2R42 A;  4LF8 E;  4X9L A;  3CRL A;  1N0U A;  4B3M E;  4LF4 I;  4AWQ A;  3MNR P;  3CGZ A;  2YE6 A;  2ZDX A;  4DPY A;  2YEB A;  4JAU A;  4O07 A;  1Z0B A;  3ZZ0 A;  4U7N A;  3JAM C;  4IZJ D;  4CWF A;  1S4E A;  4JV5 E;  4KSG A;  1S16 A;  4LF9 I;  2Z5B B;  4OX9 I;  1YT1 A;  4YHH E;  4YY3 E;  4DPT A;  4XIR A;  4DR2 E;  4Z7Y A;  1VIS A;  2E0A A;  3B78 A;  4FCP A;  2YJW A;  4EM7 A;  5FLX C;  2UU9 E;  5J6A A;  3F0N A;  1IBK E;  2XJJ A;  3PRY A;  2HKE A;  1USV A;  4DR7 E;  2BU8 A;  1K47 A;  3R4M A;  4U93 A;  2V2Z A;  4DPX A;  4KHP I;  4MP2 A;  4BQG A;  3GIE A;  4JI7 E;  2ZIT A;  3WQ9 A;  4IZK B;  1HR0 I;  4YKT A;  4JI5 E;  3V5R A;  3TZ5 A;  4HZ5 A;  4DV4 I;  1A6F A;  1N36 I;  1GKX A;  5GMD A;  5M4E A;  4DPW A;  2V8P A;  1EA6 A;  1Z0G A;  1Y8N A;  4ASF A;  4LF7 I;  3OPD A;  4I5S A;  3QT6 A;  3T10 A;  4LWG A;  5J71 A;  3KE6 A;  2Z5C A;  4UT4 A;  4IZJ B;  3ZKD A;  3QT8 A;  2UUA E;  4NH7 A;  5BR8 I;  4B3T E;  2UXD E;  2WI5 A;  2XDL A;  4X66 I;  5M4M A;  4DUY I;  4P8O A;  4HY1 A;  1XMQ E;  3WU5 A;  3P06 A;  4LFB E;  4EEH A;  2YGE A;  1XNQ E;  2HK3 A;  3QDD A;  4CWS A;  3ZXQ A;  1AM1 A;  1XMQ I;  3TZ4 A;  1QZR A;  3D36 A;  1Y4U A;  4JI0 E;  4O0B A;  2E1R A;  5FNC A;  4DR1 E;  2AKP A;  4KHP E;  3R92 A;  4B6C A;  2UUA I;  1YER A;  2FWY A;  3WU6 A;  3INX A;  4HXZ A;  3T0Z A;  4KQV A;  4LF7 E;  2O1V A;  1PKP A;  1Z0T A;  2GQP A;  2HG1 A;  2WI4 A;  2BV3 A;  2GS8 A;  3R4N A;  5M4H A;  4DR2 I;  4JI5 I;  4ZKI A;  3VHD A;  2CGF A;  3OWD A;  4KFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...