3LPSA

Crystal structure of pare
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
364
structure length
347
Chain Sequence
GLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLHGVGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of parE
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Isomerase/antibiotic
molecule keywords Topoisomerase IV subunit B
total genus 110
structure length 347
sequence length 364
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3lpsA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3lpsA01
4X65E 3JZ3A 4DV4E 4JI2E 2YKEA 3F0NA 4U7NA 3QT7A 2BU5A 1J5EI 1OJ4A 3HULA 4P7AA 3CGZA 4K0KE 1KIJA 2YKJA 4BXIA 4LFCI 1GKXA 2QFOA 1XMOE 2J7KA 2YE2A 4CE1A 1EI1A 4HYMA 3RLQA 1N36E 4LF6I 2WW4A 3K1JA 1YSRA 1MU5A 2XD6A 3GIGB 3GIEA 4DPUA 1I58A 4JI3E 4PRXA 2QG0A 1ZM4A 2XHRA 2BSMA 3K97A 5FNFA 4HZ0A 4EMVA 4URNA 1KKHA 4FCPA 4ZVIA 4DUYI 2VQEI 4L91A 3CWVA 2E0AA 2ZITA 4DV6E 2IORA 5M4HA 1NHHA 1YT2A 1N32E 5CPHA 2XJJA 2C2AA 5BR8I 1U0ZA 1UYEA 5GMDA 2YE5A 4LF5E 3R4NA 2Q8HA 4R3MA 3T1KA 3ZXOA 2BTZA 1H72C 3A0XA 5D6QA 1UYMA 2YE8A 2VWCA 4XITA 1BXDA 4HZ5A 1Z0TA 2GQPA 1ZM9A 4AWPA 5IT9Q 2E1RA 2JJCA 2VF3A 4CWQA 4ASGA 1YSZA 1THNA 2BYHA 2YI0A 3K17A 3PYDA 4JI0I 4X64I 4URMA 4EMDA 3PEJA 1Z0VA 1AMWA 4NXNE 3A0YA 2YEEA 1S14A 2IWXA 1FI4A 3U2DA 3G7BA 4DPXA 5F3KA 2YEFA 1NHJA 2YK9A 5D7CA 2YEJA 3PYFA 1N34E 4MP7A 4FN5A 4R1FA 3HZ5A 4NXME 2UXDI 4BQJA 4YKZA 3Q1QA 2BZ5A 5J6AA 4XTJA 5D7RA 2DEIA 3IEDA 5LMNE 1TILA 4DPWA 4DU7A 4DV1I 1ZWHA 2YE3A 3O6OA 4R3AA 2BU8A 4X66I 1KZNA 4B6CA 4AS9A 1IBMI 4JYAI 5IWAE 4JAUA 3U2KA 4UROA 3T0HA 3T1YI 1XNQI 2IOQA 4MPNA 2FYPA 4LF7E 1WUUA 4FCQA 1YT1A 2UUCE 3OW6A 4AWQA 5A2QQ 2YI7A 4EGIA 4DV3I 2CCTA 2XEXA 1Z5CA 5M4KA 4GQTA 3K98A 1TBWA 2Q2EB 4DV0E 2K5BA 4HXZA 1IBLI 3WU6A 1TC0A 4B3TE 2BT0A 4CE3A 3B25A 1H7UA 3Q5JA 4BAEA 2UXBI 2YEDA 3RLRA 4DU8A 2BU6A 3M6AA 2UXCE 2VW5A 5GGZA 4HY6A 3PYEA 4KSGA 4YKRA 3A0RA 1Z5BA 2A2DA 1U2OA 4LFAE 4YKUA 3FT8A 2BU2A 1UYGA 4DV2I 4EFTA 1DARA 4GKKI 4B3RI 1YETA 3J7AM 4USMA 1XNRI 4LFBI 1Z0WA 2XDSA 5A2QC 1J5EE 2CH4A 3GIGA 2YI5A 3VHAA 4JI6E 4XDMA 4EM7A 4LFCE 4DR7I 4MYUA 1A4HA 4JQLA 1UYDA 3WU4A 4LF6E 2GFDA 4KSHA 3TUHA 5CF0A 1H74A 1FJGI 4PRVA 4JI3I 3WU3A 4DR2E 1I5DA 4XIQA 4MPCA 4WUBA 4YY3I 4JI7I 2HK2A 1UEKA 4XCLA 1Z0BA 2XDXA 1IBKI 4L94A 3TTZA 4NH9A 5LL6R 1Y8OA 1UYIA 4FWGA 1UYFA 3NMQA 1HR0I 3FT5A 4BIUA 1Z59A 2XDUA 2BV3A 1AH8A 4MYTA 2HKJA 4ED4A 3QT8A 4JG4A 4ASBA 2H8MA 2UU9I 5FLXC 4MB9A 3ZZ0A 1HNZE 2UUCI 2F4VI 4LPBA 3PEHA 1UYKA 4Q20A 4LWIA 4DV3E 4GCZA 4JAVA 3OMUA 4L90A 4DUZE 4AQYE 4ASAA 4H81A 3HYYA 1B62A 1EA6A 1IBLE 1RR9A 4YHHI 3J80Q 2IOPA 2YJXA 1XHKA 2VQFE 3BMYA 4B3SE 4JI4I 1UY6A 2AKPA 3C0EA 3FV5A 3B26A 3ZXQA 2EFGA 4B3ME 2UWDA 4UTGA 4CWTA 1GKZA 1Y8NA 2IWSA 1MG7A 4MBCA 3H4LA 4YKWA 1I94I 2ZM6I 2YGFA 3CRLA 4DR3I 2XDLA 1YERA 5D6PA 3LTOA 4CWPA 5FNDA 4X62E 1IBME 2H55A 4HXWA 3QDDA 1S4EA 3JAMC 4KHPI 1FKAE 3VHCA 4P52A 1H73A 2WEQA 3KE6A 4JI8I 4X9LA 4LF7I 3J81C 1QY8A 2ZDYA 4OX9E 4L8ZA 4PU9A 4FWHA 1Z0CA 3TZ4A 4CWNA 3ZKBA 4X64E 2XHXA 4O07A 1ZW9A 1N36I 2ZKJA 3EHHA 5FNCA 4LF8E 2Q8FA 3K99A 4DR1E 2AJ4A 3INWA 4DR5I 3QTFA 4V26A 3EHJA 5C93A 3ZM7A 1VISA 2WI4A 1QZRA 4GT8A 2A2CA 2VCJA 3DGEA 4LWEA 3EKOA 2ESAA 2X36A 1HNXI 4O0BA 4HY1A 1TH8A 4HACB 3V2UC 2FXSA 2Q8IA 3T2SA 4E01A 4FPPA 3TZ0A 3ZZUA 4DR6I 3R4PA 5BODA 1S16A 4GGLA 2WI3A 4XKOA 3D2RA 1TC6A 5M4PA 2NPFA 1XNRE 2XX5A 4LF4E 3G75A 4E00A 1XMQE 5IWAI 1ZM2A 4HACA 3V5RA 2FWYA 3B28A 2R3VA 2R42A 1FWLA 1HNWE 4JI5E 5CTUA 4L93A 4DR4E 4CWRA 4X65I 3OWBA 4GKJE 5FWKA 2O1WA 2IWUA 2DEJA 3QT6A 4CWFA 4EGKA 3A0ZA 4MPEA 4JI1E 4O05A 1ID0A 2HKEA 1H7SA 2E5LI 1L0OA 2VQFI 1AM1A 5LMUI 2GS8A 4DV0I 4YY3E 4YKTA 1Z0EA 3J80C 1YS3A 4B3MI 1ELOA 3WU5A 5F5RA 2YGEA 2HG1A 5J71A 1IBKE 1N33E 1U2RA 2WI5A 3GONA 4O09A 2UUBE 2Q8GA 3D0BA 2PNRA 3TZ2A 3G7EA 2HFSA 3RKZA 4KTNA 3B24A 3JAMQ 4X62I 4PL9A 1PVGA 1I5CA 3ZZTA 3CGYA 3A0TA 3GIFA 4B3RE 4JV5I 4NH8A 3OPDA 2BM1A 1PIEA 3J7AG 1YESA 1D6TA 2XDKA 4YKYA 3ZKDA 3H80A 4RPFA 4DV7I 1KVKA 4JI6I 4CWOA 4LP0A 1US7A 4FMTA 3WQ9A 2CCSA 2HHHE 4U93A 4BIZA 5L3JA 4KP4A 1A6FA 4DR1I 2YKIA 4XCJA 3OTOI 4AWOA 4WUCA 2HFUA 1N34I 3LPSA 2UXBE 4Z7YA 4NXMI 5CTXA 5BOCA 4DV5I 1I94E 4YKXA 4EFUA 4DR6E 3R92A 5IN9A 1NHIA 2V2VA 1YC4A 5M4MA 4M1KA 4DV6I 4XC0A 4ZKIA 4CE2A 2XCMA 1XMQI 4YKQA 5LMNI 4GKKE 4LF5I 1HNWI 3EHGA 2CG9A 2UUAE 4LF9I 2V2ZA 3WHAA 4EGHA 3T0ZA 4JI8E 2BRCA 4XE2A 3O2FA 3B78A 1UY7A 4DXLA 1UYCA 1Y4SA 1Z5AA 3RLPA 5M4EA 3A0WA 1XNQE 4I3HA 2X7IA 4K4OA 1JM6A 2ZBKB 2VCIA 4DUZI 2OI2A 2E5LE 4AQYI 4XIPA 2YJWA 4DZYA 1FNMA 4K0KI 3EKRA 2YE6A 3Q5LA 1Y4UA 3D4JA 1Y8PA 4JI0E 1K47A 3VADA 4DR2I 3SL2A 1XMOI 5GMEA 2ZDXA 4DR5E 1PKPA 1I5AA 2YKCA 4P8OA 4JASA 2HK3A 4QPKA 4DUHA 3T10A 3T1HI 5IDJA 2CZ9A 1HNXE 4GEEA 4V25A 1Z0GA 4Z7CA 4DUYE 3VHDA 4MP2A 2VQEE 1UY9A 1N0UA 2XJGA 5M4NA 2BM0A 3J81Q 1ZXNA 4O04A 4CWSA 1OSFA 4LF4I 2O1VA 1YC3A 2YEBA 3R4MA 4DV2E 4H7QA 4DV1E 5IT9C 4KHPE 2V34A 4B7PA 4DV7E 1YC1A 4LFBE 4GKJI 2UU9E 4JYAE 3B82A 4OX9I 1B3QA 1NZ0A 4DV4I 4JI1I 4JI2I 4DR7E 2HHHI 1ZM3A 2BYIA 3INXA 3U67A 1UYHA 3Q5KA 4FWDA 2HCHA 2YGAA 1AJ6A 3HYZA 2XABA 3BM9A 3OTOE 4LF8I 2QG2A 3HZ1A 4LWGA 4MOTA 4YHHE 1N33I 4B3SI 4JI4E 3D36A 3B27A 3EHFA 3C11A 4XIRA 4JI7E 2WI2A 5D7DA 4LWFA 4WUDA 2XJXA 2YE4A 2YEAA 4DV5E 4KFGA 2XK2A 3QT5A 3LNUA 1R62A 2V8PA 4EEHA 2UXCI 1I59A 2YEHA 2O1UA 2FWZA 2V2QA 4QPJA 2ZM6E 4KQVA 2WI7A 5CTYA 1N32I 4HYPA 4LWHA 1KTVA 1I5BA 1HR0E 5BR8E 1UY8A 2YEGA 2YEIA 2BREA 4UT4A 4JI5I 4FW9A 4X66E 4XD8A 3K60A 2WI1A 4DR4I 3O0IA 4DPTA 4USKA 2XX2A 4GFNA 1HNZI 2F4VE 2WI6A 2YECA 1BGQA 3OWDA 2BU7A 3T1YE 3HHUA 1QYEA 2JKIA 3CRKA 2YE9A 4U7OA 1GJVA 1MX0A 3R4OA 4W7TA 3TZ5A 5LMUE 3PYGA 1TIDA 2WEPA 3MNRP 4XKAA 3HEKA 4NH7A 1FJGE 2YKBA 4E02A 1B63A 3T1HE 4NXNI 2QF6A 4DPYA 2WERA 1BYQA 1RREA 2UUBI 1AH6A 2XX4A 4B3TI 2XHTA 3B8HA 2YE7A 4H85A 5CTWA 1YT0A 2CGFA 4I5SA 4FCRA 3R91A 5IDMA 2UXDE 4JV5E 4DR3E 4LFAI 2UUAI 4LF9E 2EXLA 1ZXMA 1FWKA 1N0VC 1UYLA 2YI6A 4ASFA 2YK2A 2LJPA 2CCUA 4XKKA 5FLXQ 4URLA 1BKNA 4BQGA
