3LPSA

Crystal structure of pare
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
364
structure length
347
Chain Sequence
GLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLHGVGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Topoisomerase IV subunit B
publication title Crystal structure of parE
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Isomerase/antibiotic
total genus 110
structure length 347
sequence length 364
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3lpsA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3lpsA01
4YY3E 1S14A 2O1UA 2BSMA 3M6AA 4B3ME 3RLQA 5L3JA 2OI2A 1N33E 1N32I 2AKPA 2UXDI 4LF8E 4DV7I 4ZKIA 2YEFA 4DR7I 4H7QA 1BGQA 4KFGA 4DPUA 3B25A 4XE2A 2HHHI 3H4LA 2E5LI 1PIEA 3J80C 4NH7A 2QG0A 4EM7A 4R3AA 1UYCA 4URLA 4GKKE 1I58A 4DV6I 3G7BA 4ED4A 4LFBE 4CWRA 2YEJA 1U2RA 3T1YI 5A2QC 3GIGA 3H80A 3RKZA 4HZ0A 2XEXA 4DPWA 4FPPA 2VQEI 4I5SA 2Q2EB 1Z5CA 3D4JA 4DV3E 5J71A 4UTGA 2O1VA 1S16A 4R1FA 4DR1E 3JZ3A 4LF7I 4DU7A 2BRCA 1A4HA 3HULA 4JI7E 2BYIA 4DXLA 1KVKA 1IBME 3VHDA 3J80Q 3WU5A 2FWZA 4ASAA 3CWVA 2HK2A 4JI6E 3Q5KA 1B3QA 1XMQI 3K17A 4H81A 4MB9A 3K98A 4X64E 2BYHA 2ZDXA 1MX0A 2BU7A 2IOQA 1UEKA 2E0AA 4GKJE 2QG2A 2YE9A 4XCLA 5FNFA 2XDKA 3TZ5A 4EFUA 1RREA 4XIPA 4NH8A 1BYQA 3K97A 4HYPA 3QT6A 4CWOA 4ASFA 2JJCA 3BMYA 4LF9E 2BV3A 1KZNA 1U0ZA 2CCTA 1YT1A 4DR5I 2XD6A 4YKZA 1N32E 4MYTA 2V2QA 2YE4A 3TZ2A 3RLPA 5IWAI 4CWNA 3PEJA 4B3SI 2ESAA 1MU5A 4LWEA 2HHHE 4NXME 2CG9A 3WU4A 4KHPE 2WEPA 3IEDA 1TIDA 4JASA 4FWGA 3QT5A 4M1KA 2ZM6I 4DV6E 4JI1I 3ZZ0A 4L8ZA 1H74A 1XNQI 4URMA 2HCHA 1FWLA 5D6QA 1FNMA 4DR4E 2HFSA 4JI5I 4GT8A 4USKA 4RPFA 3O0IA 2A2DA 2VW5A 1RR9A 3GIFA 1B63A 2UUAI 4X62I 3Q5LA 3V5RA 1HNWE 4LF6E 4YKYA 4E02A 3B24A 4JI3E 4JI4I 4HXZA 4DR6I 4GGLA 2YI5A 4KP4A 1Z0WA 2IORA 1XMQE 1J5EI 1EI1A 4KTNA 1GKZA 3PEHA 4U93A 5FNDA 1H73A 3A0RA 4HY6A 4DV1E 2UXCI 4DR2E 1FJGE 2HKJA 1UY8A 4JI2I 3WU3A 2BT0A 4KSGA 4B3TI 4YKQA 4LFAI 2HG1A 4OX9E 1UY9A 5CTXA 2UWDA 3J81C 4EEHA 3O2FA 2ZBKB 1GJVA 4CE3A 1ZWHA 4P52A 4R3MA 4CWTA 2XDSA 3CGZA 5IWAE 4FCRA 4W7TA 1K47A 1ZM9A 1Z0VA 2WI1A 3HEKA 1ZXNA 2WI4A 3TUHA 3B26A 2LJPA 2GFDA 2YKIA 1HR0I 2FWYA 3VADA 2R42A 2XJGA 4P7AA 4JI1E 1TC6A 3J81Q 2YECA 5CTWA 2YK2A 1XNQE 1Z59A 1I5AA 1TC0A 2CGFA 5LMNI 4U7OA 4YHHE 3EHJA 3U2DA 2YK9A 4H85A 3K1JA 3OTOI 2HK3A 1QY8A 1FKAE 2UUAE 2YEGA 4YKXA 4ASBA 3J7AM 3EHFA 3QTFA 4XKKA 4DPYA 2XHRA 5IDJA 4JI4E 1NZ0A 1MG7A 4EMDA 3C11A 1Z5BA 3G7EA 1ELOA 2YEAA 1J5EE 4DV5I 2F4VI 3O6OA 4O0BA 2YEBA 3ZXOA 4EMVA 3VHCA 1YC1A 1N0UA 3K60A 3R92A 4LFAE 1N34E 4EGIA 5CTUA 4NXNI 3TTZA 1PKPA 2WI6A 4BQGA 2UUCE 3OW6A 1XMOE 2XJJA 3G75A 4E00A 1YERA 2YE8A 3T1KA 4EGKA 4XDMA 5IN9A 3JAMQ 5IT9C 4K0KI 2JKIA 3ZM7A 3QT7A 1OJ4A 2YKEA 4X66E 1US7A 4LPBA 2E1RA 5F3KA 2YE7A 4ASGA 2X36A 4QPKA 3HYYA 1Z0CA 3FT5A 3Q5JA 3TZ4A 4BQJA 1HNZI 1YS3A 5BR8E 1Y4UA 3MNRP 4Z7YA 4DU8A 2UU9I 1XNRI 5IT9Q 2A2CA 4DUYI 4B3RI 5LL6R 2YJXA 2XDUA 4JQLA 4L91A 2VWCA 1N0VC 4CE2A 4AQYI 2UXDE 1IBKI 2V2ZA 4DV7E 1HNXI 2V2VA 4DZYA 2O1WA 4HACA 4DR7E 1AJ6A 2YGAA 4E01A 4FWHA 2E5LE 2XX2A 2YE3A 3R4OA 1N36I 2YI6A 5D7RA 4DV2I 2F4VE 4JV5I 4DR3I 1UYIA 1BKNA 3D0BA 3PYEA 4JAUA 2UUBI 1JM6A 2V8PA 4BIUA 3B27A 3T1YE 2VQFI 2K5BA 4DUZI 1YESA 2XDXA 2HKEA 1H72C 2XDLA 4CE1A 2EFGA 2VQEE 3ZKBA 4XIQA 3CRKA 2GS8A 3EHGA 1H7SA 4XITA 2DEIA 5LMUI 1YSRA 2DEJA 4K0KE 1UYFA 4LF7E 2XABA 1YETA 3RLRA 2YE2A 5M4EA 1IBLI 4I3HA 4X65I 4UROA 4LF5I 3OPDA 4FCQA 4AWOA 1EA6A 4JYAI 2ZKJA 2AJ4A 4B3MI 5M4KA 1KKHA 2XK2A 3F0NA 1FI4A 3T0ZA 4B7PA 4GEEA 5F5RA 1UY7A 4KSHA 2CCSA 3INWA 4B6CA 1NHHA 1FWKA 3PYFA 3CRLA 4DUYE 4B3RE 4DR5E 3R4NA 2XX5A 2YKJA 4V26A 5CPHA 4AWPA 1S4EA 2Q8FA 2WI2A 4GKKI 1UYGA 1H7UA 2XJXA 1Y8PA 4B3SE 3QDDA 3DGEA 4L94A 1U2OA 3LPSA 1NHIA 4XTJA 2BZ5A 3B8HA 5D7CA 4XIRA 4DV0I 2BU2A 3BM9A 2ZM6E 4JV5E 4DR3E 4DV3I 4LWGA 2H8MA 1TILA 3TZ0A 2VF3A 4U7NA 4NH9A 1Z0GA 3B82A 3EHHA 2YKCA 4DUZE 4MPEA 2Q8GA 4JI7I 3ZZTA 5M4MA 3B78A 4JI5E 2QF6A 3C0EA 5J6AA 2Q8HA 4JI6I 3OWBA 4XCJA 3A0TA 4X62E 5FLXC 4EFTA 4YKRA 5LMUE 4X64I 5D6PA 3JAMC 2YI7A 2WI3A 1DARA 4DR6E 4LWIA 4GFNA 4GKJI 5M4HA 3U2KA 2XHXA 2XX4A 4YKTA 2WERA 3R4PA 2YKBA 1WUUA 4L90A 4JG4A 2QFOA 4JYAE 4JI0I 3GIGB 1I94I 1Z0TA 3QT8A 2UXCE 1ID0A 3D36A 2YI0A 3U67A 2HFUA 4LF9I 3R4MA 2WW4A 4JI2E 3R91A 4B3TE 4BIZA 2PNRA 1Y8NA 4PU9A 1YC4A 2CZ9A 4CWQA 3SL2A 2R3VA 2WI5A 1I59A 1UYLA 5FLXQ 3PYDA 3LNUA 4O09A 1ZXMA 4LP0A 4AS9A 4PRXA 4NXMI 1R62A 1L0OA 3KE6A 1TBWA 3T1HI 4KHPI 3INXA 4ZVIA 3T10A 1ZW9A 4GQTA 5M4PA 3ZZUA 1PVGA 2BM1A 4DV0E 1HR0E 1ZM4A 5GMEA 4LF4I 4DR4I 4HZ5A 4PL9A 3ZKDA 3FT8A 4WUDA 2BU8A 4USMA 4Z7CA 3EKRA 1Z0EA 3GONA 1YC3A 2FXSA 2NPFA 1HNWI 4URNA 4LF6I 4DV4I 4XC0A 5LMNE 4GCZA 4JI3I 4LFCI 2IWUA 4X9LA 4DUHA 1KTVA 1UYEA 4HACB 3OTOE 2YE6A 3A0WA 4PRVA 4LWFA 4HXWA 3WQ9A 4MYUA 2IOPA 1GKXA 1A6FA 2YEHA 3ZXQA 5M4NA 1KIJA 1ZM2A 4DV1I 2EXLA 3A0YA 4DR2I 1FJGI 3EKOA 2YGEA 3A0ZA 5A2QQ 4MP2A 4L93A 2YJWA 4CWFA 4EGHA 4K4OA 5FWKA 2WI7A 5FNCA 4OX9I 4XKOA 4DV5E 4JI0E 1I94E 4MP7A 3GIEA 2IWXA 3OMUA 5CTYA 4HYMA 3J7AG 1UYMA 1I5CA 4JI8I 3V2UC 1D6TA 1QYEA 4NXNE 1Y4SA 4YKWA 2BTZA 4MPCA 2YE5A 1Z0BA 2YEEA 3VHAA 4AWQA 5C93A 1QZRA 4JAVA 3T0HA 4WUCA 2YGFA 4KQVA 2BU6A 4BAEA 2UXBI 2VCJA 2H55A 3T1HE 4O07A 5CF0A 4FW9A 4XD8A 3FV5A 4MPNA 4YKUA 2WEQA 2C2AA 4YY3I 3HZ5A 1TH8A 4YHHI 1AH8A 1AM1A 2YEIA 3K99A 4LF4E 1N33I 2BU5A 1HNZE 4DPTA 3WHAA 4LF8I 5BOCA 2ZITA 1Z5AA 3PYGA 1YT2A 2UU9E 1XNRE 4DV4E 4CWSA 4XKAA 4LFCE 2VCIA 1UYDA 5GGZA 3D2RA 4AQYE 1IBKE 4FN5A 3OWDA 4LWHA 1B62A 4QPJA 2V34A 4FWDA 1HNXE 1ZM3A 2CCUA 3B28A 3HHUA 3NMQA 4P8OA 1VISA 4LFBI 1YSZA 4O04A 1Y8OA 2X7IA 4CWPA 1OSFA 2J7KA 1N36E 1N34I 4WUBA 4MBCA 4DPXA 1XHKA 4DV2E 2XHTA 2UUCI 2GQPA 1XMOI 2BREA 2Q8IA 1UYKA 4FMTA 2UUBE 4DR1I 3HZ1A 2VQFE 5BODA 1BXDA 4JI8E 3A0XA 1IBMI 2ZDYA 2BM0A 2YEDA 2CH4A 4MOTA 4X66I 4FCPA 1AMWA 4BXIA 3WU6A 1AH6A 1YT0A 5D7DA 3HYZA 3CGYA 1UY6A 2UXBE 1UYHA 1IBLE 1NHJA 2XCMA 4Q20A 3T2SA 3Q1QA 4X65E 4HY1A 1THNA 4V25A 5IDMA 4LF5E 2IWSA 4UT4A 5BR8I 3LTOA 2FYPA 1I5DA 4O05A 5GMDA 1I5BA