chains in the Genus database with same CATH superfamily
4X65E 3JZ3A 4DV4E 4JI2E 2YKEA 3F0NA 4U7NA 3QT7A 2BU5A 4IFDA 1J5EI 1OJ4A 3HULA 4P7AA 3CGZA 4K0KE 4OZEA 1KIJA 3P3EA 2YKJA 4BXIA 3P3CA 4LFCI 1GKXA 2QFOA 5JEAE 4N3OA 1XMOE 2J7KA 2YE2A 4CE1A 1EI1A 4HYMA 3RLQA 1N36E 1VI7A 4LF6I 2WW4A 3K1JA 1YSRA 1MU5A 2XD6A 3GIGB 3GIEA 4BA2A 4MU0A 4DPUA 1I58A 4JI3E 4PRXA 2QG0A 1ZM4A 2XHRA 2BSMA 3K97A 5FNFA 4HZ0A 4EMVA 4URNA 1KKHA 4FCPA 4MDTA 4ZVIA 4FW6A 4DUYI 2VQEI 2PO0B 3L7ZA 5D7DA 4L91A 3CWVA 2E0AA 2ZITA 4DV6E 5K36F 2IORA 1NHHA 1YT2A 1N32E 5CPHA 2XJJA 4IZKB 1USUA 2C2AA 3LMMA 5BR8I 1U0ZA 1UYEA 2C39B 5GMDA 2YE5A 2Z5CA 4LF5E 3R4NA 2Q8HA 4R3MA 3T1KA 3ZXOA 2BTZA 1H72C 4FW7A 3A0XA 5D6QA 1UYMA 2YE8A 2VWCA 4XITA 1BXDA 4HZ5A 1Z0TA 2GQPA 1ZM9A 4AWPA 5IT9Q 2C1GA 2E1RA 2JJCA 2VF3A 3Q6MA 4CWQA 4ASGA 1YSZA 1THNA 3P3GA 2BYHA 2YI0A 3K17A 3PYDA 4JI0I 4X64I 4URMA 4EMDA 3PEJA 1Z0VA 1AMWA 4NXNE 2JEBB 3A0YA 2YEEA 1S14A 3H1CA 2IWXA 1FI4A 2Z5BA 3U2DA 3G7BA 4DPXA 5F3KA 2YEFA 1NHJA 2YK9A 5D7CA 2YEJA 3PYFA 2AE8A 1N34E 4MP7A 4FN5A 4R1FA 3P06A 3HZ5A 4OO1E 4ISAA 4NXME 2UXDI 4BQJA 4YKZA 3Q1QA 5K36E 4IS9A 2BZ5A 5ELWA 4XTJA 5D7RA 1Y6ZA 5J6AA 2DEIA 3IEDA 5LMNE 1TILA 4DPWA 4DU7A 4DV1I 1ZWHA 2YE3A 3O6OA 4R3AA 2BU8A 4X66I 2PNZB 1KZNA 4B6CA 4AS9A 1IBMI 4IFDC 4JYAI 5IWAE 4JAUA 3U2KA 4UROA 3T0HA 2IOQA 3T1YI 1XNQI 4MPNA 2FYPA 4LF7E 1WUUA 4FCQA 1YT1A 2UUCE 3OW6A 2F1DA 4AWQA 1HK7A 3CDJA 5A2QQ 2YI7A 4EGIA 2BR2B 4DV3I 2CCTA 2XEXA 1Z5CA 5M4KA 4GQTA 3K98A 3Q6NA 1UDQA 2Q2EB 4DV0E 1TBWA 2K5BA 1Y60A 4HXZA 1IBLI 1E3HA 1UDNA 3WU6A 1TC0A 4B3TE 2BT0A 4CE3A 3B25A 4IZJD 1H7UA 3Q5JA 4BAEA 2UXBI 2YEDA 3RLRA 2Z5CB 4DU8A 2BU6A 3M6AA 2UXCE 2VW5A 3U1YA 5GGZA 4HY6A 3PYEA 4KSGA 4U3DA 4YKRA 5JEAF 3A0RA 1Z5BA 2A2DA 1U2OA 4LFAE 4YKUA 3FT8A 2BU2A 2CGEA 1UYGA 4DV2I 4EFTA 1DARA 4GKKI 4B3RI 5M4PA 1YETA 3J7AM 4AM3A 2PNLA 4USMA 1XNRI 4LFBI 1Z0WA 2XDSA 5A2QC 2Z5BB 2J65A 1J5EE 2CH4A 3GIGA 2YI5A 3VHAA 4JI6E 4XDMA 4EM7A 3K85A 4LFCE 4DR7I 4MYUA 1A4HA 2C37A 4JQLA 1UYDA 2O1TA 3WU4A 4LF6E 2GFDA 4KSHA 3TUHA 5CF0A 1H74A 1FJGI 4PRVA 4JI3I 3WU3A 4DR2E 1I5DA 4XIQA 4MPCA 2PO1A 4WUBA 1YH8A 4YY3I 4JI7I 3PS2A 2HK2A 1UEKA 4XCLA 5M4HA 1XXEA 1Z0BA 2JEBA 1IBKI 2XDXA 4L94A 3TTZA 2JEAA 4NH9A 3M7ND 5LL6R 4E72A 5JEAB 2NN6E 1Y8OA 1UYIA 4J3DA 4FWGA 4LCGA 1UYFA 3NMQA 1HR0I 3FT5A 4BIUA 1Z59A 4FW3A 2XDUA 2BV3A 2GO3A 1AH8A 4MYTA 2HKJA 4ED4A 2IESA 3QT8A 4JG4A 4ASBA 2H8MA 2UU9I 5FLXC 4MB9A 3ZZ0A 1HNZE 2UUCI 2F4VI 1R6LA 4LPBA 3PEHA 1UYKA 3M7NG 4Q20A 3GLLA 4LWIA 4DV3E 4GCZA 2WNRA 4JAVA 3OMUA 4L90A 4DUZE 4AQYE 3CYGA 4ASAA 4H81A 2PO0A 3HYYA 1B62A 1EA6A 1IBLE 5JENA 4LCFA 2WP8B 1RR9A 4YHHI 3J80Q 2IOPA 4AIDA 1XHKA 2VQFE 2YJXA 4B3SE 4JI4I 1UY6A 2AKPA 3BMYA 3C0EA 3B26A 3FV5A 3ZXQA 2EFGA 4B3ME 2UWDA 4UTGA 4CWTA 1GKZA 1Y8NA 2IWSA 5EL9A 1MG7A 2CVEA 5DNLA 4MBCA 3H4LA 4YKWA 1I94I 2ZM6I 2YGFA 3CRLA 2C38A 4IZJB 4DR3I 2XDLA 1YERA 5D6PA 3LTOA 4CWPA 5FNDA 4X62E 2JE6A 1IBME 2H55A 4HXWA 3QDDA 1S4EA 2Z5EA 3JAMC 4KHPI 1FKAE 3VHCA 4P52A 1H73A 4OO1C 2WEQA 3KE6A 4JI8I 4X9LA 4LF7I 3J81C 1QY8A 2JEAB 2ZDYA 4OX9E 4L8ZA 4PU9A 2C39A 4FWHA 1Z0CA 2BA0G 3NZKA 3TZ4A 4CWNA 3ZKBA 4X64E 2XHXA 4O07A 1ZW9A 1UDSA 4LCHA 4U3BA 1N36I 2ZKJA 1OYSA 3U1KA 4IFDE 2BR2A 4MU3A 3EHHA 5FNCA 4LF8E 2Q8FA 3K99A 4DR1E 2AJ4A 3INWA 4DR5I 3QTFA 1RHYA 3EHJA 4V26A 5C93A 4IFDD 3ZM7A 2JE6B 1VISA 2WI4A 1QZRA 4GT8A 2A2CA 2VCJA 3DGEA 5C0XC 3EKOA 4LWEA 2ESAA 2X36A 1HNXI 4O0BA 4HY1A 1TH8A 4HACB 3V2UC 2FXSA 2Q8IA 3T2SA 4E01A 4FPPA 3GCMA 3TZ0A 3ZZUA 4DR6I 3R4PA 5BODA 1S16A 3HKMA 4GGLA 2WI3A 4XKOA 3D2RA 5C0XA 4OO1D 2NPFA 1XNRE 1TC6A 4LF4E 2XX5A 3G75A 4E00A 1XMQE 5IWAI 1ZM2A 4HACA 3V5RA 2FWYA 3B28A 2R3VA 2R42A 1FWLA 1P42A 1HNWE 5DRRA 4JI5E 4BA1A 5CTUA 4L93A 4DR4E 4CWRA 2HHIA 4X65I 3OWBA 5FWKA 4GKJE 2O1WA 5C0XD 4OO1F 2IWUA 2DEJA 3QT6A 5JEAC 4CWFA 4EGKA 3A0ZA 4MPEA 4JI1E 4O05A 1ID0A 2HKEA 1H7SA 4QNKA 2E5LI 1L0OA 2VQFI 1AM1A 5LMUI 2GS8A 4DV0I 5DRPA 4YY3E 4YKTA 3S5TA 1Z0EA 4AIMA 3J80C 1YS3A 4B3MI 1ELOA 3WU5A 5F5RA 2YGEA 2HG1A 2VESA 5J71A 1IBKE 1N33E 1U2RA 2WI5A 3GONA 4O09A 4GQUA 2UUBE 2Q8GA 3D0BA 2PNRA 3TZ2A 3G7EA 2HFSA 3RKZA 4IZJA 4BA1B 4KTNA 3B24A 3JAMQ 4X62I 2C37B 4PL9A 1PVGA 1I5CA 3ZZTA 3CGYA 3A0TA 3GIFA 4B3RE 2BA0D 4JV5I 4NH8A 3OPDA 2BM1A 1PIEA 3J7AG 1YESA 1D6TA 2XDKA 1Y5YA 4YKYA 3ZKDA 2PO1B 3H80A 2IERA 4RPFA 4DV7I 3UHMA 1KVKA 4JI6I 4CWOA 4LP0A 2NN6B 5DROA 1IXMA 1US7A 4FMTA 3WQ9A 2CCSA 4BA2B 2HHHE 5C0XB 4U93A 4BIZA 2PO2A 5L3JA 4KP4A 1A6FA 4DR1I 2YKIA 4XCJA 5EKWA 3OTOI 4AWOA 4WUCA 2HFUA 1N34I 3LPSA 2UXBE 2O3ZA 4Z7YA 4NXMI 5CTXA 5K36C 2BA1G 5BOCA 4DV5I 1I94E 4YKXA 4EFUA 4DR6E 3R92A 5IN9A 1NHIA 2V2VA 1YC4A 5M4MA 4M1KA 4DV6I 4XC0A 4ZKIA 4CE2A 4FW4A 2XCMA 2JT2A 1XMQI 4YKQA 5LMNI 4GKKE 4LF5I 1HNWI 5K36A 3EHGA 2CG9A 2UUAE 4LF9I 2V2ZA 2C38B 3WHAA 4EGHA 3T0ZA 4JI8E 2BRCA 4XE2A 5JEAD 5JEAA 3O2FA 3B78A 1UY7A 4DXLA 1UYCA 1Y4SA 1Z5AA 3RLPA 3DD6A 5M4EA 3A0WA 1XNQE 5K36D 4I3HA 2X7IA 4K4OA 1JM6A 2ZBKB 4MQYA 4LPFA 4MU4A 2GO4A 4IZKA 2OI2A 4DUZI 2VCIA 2E5LE 4AQYI 4XIPA 2YJWA 4DZYA 4QNJA 1FNMA 4K0KI 3EKRA 2YE6A 3Q5LA 1Y4UA 3D4JA 1Y8PA 4JI0E 1K47A 3VADA 4DR2I 1E3PA 3SL2A 5DRQA 5GMEA 1XMOI 1F51A 2ZDXA 4DR5E 1PKPA 1I5AA 2YKCA 4P8OA 4JASA 2HK3A 2NN6F 4QPKA 4DUHA 3T10A 3CDIA 3T1HI 5IDJA 2CZ9A 1HNXE 4GEEA 4V25A 1Z0GA 4Z7CA 4DUYE 3VHDA 4MP2A 2VQEE 