chains in the Genus database with same CATH superfamily
4YY3E 2O1UA 1S14A 5C0XE 2BSMA 3M6AA 4B3ME 3RLQA 5L3JA 2OI2A 4IZKB 1N33E 1N32I 2AKPA 2UXDI 4LF8E 4DV7I 4ZKIA 2YEFA 4DR7I 2IERA 4H7QA 1BGQA 4KFGA 4DPUA 3B25A 4XE2A 2HHHI 3H4LA 2E5LI 1PIEA 3J80C 4NH7A 2QG0A 4EM7A 4R3AA 1UYCA 4URLA 4GKKE 1I58A 2Z5BA 4LCFA 1OYRA 4DV6I 2Z5CB 3G7BA 4ED4A 4LFBE 3HKMA 4CWRA 2YEJA 1U2RA 3T1YI 5A2QC 3GIGA 3H80A 3RKZA 5K36A 2XEXA 4HZ0A 4DPWA 4FPPA 2VQEI 4I5SA 2Q2EB 1Z5CA 3D4JA 4DV3E 5J71A 4UTGA 2O1VA 1S16A 4R1FA 4DR1E 3JZ3A 4LF7I 4DU7A 2BRCA 1A4HA 3HULA 3DD6A 4JI7E 4DXLA 1KVKA 1IBME 2BYIA 3VHDA 3J80Q 3WU5A 2FWZA 4ASAA 3CWVA 2HK2A 4JI6E 3Q5KA 1B3QA 2F1DA 1XMQI 2JEAB 3K17A 4IFDD 4H81A 4MB9A 3U1KA 3K98A 4X64E 2BYHA 2C1IA 2ZDXA 1MX0A 2BU7A 4ISAA 2IOQA 1UEKA 2E0AA 4GKJE 2QG2A 2YE9A 4XCLA 1UDQA 5FNFA 2XDKA 1Y6ZA 3TZ5A 4EFUA 1RREA 4XIPA 4NH8A 3GLLA 1BYQA 3K97A 3LMMA 4HYPA 2BA0G 3QT6A 4IZJA 4CWOA 4ASFA 2JJCA 3BMYA 3PS2A 2BV3A 4LF9E 1KZNA 1U0ZA 2CCTA 4IFDB 4DR5I 1YT1A 2XD6A 4YKZA 1N32E 4MYTA 2V2QA 2YE4A 2O1TA 3TZ2A 4FW7A 5IWAI 3RLPA 4CWNA 3PEJA 4B3SI 2ESAA 1MU5A 4LWEA 2HHHE 4NXME 2CG9A 3WU4A 4BA2B 4KHPE 2WEPA 3IEDA 1TIDA 4JASA 4FWGA 3QT5A 4M1KA 2ZM6I 5DNLA 4JI1I 3ZZ0A 4DV6E 4L8ZA 1H74A 1XNQI 4URMA 2HCHA 3L7ZA 1FWLA 5D6QA 1FNMA 4DR4E 2HFSA 4JI5I 4GT8A 4USKA 4RPFA 3O0IA 2A2DA 2VW5A 4IFDC 1RR9A 3GIFA 1B63A 2UUAI 4X62I 3Q5LA 3V5RA 4QNKA 1HNWE 4LF6E 4YKYA 4E02A 3B24A 5C0XA 4JI3E 4HXZA 4JI4I 4DR6I 2YI5A 4GGLA 4KP4A 3P76A 1Z0WA 2J65A 2IORA 1XMQE 1J5EI 1EI1A 4KTNA 3P3GA 1GKZA 3PEHA 4U93A 2PO1A 5FNDA 1H73A 3A0RA 4HY6A 4OZEA 4DV1E 2UXCI 4DR2E 5EL9A 4OKGA 2HKJA 1FJGE 4FW3A 1UY8A 2FTKA 4JI2I 3WU3A 2BT0A 4KSGA 4B3TI 4YKQA 4LFAI 2HG1A 4OO1F 4OX9E 2WP8B 1UY9A 5DRPA 5CTXA 2UWDA 4NBQA 3J81C 4EEHA 3O2FA 2ZBKB 2JEBA 1GJVA 4CE3A 1RHYA 1ZWHA 4P52A 4R3MA 4CWTA 2XDSA 2BA1D 4EGHA 3CGZA 5IWAE 4FCRA 5EKWA 1R6LA 2JE6B 4W7TA 1K47A 1Y60A 1Z0VA 1ZM9A 2WI1A 3HEKA 1ZXNA 2WI4A 2WNRB 3TUHA 3B26A 2LJPA 2GFDA 2YKIA 1HR0I 2FWYA 3VADA 2R42A 2XJGA 4P7AA 5DROA 3UHMA 4JI1E 1TC6A 3J81Q 2YECA 5CTWA 4LCGA 2YK2A 1XNQE 1Z59A 1I5AA 1TC0A 2CGFA 1Y5YA 5LMNI 4U7OA 4YHHE 3EHJA 3U2DA 2YK9A 4H85A 3K1JA 2C38A 2HK3A 5JEAD 3OTOI 1QY8A 1FKAE 2UUAE 2YEGA 4YKXA 4ASBA 3J7AM 3EHFA 3QTFA 4XKKA 4DPYA 2XHRA 5IDJA 4JI4E 1NZ0A 1MG7A 4EMDA 3C11A 1Z5BA 3G7EA 2PO0A 1ELOA 2YEAA 1YHCA 2AE8A 5DRQA 1J5EE 4DV5I 5ELWA 2F4VI 3O6OA 4O0BA 2PO2A 3GMEA 2YEBA 3ZXOA 5K36B 4EMVA 3VHCA 1YC1A 5JEAB 1N0UA 3K60A 2NN6D 4LFAE 1N34E 3R92A 4EGIA 4NXNI 5CTUA 3HJCA 3TTZA 1PKPA 2WI6A 4BQGA 2UUCE 3OW6A 1XMOE 2XJJA 4OO1D 3G75A 1YERA 2YE8A 4LPFA 3T1KA 4E00A 4EGKA 4XDMA 5IN9A 3JAMQ 5IT9C 4K0KI 2JKIA 3ZM7A 3QT7A 2HHIA 1OJ4A 2YKEA 4X66E 1US7A 4LPBA 5DNXA 2E1RA 5F3KA 2NN6B 3PRYA 2YE7A 3P3CA 4ASGA 2X36A 4QPKA 3HYYA 1Z0CA 3FT5A 2Z5CA 3Q6MA 2PNZA 4OO1B 5K36C 3Q5JA 3TZ4A 4BQJA 2PNMA 1HNZI 5JEAC 1YS3A 4MP2A 5BR8E 1Y4UA 3MNRP 4Z7YA 4DU8A 2UU9I 1XNRI 5IT9Q 2A2CA 4DUYI 4B3RI 5LL6R 2YJXA 2XDUA 4JQLA 3CDJA 2VWCA 4L91A 1N0VC 4CE2A 4AQYI 2UXDE 1IBKI 2C39B 2V2ZA 4DV7E 1UDSA 1HNXI 2V2VA 4DZYA 2O1WA 4HACA 4DR7E 1AJ6A 2YGAA 4E01A 4N3OA 2NN6C 4FWHA 2E5LE 2XX2A 2YE3A 2GQ0A 3R4OA 1N36I 4FW6A 2YI6A 5D7RA 4OO1C 4DV2I 2F4VE 4JV5I 4DR3I 1UYIA 3M85G 1BKNA 1E3PA 3D0BA 3PYEA 4JAUA 2UUBI 1JM6A 2V8PA 4BIUA 3B27A 3T1YE 2VQFI 5K36F 4IS9A 4DUZI 1YESA 2K5BA 2XDXA 5JEAF 2HKEA 1H72C 2XDLA 3U1YA 4BA1A 2EFGA 2VQEE 4CE1A 3ZKBA 4XIQA 2BA0D 4IFDA 3CRKA 2GS8A 3NZKA 3EHGA 1H7SA 4XITA 5C0XB 2DEIA 5LMUI 1YSRA 2DEJA 4LCHA 4K0KE 4LF7E 1UYFA 1YETA 2XABA 3RLRA 3M7NG 2YE2A 5M4EA 1IBLI 4I3HA 4X65I 4UROA 4LF5I 3OPDA 4QNJA 4FCQA 4AWOA 1EA6A 2BR2B 4JYAI 2ZKJA 2AJ4A 2NN6F 3P06A 4B3MI 5M4KA 1KKHA 4FW4A 4U3DA 2C1GA 2XK2A 3F0NA 1FI4A 3T0ZA 4B7PA 4GEEA 5F5RA 1UY7A 4KSHA 2CCSA 3INWA 4B6CA 5DRRA 1NHHA 1FWKA 3PYFA 3CRLA 5C0XC 4DUYE 4B3RE 4DR5E 3H1CA 3R4NA 2XX5A 1UDNA 2YKJA 4V26A 5CPHA 4AWPA 1S4EA 2Q8FA 2WI2A 4GKKI 1UYGA 1H7UA 2XJXA 1E3HA 1Y8PA 4B3SE 3QDDA 1I5DA 3DGEA 4L94A 1U2OA 3LPSA 1NHIA 4XTJA 2BZ5A 3B8HA 5D7CA 4XIRA 4DV0I 4MU3A 4IFDE 2BU2A 3BM9A 2ZM6E 4JV5E 4DR3E 4DV3I 4LWGA 2VESA 2H8MA 1TILA 3TZ0A 2VF3A 2WP8A 4U7NA 4NH9A 1Z0GA 3B82A 3EHHA 2YKCA 1USUA 4DUZE 4MPEA 1R6MA 2Q8GA 4JI7I 3ZZTA 5M4MA 3B78A 4JI5E 2QF6A 5K36D 3C0EA 5J6AA 2Q8HA 4JI6I 3OWBA 4XCJA 3A0TA 1USVA 4X62E 5FLXC 1HK7A 4EFTA 4YKRA 5LMUE 4X64I 5C0XF 5D6PA 3JAMC 2YI7A 2C37A 3CYGA 2WI3A 1DARA 4DR6E 4LWIA 4GFNA 4GKJI 5M4HA 3U2KA 2JE6A 2Z5BB 2XHXA 2XX4A 2PO2B 2WERA 4YKTA 3R4PA 2YKBA 1WUUA 4L90A 4JG4A 2QFOA 4JYAE 4JI0I 3GIGB 1I94I 1Z0TA 3QT8A 2UXCE 1ID0A 3D36A 2YI0A 3U67A 2HFUA 1OYSA 4LF9I 4LOMA 3R4MA 2WW4A 4MU4A 4JI2E 3R91A 4B3TE 4BIZA 2PNRA 1Y8NA 4PU9A 1YC4A 2CZ9A 4CWQA 3SL2A 3CDIA 2R3VA 4E72A 2WI5A 1I59A 4IZKA 1UYLA 5FLXQ 3PYDA 3LNUA 4O09A 4IZJD 1ZXMA 4LP0A 4AS9A 4MDTA 4PRXA 4NXMI 1R62A 1L0OA 3KE6A 1TBWA 3T1HI 4KHPI 3INXA 4ZVIA 3T10A 1ZW9A 4GQTA 2GO4A 2PNZB 5M4PA 3ZZUA 2O3ZA 1PVGA 2BM1A 4DV0E 1ZM4A 1HR0E 5GMEA 4LF4I 4DR4I 5JEAA 4HZ5A 4IZJB 4PL9A 3ZKDA 3FT8A 4WUDA 2BU8A 4USMA 4Z7CA 3EKRA 1Z0EA 3GONA 3GCMA 1YC3A 2NPFA 1HNWI 4FW5A 4AIMA 2FXSA 4URNA 4LF6I 4DV4I 4XC0A 2CGEA 5LMNE 4GCZA 4JI3I 4LFCI 2IWUA 4X9LA 4DUHA 4GQUA 1KTVA 1UYEA 4HACB 3OTOE 2YE6A 3A0WA 4PRVA 4LWFA 4HXWA 3WQ9A 2IOPA 4MYUA 1GKXA 1A6FA 2YEHA 3ZXQA 5M4NA 1KIJA 1ZM2A 4DV1I 2JEAA 2EXLA 3A0YA 4DR2I 3PS1A 1FJGI 2YGEA 3A0ZA 2NN6A 5A2QQ 3EKOA 5C0XD 2YJWA 4L93A 4CWFA 4K4OA 5FWKA 2WI7A 5FNCA 4OX9I 4XKOA 4DV5E 4OO1A 3L7ZB 4JI0E 1I94E 4MP7A 3GIEA 1IXMA 4BA1B 2IWXA 3OMUA 5CTYA 4HYMA 3J7AG 2PNLA 1UYMA 1I5CA 4JI8I 3V2UC 1D6TA 1QYEA 1Y4SA 4NXNE 4YKWA 2BTZA 4MPCA 2YE5A 1Z0BA 2YEEA 3VHAA 4AWQA 1F51A 5C93A 1QZRA 2C39A 3Q6NA 4JAVA 3T0HA 4WUCA 2YGFA 4AIDA 5K36E 4KQVA 2BU6A 4BAEA 2UXBI 5JEAE 2H55A 2VCJA 3T1HE 3B4TA 4O07A 4FW9A 5CF0A 4XD8A 2PO1B 3FV5A 4MPNA 4YKUA 3S5TA 2WEQA 1P42A 3P3EA 4BA2A 2C2AA 4YY3I 2JT2A 3HZ5A 1TH8A 4YHHI 1AH8A 1AM1A 2YEIA 3K99A 4LF4E 1N33I 2BU5A 1HNZE 4DPTA 3KRNA 3M85D 3WHAA 4LF8I 5BOCA 2ZITA 5JENA 1Z5AA 2BA1G 2JEBB 3PYGA 1YT2A 2UU9E 1XNRE 4DV4E 4CWSA 2NN6E 4AM3A 4XKAA 4LFCE 2VCIA 1UYDA 5GGZA 3D2RA 4AQYE 1IBKE 4FN5A 4OO1E 3OWDA 4LWHA 1B62A 4QPJA 2V34A 4FWDA 1HNXE 1ZM3A 2CCUA 3B28A 3HHUA 3NMQA 4P8OA 1VISA 2IESA 3M7ND 4LFBI 1YSZA 4O04A 2BR2A 1Y8OA 2X7IA 4CWPA 1OSFA 2J7KA 1N36E 1N34I 4WUBA 4MBCA 1VI7A 1XHKA 3PS3A 4DPXA 4DV2E 2UUCI 2GQPA 1XMOI 2XHTA 2BREA 2Q8IA 1XXEA 1UYKA 4FMTA 2UUBE 4DR1I 3HZ1A 2VQFE 5BODA 1BXDA 4J3DA 2C38B 4JI8E 3A0XA 1IBMI 2GO3A 4IFDF 2ZDYA 4MU0A 2BM0A 2YEDA 2CH4A 1YH8A 4MOTA 4X66I 4FCPA 1UDOA 1AMWA 2C37B 3WU6A 1AH6A 1YT0A 4BXIA 5D7DA 2PO0B 3HYZA 3CGYA 1UY6A 2UXBE 1UYHA 1IBLE 1NHJA 2XCMA 4Q20A 2CVEA 3T2SA 3Q1QA 4X65E 4HY1A 1THNA 4V25A 5IDMA 4LF5E 2IWSA 4U3BA 2WNRA 4MQYA 2Z5EA 4MU1A 3K85A 4UT4A 5BR8I 3LTOA 2FYPA 1OYPA 4O05A 5GMDA 1I5BA
chains in the Genus database with same CATH topology
4YY3E 2O1UA 1S14A 2BSMA 3M6AA 4B3ME 3RLQA 5L3JA 2OI2A 4IZKB 1N33E 1N32I 2AKPA 2UXDI 4LF8E 4DV7I 4ZKIA 2YEFA 4DR7I 4H7QA 1BGQA 4KFGA 4DPUA 3B25A 4XE2A 2HHHI 3H4LA 2E5LI 1PIEA 3J80C 4NH7A 2QG0A 4EM7A 4R3AA 1UYCA 4URLA 4GKKE 1I58A 2Z5BA 4DV6I 2Z5CB 3G7BA 4ED4A 4LFBE 4CWRA 2YEJA 1U2RA 3T1YI 5A2QC 3GIGA 3H80A 3RKZA 4HZ0A 2XEXA 4DPWA 4FPPA 2VQEI 4I5SA 2Q2EB 1Z5CA 3D4JA 4DV3E 5J71A 4UTGA 2O1VA 1S16A 4R1FA 4DR1E 3JZ3A 4LF7I 4DU7A 2BRCA 1A4HA 3HULA 4JI7E 2BYIA 4DXLA 1KVKA 1IBME 3VHDA 3J80Q 3WU5A 2FWZA 4ASAA 3CWVA 2HK2A 4JI6E 3Q5KA 1B3QA 1XMQI 3K17A 4H81A 4MB9A 3K98A 4X64E 2BYHA 2ZDXA 1MX0A 2BU7A 2IOQA 1UEKA 2E0AA 4GKJE 2QG2A 2YE9A 4XCLA 5FNFA 2XDKA 1Y6ZA 3TZ5A 4EFUA 1RREA 4XIPA 4NH8A 1BYQA 3K97A 4HYPA 3QT6A 4IZJA 4CWOA 4ASFA 2JJCA 3BMYA 4LF9E 2BV3A 1KZNA 1U0ZA 2CCTA 1YT1A 4DR5I 2XD6A 4YKZA 1N32E 4MYTA 2V2QA 2YE4A 2O1TA 3TZ2A 3RLPA 5IWAI 4CWNA 3PEJA 4B3SI 2ESAA 1MU5A 4LWEA 2HHHE 4NXME 2CG9A 3WU4A 4KHPE 2WEPA 3IEDA 1TIDA 4JASA 4FWGA 3QT5A 4M1KA 2ZM6I 4DV6E 4JI1I 3ZZ0A 4L8ZA 1H74A 1XNQI 4URMA 2HCHA 1FWLA 5D6QA 1FNMA 4DR4E 2HFSA 4JI5I 4GT8A 4USKA 4RPFA 3O0IA 2A2DA 2VW5A 1RR9A 3GIFA 1B63A 2UUAI 4X62I 3Q5LA 3V5RA 1HNWE 4LF6E 4YKYA 4E02A 3B24A 4JI3E 4JI4I 4HXZA 4DR6I 4GGLA 2YI5A 4KP4A 1Z0WA 2IORA 1XMQE 1J5EI 1EI1A 4KTNA 1GKZA 3PEHA 4U93A 5FNDA 1H73A 3A0RA 4HY6A 4DV1E 2UXCI 4DR2E 1FJGE 2HKJA 1UY8A 4JI2I 3WU3A 2BT0A 4KSGA 4B3TI 4YKQA 4LFAI 2HG1A 4OX9E 1UY9A 5CTXA 2UWDA 3J81C 4EEHA 3O2FA 2ZBKB 1GJVA 4CE3A 1ZWHA 4P52A 4R3MA 4CWTA 2XDSA 3CGZA 5IWAE 4FCRA 4W7TA 1K47A 1ZM9A 1Z0VA 2WI1A 3HEKA 1ZXNA 2WI4A 3TUHA 3B26A 2LJPA 2GFDA 2YKIA 1HR0I 2FWYA 3VADA 2R42A 2XJGA 4P7AA 4JI1E 1TC6A 3J81Q 2YECA 5CTWA 2YK2A 1XNQE 1Z59A 1I5AA 1TC0A 2CGFA 5LMNI 4U7OA 4YHHE 3EHJA 3U2DA 2YK9A 4H85A 3K1JA 3OTOI 2HK3A 1QY8A 1FKAE 2UUAE 2YEGA 4YKXA 4ASBA 3J7AM 3EHFA 3QTFA 4XKKA 4DPYA 2XHRA 5IDJA 4JI4E 1NZ0A 1MG7A 4EMDA 3C11A 1Z5BA 3G7EA 1ELOA 2YEAA 1J5EE 4DV5I 2F4VI 3O6OA 4O0BA 2YEBA 3ZXOA 4EMVA 3VHCA 1YC1A 1N0UA 3K60A 3R92A 4LFAE 1N34E 4EGIA 5CTUA 4NXNI 3HJCA 3TTZA 1PKPA 2WI6A 4BQGA 2UUCE 3OW6A 1XMOE 2XJJA 3G75A 4E00A 1YERA 2YE8A 3T1KA 4EGKA 4XDMA 5IN9A 3JAMQ 5IT9C 4K0KI 2JKIA 3ZM7A 3QT7A 1OJ4A 2YKEA 4X66E 1US7A 4LPBA 2E1RA 5F3KA 3PRYA 2YE7A 4ASGA 2X36A 4QPKA 3HYYA 1Z0CA 3FT5A 2Z5CA 3Q6MA 3Q5JA 3TZ4A 4BQJA 2PNMA 1HNZI 1YS3A 5BR8E 1Y4UA 3MNRP 4Z7YA 4DU8A 2UU9I 1XNRI 5IT9Q 2A2CA 4DUYI 4B3RI 5LL6R 2YJXA 2XDUA 4JQLA 4L91A 2VWCA 1N0VC 4CE2A 4AQYI 2UXDE 1IBKI 2V2ZA 4DV7E 1HNXI 2V2VA 4DZYA 2O1WA 4HACA 4DR7E 1AJ6A 2YGAA 4E01A 4N3OA 4FWHA 2E5LE 2XX2A 2YE3A 2GQ0A 3R4OA 1N36I 2YI6A 5D7RA 4DV2I 2F4VE 4JV5I 4DR3I 1UYIA 1BKNA 3D0BA 3PYEA 4JAUA 2UUBI 1JM6A 2V8PA 4BIUA 3B27A 3T1YE 2VQFI 2K5BA 4DUZI 1YESA 2XDXA 2HKEA 1H72C 2XDLA 4CE1A 2EFGA 2VQEE 3ZKBA 4XIQA 3CRKA 2GS8A 3EHGA 1H7SA 4XITA 2DEIA 5LMUI 1YSRA 2DEJA 4K0KE 1UYFA 4LF7E 2XABA 1YETA 3RLRA 2YE2A 5M4EA 1IBLI 4I3HA 4X65I 4UROA 4LF5I 3OPDA 4FCQA 4AWOA 1EA6A 4JYAI 2ZKJA 2AJ4A 3P06A 4B3MI 5M4KA 1KKHA 2XK2A 3F0NA 1FI4A 3T0ZA 4B7PA 4GEEA 5F5RA 1UY7A 4KSHA 2CCSA 3INWA 4B6CA 1NHHA 1FWKA 3PYFA 3CRLA 4DUYE 4B3RE 4DR5E 3R4NA 2XX5A 2YKJA 4V26A 5CPHA 4AWPA 1S4EA 2Q8FA 2WI2A 4GKKI 1UYGA 1H7UA 2XJXA 1Y8PA 4B3SE 3QDDA 3DGEA 4L94A 1U2OA 3LPSA 1NHIA 4XTJA 2BZ5A 3B8HA 5D7CA 4XIRA 4DV0I 2BU2A 3BM9A 2ZM6E 4JV5E 4DR3E 4DV3I 4LWGA 2H8MA 1TILA 3TZ0A 2VF3A 4U7NA 4NH9A 1Z0GA 3B82A 3EHHA 2YKCA 1USUA 4DUZE 4MPEA 2Q8GA 4JI7I 3ZZTA 5M4MA 3B78A 4JI5E 2QF6A 3C0EA 5J6AA 2Q8HA 4JI6I 3OWBA 4XCJA 3A0TA 1USVA 4X62E 5FLXC 1HK7A 4EFTA 4YKRA 5LMUE 4X64I 5D6PA 3JAMC 2YI7A 2WI3A 1DARA 4DR6E 4LWIA 4GFNA 4GKJI 5M4HA 3U2KA 2Z5BB 2XHXA 2XX4A 4YKTA 2WERA 3R4PA 2YKBA 1WUUA 4L90A 4JG4A 2QFOA 4JYAE 4JI0I 3GIGB 1I94I 1Z0TA 3QT8A 2UXCE 1ID0A 3D36A 2YI0A 3U67A 2HFUA 4LF9I 3R4MA 2WW4A 4JI2E 3R91A 4B3TE 4BIZA 2PNRA 1Y8NA 4PU9A 1YC4A 2CZ9A 4CWQA 3SL2A 2R3VA 2WI5A 1I59A 4IZKA 1UYLA 5FLXQ 3PYDA 3LNUA 4O09A 4IZJD 1ZXMA 4LP0A 4AS9A 4PRXA 4NXMI 1R62A 1L0OA 3KE6A 1TBWA 3T1HI 4KHPI 3INXA 4ZVIA 3T10A 1ZW9A 4GQTA 5M4PA 3ZZUA 1PVGA 2BM1A 4DV0E 1ZM4A 1HR0E 5GMEA 4LF4I 4DR4I 4HZ5A 4IZJB 4PL9A 3ZKDA 3FT8A 