1UY9A 1N0UA 2XJGA 5M4NA 2BM0A 3J81Q 1ZXNA 1USVA 2WP8A 4O04A 4CWSA 4IFDB 1OSFA 2O1VA 4LF4I 3PS1A 1YC3A 2YEBA 3R4MA 4DV2E 4H7QA 4DV1E 5IT9C 4KHPE 2V34A 4B7PA 4DV7E 1YHCA 1YC1A 4LFBE 4GKJI 2UU9E 4JYAE 4FW5A 3PS3A 3B82A 4OX9I 1B3QA 1NZ0A 4OO1B 3KRNA 4DV4I 4JI1I 4JI2I 4DR7E 2HHHI 1ZM3A 2BYIA 3INXA 3U67A 1UYHA 3Q5KA 4FWDA 3B4TA 4NBQA 5K36B 2HCHA 2YGAA 1AJ6A 3HYZA 2XABA 3BM9A 3OTOE 4LF8I 2QG2A 3HZ1A 4LWGA 4MOTA 4YHHE 3GMEA 1N33I 4B3SI 4JI4E 3D36A 3B27A 3EHFA 3C11A 4XIRA 1UDOA 2PNMA 4JI7E 2WI2A 4LWFA 4WUDA 2XJXA 2YE4A 2YEAA 4DV5E 4KFGA 2XK2A 3QT5A 2NN6C 3LNUA 1R62A 2V8PA 4EEHA 2UXCI 5C0XF 1I59A 2YEHA 2O1UA 2FWZA 2V2QA 2PNZA 4QPJA 2ZM6E 4KQVA 3L7ZB 4MU1A 2WI7A 2NN6A 1N32I 4HYPA 1OYPA 4LWHA 5CTYA 1KTVA 1I5BA 1HR0E 5BR8E 1UY8A 2YEGA 2YEIA 2BREA 4UT4A 4JI5I 4FW9A 4X66E 4XD8A 2FTKA 3M85G 2WI1A 4DR4I 3K60A 3O0IA 2WNRB 4DPTA 4USKA 2XX2A 4GFNA 1HNZI 2F4VE 2WI6A 2YECA 2GQ0A 1BGQA 3OWDA 4OKGA 2BU7A 3T1YE 3PRYA 3HHUA 1QYEA 2JKIA 3CRKA 2YE9A 4U7OA 1GJVA 1MX0A 3R4OA 1R6MA 4W7TA 3TZ5A 5LMUE 3PYGA 1TIDA 2C1IA 3P76A 2WEPA 3HEKA 3MNRP 4XKAA 4NH7A 1FJGE 2YKBA 2NN6D 4E02A 1B63A 3T1HE 4NXNI 2BA1D 2QF6A 4DPYA 2WERA 1BYQA 1RREA 2UUBI 3M85D 1AH6A 2XX4A 4B3TI 2XHTA 3B8HA 1OYRA 2YE7A 4H85A 5CTWA 1YT0A 5C0XE 2CGFA 4I5SA 4FCRA 3R91A 5IDMA 4OO1A 2UXDE 4JV5E 4DR3E 4LFAI 2UUAI 4LF9E 4IFDF 2EXLA 1ZXMA 1FWKA 1N0VC 1UYLA 2PO2B 2YI6A 4ASFA 2YK2A 2LJPA 3HJCA 2CCUA 4XKKA 4LOMA 5FLXQ 4URLA 1BKNA 5DNXA 4BQGA
chains in the Genus database with same CATH topology
4X65E 3JZ3A 4DV4E 4JI2E 2YKEA 3F0NA 4U7NA 3QT7A 2BU5A 1J5EI 1OJ4A 3HULA 4P7AA 3CGZA 4K0KE 1KIJA 2YKJA 4BXIA 4LFCI 1GKXA 2QFOA 4N3OA 1XMOE 2J7KA 2YE2A 4CE1A 1EI1A 4HYMA 3RLQA 1N36E 4LF6I 2WW4A 3K1JA 1YSRA 1MU5A 2XD6A 3GIGB 3GIEA 4DPUA 1I58A 4JI3E 4PRXA 2QG0A 1ZM4A 2XHRA 2BSMA 3K97A 5FNFA 4HZ0A 4EMVA 4URNA 1KKHA 4FCPA 4ZVIA 4DUYI 2VQEI 5D7DA 4L91A 3CWVA 2E0AA 2ZITA 4DV6E 2IORA 5M4HA 1NHHA 1YT2A 1N32E 5CPHA 2XJJA 4IZKB 1USUA 2C2AA 5BR8I 1U0ZA 1UYEA 5GMDA 2YE5A 2Z5CA 4LF5E 3R4NA 2Q8HA 4R3MA 3T1KA 3ZXOA 2BTZA 1H72C 3A0XA 5D6QA 1UYMA 2YE8A 2VWCA 4XITA 1BXDA 4HZ5A 1Z0TA 2GQPA 1ZM9A 4AWPA 5IT9Q 2E1RA 2JJCA 2VF3A 3Q6MA 4CWQA 4ASGA 1YSZA 1THNA 2BYHA 2YI0A 3K17A 3PYDA 4JI0I 4X64I 4URMA 4EMDA 3PEJA 1Z0VA 1AMWA 4NXNE 3A0YA 2YEEA 1S14A 2IWXA 1FI4A 2Z5BA 3U2DA 3G7BA 4DPXA 5F3KA 2YEFA 1NHJA 2YK9A 5D7CA 2YEJA 3PYFA 1N34E 4MP7A 4FN5A 4R1FA 3P06A 3HZ5A 4NXME 2UXDI 4BQJA 4YKZA 3Q1QA 2BZ5A 5J6AA 4XTJA 5D7RA 1Y6ZA 2DEIA 3IEDA 5LMNE 1TILA 4DPWA 4DU7A 4DV1I 1ZWHA 2YE3A 3O6OA 4R3AA 2BU8A 4X66I 1KZNA 4B6CA 4AS9A 1IBMI 4JYAI 5IWAE 4JAUA 3U2KA 4UROA 3T0HA 2IOQA 3T1YI 1XNQI 4MPNA 2FYPA 4LF7E 1WUUA 4FCQA 1YT1A 2UUCE 3OW6A 4AWQA 1HK7A 5A2QQ 2YI7A 4EGIA 4DV3I 2CCTA 2XEXA 1Z5CA 5M4KA 4GQTA 3K98A 3Q6NA 1TBWA 2Q2EB 4DV0E 2K5BA 4HXZA 1IBLI 3WU6A 1TC0A 4B3TE 2BT0A 4CE3A 3B25A 4IZJD 1H7UA 3Q5JA 4BAEA 2UXBI 2YEDA 3RLRA 2Z5CB 4DU8A 2BU6A 3M6AA 2UXCE 2VW5A 5GGZA 4HY6A 3PYEA 4KSGA 4YKRA 3A0RA 1Z5BA 2A2DA 1U2OA 4LFAE 4YKUA 3FT8A 2BU2A 2CGEA 1UYGA 4DV2I 4EFTA 1DARA 4GKKI 4B3RI 1YETA 3J7AM 2PNLA 4USMA 1XNRI 4LFBI 1Z0WA 2XDSA 5A2QC 2Z5BB 1J5EE 2CH4A 3GIGA 2YI5A 3VHAA 4JI6E 4XDMA 4EM7A 3K85A 4LFCE 4DR7I 4MYUA 1A4HA 4JQLA 1UYDA 2O1TA 3WU4A 4LF6E 2GFDA 4KSHA 3TUHA 5CF0A 1H74A 1FJGI 4PRVA 4JI3I 3WU3A 4DR2E 1I5DA 4XIQA 4MPCA 4WUBA 4YY3I 4JI7I 2HK2A 1UEKA 4XCLA 1Z0BA 2XDXA 1IBKI 4L94A 3TTZA 4NH9A 5LL6R 1Y8OA 1UYIA 4FWGA 1UYFA 3NMQA 1HR0I 3FT5A 4BIUA 1Z59A 2XDUA 2BV3A 1AH8A 4MYTA 2HKJA 4ED4A 3QT8A 4JG4A 4ASBA 2H8MA 2UU9I 5FLXC 4MB9A 3ZZ0A 1HNZE 2UUCI 2F4VI 4LPBA 3PEHA 1UYKA 4Q20A 4LWIA 4DV3E 4GCZA 4JAVA 3OMUA 4L90A 4DUZE 4AQYE 4ASAA 4H81A 3HYYA 1B62A 1EA6A 1IBLE 1RR9A 4YHHI 3J80Q 2IOPA 2YJXA 1XHKA 2VQFE 3BMYA 4B3SE 4JI4I 1UY6A 2AKPA 3C0EA 3FV5A 3B26A 3ZXQA 2EFGA 4B3ME 2UWDA 4UTGA 4CWTA 1GKZA 1Y8NA 2IWSA 1MG7A 4MBCA 3H4LA 4YKWA 1I94I 2ZM6I 2YGFA 3CRLA 4DR3I 4IZJB 2XDLA 1YERA 5D6PA 3LTOA 4CWPA 5FNDA 4X62E 1IBME 2H55A 4HXWA 3QDDA 1S4EA 2Z5EA 3JAMC 4KHPI 1FKAE 3VHCA 4P52A 1H73A 2WEQA 3KE6A 4JI8I 4X9LA 4LF7I 3J81C 1QY8A 2ZDYA 4OX9E 4L8ZA 4PU9A 4FWHA 1Z0CA 3TZ4A 4CWNA 3ZKBA 4X64E 2XHXA 4O07A 1ZW9A 1N36I 2ZKJA 3EHHA 5FNCA 4LF8E 2Q8FA 3K99A 4DR1E 2AJ4A 3INWA 4DR5I 3QTFA 4V26A 3EHJA 5C93A 3ZM7A 1VISA 2WI4A 1QZRA 4GT8A 2A2CA 2VCJA 3DGEA 4LWEA 3EKOA 2ESAA 2X36A 1HNXI 4O0BA 4HY1A 1TH8A 4HACB 3V2UC 2FXSA 2Q8IA 3T2SA 4E01A 4FPPA 3TZ0A 3ZZUA 4DR6I 3R4PA 5BODA 1S16A 4GGLA 2WI3A 4XKOA 3D2RA 1TC6A 5M4PA 2NPFA 1XNRE 2XX5A 4LF4E 3G75A 4E00A 1XMQE 5IWAI 1ZM2A 4HACA 3V5RA 2FWYA 3B28A 2R3VA 2R42A 1FWLA 1HNWE 4JI5E 5CTUA 4L93A 4DR4E 4CWRA 4X65I 3OWBA 5FWKA 4GKJE 2O1WA 2IWUA 2DEJA 3QT6A 4CWFA 4EGKA 3A0ZA 4MPEA 4JI1E 4O05A 1ID0A 2HKEA 1H7SA 2E5LI 1L0OA 2VQFI 1AM1A 5LMUI 2GS8A 4DV0I 4YY3E 4YKTA 1Z0EA 3J80C 1YS3A 4B3MI 1ELOA 3WU5A 5F5RA 2YGEA 2HG1A 5J71A 1IBKE 1N33E 1U2RA 2WI5A 3GONA 4O09A 2UUBE 2Q8GA 3D0BA 2PNRA 3TZ2A 3G7EA 2HFSA 3RKZA 4IZJA 4KTNA 3B24A 3JAMQ 4X62I 4PL9A 1PVGA 1I5CA 3ZZTA 3CGYA 3A0TA 3GIFA 4B3RE 4JV5I 4NH8A 3OPDA 2BM1A 1PIEA 3J7AG 1YESA 1D6TA 2XDKA 4YKYA 3ZKDA 3H80A 4RPFA 4DV7I 1KVKA 4JI6I 4CWOA 4LP0A 1US7A 4FMTA 3WQ9A 2CCSA 2HHHE 4U93A 4BIZA 5L3JA 4KP4A 1A6FA 4DR1I 2YKIA 4XCJA 3OTOI 4AWOA 4WUCA 2HFUA 1N34I 3LPSA 2UXBE 4Z7YA 4NXMI 5CTXA 5BOCA 4DV5I 1I94E 4YKXA 4EFUA 4DR6E 3R92A 5IN9A 1NHIA 2V2VA 1YC4A 5M4MA 4M1KA 4DV6I 4XC0A 4ZKIA 4CE2A 2XCMA 1XMQI 4YKQA 5LMNI 4GKKE 4LF5I 1HNWI 3EHGA 2CG9A 2UUAE 4LF9I 2V2ZA 3WHAA 4EGHA 3T0ZA 4JI8E 2BRCA 4XE2A 3O2FA 3B78A 1UY7A 4DXLA 1UYCA 1Y4SA 1Z5AA 3RLPA 5M4EA 3A0WA 1XNQE 4I3HA 2X7IA 4K4OA 1JM6A 2ZBKB 2VCIA 4DUZI 4IZKA 2OI2A 2E5LE 4AQYI 4XIPA 2YJWA 4DZYA 1FNMA 4K0KI 