4WUDA 2BU8A 4USMA 4Z7CA 3EKRA 1Z0EA 3GONA 1YC3A 2FXSA 2NPFA 1HNWI 4URNA 4LF6I 4DV4I 4XC0A 2CGEA 5LMNE 4GCZA 4JI3I 4LFCI 2IWUA 4X9LA 4DUHA 1KTVA 1UYEA 4HACB 3OTOE 2YE6A 3A0WA 4PRVA 4LWFA 4HXWA 3WQ9A 2IOPA 4MYUA 1GKXA 1A6FA 2YEHA 3ZXQA 5M4NA 1KIJA 1ZM2A 4DV1I 2EXLA 3A0YA 4DR2I 1FJGI 3EKOA 2YGEA 3A0ZA 5A2QQ 4MP2A 4L93A 2YJWA 4CWFA 4EGHA 4K4OA 5FWKA 2WI7A 5FNCA 4OX9I 4XKOA 4DV5E 4JI0E 1I94E 4MP7A 3GIEA 2IWXA 3OMUA 5CTYA 4HYMA 3J7AG 2PNLA 1UYMA 1I5CA 4JI8I 3V2UC 1D6TA 1QYEA 1Y4SA 4NXNE 4YKWA 2BTZA 4MPCA 2YE5A 1Z0BA 2YEEA 3VHAA 4AWQA 5C93A 1QZRA 3Q6NA 4JAVA 3T0HA 4WUCA 2YGFA 4KQVA 2BU6A 4BAEA 2UXBI 2VCJA 2H55A 3T1HE 4O07A 5CF0A 4FW9A 4XD8A 3FV5A 4MPNA 4YKUA 2WEQA 2C2AA 4YY3I 3HZ5A 1TH8A 4YHHI 1AH8A 1AM1A 2YEIA 3K99A 4LF4E 1N33I 2BU5A 1HNZE 4DPTA 3WHAA 4LF8I 5BOCA 2ZITA 1Z5AA 3PYGA 1YT2A 2UU9E 1XNRE 4DV4E 4CWSA 4XKAA 4LFCE 2VCIA 1UYDA 5GGZA 3D2RA 4AQYE 1IBKE 4FN5A 3OWDA 4LWHA 1B62A 4QPJA 2V34A 4FWDA 1HNXE 1ZM3A 2CCUA 3B28A 3HHUA 3NMQA 4P8OA 1VISA 4LFBI 1YSZA 4O04A 1Y8OA 2X7IA 4CWPA 1OSFA 2J7KA 1N36E 1N34I 4WUBA 4MBCA 4DPXA 1XHKA 4DV2E 2XHTA 2UUCI 2GQPA 1XMOI 2BREA 2Q8IA 1UYKA 4FMTA 2UUBE 4DR1I 3HZ1A 2VQFE 5BODA 1BXDA 4JI8E 3A0XA 1IBMI 2ZDYA 2BM0A 2YEDA 2CH4A 4MOTA 4X66I 4FCPA 1AMWA 4BXIA 3WU6A 1AH6A 1YT0A 5D7DA 3HYZA 3CGYA 1UY6A 2UXBE 1UYHA 1IBLE 1NHJA 2XCMA 4Q20A 3T2SA 3Q1QA 4X65E 4HY1A 1THNA 4V25A 5IDMA 4LF5E 2IWSA 2Z5EA 4UT4A 3K85A 5BR8I 3LTOA 2FYPA 1I5DA 4O05A 5GMDA 1I5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 E;  1S14 A;  2O1U A;  2BSM A;  3M6A A;  4B3M E;  3RLQ A;  5L3J A;  2OI2 A;  1N33 E;  1N32 I;  2AKP A;  2UXD I;  4LF8 E;  4DV7 I;  4ZKI A;  2YEF A;  4DR7 I;  4H7Q A;  1BGQ A;  4KFG A;  4DPU A;  3B25 A;  4XE2 A;  2HHH I;  3H4L A;  2E5L I;  1PIE A;  3J80 C;  4NH7 A;  2QG0 A;  4EM7 A;  4R3A A;  1UYC A;  4URL A;  4GKK E;  1I58 A;  4DV6 I;  3G7B A;  4ED4 A;  4LFB E;  4CWR A;  2YEJ A;  1U2R A;  3T1Y I;  5A2Q C;  3GIG A;  3H80 A;  3RKZ A;  4HZ0 A;  2XEX A;  4DPW A;  4FPP A;  2VQE I;  4I5S A;  2Q2E B;  1Z5C A;  3D4J A;  4DV3 E;  5J71 A;  4UTG A;  2O1V A;  1S16 A;  4R1F A;  4DR1 E;  3JZ3 A;  4LF7 I;  4DU7 A;  2BRC A;  1A4H A;  3HUL A;  4JI7 E;  2BYI A;  4DXL A;  1KVK A;  1IBM E;  3VHD A;  3J80 Q;  3WU5 A;  2FWZ A;  4ASA A;  3CWV A;  2HK2 A;  4JI6 E;  3Q5K A;  1B3Q A;  1XMQ I;  3K17 A;  4H81 A;  4MB9 A;  3K98 A;  4X64 E;  2BYH A;  2ZDX A;  1MX0 A;  2BU7 A;  2IOQ A;  1UEK A;  2E0A A;  4GKJ E;  2QG2 A;  2YE9 A;  4XCL A;  5FNF A;  2XDK A;  3TZ5 A;  4EFU A;  1RRE A;  4XIP A;  4NH8 A;  1BYQ A;  3K97 A;  4HYP A;  3QT6 A;  4CWO A;  4ASF A;  2JJC A;  3BMY A;  4LF9 E;  2BV3 A;  1KZN A;  1U0Z A;  2CCT A;  1YT1 A;  4DR5 I;  2XD6 A;  4YKZ A;  1N32 E;  4MYT A;  2V2Q A;  2YE4 A;  3TZ2 A;  3RLP A;  5IWA I;  4CWN A;  3PEJ A;  4B3S I;  2ESA A;  1MU5 A;  4LWE A;  2HHH E;  4NXM E;  2CG9 A;  3WU4 A;  4KHP E;  2WEP A;  3IED A;  1TID A;  4JAS A;  4FWG A;  3QT5 A;  4M1K A;  2ZM6 I;  4DV6 E;  4JI1 I;  3ZZ0 A;  4L8Z A;  1H74 A;  1XNQ I;  4URM A;  2HCH A;  1FWL A;  5D6Q A;  1FNM A;  4DR4 E;  2HFS A;  4JI5 I;  4GT8 A;  4USK A;  4RPF A;  3O0I A;  2A2D A;  2VW5 A;  1RR9 A;  3GIF A;  1B63 A;  2UUA I;  4X62 I;  3Q5L A;  3V5R A;  1HNW E;  4LF6 E;  4YKY A;  4E02 A;  3B24 A;  4JI3 E;  4JI4 I;  4HXZ A;  4DR6 I;  4GGL A;  2YI5 A;  4KP4 A;  1Z0W A;  2IOR A;  1XMQ E;  1J5E I;  1EI1 A;  4KTN A;  1GKZ A;  3PEH A;  4U93 A;  5FND A;  1H73 A;  3A0R A;  4HY6 A;  4DV1 E;  2UXC I;  4DR2 E;  1FJG E;  2HKJ A;  1UY8 A;  4JI2 I;  3WU3 A;  2BT0 A;  4KSG A;  4B3T I;  4YKQ A;  4LFA I;  2HG1 A;  4OX9 E;  1UY9 A;  5CTX A;  2UWD A;  3J81 C;  4EEH A;  3O2F A;  2ZBK B;  1GJV A;  4CE3 A;  1ZWH A;  4P52 A;  4R3M A;  4CWT A;  2XDS A;  3CGZ A;  5IWA E;  4FCR A;  4W7T A;  1K47 A;  1ZM9 A;  1Z0V A;  2WI1 A;  3HEK A;  1ZXN A;  2WI4 A;  3TUH A;  3B26 A;  2LJP A;  2GFD A;  2YKI A;  1HR0 I;  2FWY A;  3VAD A;  2R42 A;  2XJG A;  4P7A A;  4JI1 E;  1TC6 A;  3J81 Q;  2YEC A;  5CTW A;  2YK2 A;  1XNQ E;  1Z59 A;  1I5A A;  1TC0 A;  2CGF A;  5LMN I;  4U7O A;  4YHH E;  3EHJ A;  3U2D A;  2YK9 A;  4H85 A;  3K1J A;  3OTO I;  2HK3 A;  1QY8 A;  1FKA E;  2UUA E;  2YEG A;  4YKX A;  4ASB A;  3J7A M;  3EHF A;  3QTF A;  4XKK A;  4DPY A;  2XHR A;  5IDJ A;  4JI4 E;  1NZ0 A;  1MG7 A;  4EMD A;  3C11 A;  1Z5B A;  3G7E A;  1ELO A;  2YEA A;  1J5E E;  4DV5 I;  2F4V I;  3O6O A;  4O0B A;  2YEB A;  3ZXO A;  4EMV A;  3VHC A;  1YC1 A;  1N0U A;  3K60 A;  3R92 A;  4LFA E;  1N34 E;  4EGI A;  5CTU A;  4NXN I;  3TTZ A;  1PKP A;  2WI6 A;  4BQG A;  2UUC E;  3OW6 A;  1XMO E;  2XJJ A;  3G75 A;  4E00 A;  1YER A;  2YE8 A;  3T1K A;  4EGK A;  4XDM A;  5IN9 A;  3JAM Q;  5IT9 C;  4K0K I;  2JKI A;  3ZM7 A;  3QT7 A;  1OJ4 A;  2YKE A;  4X66 E;  1US7 A;  4LPB A;  2E1R A;  5F3K A;  2YE7 A;  4ASG A;  2X36 A;  4QPK A;  3HYY A;  1Z0C A;  3FT5 A;  3Q5J A;  3TZ4 A;  4BQJ A;  1HNZ I;  1YS3 A;  5BR8 E;  1Y4U A;  3MNR P;  4Z7Y A;  4DU8 A;  2UU9 I;  1XNR I;  5IT9 Q;  2A2C A;  4DUY I;  4B3R I;  5LL6 R;  2YJX A;  2XDU A;  4JQL A;  4L91 A;  2VWC A;  1N0V C;  4CE2 A;  4AQY I;  2UXD E;  1IBK I;  2V2Z A;  4DV7 E;  1HNX I;  2V2V A;  4DZY A;  2O1W A;  4HAC A;  4DR7 E;  1AJ6 A;  2YGA A;  4E01 A;  4FWH A;  2E5L E;  2XX2 A;  2YE3 A;  3R4O A;  1N36 I;  2YI6 A;  5D7R A;  4DV2 I;  2F4V E;  4JV5 I;  4DR3 I;  1UYI A;  1BKN A;  3D0B A;  3PYE A;  4JAU A;  2UUB I;  1JM6 A;  2V8P A;  4BIU A;  3B27 A;  3T1Y E;  2VQF I;  2K5B A;  4DUZ I;  1YES A;  2XDX A;  2HKE A;  1H72 C;  2XDL A;  4CE1 A;  2EFG A;  2VQE E;  3ZKB A;  4XIQ A;  3CRK A;  2GS8 A;  3EHG A;  1H7S A;  4XIT A;  2DEI A;  5LMU I;  1YSR A;  