3EKRA 2YE6A 3Q5LA 1Y4UA 3D4JA 1Y8PA 4JI0E 1K47A 3VADA 4DR2I 3SL2A 1XMOI 5GMEA 2ZDXA 4DR5E 1PKPA 1I5AA 2YKCA 4P8OA 4JASA 2HK3A 4QPKA 4DUHA 3T10A 3T1HI 5IDJA 2CZ9A 1HNXE 4GEEA 4V25A 1Z0GA 4Z7CA 4DUYE 3VHDA 4MP2A 2VQEE 1UY9A 1N0UA 2XJGA 5M4NA 2BM0A 3J81Q 1ZXNA 1USVA 4O04A 4CWSA 1OSFA 2O1VA 4LF4I 1YC3A 2YEBA 3R4MA 4DV2E 4H7QA 4DV1E 5IT9C 4KHPE 2V34A 4B7PA 4DV7E 1YC1A 4LFBE 4GKJI 2UU9E 4JYAE 3B82A 4OX9I 1B3QA 1NZ0A 4DV4I 4JI1I 4JI2I 4DR7E 2HHHI 1ZM3A 2BYIA 3INXA 3U67A 1UYHA 3Q5KA 4FWDA 2HCHA 2YGAA 1AJ6A 3HYZA 2XABA 3BM9A 3OTOE 4LF8I 2QG2A 3HZ1A 4LWGA 4MOTA 4YHHE 1N33I 4B3SI 4JI4E 3D36A 3B27A 3EHFA 3C11A 4XIRA 2PNMA 4JI7E 2WI2A 4LWFA 4WUDA 2XJXA 2YE4A 2YEAA 4DV5E 4KFGA 2XK2A 3QT5A 3LNUA 1R62A 2V8PA 4EEHA 2UXCI 1I59A 2YEHA 2O1UA 2FWZA 2V2QA 4QPJA 2ZM6E 4KQVA 2WI7A 5CTYA 1N32I 4HYPA 4LWHA 1KTVA 1I5BA 1HR0E 5BR8E 1UY8A 2YEGA 2YEIA 2BREA 4UT4A 4JI5I 4FW9A 4X66E 4XD8A 3K60A 2WI1A 4DR4I 3O0IA 4DPTA 4USKA 2XX2A 4GFNA 1HNZI 2F4VE 2WI6A 2YECA 2GQ0A 1BGQA 3OWDA 2BU7A 3T1YE 3PRYA 3HHUA 1QYEA 2JKIA 3CRKA 2YE9A 4U7OA 1GJVA 1MX0A 3R4OA 4W7TA 3TZ5A 5LMUE 3PYGA 1TIDA 2WEPA 3MNRP 4XKAA 3HEKA 4NH7A 1FJGE 2YKBA 4E02A 1B63A 3T1HE 4NXNI 2QF6A 4DPYA 2WERA 1BYQA 1RREA 2UUBI 1AH6A 2XX4A 4B3TI 2XHTA 3B8HA 2YE7A 4H85A 5CTWA 1YT0A 2CGFA 4I5SA 4FCRA 3R91A 5IDMA 2UXDE 4JV5E 4DR3E 4LFAI 2UUAI 4LF9E 2EXLA 1ZXMA 1FWKA 1N0VC 1UYLA 2YI6A 4ASFA 2YK2A 2LJPA 3HJCA 2CCUA 4XKKA 5FLXQ 4URLA 1BKNA 4BQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 E;  3JZ3 A;  4DV4 E;  4JI2 E;  2YKE A;  3F0N A;  4U7N A;  3QT7 A;  2BU5 A;  1J5E I;  1OJ4 A;  3HUL A;  4P7A A;  3CGZ A;  4K0K E;  1KIJ A;  2YKJ A;  4BXI A;  4LFC I;  1GKX A;  2QFO A;  1XMO E;  2J7K A;  2YE2 A;  4CE1 A;  1EI1 A;  4HYM A;  3RLQ A;  1N36 E;  4LF6 I;  2WW4 A;  3K1J A;  1YSR A;  1MU5 A;  2XD6 A;  3GIG B;  3GIE A;  4DPU A;  1I58 A;  4JI3 E;  4PRX A;  2QG0 A;  1ZM4 A;  2XHR A;  2BSM A;  3K97 A;  5FNF A;  4HZ0 A;  4EMV A;  4URN A;  1KKH A;  4FCP A;  4ZVI A;  4DUY I;  2VQE I;  4L91 A;  3CWV A;  2E0A A;  2ZIT A;  4DV6 E;  2IOR A;  5M4H A;  1NHH A;  1YT2 A;  1N32 E;  5CPH A;  2XJJ A;  2C2A A;  5BR8 I;  1U0Z A;  1UYE A;  5GMD A;  2YE5 A;  4LF5 E;  3R4N A;  2Q8H A;  4R3M A;  3T1K A;  3ZXO A;  2BTZ A;  1H72 C;  3A0X A;  5D6Q A;  1UYM A;  2YE8 A;  2VWC A;  4XIT A;  1BXD A;  4HZ5 A;  1Z0T A;  2GQP A;  1ZM9 A;  4AWP A;  5IT9 Q;  2E1R A;  2JJC A;  2VF3 A;  4CWQ A;  4ASG A;  1YSZ A;  1THN A;  2BYH A;  2YI0 A;  3K17 A;  3PYD A;  4JI0 I;  4X64 I;  4URM A;  4EMD A;  3PEJ A;  1Z0V A;  1AMW A;  4NXN E;  3A0Y A;  2YEE A;  1S14 A;  2IWX A;  1FI4 A;  3U2D A;  3G7B A;  4DPX A;  5F3K A;  2YEF A;  1NHJ A;  2YK9 A;  5D7C A;  2YEJ A;  3PYF A;  1N34 E;  4MP7 A;  4FN5 A;  4R1F A;  3HZ5 A;  4NXM E;  2UXD I;  4BQJ A;  4YKZ A;  3Q1Q A;  2BZ5 A;  5J6A A;  4XTJ A;  5D7R A;  2DEI A;  3IED A;  5LMN E;  1TIL A;  4DPW A;  4DU7 A;  4DV1 I;  1ZWH A;  2YE3 A;  3O6O A;  4R3A A;  2BU8 A;  4X66 I;  1KZN A;  4B6C A;  4AS9 A;  1IBM I;  4JYA I;  5IWA E;  4JAU A;  3U2K A;  4URO A;  3T0H A;  3T1Y I;  1XNQ I;  2IOQ A;  4MPN A;  2FYP A;  4LF7 E;  1WUU A;  4FCQ A;  1YT1 A;  2UUC E;  3OW6 A;  4AWQ A;  5A2Q Q;  2YI7 A;  4EGI A;  4DV3 I;  2CCT A;  2XEX A;  1Z5C A;  5M4K A;  4GQT A;  3K98 A;  1TBW A;  2Q2E B;  4DV0 E;  2K5B A;  4HXZ A;  1IBL I;  3WU6 A;  1TC0 A;  4B3T E;  2BT0 A;  4CE3 A;  3B25 A;  1H7U A;  3Q5J A;  4BAE A;  2UXB I;  2YED A;  3RLR A;  4DU8 A;  2BU6 A;  3M6A A;  2UXC E;  2VW5 A;  5GGZ A;  4HY6 A;  3PYE A;  4KSG A;  4YKR A;  3A0R A;  1Z5B A;  2A2D A;  1U2O A;  4LFA E;  4YKU A;  3FT8 A;  2BU2 A;  1UYG A;  4DV2 I;  4EFT A;  1DAR A;  4GKK I;  4B3R I;  1YET A;  3J7A M;  4USM A;  1XNR I;  4LFB I;  1Z0W A;  2XDS A;  5A2Q C;  1J5E E;  2CH4 A;  3GIG A;  2YI5 A;  3VHA A;  4JI6 E;  4XDM A;  4EM7 A;  4LFC E;  4DR7 I;  4MYU A;  1A4H A;  4JQL A;  1UYD A;  3WU4 A;  4LF6 E;  2GFD A;  4KSH A;  3TUH A;  5CF0 A;  1H74 A;  1FJG I;  4PRV A;  4JI3 I;  3WU3 A;  4DR2 E;  1I5D A;  4XIQ A;  4MPC A;  4WUB A;  4YY3 I;  4JI7 I;  2HK2 A;  1UEK A;  4XCL A;  1Z0B A;  2XDX A;  1IBK I;  4L94 A;  3TTZ A;  4NH9 A;  5LL6 R;  1Y8O A;  1UYI A;  4FWG A;  1UYF A;  3NMQ A;  1HR0 I;  3FT5 A;  4BIU A;  1Z59 A;  2XDU A;  2BV3 A;  1AH8 A;  4MYT A;  2HKJ A;  4ED4 A;  3QT8 A;  4JG4 A;  4ASB A;  2H8M A;  2UU9 I;  5FLX C;  4MB9 A;  3ZZ0 A;  1HNZ E;  2UUC I;  2F4V I;  4LPB A;  3PEH A;  1UYK A;  4Q20 A;  4LWI A;  4DV3 E;  4GCZ A;  4JAV A;  3OMU A;  4L90 A;  4DUZ E;  4AQY E;  4ASA A;  4H81 A;  3HYY A;  1B62 A;  1EA6 A;  1IBL E;  1RR9 A;  4YHH I;  3J80 Q;  2IOP A;  2YJX A;  1XHK A;  2VQF E;  3BMY A;  4B3S E;  4JI4 I;  1UY6 A;  2AKP A;  3C0E A;  3FV5 A;  3B26 A;  3ZXQ A;  2EFG A;  4B3M E;  2UWD A;  4UTG A;  4CWT A;  1GKZ A;  1Y8N A;  2IWS A;  1MG7 A;  4MBC A;  3H4L A;  4YKW A;  1I94 I;  2ZM6 I;  2YGF A;  3CRL A;  4DR3 I;  2XDL A;  1YER A;  5D6P A;  3LTO A;  4CWP A;  5FND A;  4X62 E;  1IBM E;  2H55 A;  4HXW A;  3QDD A;  1S4E A;  3JAM C;  4KHP I;  1FKA E;  3VHC A;  4P52 A;  1H73 A;  2WEQ A;  3KE6 A;  4JI8 I;  4X9L A;  4LF7 I;  3J81 C;  1QY8 A;  2ZDY A;  4OX9 E;  4L8Z A;  4PU9 A;  4FWH A;  1Z0C A;  3TZ4 A;  4CWN A;  3ZKB A;  4X64 E;  2XHX A;  4O07 A;  1ZW9 A;  1N36 I;  2ZKJ A;  3EHH A;  5FNC A;  4LF8 E;  2Q8F A;  3K99 A;  4DR1 E;  2AJ4 A;  3INW A;  4DR5 I;  3QTF A;  4V26 A;  3EHJ A;  5C93 A;  3ZM7 A;  1VIS A;  2WI4 A;  1QZR A;  4GT8 A;  2A2C A;  2VCJ A;  3DGE A;  4LWE A;  3EKO A;  2ESA A;  2X36 A;  1HNX I;  4O0B A;  4HY1 A;  1TH8 A;  4HAC B;  3V2U C;  2FXS A;  2Q8I A;  3T2S A;  4E01 A;  4FPP A;  3TZ0 A;  3ZZU A;  4DR6 I;  3R4P A;  