2DEJ A;  4K0K E;  1UYF A;  4LF7 E;  2XAB A;  1YET A;  3RLR A;  2YE2 A;  5M4E A;  1IBL I;  4I3H A;  4X65 I;  4URO A;  4LF5 I;  3OPD A;  4FCQ A;  4AWO A;  1EA6 A;  4JYA I;  2ZKJ A;  2AJ4 A;  4B3M I;  5M4K A;  1KKH A;  2XK2 A;  3F0N A;  1FI4 A;  3T0Z A;  4B7P A;  4GEE A;  5F5R A;  1UY7 A;  4KSH A;  2CCS A;  3INW A;  4B6C A;  1NHH A;  1FWK A;  3PYF A;  3CRL A;  4DUY E;  4B3R E;  4DR5 E;  3R4N A;  2XX5 A;  2YKJ A;  4V26 A;  5CPH A;  4AWP A;  1S4E A;  2Q8F A;  2WI2 A;  4GKK I;  1UYG A;  1H7U A;  2XJX A;  1Y8P A;  4B3S E;  3QDD A;  3DGE A;  4L94 A;  1U2O A;  3LPS A;  1NHI A;  4XTJ A;  2BZ5 A;  3B8H A;  5D7C A;  4XIR A;  4DV0 I;  2BU2 A;  3BM9 A;  2ZM6 E;  4JV5 E;  4DR3 E;  4DV3 I;  4LWG A;  2H8M A;  1TIL A;  3TZ0 A;  2VF3 A;  4U7N A;  4NH9 A;  1Z0G A;  3B82 A;  3EHH A;  2YKC A;  4DUZ E;  4MPE A;  2Q8G A;  4JI7 I;  3ZZT A;  5M4M A;  3B78 A;  4JI5 E;  2QF6 A;  3C0E A;  5J6A A;  2Q8H A;  4JI6 I;  3OWB A;  4XCJ A;  3A0T A;  4X62 E;  5FLX C;  4EFT A;  4YKR A;  5LMU E;  4X64 I;  5D6P A;  3JAM C;  2YI7 A;  2WI3 A;  1DAR A;  4DR6 E;  4LWI A;  4GFN A;  4GKJ I;  5M4H A;  3U2K A;  2XHX A;  2XX4 A;  4YKT A;  2WER A;  3R4P A;  2YKB A;  1WUU A;  4L90 A;  4JG4 A;  2QFO A;  4JYA E;  4JI0 I;  3GIG B;  1I94 I;  1Z0T A;  3QT8 A;  2UXC E;  1ID0 A;  3D36 A;  2YI0 A;  3U67 A;  2HFU A;  4LF9 I;  3R4M A;  2WW4 A;  4JI2 E;  3R91 A;  4B3T E;  4BIZ A;  2PNR A;  1Y8N A;  4PU9 A;  1YC4 A;  2CZ9 A;  4CWQ A;  3SL2 A;  2R3V A;  2WI5 A;  1I59 A;  1UYL A;  5FLX Q;  3PYD A;  3LNU A;  4O09 A;  1ZXM A;  4LP0 A;  4AS9 A;  4PRX A;  4NXM I;  1R62 A;  1L0O A;  3KE6 A;  1TBW A;  3T1H I;  4KHP I;  3INX A;  4ZVI A;  3T10 A;  1ZW9 A;  4GQT A;  5M4P A;  3ZZU A;  1PVG A;  2BM1 A;  4DV0 E;  1HR0 E;  1ZM4 A;  5GME A;  4LF4 I;  4DR4 I;  4HZ5 A;  4PL9 A;  3ZKD A;  3FT8 A;  4WUD A;  2BU8 A;  4USM A;  4Z7C A;  3EKR A;  1Z0E A;  3GON A;  1YC3 A;  2FXS A;  2NPF A;  1HNW I;  4URN A;  4LF6 I;  4DV4 I;  4XC0 A;  5LMN E;  4GCZ A;  4JI3 I;  4LFC I;  2IWU A;  4X9L A;  4DUH A;  1KTV A;  1UYE A;  4HAC B;  3OTO E;  2YE6 A;  3A0W A;  4PRV A;  4LWF A;  4HXW A;  3WQ9 A;  4MYU A;  2IOP A;  1GKX A;  1A6F A;  2YEH A;  3ZXQ A;  5M4N A;  1KIJ A;  1ZM2 A;  4DV1 I;  2EXL A;  3A0Y A;  4DR2 I;  1FJG I;  3EKO A;  2YGE A;  3A0Z A;  5A2Q Q;  4MP2 A;  4L93 A;  2YJW A;  4CWF A;  4EGH A;  4K4O A;  5FWK A;  2WI7 A;  5FNC A;  4OX9 I;  4XKO A;  4DV5 E;  4JI0 E;  1I94 E;  4MP7 A;  3GIE A;  2IWX A;  3OMU A;  5CTY A;  4HYM A;  3J7A G;  1UYM A;  1I5C A;  4JI8 I;  3V2U C;  1D6T A;  1QYE A;  4NXN E;  1Y4S A;  4YKW A;  2BTZ A;  4MPC A;  2YE5 A;  1Z0B A;  2YEE A;  3VHA A;  4AWQ A;  5C93 A;  1QZR A;  4JAV A;  3T0H A;  4WUC A;  2YGF A;  4KQV A;  2BU6 A;  4BAE A;  2UXB I;  2VCJ A;  2H55 A;  3T1H E;  4O07 A;  5CF0 A;  4FW9 A;  4XD8 A;  3FV5 A;  4MPN A;  4YKU A;  2WEQ A;  2C2A A;  4YY3 I;  3HZ5 A;  1TH8 A;  4YHH I;  1AH8 A;  1AM1 A;  2YEI A;  3K99 A;  4LF4 E;  1N33 I;  2BU5 A;  1HNZ E;  4DPT A;  3WHA A;  4LF8 I;  5BOC A;  2ZIT A;  1Z5A A;  3PYG A;  1YT2 A;  2UU9 E;  1XNR E;  4DV4 E;  4CWS A;  4XKA A;  4LFC E;  2VCI A;  1UYD A;  5GGZ A;  3D2R A;  4AQY E;  1IBK E;  4FN5 A;  3OWD A;  4LWH A;  1B62 A;  4QPJ A;  2V34 A;  4FWD A;  1HNX E;  1ZM3 A;  2CCU A;  3B28 A;  3HHU A;  3NMQ A;  4P8O A;  1VIS A;  4LFB I;  1YSZ A;  4O04 A;  1Y8O A;  2X7I A;  4CWP A;  1OSF A;  2J7K A;  1N36 E;  1N34 I;  4WUB A;  4MBC A;  4DPX A;  1XHK A;  4DV2 E;  2XHT A;  2UUC I;  2GQP A;  1XMO I;  2BRE A;  2Q8I A;  1UYK A;  4FMT A;  2UUB E;  4DR1 I;  3HZ1 A;  2VQF E;  5BOD A;  1BXD A;  4JI8 E;  3A0X A;  1IBM I;  2ZDY A;  2BM0 A;  2YED A;  2CH4 A;  4MOT A;  4X66 I;  4FCP A;  1AMW A;  4BXI A;  3WU6 A;  1AH6 A;  1YT0 A;  5D7D A;  3HYZ A;  3CGY A;  1UY6 A;  2UXB E;  1UYH A;  1IBL E;  1NHJ A;  2XCM A;  4Q20 A;  3T2S A;  3Q1Q A;  4X65 E;  4HY1 A;  1THN A;  4V25 A;  5IDM A;  4LF5 E;  2IWS A;  4UT4 A;  5BR8 I;  3LTO A;  2FYP A;  1I5D A;  4O05 A;  5GMD A;  1I5B A; 
#chains in the Genus database with same CATH topology
 4YY3 E;  2O1U A;  1S14 A;  5C0X E;  2BSM A;  3M6A A;  4B3M E;  3RLQ A;  5L3J A;  2OI2 A;  4IZK B;  1N33 E;  1N32 I;  2AKP A;  2UXD I;  4LF8 E;  4DV7 I;  4ZKI A;  2YEF A;  4DR7 I;  2IER A;  4H7Q A;  1BGQ A;  4KFG A;  4DPU A;  3B25 A;  4XE2 A;  2HHH I;  3H4L A;  2E5L I;  1PIE A;  3J80 C;  4NH7 A;  2QG0 A;  4EM7 A;  4R3A A;  1UYC A;  4URL A;  4GKK E;  1I58 A;  2Z5B A;  4LCF A;  1OYR A;  4DV6 I;  2Z5C B;  3G7B A;  4ED4 A;  4LFB E;  3HKM A;  4CWR A;  2YEJ A;  1U2R A;  3T1Y I;  5A2Q C;  3GIG A;  3H80 A;  3RKZ A;  5K36 A;  2XEX A;  4HZ0 A;  4DPW A;  4FPP A;  2VQE I;  4I5S A;  2Q2E B;  1Z5C A;  3D4J A;  4DV3 E;  5J71 A;  4UTG A;  2O1V A;  1S16 A;  4R1F A;  4DR1 E;  3JZ3 A;  4LF7 I;  4DU7 A;  2BRC A;  1A4H A;  3HUL A;  3DD6 A;  4JI7 E;  4DXL A;  1KVK A;  1IBM E;  2BYI A;  3VHD A;  3J80 Q;  3WU5 A;  2FWZ A;  4ASA A;  3CWV A;  2HK2 A;  4JI6 E;  3Q5K A;  1B3Q A;  2F1D A;  1XMQ I;  2JEA B;  3K17 A;  4IFD D;  4H81 A;  4MB9 A;  3U1K A;  3K98 A;  4X64 E;  2BYH A;  2C1I A;  2ZDX A;  1MX0 A;  2BU7 A;  4ISA A;  2IOQ A;  1UEK A;  2E0A A;  4GKJ E;  2QG2 A;  2YE9 A;  4XCL A;  1UDQ A;  5FNF A;  2XDK A;  1Y6Z A;  3TZ5 A;  4EFU A;  1RRE A;  4XIP A;  4NH8 A;  3GLL A;  1BYQ A;  3K97 A;  3LMM A;  4HYP A;  2BA0 G;  3QT6 A;  4IZJ A;  4CWO A;  4ASF A;  2JJC A;  3BMY A;  3PS2 A;  2BV3 A;  4LF9 E;  1KZN A;  1U0Z A;  2CCT A;  4IFD B;  4DR5 I;  1YT1 A;  2XD6 A;  4YKZ A;  1N32 E;  4MYT A;  2V2Q A;  2YE4 A;  2O1T A;  3TZ2 A;  4FW7 A;  5IWA I;  3RLP A;  4CWN A;  3PEJ A;  4B3S I;  2ESA A;  1MU5 A;  4LWE A;  2HHH E;  4NXM E;  2CG9 A;  3WU4 A;  4BA2 B;  4KHP E;  2WEP A;  3IED A;  1TID A;  4JAS A;  4FWG A;  3QT5 A;  4M1K A;  2ZM6 I;  5DNL A;  4JI1 I;  3ZZ0 A;  4DV6 E;  4L8Z A;  1H74 A;  1XNQ I;  4URM A;  2HCH A;  3L7Z A;  1FWL A;  5D6Q A;  1FNM A;  4DR4 E;  2HFS A;  4JI5 I;  4GT8 A;  4USK A;  4RPF A;  3O0I A;  2A2D A;  2VW5 A;  4IFD C;  1RR9 A;  3GIF A;  1B63 A;  2UUA I;  4X62 I;  3Q5L A;  3V5R A;  4QNK A;  1HNW E;  4LF6 E;  4YKY A;  4E02 A;  3B24 A;  5C0X A;  4JI3 E;  4HXZ A;  4JI4 I;  4DR6 I;  2YI5 A;  4GGL A;  4KP4 A;  3P76 A;  1Z0W A;  2J65 A;  2IOR A;  1XMQ E;  1J5E I;  1EI1 A;  4KTN A;  3P3G A;  1GKZ A;  3PEH A;  4U93 A;  2PO1 A;  5FND A;  1H73 A;  3A0R A;  4HY6 A;  4OZE A;  4DV1 E;  2UXC I;  4DR2 E;  5EL9 A;  4OKG A;  2HKJ A;  1FJG E;  4FW3 A;  1UY8 A;  2FTK A;  4JI2 I;  3WU3 A;  2BT0 A;  4KSG A;  4B3T I;  4YKQ A;  4LFA I;  2HG1 A;  4OO1 F;  4OX9 E;  2WP8 B;  1UY9 A;  5DRP A;  5CTX A;  2UWD A;  4NBQ A;  3J81 C;  4EEH A;  3O2F A;  2ZBK B;  2JEB A;  1GJV A;  4CE3 A;  1RHY A;  1ZWH A;  4P52 A;  4R3M A;  4CWT A;  2XDS A;  2BA1 D;  4EGH A;  3CGZ A;  5IWA E;  4FCR A;  5EKW A;  1R6L A;  2JE6 B;  4W7T A;  1K47 A;  1Y60 A;  1Z0V A;  1ZM9 A;  2WI1 A;  3HEK A;  1ZXN A;  2WI4 A;  2WNR B;  3TUH A;  3B26 A;  2LJP A;  2GFD A;  2YKI A;  1HR0 I;  2FWY A;  3VAD A;  2R42 A;  2XJG A;  4P7A A;  5DRO A;  3UHM A;  4JI1 E;  1TC6 A;  3J81 Q;  2YEC A;  5CTW A;  4LCG A;  2YK2 A;  1XNQ E;  1Z59 A;  1I5A A;  1TC0 A;  2CGF A;  1Y5Y A;  5LMN I;  4U7O A;  4YHH E;  3EHJ A;  3U2D A;  2YK9 A;  4H85 A;  3K1J A;  2C38 A;  2HK3 A;  5JEA D;  3OTO I;  1QY8 A;  1FKA E;  2UUA E;  2YEG A;  4YKX A;  4ASB A;  3J7A M;  3EHF A;  3QTF A;  4XKK A;  4DPY A;  2XHR A;  5IDJ A;  4JI4 E;  1NZ0 A;  1MG7 A;  4EMD A;  3C11 A;  1Z5B A;  3G7E A;  2PO0 A;  1ELO A;  2YEA A;  1YHC A;  2AE8 A;  5DRQ A;  1J5E E;  4DV5 I;  5ELW A;  2F4V I;  3O6O A;  4O0B A;  2PO2 A;  3GME A;  2YEB A;  3ZXO A;  5K36 B;  4EMV A;  3VHC A;  1YC1 A;  5JEA B;  1N0U A;  3K60 A;  2NN6 D;  4LFA E;  1N34 E;  3R92 A;  4EGI A;  4NXN I;  5CTU A;  3HJC A;  3TTZ A;  1PKP A;  2WI6 A;  4BQG A;  2UUC E;  3OW6 A;  1XMO E;  2XJJ A;  4OO1 D;  3G75 A;  1YER A;  2YE8 A;  4LPF A;  3T1K A;  4E00 A;  4EGK A;  4XDM A;  5IN9 A;  3JAM Q;  5IT9 C;  4K0K I;  2JKI A;  3ZM7 A;  3QT7 A;  2HHI A;  1OJ4 A;  2YKE A;  4X66 E;  1US7 A;  4LPB A;  5DNX A;  2E1R A;  5F3K A;  2NN6 B;  3PRY A;  2YE7 A;  3P3C A;  4ASG A;  2X36 A;  4QPK A;  3HYY A;  1Z0C A;  3FT5 A;  2Z5C A;  3Q6M A;  2PNZ A;  4OO1 B;  5K36 C;  3Q5J A;  3TZ4 A;  4BQJ A;  2PNM A;  1HNZ I;  5JEA C;  1YS3 A;  4MP2 A;  5BR8 E;  1Y4U A;  3MNR P;  4Z7Y A;  4DU8 A;  2UU9 I;  1XNR I;  5IT9 Q;  2A2C A;  4DUY I;  4B3R I;  5LL6 R;  2YJX A;  2XDU A;  4JQL A;  3CDJ A;  2VWC A;  4L91 A;  1N0V C;  4CE2 A;  4AQY I;  2UXD E;  1IBK I;  2C39 B;  2V2Z A;  4DV7 E;  1UDS A;  1HNX I;  2V2V A;  4DZY A;  2O1W A;  4HAC A;  4DR7 E;  1AJ6 A;  2YGA A;  4E01 A;  4N3O A;  2NN6 C;  4FWH A;  2E5L E;  2XX2 A;  2YE3 A;  2GQ0 A;  3R4O A;  1N36 I;  4FW6 A;  2YI6 A;  5D7R A;  4OO1 C;  4DV2 I;  2F4V E;  4JV5 I;  4DR3 I;  1UYI A;  3M85 G;  1BKN A;  1E3P A;  3D0B A;  3PYE A;  4JAU A;  2UUB I;  1JM6 A;  2V8P A;  4BIU A;  3B27 A;  3T1Y E;  2VQF I;  5K36 F;  4IS9 A;  4DUZ I;  1YES A;  2K5B A;  2XDX A;  5JEA F;  2HKE A;  1H72 C;  2XDL A;  3U1Y A;  4BA1 A;  2EFG A;  2VQE E;  4CE1 A;  3ZKB A;  4XIQ A;  2BA0 D;  4IFD A;  3CRK A;  2GS8 A;  3NZK A;  3EHG A;  1H7S A;  4XIT A;  5C0X B;  2DEI A;  5LMU I;  1YSR A;  2DEJ A;  4LCH A;  4K0K E;  4LF7 E;  1UYF A;  1YET A;  2XAB A;  3RLR A;  3M7N G;  2YE2 A;  5M4E A;  1IBL I;  4I3H A;  4X65 I;  4URO A;  4LF5 I;  3OPD A;  4QNJ A;  4FCQ A;  4AWO A;  1EA6 A;  2BR2 B;  4JYA I;  2ZKJ A;  2AJ4 A;  2NN6 F;  3P06 A;  4B3M I;  5M4K A;  1KKH A;  4FW4 A;  4U3D A;  2C1G A;  2XK2 A;  3F0N A;  1FI4 A;  3T0Z A;  4B7P A;  4GEE A;  5F5R A;  1UY7 A;  4KSH A;  2CCS A;  3INW A;  4B6C A;  5DRR A;  1NHH A;  1FWK A;  3PYF A;  3CRL A;  5C0X C;  4DUY E;  4B3R E;  4DR5 E;  3H1C A;  3R4N A;  2XX5 A;  1UDN A;  2YKJ A;  4V26 A;  5CPH A;  4AWP A;  1S4E A;  2Q8F A;  2WI2 A;  4GKK I;  1UYG A;  1H7U A;  2XJX A;  1E3H A;  1Y8P A;  4B3S E;  3QDD A;  1I5D A;  3DGE A;  4L94 A;  1U2O A;  3LPS A;  1NHI A;  4XTJ A;  2BZ5 A;  3B8H A;  5D7C A;  4XIR A;  4DV0 I;  4MU3 A;  4IFD E;  2BU2 A;  3BM9 A;  2ZM6 E;  4JV5 E;  4DR3 E;  4DV3 I;  4LWG A;  2VES A;  2H8M A;  1TIL A;  3TZ0 A;  2VF3 A;  2WP8 A;  4U7N A;  4NH9 A;  1Z0G A;  3B82 A;  3EHH A;  2YKC A;  1USU A;  4DUZ E;  4MPE A;  1R6M A;  2Q8G A;  4JI7 I;  3ZZT A;  5M4M A;  3B78 A;  4JI5 E;  2QF6 A;  5K36 D;  3C0E A;  5J6A A;  2Q8H A;  4JI6 I;  3OWB A;  4XCJ A;  3A0T A;  1USV A;  4X62 E;  5FLX C;  1HK7 A;  4EFT A;  4YKR A;  5LMU E;  4X64 I;  5C0X F;  5D6P A;  3JAM C;  2YI7 A;  2C37 A;  3CYG A;  2WI3 A;  1DAR A;  4DR6 E;  4LWI A;  4GFN A;  4GKJ I;  5M4H A;  3U2K A;  2JE6 A;  2Z5B B;  2XHX A;  2XX4 A;  2PO2 B;  2WER A;  4YKT A;  3R4P A;  2YKB A;  1WUU A;  4L90 A;  4JG4 A;  2QFO A;  4JYA E;  4JI0 I;  3GIG B;  1I94 I;  1Z0T A;  3QT8 A;  2UXC E;  1ID0 A;  3D36 A;  2YI0 A;  3U67 A;  2HFU A;  1OYS A;  4LF9 I;  4LOM A;  3R4M A;  2WW4 A;  4MU4 A;  4JI2 E;  3R91 A;  4B3T E;  4BIZ A;  2PNR A;  1Y8N A;  4PU9 A;  1YC4 A;  2CZ9 A;  4CWQ A;  3SL2 A;  3CDI A;  2R3V A;  4E72 A;  2WI5 A;  1I59 A;  4IZK A;  1UYL A;  5FLX Q;  3PYD A;  3LNU A;  4O09 A;  4IZJ D;  1ZXM A;  4LP0 A;  4AS9 A;  4MDT A;  4PRX A;  4NXM I;  1R62 A;  1L0O A;  3KE6 A;  1TBW A;  3T1H I;  4KHP I;  3INX A;  4ZVI A;  3T10 A;  1ZW9 A;  4GQT A;  2GO4 A;  2PNZ B;  5M4P A;  3ZZU A;  2O3Z A;  