5BOD A;  1S16 A;  4GGL A;  2WI3 A;  4XKO A;  3D2R A;  1TC6 A;  5M4P A;  2NPF A;  1XNR E;  2XX5 A;  4LF4 E;  3G75 A;  4E00 A;  1XMQ E;  5IWA I;  1ZM2 A;  4HAC A;  3V5R A;  2FWY A;  3B28 A;  2R3V A;  2R42 A;  1FWL A;  1HNW E;  4JI5 E;  5CTU A;  4L93 A;  4DR4 E;  4CWR A;  4X65 I;  3OWB A;  4GKJ E;  5FWK A;  2O1W A;  2IWU A;  2DEJ A;  3QT6 A;  4CWF A;  4EGK A;  3A0Z A;  4MPE A;  4JI1 E;  4O05 A;  1ID0 A;  2HKE A;  1H7S A;  2E5L I;  1L0O A;  2VQF I;  1AM1 A;  5LMU I;  2GS8 A;  4DV0 I;  4YY3 E;  4YKT A;  1Z0E A;  3J80 C;  1YS3 A;  4B3M I;  1ELO A;  3WU5 A;  5F5R A;  2YGE A;  2HG1 A;  5J71 A;  1IBK E;  1N33 E;  1U2R A;  2WI5 A;  3GON A;  4O09 A;  2UUB E;  2Q8G A;  3D0B A;  2PNR A;  3TZ2 A;  3G7E A;  2HFS A;  3RKZ A;  4KTN A;  3B24 A;  3JAM Q;  4X62 I;  4PL9 A;  1PVG A;  1I5C A;  3ZZT A;  3CGY A;  3A0T A;  3GIF A;  4B3R E;  4JV5 I;  4NH8 A;  3OPD A;  2BM1 A;  1PIE A;  3J7A G;  1YES A;  1D6T A;  2XDK A;  4YKY A;  3ZKD A;  3H80 A;  4RPF A;  4DV7 I;  1KVK A;  4JI6 I;  4CWO A;  4LP0 A;  1US7 A;  4FMT A;  3WQ9 A;  2CCS A;  2HHH E;  4U93 A;  4BIZ A;  5L3J A;  4KP4 A;  1A6F A;  4DR1 I;  2YKI A;  4XCJ A;  3OTO I;  4AWO A;  4WUC A;  2HFU A;  1N34 I;  3LPS A;  2UXB E;  4Z7Y A;  4NXM I;  5CTX A;  5BOC A;  4DV5 I;  1I94 E;  4YKX A;  4EFU A;  4DR6 E;  3R92 A;  5IN9 A;  1NHI A;  2V2V A;  1YC4 A;  5M4M A;  4M1K A;  4DV6 I;  4XC0 A;  4ZKI A;  4CE2 A;  2XCM A;  1XMQ I;  4YKQ A;  5LMN I;  4GKK E;  4LF5 I;  1HNW I;  3EHG A;  2CG9 A;  2UUA E;  4LF9 I;  2V2Z A;  3WHA A;  4EGH A;  3T0Z A;  4JI8 E;  2BRC A;  4XE2 A;  3O2F A;  3B78 A;  1UY7 A;  4DXL A;  1UYC A;  1Y4S A;  1Z5A A;  3RLP A;  5M4E A;  3A0W A;  1XNQ E;  4I3H A;  2X7I A;  4K4O A;  1JM6 A;  2ZBK B;  2VCI A;  4DUZ I;  2OI2 A;  2E5L E;  4AQY I;  4XIP A;  2YJW A;  4DZY A;  1FNM A;  4K0K I;  3EKR A;  2YE6 A;  3Q5L A;  1Y4U A;  3D4J A;  1Y8P A;  4JI0 E;  1K47 A;  3VAD A;  4DR2 I;  3SL2 A;  1XMO I;  5GME A;  2ZDX A;  4DR5 E;  1PKP A;  1I5A A;  2YKC A;  4P8O A;  4JAS A;  2HK3 A;  4QPK A;  4DUH A;  3T10 A;  3T1H I;  5IDJ A;  2CZ9 A;  1HNX E;  4GEE A;  4V25 A;  1Z0G A;  4Z7C A;  4DUY E;  3VHD A;  4MP2 A;  2VQE E;  1UY9 A;  1N0U A;  2XJG A;  5M4N A;  2BM0 A;  3J81 Q;  1ZXN A;  4O04 A;  4CWS A;  1OSF A;  4LF4 I;  2O1V A;  1YC3 A;  2YEB A;  3R4M A;  4DV2 E;  4H7Q A;  4DV1 E;  5IT9 C;  4KHP E;  2V34 A;  4B7P A;  4DV7 E;  1YC1 A;  4LFB E;  4GKJ I;  2UU9 E;  4JYA E;  3B82 A;  4OX9 I;  1B3Q A;  1NZ0 A;  4DV4 I;  4JI1 I;  4JI2 I;  4DR7 E;  2HHH I;  1ZM3 A;  2BYI A;  3INX A;  3U67 A;  1UYH A;  3Q5K A;  4FWD A;  2HCH A;  2YGA A;  1AJ6 A;  3HYZ A;  2XAB A;  3BM9 A;  3OTO E;  4LF8 I;  2QG2 A;  3HZ1 A;  4LWG A;  4MOT A;  4YHH E;  1N33 I;  4B3S I;  4JI4 E;  3D36 A;  3B27 A;  3EHF A;  3C11 A;  4XIR A;  4JI7 E;  2WI2 A;  5D7D A;  4LWF A;  4WUD A;  2XJX A;  2YE4 A;  2YEA A;  4DV5 E;  4KFG A;  2XK2 A;  3QT5 A;  3LNU A;  1R62 A;  2V8P A;  4EEH A;  2UXC I;  1I59 A;  2YEH A;  2O1U A;  2FWZ A;  2V2Q A;  4QPJ A;  2ZM6 E;  4KQV A;  2WI7 A;  5CTY A;  1N32 I;  4HYP A;  4LWH A;  1KTV A;  1I5B A;  1HR0 E;  5BR8 E;  1UY8 A;  2YEG A;  2YEI A;  2BRE A;  4UT4 A;  4JI5 I;  4FW9 A;  4X66 E;  4XD8 A;  3K60 A;  2WI1 A;  4DR4 I;  3O0I A;  4DPT A;  4USK A;  2XX2 A;  4GFN A;  1HNZ I;  2F4V E;  2WI6 A;  2YEC A;  1BGQ A;  3OWD A;  2BU7 A;  3T1Y E;  3HHU A;  1QYE A;  2JKI A;  3CRK A;  2YE9 A;  4U7O A;  1GJV A;  1MX0 A;  3R4O A;  4W7T A;  3TZ5 A;  5LMU E;  3PYG A;  1TID A;  2WEP A;  3MNR P;  4XKA A;  3HEK A;  4NH7 A;  1FJG E;  2YKB A;  4E02 A;  1B63 A;  3T1H E;  4NXN I;  2QF6 A;  4DPY A;  2WER A;  1BYQ A;  1RRE A;  2UUB I;  1AH6 A;  2XX4 A;  4B3T I;  2XHT A;  3B8H A;  2YE7 A;  4H85 A;  5CTW A;  1YT0 A;  2CGF A;  4I5S A;  4FCR A;  3R91 A;  5IDM A;  2UXD E;  4JV5 E;  4DR3 E;  4LFA I;  2UUA I;  4LF9 E;  2EXL A;  1ZXM A;  1FWK A;  1N0V C;  1UYL A;  2YI6 A;  4ASF A;  2YK2 A;  2LJP A;  2CCU A;  4XKK A;  5FLX Q;  4URL A;  1BKN A;  4BQG A; 
#chains in the Genus database with same CATH topology
 4X65 E;  3JZ3 A;  4DV4 E;  4JI2 E;  2YKE A;  3F0N A;  4U7N A;  3QT7 A;  2BU5 A;  4IFD A;  1J5E I;  1OJ4 A;  3HUL A;  4P7A A;  3CGZ A;  4K0K E;  4OZE A;  1KIJ A;  3P3E A;  2YKJ A;  4BXI A;  3P3C A;  4LFC I;  1GKX A;  2QFO A;  5JEA E;  4N3O A;  1XMO E;  2J7K A;  2YE2 A;  4CE1 A;  1EI1 A;  4HYM A;  3RLQ A;  1N36 E;  1VI7 A;  4LF6 I;  2WW4 A;  3K1J A;  1YSR A;  1MU5 A;  2XD6 A;  3GIG B;  3GIE A;  4BA2 A;  4MU0 A;  4DPU A;  1I58 A;  4JI3 E;  4PRX A;  2QG0 A;  1ZM4 A;  2XHR A;  2BSM A;  3K97 A;  5FNF A;  4HZ0 A;  4EMV A;  4URN A;  1KKH A;  4FCP A;  4MDT A;  4ZVI A;  4FW6 A;  4DUY I;  2VQE I;  2PO0 B;  3L7Z A;  5D7D A;  4L91 A;  3CWV A;  2E0A A;  2ZIT A;  4DV6 E;  5K36 F;  2IOR A;  1NHH A;  1YT2 A;  1N32 E;  5CPH A;  2XJJ A;  4IZK B;  1USU A;  2C2A A;  3LMM A;  5BR8 I;  1U0Z A;  1UYE A;  2C39 B;  5GMD A;  2YE5 A;  2Z5C A;  4LF5 E;  3R4N A;  2Q8H A;  4R3M A;  3T1K A;  3ZXO A;  2BTZ A;  1H72 C;  4FW7 A;  3A0X A;  5D6Q A;  1UYM A;  2YE8 A;  2VWC A;  4XIT A;  1BXD A;  4HZ5 A;  1Z0T A;  2GQP A;  1ZM9 A;  4AWP A;  5IT9 Q;  2C1G A;  2E1R A;  2JJC A;  2VF3 A;  3Q6M A;  4CWQ A;  4ASG A;  1YSZ A;  1THN A;  3P3G A;  2BYH A;  2YI0 A;  3K17 A;  3PYD A;  4JI0 I;  4X64 I;  4URM A;  4EMD A;  3PEJ A;  1Z0V A;  1AMW A;  4NXN E;  2JEB B;  3A0Y A;  2YEE A;  1S14 A;  3H1C A;  2IWX A;  1FI4 A;  2Z5B A;  3U2D A;  3G7B A;  4DPX A;  5F3K A;  2YEF A;  1NHJ A;  2YK9 A;  5D7C A;  2YEJ A;  3PYF A;  2AE8 A;  1N34 E;  4MP7 A;  4FN5 A;  4R1F A;  3P06 A;  3HZ5 A;  4OO1 E;  4ISA A;  4NXM E;  2UXD I;  4BQJ A;  4YKZ A;  3Q1Q A;  5K36 E;  