1PVG A;  2BM1 A;  4DV0 E;  1ZM4 A;  1HR0 E;  5GME A;  4LF4 I;  4DR4 I;  5JEA A;  4HZ5 A;  4IZJ B;  4PL9 A;  3ZKD A;  3FT8 A;  4WUD A;  2BU8 A;  4USM A;  4Z7C A;  3EKR A;  1Z0E A;  3GON A;  3GCM A;  1YC3 A;  2NPF A;  1HNW I;  4FW5 A;  4AIM A;  2FXS A;  4URN A;  4LF6 I;  4DV4 I;  4XC0 A;  2CGE A;  5LMN E;  4GCZ A;  4JI3 I;  4LFC I;  2IWU A;  4X9L A;  4DUH A;  4GQU A;  1KTV A;  1UYE A;  4HAC B;  3OTO E;  2YE6 A;  3A0W A;  4PRV A;  4LWF A;  4HXW A;  3WQ9 A;  2IOP A;  4MYU A;  1GKX A;  1A6F A;  2YEH A;  3ZXQ A;  5M4N A;  1KIJ A;  1ZM2 A;  4DV1 I;  2JEA A;  2EXL A;  3A0Y A;  4DR2 I;  3PS1 A;  1FJG I;  2YGE A;  3A0Z A;  2NN6 A;  5A2Q Q;  3EKO A;  5C0X D;  2YJW A;  4L93 A;  4CWF A;  4K4O A;  5FWK A;  2WI7 A;  5FNC A;  4OX9 I;  4XKO A;  4DV5 E;  4OO1 A;  3L7Z B;  4JI0 E;  1I94 E;  4MP7 A;  3GIE A;  1IXM A;  4BA1 B;  2IWX A;  3OMU A;  5CTY A;  4HYM A;  3J7A G;  2PNL A;  1UYM A;  1I5C A;  4JI8 I;  3V2U C;  1D6T A;  1QYE A;  1Y4S A;  4NXN E;  4YKW A;  2BTZ A;  4MPC A;  2YE5 A;  1Z0B A;  2YEE A;  3VHA A;  4AWQ A;  1F51 A;  5C93 A;  1QZR A;  2C39 A;  3Q6N A;  4JAV A;  3T0H A;  4WUC A;  2YGF A;  4AID A;  5K36 E;  4KQV A;  2BU6 A;  4BAE A;  2UXB I;  5JEA E;  2H55 A;  2VCJ A;  3T1H E;  3B4T A;  4O07 A;  4FW9 A;  5CF0 A;  4XD8 A;  2PO1 B;  3FV5 A;  4MPN A;  4YKU A;  3S5T A;  2WEQ A;  1P42 A;  3P3E A;  4BA2 A;  2C2A A;  4YY3 I;  2JT2 A;  3HZ5 A;  1TH8 A;  4YHH I;  1AH8 A;  1AM1 A;  2YEI A;  3K99 A;  4LF4 E;  1N33 I;  2BU5 A;  1HNZ E;  4DPT A;  3KRN A;  3M85 D;  3WHA A;  4LF8 I;  5BOC A;  2ZIT A;  5JEN A;  1Z5A A;  2BA1 G;  2JEB B;  3PYG A;  1YT2 A;  2UU9 E;  1XNR E;  4DV4 E;  4CWS A;  2NN6 E;  4AM3 A;  4XKA A;  4LFC E;  2VCI A;  1UYD A;  5GGZ A;  3D2R A;  4AQY E;  1IBK E;  4FN5 A;  4OO1 E;  3OWD A;  4LWH A;  1B62 A;  4QPJ A;  2V34 A;  4FWD A;  1HNX E;  1ZM3 A;  2CCU A;  3B28 A;  3HHU A;  3NMQ A;  4P8O A;  1VIS A;  2IES A;  3M7N D;  4LFB I;  1YSZ A;  4O04 A;  2BR2 A;  1Y8O A;  2X7I A;  4CWP A;  1OSF A;  2J7K A;  1N36 E;  1N34 I;  4WUB A;  4MBC A;  1VI7 A;  1XHK A;  3PS3 A;  4DPX A;  4DV2 E;  2UUC I;  2GQP A;  1XMO I;  2XHT A;  2BRE A;  2Q8I A;  1XXE A;  1UYK A;  4FMT A;  2UUB E;  4DR1 I;  3HZ1 A;  2VQF E;  5BOD A;  1BXD A;  4J3D A;  2C38 B;  4JI8 E;  3A0X A;  1IBM I;  2GO3 A;  4IFD F;  2ZDY A;  4MU0 A;  2BM0 A;  2YED A;  2CH4 A;  1YH8 A;  4MOT A;  4X66 I;  4FCP A;  1UDO A;  1AMW A;  2C37 B;  3WU6 A;  1AH6 A;  1YT0 A;  4BXI A;  5D7D A;  2PO0 B;  3HYZ A;  3CGY A;  1UY6 A;  2UXB E;  1UYH A;  1IBL E;  1NHJ A;  2XCM A;  4Q20 A;  2CVE A;  3T2S A;  3Q1Q A;  4X65 E;  4HY1 A;  1THN A;  4V25 A;  5IDM A;  4LF5 E;  2IWS A;  4U3B A;  2WNR A;  4MQY A;  2Z5E A;  4MU1 A;  3K85 A;  4UT4 A;  5BR8 I;  3LTO A;  2FYP A;  1OYP A;  4O05 A;  5GMD A;  1I5B A; 
#chains in the Genus database with same CATH homology
 4YY3 E;  2O1U A;  1S14 A;  2BSM A;  3M6A A;  4B3M E;  3RLQ A;  5L3J A;  2OI2 A;  4IZK B;  1N33 E;  1N32 I;  2AKP A;  2UXD I;  4LF8 E;  4DV7 I;  4ZKI A;  2YEF A;  4DR7 I;  4H7Q A;  1BGQ A;  4KFG A;  4DPU A;  3B25 A;  4XE2 A;  2HHH I;  3H4L A;  2E5L I;  1PIE A;  3J80 C;  4NH7 A;  2QG0 A;  4EM7 A;  4R3A A;  1UYC A;  4URL A;  4GKK E;  1I58 A;  2Z5B A;  4DV6 I;  2Z5C B;  3G7B A;  4ED4 A;  4LFB E;  4CWR A;  2YEJ A;  1U2R A;  3T1Y I;  5A2Q C;  3GIG A;  3H80 A;  3RKZ A;  4HZ0 A;  2XEX A;  4DPW A;  4FPP A;  2VQE I;  4I5S A;  2Q2E B;  1Z5C A;  3D4J A;  4DV3 E;  5J71 A;  4UTG A;  2O1V A;  1S16 A;  4R1F A;  4DR1 E;  3JZ3 A;  4LF7 I;  4DU7 A;  2BRC A;  1A4H A;  3HUL A;  4JI7 E;  2BYI A;  4DXL A;  1KVK A;  1IBM E;  3VHD A;  3J80 Q;  3WU5 A;  2FWZ A;  4ASA A;  3CWV A;  2HK2 A;  4JI6 E;  3Q5K A;  1B3Q A;  1XMQ I;  3K17 A;  4H81 A;  4MB9 A;  3K98 A;  4X64 E;  2BYH A;  2ZDX A;  1MX0 A;  2BU7 A;  2IOQ A;  1UEK A;  2E0A A;  4GKJ E;  2QG2 A;  2YE9 A;  4XCL A;  5FNF A;  2XDK A;  1Y6Z A;  3TZ5 A;  4EFU A;  1RRE A;  4XIP A;  4NH8 A;  1BYQ A;  3K97 A;  4HYP A;  3QT6 A;  4IZJ A;  4CWO A;  4ASF A;  2JJC A;  3BMY A;  4LF9 E;  2BV3 A;  1KZN A;  1U0Z A;  2CCT A;  1YT1 A;  4DR5 I;  2XD6 A;  4YKZ A;  1N32 E;  4MYT A;  2V2Q A;  2YE4 A;  2O1T A;  3TZ2 A;  3RLP A;  5IWA I;  4CWN A;  3PEJ A;  4B3S I;  2ESA A;  1MU5 A;  4LWE A;  2HHH E;  4NXM E;  2CG9 A;  3WU4 A;  4KHP E;  2WEP A;  3IED A;  1TID A;  4JAS A;  4FWG A;  3QT5 A;  4M1K A;  2ZM6 I;  4DV6 E;  4JI1 I;  3ZZ0 A;  4L8Z A;  1H74 A;  1XNQ I;  4URM A;  2HCH A;  1FWL A;  5D6Q A;  1FNM A;  4DR4 E;  2HFS A;  4JI5 I;  4GT8 A;  4USK A;  4RPF A;  3O0I A;  2A2D A;  2VW5 A;  1RR9 A;  3GIF A;  1B63 A;  2UUA I;  4X62 I;  3Q5L A;  3V5R A;  1HNW E;  4LF6 E;  4YKY A;  4E02 A;  3B24 A;  4JI3 E;  4JI4 I;  4HXZ A;  4DR6 I;  4GGL A;  2YI5 A;  4KP4 A;  1Z0W A;  2IOR A;  1XMQ E;  1J5E I;  1EI1 A;  4KTN A;  1GKZ A;  3PEH A;  4U93 A;  5FND A;  1H73 A;  3A0R A;  4HY6 A;  4DV1 E;  2UXC I;  4DR2 E;  1FJG E;  2HKJ A;  1UY8 A;  4JI2 I;  3WU3 A;  2BT0 A;  4KSG A;  4B3T I;  4YKQ A;  4LFA I;  2HG1 A;  4OX9 E;  1UY9 A;  5CTX A;  2UWD A;  3J81 C;  4EEH A;  3O2F A;  2ZBK B;  1GJV A;  4CE3 A;  1ZWH A;  4P52 A;  4R3M A;  4CWT A;  2XDS A;  3CGZ A;  5IWA E;  4FCR A;  4W7T A;  1K47 A;  1ZM9 A;  1Z0V A;  2WI1 A;  3HEK A;  1ZXN A;  2WI4 A;  3TUH A;  3B26 A;  2LJP A;  2GFD A;  2YKI A;  1HR0 I;  2FWY A;  3VAD A;  2R42 A;  2XJG A;  4P7A A;  4JI1 E;  1TC6 A;  3J81 Q;  2YEC A;  5CTW A;  2YK2 A;  1XNQ E;  1Z59 A;  1I5A A;  1TC0 A;  2CGF A;  5LMN I;  4U7O A;  4YHH E;  3EHJ A;  3U2D A;  2YK9 A;  4H85 A;  3K1J A;  3OTO I;  2HK3 A;  1QY8 A;  1FKA E;  2UUA E;  2YEG A;  4YKX A;  4ASB A;  3J7A M;  3EHF A;  3QTF A;  4XKK