4IS9 A;  2BZ5 A;  5ELW A;  4XTJ A;  5D7R A;  1Y6Z A;  5J6A A;  2DEI A;  3IED A;  5LMN E;  1TIL A;  4DPW A;  4DU7 A;  4DV1 I;  1ZWH A;  2YE3 A;  3O6O A;  4R3A A;  2BU8 A;  4X66 I;  2PNZ B;  1KZN A;  4B6C A;  4AS9 A;  1IBM I;  4IFD C;  4JYA I;  5IWA E;  4JAU A;  3U2K A;  4URO A;  3T0H A;  2IOQ A;  3T1Y I;  1XNQ I;  4MPN A;  2FYP A;  4LF7 E;  1WUU A;  4FCQ A;  1YT1 A;  2UUC E;  3OW6 A;  2F1D A;  4AWQ A;  1HK7 A;  3CDJ A;  5A2Q Q;  2YI7 A;  4EGI A;  2BR2 B;  4DV3 I;  2CCT A;  2XEX A;  1Z5C A;  5M4K A;  4GQT A;  3K98 A;  3Q6N A;  1UDQ A;  2Q2E B;  4DV0 E;  1TBW A;  2K5B A;  1Y60 A;  4HXZ A;  1IBL I;  1E3H A;  1UDN A;  3WU6 A;  1TC0 A;  4B3T E;  2BT0 A;  4CE3 A;  3B25 A;  4IZJ D;  1H7U A;  3Q5J A;  4BAE A;  2UXB I;  2YED A;  3RLR A;  2Z5C B;  4DU8 A;  2BU6 A;  3M6A A;  2UXC E;  2VW5 A;  3U1Y A;  5GGZ A;  4HY6 A;  3PYE A;  4KSG A;  4U3D A;  4YKR A;  5JEA F;  3A0R A;  1Z5B A;  2A2D A;  1U2O A;  4LFA E;  4YKU A;  3FT8 A;  2BU2 A;  2CGE A;  1UYG A;  4DV2 I;  4EFT A;  1DAR A;  4GKK I;  4B3R I;  5M4P A;  1YET A;  3J7A M;  4AM3 A;  2PNL A;  4USM A;  1XNR I;  4LFB I;  1Z0W A;  2XDS A;  5A2Q C;  2Z5B B;  2J65 A;  1J5E E;  2CH4 A;  3GIG A;  2YI5 A;  3VHA A;  4JI6 E;  4XDM A;  4EM7 A;  3K85 A;  4LFC E;  4DR7 I;  4MYU A;  1A4H A;  2C37 A;  4JQL A;  1UYD A;  2O1T A;  3WU4 A;  4LF6 E;  2GFD A;  4KSH A;  3TUH A;  5CF0 A;  1H74 A;  1FJG I;  4PRV A;  4JI3 I;  3WU3 A;  4DR2 E;  1I5D A;  4XIQ A;  4MPC A;  2PO1 A;  4WUB A;  1YH8 A;  4YY3 I;  4JI7 I;  3PS2 A;  2HK2 A;  1UEK A;  4XCL A;  5M4H A;  1XXE A;  1Z0B A;  2JEB A;  1IBK I;  2XDX A;  4L94 A;  3TTZ A;  2JEA A;  4NH9 A;  3M7N D;  5LL6 R;  4E72 A;  5JEA B;  2NN6 E;  1Y8O A;  1UYI A;  4J3D A;  4FWG A;  4LCG A;  1UYF A;  3NMQ A;  1HR0 I;  3FT5 A;  4BIU A;  1Z59 A;  4FW3 A;  2XDU A;  2BV3 A;  2GO3 A;  1AH8 A;  4MYT A;  2HKJ A;  4ED4 A;  2IES A;  3QT8 A;  4JG4 A;  4ASB A;  2H8M A;  2UU9 I;  5FLX C;  4MB9 A;  3ZZ0 A;  1HNZ E;  2UUC I;  2F4V I;  1R6L A;  4LPB A;  3PEH A;  1UYK A;  3M7N G;  4Q20 A;  3GLL A;  4LWI A;  4DV3 E;  4GCZ A;  2WNR A;  4JAV A;  3OMU A;  4L90 A;  4DUZ E;  4AQY E;  3CYG A;  4ASA A;  4H81 A;  2PO0 A;  3HYY A;  1B62 A;  1EA6 A;  1IBL E;  5JEN A;  4LCF A;  2WP8 B;  1RR9 A;  4YHH I;  3J80 Q;  2IOP A;  4AID A;  1XHK A;  2VQF E;  2YJX A;  4B3S E;  4JI4 I;  1UY6 A;  2AKP A;  3BMY A;  3C0E A;  3B26 A;  3FV5 A;  3ZXQ A;  2EFG A;  4B3M E;  2UWD A;  4UTG A;  4CWT A;  1GKZ A;  1Y8N A;  2IWS A;  5EL9 A;  1MG7 A;  2CVE A;  5DNL A;  4MBC A;  3H4L A;  4YKW A;  1I94 I;  2ZM6 I;  2YGF A;  3CRL A;  2C38 A;  4IZJ B;  4DR3 I;  2XDL A;  1YER A;  5D6P A;  3LTO A;  4CWP A;  5FND A;  4X62 E;  2JE6 A;  1IBM E;  2H55 A;  4HXW A;  3QDD A;  1S4E A;  2Z5E A;  3JAM C;  4KHP I;  1FKA E;  3VHC A;  4P52 A;  1H73 A;  4OO1 C;  2WEQ A;  3KE6 A;  4JI8 I;  4X9L A;  4LF7 I;  3J81 C;  1QY8 A;  2JEA B;  2ZDY A;  4OX9 E;  4L8Z A;  4PU9 A;  2C39 A;  4FWH A;  1Z0C A;  2BA0 G;  3NZK A;  3TZ4 A;  4CWN A;  3ZKB A;  4X64 E;  2XHX A;  4O07 A;  1ZW9 A;  1UDS A;  4LCH A;  4U3B A;  1N36 I;  2ZKJ A;  1OYS A;  3U1K A;  4IFD E;  2BR2 A;  4MU3 A;  3EHH A;  5FNC A;  4LF8 E;  2Q8F A;  3K99 A;  4DR1 E;  2AJ4 A;  3INW A;  4DR5 I;  3QTF A;  1RHY A;  3EHJ A;  4V26 A;  5C93 A;  4IFD D;  3ZM7 A;  2JE6 B;  1VIS A;  2WI4 A;  1QZR A;  4GT8 A;  2A2C A;  2VCJ A;  3DGE A;  5C0X C;  3EKO A;  4LWE A;  2ESA A;  2X36 A;  1HNX I;  4O0B A;  4HY1 A;  1TH8 A;  4HAC B;  3V2U C;  2FXS A;  2Q8I A;  3T2S A;  4E01 A;  4FPP A;  3GCM A;  3TZ0 A;  3ZZU A;  4DR6 I;  3R4P A;  5BOD A;  1S16 A;  3HKM A;  4GGL A;  2WI3 A;  4XKO A;  3D2R A;  5C0X A;  4OO1 D;  2NPF A;  1XNR E;  1TC6 A;  4LF4 E;  2XX5 A;  3G75 A;  4E00 A;  1XMQ E;  5IWA I;  1ZM2 A;  4HAC A;  3V5R A;  2FWY A;  3B28 A;  2R3V A;  2R42 A;  1FWL A;  1P42 A;  1HNW E;  5DRR A;  4JI5 E;  4BA1 A;  5CTU A;  4L93 A;  4DR4 E;  4CWR A;  2HHI A;  4X65 I;  3OWB A;  5FWK A;  4GKJ E;  2O1W A;  5C0X D;  4OO1 F;  2IWU A;  2DEJ A;  3QT6 A;  5JEA C;  4CWF A;  4EGK A;  3A0Z A;  4MPE A;  4JI1 E;  4O05 A;  1ID0 A;  2HKE A;  1H7S A;  4QNK A;  2E5L I;  1L0O A;  2VQF I;  1AM1 A;  5LMU I;  2GS8 A;  4DV0 I;  5DRP A;  4YY3 E;  4YKT A;  3S5T A;  1Z0E A;  4AIM A;  3J80 C;  1YS3 A;  4B3M I;  1ELO A;  3WU5 A;  5F5R A;  2YGE A;  2HG1 A;  2VES A;  5J71 A;  1IBK E;  1N33 E;  1U2R A;  2WI5 A;  3GON A;  4O09 A;  4GQU A;  2UUB E;  2Q8G A;  3D0B A;  2PNR A;  3TZ2 A;  3G7E A;  2HFS A;  3RKZ A;  4IZJ A;  4BA1 B;  4KTN A;  3B24 A;  3JAM Q;  4X62 I;  2C37 B;  4PL9 A;  1PVG A;  1I5C A;  3ZZT A;  3CGY A;  3A0T A;  3GIF A;  4B3R E;  2BA0 D;  4JV5 I;  4NH8 A;  3OPD A;  2BM1 A;  1PIE A;  3J7A G;  1YES A;  1D6T A;  2XDK A;  1Y5Y A;  4YKY A;  3ZKD A;  2PO1 B;  3H80 A;  2IER A;  4RPF A;  4DV7 I;  3UHM A;  1KVK A;  4JI6 I;  4CWO A;  4LP0 A;  2NN6 B;  5DRO A;  1IXM A;  1US7 A;  4FMT A;  3WQ9 A;  2CCS A;  4BA2 B;  2HHH E;  5C0X B;  4U93 A;  4BIZ A;  2PO2 A;  5L3J A;  4KP4 A;  1A6F A;  4DR1 I;  2YKI A;  4XCJ A;  5EKW A;  3OTO I;  4AWO A;  4WUC A;  2HFU A;  1N34 I;  3LPS A;  2UXB E;  2O3Z A;  4Z7Y A;  4NXM I;  5CTX A;  5K36 C;  2BA1 G;  5BOC A;  4DV5 I;  1I94 E;  4YKX A;  4EFU A;  4DR6 E;  3R92 A;  5IN9 A;  1NHI A;  2V2V A;  1YC4 A;  5M4M A;  4M1K A;  4DV6 I;  4XC0 A;  4ZKI A;  4CE2 A;  4FW4 A;  2XCM A;  2JT2 A;  1XMQ I;  4YKQ A;  5LMN I;  4GKK E;  4LF5 I;  1HNW I;  5K36 A;  3EHG A;  2CG9 A;  2UUA E;  4LF9 I;  2V2Z A;  2C38 B;  3WHA A;  4EGH A;  3T0Z A;  4JI8 E;  2BRC A;  4XE2 A;  5JEA D;  5JEA A;  3O2F A;  3B78 A;  1UY7 A;  4DXL A;  1UYC A;  1Y4S A;  1Z5A A;  3RLP A;  3DD6 A;  5M4E A;  3A0W A;  1XNQ E;  5K36 D;  4I3H A;  2X7I A;  4K4O A;  1JM6 A;  2ZBK B;  4MQY A;  4LPF A;  4MU4 A;  2GO4 A;  4IZK A;  2OI2 A;  4DUZ I;  2VCI A;  2E5L E;  4AQY I;  4XIP A;  2YJW A;  4DZY A;  4QNJ A;  1FNM A;  4K0K I;  3EKR A;  2YE6 A;  3Q5L A;  1Y4U A;  3D4J A;  1Y8P A;  4JI0 E;  1K47 A;  3VAD A;  4DR2 I;  1E3P A;  3SL2 A;  5DRQ A;  5GME A;  1XMO I;  1F51 A;  2ZDX A;  4DR5 E;  1PKP A;  1I5A A;  2YKC A;  4P8O A;  4JAS A;  2HK3 A;  2NN6 F;  4QPK A;  4DUH A;  3T10 A;  3CDI A;  3T1H I;  5IDJ A;  2CZ9 A;  1HNX E;  4GEE A;  4V25 A;  1Z0G A;  4Z7C A;  4DUY E;  3VHD A;  4MP2 A;  2VQE E;  1UY9 A;  1N0U A;  2XJG A;  5M4N A;  2BM0 A;  3J81 Q;  1ZXN A;  1USV A;  2WP8 A;  4O04 A;  4CWS A;  4IFD B;  1OSF A;  2O1V A;  4LF4 I;  3PS1 A;  1YC3 A;  2YEB A;  3R4M A;  4DV2 E;  4H7Q A;  4DV1 E;  5IT9 C;  4KHP E;  2V34 A;  4B7P A;  4DV7 E;  1YHC A;  1YC1 A;  4LFB E;  4GKJ I;  2UU9 E;  4JYA E;  4FW5 A;  3PS3 A;  3B82 A;  4OX9 I;  1B3Q A;  1NZ0 A;  4OO1 B;  3KRN A;  4DV4 I;  4JI1 I;  4JI2 I;  4DR7 E;  2HHH I;  1ZM3 A;  2BYI A;  3INX A;  3U67 A;  1UYH A;  3Q5K A;  4FWD A;  3B4T A;  4NBQ A;  5K36 B;  2HCH A;  2YGA A;  1AJ6 A;  3HYZ A;  2XAB A;  3BM9 A;  3OTO E;  4LF8 I;  2QG2 A;  3HZ1 A;  4LWG A;  4MOT A;  4YHH E;  3GME A;  1N33 I;  4B3S I;  4JI4 E;  3D36 A;  3B27 A;  3EHF A;  3C11 A;  4XIR A;  1UDO A;  2PNM A;  4JI7 E;  2WI2 A;  4LWF A;  4WUD A;  2XJX A;  2YE4 A;  2YEA A;  4DV5 E;  4KFG A;  2XK2 A;  3QT5 A;  2NN6 C;  3LNU A;  1R62 A;  2V8P A;  4EEH A;  2UXC I;  5C0X F;  1I59 A;  2YEH A;  2O1U A;  2FWZ A;  2V2Q A;  2PNZ A;  4QPJ A;  2ZM6 E;  4KQV A;  3L7Z B;  4MU1 A;  2WI7 A;  2NN6 A;  1N32 I;  4HYP A;  1OYP A;  4LWH A;  5CTY A;  1KTV A;  1I5B A;  1HR0 E;  5BR8 E;  1UY8 A;  2YEG A;  2YEI A;  2BRE A;  4UT4 A;  4JI5 I;  4FW9 A;  4X66 E;  4XD8 A;  2FTK A;  3M85 G;  2WI1 A;  4DR4 I;  3K60 A;  3O0I A;  2WNR B;  4DPT A;  4USK A;  2XX2 A;  4GFN A;  1HNZ I;  2F4V E;  2WI6 A;  2YEC A;  2GQ0 A;  1BGQ A;  3OWD A;  4OKG A;  2BU7 A;  3T1Y E;  3PRY A;  3HHU A;  1QYE A;  2JKI A;  3CRK A;  2YE9 A;  4U7O A;  1GJV A;  1MX0 A;  3R4O A;  1R6M A;  4W7T A;  3TZ5 A;  5LMU E;  3PYG A;  1TID A;  2C1I A;  3P76 A;  2WEP A;  3HEK A;  3MNR P;  4XKA A;  4NH7 A;  1FJG E;  2YKB A;  2NN6 D;  4E02 A;  1B63 A;  3T1H E;  4NXN I;  2BA1 D;  2QF6 A;  4DPY A;  2WER A;  1BYQ A;  1RRE A;  2UUB I;  3M85 D;  1AH6 A;  2XX4 A;  4B3T I;  2XHT A;  3B8H A;  1OYR A;  2YE7 A;  4H85 A;  5CTW A;  1YT0 A;  5C0X E;  2CGF A;  4I5S A;  4FCR A;  3R91 A;  5IDM A;  4OO1 A;  2UXD E;  4JV5 E;  4DR3 E;  4LFA I;  2UUA I;  4LF9 E;  4IFD F;  2EXL A;  1ZXM A;  1FWK A;  1N0V C;  1UYL A;  2PO2 B;  2YI6 A;  4ASF A;  2YK2 A;  2LJP A;  3HJC A;  2CCU A;  4XKK A;  4LOM A;  5FLX Q;  4URL A;  1BKN A;  5DNX A;  4BQG A; 
#chains in the Genus database with same CATH homology
 4X65 E;  3JZ3 A;  4DV4 E;  4JI2 E;  2YKE A;  3F0N A;  4U7N A;  3QT7 A;  2BU5 A;  1J5E I;  1OJ4 A;  3HUL A;  4P7A A;  3CGZ A;  4K0K E;  1KIJ A;  2YKJ A;  4BXI A;  4LFC I;  1GKX A;  2QFO A;  4N3O A;  1XMO E;  2J7K A;  2YE2 A;  4CE1 A;  1EI1 A;  4HYM A;  3RLQ A;  1N36 E;  4LF6 I;  2WW4 A;  3K1J A;  1YSR A;  1MU5 A;  2XD6 A;  3GIG B;  3GIE A;  4DPU A;  1I58 A;  4JI3 E;  4PRX A;  2QG0 A;  1ZM4 A;  2XHR A;  2BSM A;  3K97 A;  5FNF A;  4HZ0 A;  4EMV A;  4URN A;  1KKH A;  4FCP A;  4ZVI A;  4DUY I;  2VQE I;  5D7D A;  4L91 A;  3CWV A;  2E0A A;  2ZIT A;  4DV6 E;  2IOR A;  5M4H A;  1NHH A;  1YT2 A;  1N32 E;  5CPH A;  2XJJ A;  4IZK B;  1USU A;  2C2A A;  5BR8 I;  1U0Z A;  1UYE A;  5GMD A;  2YE5 A;  2Z5C A;  4LF5 E;  3R4N A;  2Q8H A;  4R3M A;  3T1K A;  3ZXO A;  2BTZ A;  1H72 C;  3A0X A;  5D6Q A;  1UYM A;  2YE8 A;  2VWC A;  4XIT A;  1BXD A;  4HZ5 A;  1Z0T A;  2GQP A;  1ZM9 A;  4AWP A;  5IT9 Q;  2E1R A;  2JJC A;  2VF3 A;  3Q6M A;  4CWQ A;  4ASG A;  1YSZ A;  1THN A;  2BYH A;  2YI0 A;  3K17 A;  3PYD A;  4JI0 I;  4X64 I;  4URM A;  4EMD A;  3PEJ A;  1Z0V A;  1AMW A;  4NXN E;  3A0Y A;  2YEE A;  1S14 A;  2IWX A;  1FI4 A;  2Z5B A;  3U2D A;  3G7B A;  4DPX A;  5F3K A;  2YEF A;  1NHJ A;  2YK9 A;  5D7C A;  2YEJ A;  3PYF A;  1N34 E;  4MP7 A;  4FN5 A;  4R1F A;  3P06 A;  3HZ5 A;  4NXM E;  2UXD I;  4BQJ A;  4YKZ A;  3Q1Q A;  2BZ5 A;  5J6A A;  4XTJ A;  5D7R A;  1Y6Z A;  2DEI A;  3IED A;  5LMN E;  1TIL A;  4DPW A;  4DU7 A;  4DV1 I;  1ZWH A;  2YE3 A;  3O6O A;  4R3A A;  2BU8 A;  4X66 I;  1KZN A;  4B6C A;  4AS9 A;  1IBM I;  4JYA I;  5IWA E;  4JAU A;  3U2K A;  4URO A;  3T0H A;  2IOQ A;  3T1Y I;  1XNQ I;  4MPN A;  2FYP A;  4LF7 E;  1WUU A;  4FCQ A;  1YT1 A;  2UUC E;  3OW6 A;  4AWQ A;  1HK7 A;  5A2Q Q;  2YI7 A;  4EGI A;  4DV3 I;  2CCT A;  2XEX A;  1Z5C A;  5M4K A;  4GQT A;  3K98 A;  3Q6N A;  1TBW A;  2Q2E B;  4DV0 E;  2K5B A;  4HXZ A;  1IBL I;  3WU6 A;  1TC0 A;  4B3T E;  2BT0 A;  4CE3 A;  3B25 A;  4IZJ D;  1H7U A;  3Q5J A;  4BAE A;  2UXB I;  2YED A;  3RLR A;  2Z5C B;  4DU8 A;  2BU6 A;  3M6A A;  2UXC E;  2VW5 A;  5GGZ A;  4HY6 A;  3PYE A;  4KSG A;  4YKR A;  3A0R A;  1Z5B A;  2A2D A;  1U2O A;  4LFA E;  4YKU A;  3FT8 A;  2BU2 A;  2CGE A;  1UYG A;  4DV2 I;  4EFT A;  1DAR A;  4GKK I;  4B3R I;  1YET A;  3J7A M;  2PNL A;  4USM A;  1XNR I;  4LFB I;  1Z0W A;  2XDS A;  5A2Q C;  2Z5B B;  1J5E E;  2CH4 A;  3GIG A;  2YI5 A;  3VHA A;  4JI6 E;  4XDM A;  4EM7 A;  3K85 A;  4LFC E;  4DR7 I;  4MYU A;  1A4H A;  4JQL A;  1UYD A;  2O1T A;  3WU4 A;  4LF6 E;  2GFD A;  4KSH A;  3TUH A;  5CF0 A;  1H74 A;  1FJG I;  4PRV A;  4JI3 I;  3WU3 A;  4DR2 E;  1I5D A;  4XIQ A;  4MPC A;  4WUB A;  4YY3 I;  4JI7 I;  2HK2 A;  1UEK A;  4XCL A;  1Z0B A;  2XDX A;  1IBK I;  