A;  4DPY A;  2XHR A;  5IDJ A;  4JI4 E;  1NZ0 A;  1MG7 A;  4EMD A;  3C11 A;  1Z5B A;  3G7E A;  1ELO A;  2YEA A;  1J5E E;  4DV5 I;  2F4V I;  3O6O A;  4O0B A;  2YEB A;  3ZXO A;  4EMV A;  3VHC A;  1YC1 A;  1N0U A;  3K60 A;  3R92 A;  4LFA E;  1N34 E;  4EGI A;  5CTU A;  4NXN I;  3HJC A;  3TTZ A;  1PKP A;  2WI6 A;  4BQG A;  2UUC E;  3OW6 A;  1XMO E;  2XJJ A;  3G75 A;  4E00 A;  1YER A;  2YE8 A;  3T1K A;  4EGK A;  4XDM A;  5IN9 A;  3JAM Q;  5IT9 C;  4K0K I;  2JKI A;  3ZM7 A;  3QT7 A;  1OJ4 A;  2YKE A;  4X66 E;  1US7 A;  4LPB A;  2E1R A;  5F3K A;  3PRY A;  2YE7 A;  4ASG A;  2X36 A;  4QPK A;  3HYY A;  1Z0C A;  3FT5 A;  2Z5C A;  3Q6M A;  3Q5J A;  3TZ4 A;  4BQJ A;  2PNM A;  1HNZ I;  1YS3 A;  5BR8 E;  1Y4U A;  3MNR P;  4Z7Y A;  4DU8 A;  2UU9 I;  1XNR I;  5IT9 Q;  2A2C A;  4DUY I;  4B3R I;  5LL6 R;  2YJX A;  2XDU A;  4JQL A;  4L91 A;  2VWC A;  1N0V C;  4CE2 A;  4AQY I;  2UXD E;  1IBK I;  2V2Z A;  4DV7 E;  1HNX I;  2V2V A;  4DZY A;  2O1W A;  4HAC A;  4DR7 E;  1AJ6 A;  2YGA A;  4E01 A;  4N3O A;  4FWH A;  2E5L E;  2XX2 A;  2YE3 A;  2GQ0 A;  3R4O A;  1N36 I;  2YI6 A;  5D7R A;  4DV2 I;  2F4V E;  4JV5 I;  4DR3 I;  1UYI A;  1BKN A;  3D0B A;  3PYE A;  4JAU A;  2UUB I;  1JM6 A;  2V8P A;  4BIU A;  3B27 A;  3T1Y E;  2VQF I;  2K5B A;  4DUZ I;  1YES A;  2XDX A;  2HKE A;  1H72 C;  2XDL A;  4CE1 A;  2EFG A;  2VQE E;  3ZKB A;  4XIQ A;  3CRK A;  2GS8 A;  3EHG A;  1H7S A;  4XIT A;  2DEI A;  5LMU I;  1YSR A;  2DEJ A;  4K0K E;  1UYF A;  4LF7 E;  2XAB A;  1YET A;  3RLR A;  2YE2 A;  5M4E A;  1IBL I;  4I3H A;  4X65 I;  4URO A;  4LF5 I;  3OPD A;  4FCQ A;  4AWO A;  1EA6 A;  4JYA I;  2ZKJ A;  2AJ4 A;  3P06 A;  4B3M I;  5M4K A;  1KKH A;  2XK2 A;  3F0N A;  1FI4 A;  3T0Z A;  4B7P A;  4GEE A;  5F5R A;  1UY7 A;  4KSH A;  2CCS A;  3INW A;  4B6C A;  1NHH A;  1FWK A;  3PYF A;  3CRL A;  4DUY E;  4B3R E;  4DR5 E;  3R4N A;  2XX5 A;  2YKJ A;  4V26 A;  5CPH A;  4AWP A;  1S4E A;  2Q8F A;  2WI2 A;  4GKK I;  1UYG A;  1H7U A;  2XJX A;  1Y8P A;  4B3S E;  3QDD A;  3DGE A;  4L94 A;  1U2O A;  3LPS A;  1NHI A;  4XTJ A;  2BZ5 A;  3B8H A;  5D7C A;  4XIR A;  4DV0 I;  2BU2 A;  3BM9 A;  2ZM6 E;  4JV5 E;  4DR3 E;  4DV3 I;  4LWG A;  2H8M A;  1TIL A;  3TZ0 A;  2VF3 A;  4U7N A;  4NH9 A;  1Z0G A;  3B82 A;  3EHH A;  2YKC A;  1USU A;  4DUZ E;  4MPE A;  2Q8G A;  4JI7 I;  3ZZT A;  5M4M A;  3B78 A;  4JI5 E;  2QF6 A;  3C0E A;  5J6A A;  2Q8H A;  4JI6 I;  3OWB A;  4XCJ A;  3A0T A;  1USV A;  4X62 E;  5FLX C;  1HK7 A;  4EFT A;  4YKR A;  5LMU E;  4X64 I;  5D6P A;  3JAM C;  2YI7 A;  2WI3 A;  1DAR A;  4DR6 E;  4LWI A;  4GFN A;  4GKJ I;  5M4H A;  3U2K A;  2Z5B B;  2XHX A;  2XX4 A;  4YKT A;  2WER A;  3R4P A;  2YKB A;  1WUU A;  4L90 A;  4JG4 A;  2QFO A;  4JYA E;  4JI0 I;  3GIG B;  1I94 I;  1Z0T A;  3QT8 A;  2UXC E;  1ID0 A;  3D36 A;  2YI0 A;  3U67 A;  2HFU A;  4LF9 I;  3R4M A;  2WW4 A;  4JI2 E;  3R91 A;  4B3T E;  4BIZ A;  2PNR A;  1Y8N A;  4PU9 A;  1YC4 A;  2CZ9 A;  4CWQ A;  3SL2 A;  2R3V A;  2WI5 A;  1I59 A;  4IZK A;  1UYL A;  5FLX Q;  3PYD A;  3LNU A;  4O09 A;  4IZJ D;  1ZXM A;  4LP0 A;  4AS9 A;  4PRX A;  4NXM I;  1R62 A;  1L0O A;  3KE6 A;  1TBW A;  3T1H I;  4KHP I;  3INX A;  4ZVI A;  3T10 A;  1ZW9 A;  4GQT A;  5M4P A;  3ZZU A;  1PVG A;  2BM1 A;  4DV0 E;  1ZM4 A;  1HR0 E;  5GME A;  4LF4 I;  4DR4 I;  4HZ5 A;  4IZJ B;  4PL9 A;  3ZKD A;  3FT8 A;  4WUD A;  2BU8 A;  4USM A;  4Z7C A;  3EKR A;  1Z0E A;  3GON A;  1YC3 A;  2FXS A;  2NPF A;  1HNW I;  4URN A;  4LF6 I;  4DV4 I;  4XC0 A;  2CGE A;  5LMN E;  4GCZ A;  4JI3 I;  4LFC I;  2IWU A;  4X9L A;  4DUH A;  1KTV A;  1UYE A;  4HAC B;  3OTO E;  2YE6 A;  3A0W A;  4PRV A;  4LWF A;  4HXW A;  3WQ9 A;  2IOP A;  4MYU A;  1GKX A;  1A6F A;  2YEH A;  3ZXQ A;  5M4N A;  1KIJ A;  1ZM2 A;  4DV1 I;  2EXL A;  3A0Y A;  4DR2 I;  1FJG I;  3EKO A;  2YGE A;  3A0Z A;  5A2Q Q;  4MP2 A;  4L93 A;  2YJW A;  4CWF A;  4EGH A;  4K4O A;  5FWK A;  2WI7 A;  5FNC A;  4OX9 I;  4XKO A;  4DV5 E;  4JI0 E;  1I94 E;  4MP7 A;  3GIE A;  2IWX A;  3OMU A;  5CTY A;  4HYM A;  3J7A G;  2PNL A;  1UYM A;  1I5C A;  4JI8 I;  3V2U C;  1D6T A;  1QYE A;  1Y4S A;  4NXN E;  4YKW A;  2BTZ A;  4MPC A;  2YE5 A;  1Z0B A;  2YEE A;  3VHA A;  4AWQ A;  5C93 A;  1QZR A;  3Q6N A;  4JAV A;  3T0H A;  4WUC A;  2YGF A;  4KQV A;  2BU6 A;  4BAE A;  2UXB I;  2VCJ A;  2H55 A;  3T1H E;  4O07 A;  5CF0 A;  4FW9 A;  4XD8 A;  3FV5 A;  4MPN A;  4YKU A;  2WEQ A;  2C2A A;  4YY3 I;  3HZ5 A;  1TH8 A;  4YHH I;  1AH8 A;  1AM1 A;  2YEI A;  3K99 A;  4LF4 E;  1N33 I;  2BU5 A;  1HNZ E;  4DPT A;  3WHA A;  4LF8 I;  5BOC A;  2ZIT A;  1Z5A A;  3PYG A;  1YT2 A;  2UU9 E;  1XNR E;  4DV4 E;  4CWS A;  4XKA A;  4LFC E;  2VCI A;  1UYD A;  5GGZ A;  3D2R A;  4AQY E;  1IBK E;  4FN5 A;  3OWD A;  4LWH A;  1B62 A;  4QPJ A;  2V34 A;  4FWD A;  1HNX E;  1ZM3 A;  2CCU A;  3B28 A;  3HHU A;  3NMQ A;  4P8O A;  1VIS A;  4LFB I;  1YSZ A;  4O04 A;  1Y8O A;  2X7I A;  4CWP A;  1OSF A;  2J7K A;  1N36 E;  1N34 I;  4WUB A;  4MBC A;  4DPX A;  1XHK A;  4DV2 E;  2XHT A;  2UUC I;  2GQP A;  1XMO I;  2BRE A;  2Q8I A;  1UYK A;  4FMT A;  2UUB E;  4DR1 I;  3HZ1 A;  2VQF E;  5BOD A;  1BXD A;  4JI8 E;  3A0X A;  1IBM I;  2ZDY A;  2BM0 A;  2YED A;  2CH4 A;  4MOT A;  4X66 I;  4FCP A;  1AMW A;  4BXI A;  3WU6 A;  1AH6 A;  1YT0 A;  5D7D A;  3HYZ A;  3CGY A;  1UY6 A;  2UXB E;  1UYH A;  1IBL E;  1NHJ A;  2XCM A;  4Q20 A;  3T2S A;  3Q1Q A;  4X65 E;  4HY1 A;  1THN A;  4V25 A;  5IDM A;  4LF5 E;  2IWS A;  2Z5E A;  4UT4 A;  3K85 A;  5BR8 I;  3LTO A;  2FYP A;  1I5D A;  4O05 A;  5GMD A;  1I5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...