4L94 A;  3TTZ A;  4NH9 A;  5LL6 R;  1Y8O A;  1UYI A;  4FWG A;  1UYF A;  3NMQ A;  1HR0 I;  3FT5 A;  4BIU A;  1Z59 A;  2XDU A;  2BV3 A;  1AH8 A;  4MYT A;  2HKJ A;  4ED4 A;  3QT8 A;  4JG4 A;  4ASB A;  2H8M A;  2UU9 I;  5FLX C;  4MB9 A;  3ZZ0 A;  1HNZ E;  2UUC I;  2F4V I;  4LPB A;  3PEH A;  1UYK A;  4Q20 A;  4LWI A;  4DV3 E;  4GCZ A;  4JAV A;  3OMU A;  4L90 A;  4DUZ E;  4AQY E;  4ASA A;  4H81 A;  3HYY A;  1B62 A;  1EA6 A;  1IBL E;  1RR9 A;  4YHH I;  3J80 Q;  2IOP A;  2YJX A;  1XHK A;  2VQF E;  3BMY A;  4B3S E;  4JI4 I;  1UY6 A;  2AKP A;  3C0E A;  3FV5 A;  3B26 A;  3ZXQ A;  2EFG A;  4B3M E;  2UWD A;  4UTG A;  4CWT A;  1GKZ A;  1Y8N A;  2IWS A;  1MG7 A;  4MBC A;  3H4L A;  4YKW A;  1I94 I;  2ZM6 I;  2YGF A;  3CRL A;  4DR3 I;  4IZJ B;  2XDL A;  1YER A;  5D6P A;  3LTO A;  4CWP A;  5FND A;  4X62 E;  1IBM E;  2H55 A;  4HXW A;  3QDD A;  1S4E A;  2Z5E A;  3JAM C;  4KHP I;  1FKA E;  3VHC A;  4P52 A;  1H73 A;  2WEQ A;  3KE6 A;  4JI8 I;  4X9L A;  4LF7 I;  3J81 C;  1QY8 A;  2ZDY A;  4OX9 E;  4L8Z A;  4PU9 A;  4FWH A;  1Z0C A;  3TZ4 A;  4CWN A;  3ZKB A;  4X64 E;  2XHX A;  4O07 A;  1ZW9 A;  1N36 I;  2ZKJ A;  3EHH A;  5FNC A;  4LF8 E;  2Q8F A;  3K99 A;  4DR1 E;  2AJ4 A;  3INW A;  4DR5 I;  3QTF A;  4V26 A;  3EHJ A;  5C93 A;  3ZM7 A;  1VIS A;  2WI4 A;  1QZR A;  4GT8 A;  2A2C A;  2VCJ A;  3DGE A;  4LWE A;  3EKO A;  2ESA A;  2X36 A;  1HNX I;  4O0B A;  4HY1 A;  1TH8 A;  4HAC B;  3V2U C;  2FXS A;  2Q8I A;  3T2S A;  4E01 A;  4FPP A;  3TZ0 A;  3ZZU A;  4DR6 I;  3R4P A;  5BOD A;  1S16 A;  4GGL A;  2WI3 A;  4XKO A;  3D2R A;  1TC6 A;  5M4P A;  2NPF A;  1XNR E;  2XX5 A;  4LF4 E;  3G75 A;  4E00 A;  1XMQ E;  5IWA I;  1ZM2 A;  4HAC A;  3V5R A;  2FWY A;  3B28 A;  2R3V A;  2R42 A;  1FWL A;  1HNW E;  4JI5 E;  5CTU A;  4L93 A;  4DR4 E;  4CWR A;  4X65 I;  3OWB A;  5FWK A;  4GKJ E;  2O1W A;  2IWU A;  2DEJ A;  3QT6 A;  4CWF A;  4EGK A;  3A0Z A;  4MPE A;  4JI1 E;  4O05 A;  1ID0 A;  2HKE A;  1H7S A;  2E5L I;  1L0O A;  2VQF I;  1AM1 A;  5LMU I;  2GS8 A;  4DV0 I;  4YY3 E;  4YKT A;  1Z0E A;  3J80 C;  1YS3 A;  4B3M I;  1ELO A;  3WU5 A;  5F5R A;  2YGE A;  2HG1 A;  5J71 A;  1IBK E;  1N33 E;  1U2R A;  2WI5 A;  3GON A;  4O09 A;  2UUB E;  2Q8G A;  3D0B A;  2PNR A;  3TZ2 A;  3G7E A;  2HFS A;  3RKZ A;  4IZJ A;  4KTN A;  3B24 A;  3JAM Q;  4X62 I;  4PL9 A;  1PVG A;  1I5C A;  3ZZT A;  3CGY A;  3A0T A;  3GIF A;  4B3R E;  4JV5 I;  4NH8 A;  3OPD A;  2BM1 A;  1PIE A;  3J7A G;  1YES A;  1D6T A;  2XDK A;  4YKY A;  3ZKD A;  3H80 A;  4RPF A;  4DV7 I;  1KVK A;  4JI6 I;  4CWO A;  4LP0 A;  1US7 A;  4FMT A;  3WQ9 A;  2CCS A;  2HHH E;  4U93 A;  4BIZ A;  5L3J A;  4KP4 A;  1A6F A;  4DR1 I;  2YKI A;  4XCJ A;  3OTO I;  4AWO A;  4WUC A;  2HFU A;  1N34 I;  3LPS A;  2UXB E;  4Z7Y A;  4NXM I;  5CTX A;  5BOC A;  4DV5 I;  1I94 E;  4YKX A;  4EFU A;  4DR6 E;  3R92 A;  5IN9 A;  1NHI A;  2V2V A;  1YC4 A;  5M4M A;  4M1K A;  4DV6 I;  4XC0 A;  4ZKI A;  4CE2 A;  2XCM A;  1XMQ I;  4YKQ A;  5LMN I;  4GKK E;  4LF5 I;  1HNW I;  3EHG A;  2CG9 A;  2UUA E;  4LF9 I;  2V2Z A;  3WHA A;  4EGH A;  3T0Z A;  4JI8 E;  2BRC A;  4XE2 A;  3O2F A;  3B78 A;  1UY7 A;  4DXL A;  1UYC A;  1Y4S A;  1Z5A A;  3RLP A;  5M4E A;  3A0W A;  1XNQ E;  4I3H A;  2X7I A;  4K4O A;  1JM6 A;  2ZBK B;  2VCI A;  4DUZ I;  4IZK A;  2OI2 A;  2E5L E;  4AQY I;  4XIP A;  2YJW A;  4DZY A;  1FNM A;  4K0K I;  3EKR A;  2YE6 A;  3Q5L A;  1Y4U A;  3D4J A;  1Y8P A;  4JI0 E;  1K47 A;  3VAD A;  4DR2 I;  3SL2 A;  1XMO I;  5GME A;  2ZDX A;  4DR5 E;  1PKP A;  1I5A A;  2YKC A;  4P8O A;  4JAS A;  2HK3 A;  4QPK A;  4DUH A;  3T10 A;  3T1H I;  5IDJ A;  2CZ9 A;  1HNX E;  4GEE A;  4V25 A;  1Z0G A;  4Z7C A;  4DUY E;  3VHD A;  4MP2 A;  2VQE E;  1UY9 A;  1N0U A;  2XJG A;  5M4N A;  2BM0 A;  3J81 Q;  1ZXN A;  1USV A;  4O04 A;  4CWS A;  1OSF A;  2O1V A;  4LF4 I;  1YC3 A;  2YEB A;  3R4M A;  4DV2 E;  4H7Q A;  4DV1 E;  5IT9 C;  4KHP E;  2V34 A;  4B7P A;  4DV7 E;  1YC1 A;  4LFB E;  4GKJ I;  2UU9 E;  4JYA E;  3B82 A;  4OX9 I;  1B3Q A;  1NZ0 A;  4DV4 I;  4JI1 I;  4JI2 I;  4DR7 E;  2HHH I;  1ZM3 A;  2BYI A;  3INX A;  3U67 A;  1UYH A;  3Q5K A;  4FWD A;  2HCH A;  2YGA A;  1AJ6 A;  3HYZ A;  2XAB A;  3BM9 A;  3OTO E;  4LF8 I;  2QG2 A;  3HZ1 A;  4LWG A;  4MOT A;  4YHH E;  1N33 I;  4B3S I;  4JI4 E;  3D36 A;  3B27 A;  3EHF A;  3C11 A;  4XIR A;  2PNM A;  4JI7 E;  2WI2 A;  4LWF A;  4WUD A;  2XJX A;  2YE4 A;  2YEA A;  4DV5 E;  4KFG A;  2XK2 A;  3QT5 A;  3LNU A;  1R62 A;  2V8P A;  4EEH A;  2UXC I;  1I59 A;  2YEH A;  2O1U A;  2FWZ A;  2V2Q A;  4QPJ A;  2ZM6 E;  4KQV A;  2WI7 A;  5CTY A;  1N32 I;  4HYP A;  4LWH A;  1KTV A;  1I5B A;  1HR0 E;  5BR8 E;  1UY8 A;  2YEG A;  2YEI A;  2BRE A;  4UT4 A;  4JI5 I;  4FW9 A;  4X66 E;  4XD8 A;  3K60 A;  2WI1 A;  4DR4 I;  3O0I A;  4DPT A;  4USK A;  2XX2 A;  4GFN A;  1HNZ I;  2F4V E;  2WI6 A;  2YEC A;  2GQ0 A;  1BGQ A;  3OWD A;  2BU7 A;  3T1Y E;  3PRY A;  3HHU A;  1QYE A;  2JKI A;  3CRK A;  2YE9 A;  4U7O A;  1GJV A;  1MX0 A;  3R4O A;  4W7T A;  3TZ5 A;  5LMU E;  3PYG A;  1TID A;  2WEP A;  3MNR P;  4XKA A;  3HEK A;  4NH7 A;  1FJG E;  2YKB A;  4E02 A;  1B63 A;  3T1H E;  4NXN I;  2QF6 A;  4DPY A;  2WER A;  1BYQ A;  1RRE A;  2UUB I;  1AH6 A;  2XX4 A;  4B3T I;  2XHT A;  3B8H A;  2YE7 A;  4H85 A;  5CTW A;  1YT0 A;  2CGF A;  4I5S A;  4FCR A;  3R91 A;  5IDM A;  2UXD E;  4JV5 E;  4DR3 E;  4LFA I;  2UUA I;  4LF9 E;  2EXL A;  1ZXM A;  1FWK A;  1N0V C;  1UYL A;  2YI6 A;  4ASF A;  2YK2 A;  2LJP A;  3HJC A;  2CCU A;  4XKK A;  5FLX Q;  4URL A;  1BKN A;  4BQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...