3LPUA

Hiv integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
142
Chain Sequence
DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Rational design of small-molecule inhibitors of the LEDGF/p75-integrase interaction and HIV replication.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 47
structure length 142
sequence length 155
ec nomenclature
pdb deposition date 2010-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lpuA00
1A5VA 4FJGA 3HSTB 3VA0A 5HLFA 1UOCA 4CJTA 5CZ2A 3EY1A 2HNZA 1U47A 4B9LA 3AO2A 5KTQA 3M8QA 3K5LA 3MECA 3V81A 1XC9A 1A5WA 1S6PA 3NFAA 1D9FA 4FM0A 4ICLA 3NF6A 1NJZA 3SPYA 3VQPA 5JS2A 4CHQA 4B8CA 1NJWA 1HYVA 2VG5A 2G8HA 4FZXC 3SQ2A 3DRSA 3OYEA 4CJLA 3U6FA 3AVKA 3P83D 5HP1A 2IAJA 4M3WA 1BI4B 3PUFA 2KZZA 1J54A 4KHWA 1U04A 3P1GA 4C8OA 4FLYA 1HQUA 1IO2A 2XY5A 1RT6A 4N41A 4CJFA 4C8NA 1IKWA 1SKRA 1SV5A 3H08A 3QETA 1Q9XA 3EYZA 2FC0A 2IDOA 2KFNA 5KGXA 2JLEA 3LAMA 3O4NA 4RW6A 3SNNA 3IRXA 1L3UA 3SCXA 4FXDA 4M3ZA 1ZYQA 5DMRA 4JRPA 2P1JA 4FCYA 4KAZA 1JLGA 4DTRA 4QAGA 3KTQA 1RBTA 4Z4CA 4O5BA 3QESA 1ASWA 3V1OA 4QOZB 3OS0A 3V9ZA 2HW3A 4KRFA 2XO7A 3NF7A 3THVA 3CM5A 4UQGA 1C0MA 1EX4A 4M3XA 2Z1JA 3VQEA 4M41A 3F73A 1UAXA 1IG9A 1EP4A 3MXMA 3LZIA 1KLNA 4B08A 2G8VA 3BDPA 4FJJA 3L2VA 4NCGA 1JXEA 4CGDA 3CFRA 4EP4A 3OYNA 3DM2A 2I5JA 3G0ZA 3TAQA 3OS1A 4LY7A 4FYDA 2Z1GA 2W42A 3PX6A 3AVLA 4IDKA 1KRPA 4KTQA 1D8YA 1YTUA 3LWMA 4DTPA 2VG6A 3LP1A 4LSNA 5EU7A 3HXMA 3QINA 4B9VA 2G8UA 1D5AA 3MEGA 4OGCA 2HVIA 1SL2A 4DTNA 1NK6A 3V9XA 1VSJA 4CEDA 1NK0A 2G8IA 1A5XA 3AVNA 4B9TA 4W5NA 5FROA 5KRSA 2PZSA 4CJSA 4CJ3A 4O0JA 4BDYA 4E7LA 5HRPA 4YFUA 4IG0A 4FJ9A 2HMIA 2ZE2A 4OKEA 1VSEA 2B5JA 2EHGA 1XWLA 1BISA 2X6SA 1WSEA 3V6DA 2RN2A 3NAEA 1FKOA 3O3GA 5D3GA 4KB0A 4CEFA 4ELUA 4Z4EA 3HYFA 2YHBA 3MAQA 4JS4A 1KVBA 1ASVA 3C95A 3DOLA 5DK5A 3K5OA 5FRMA 4DF8A 3L8BA 5J2PA 2ZD1A 3V4IA 1VSDA 3KKSA 1WLJA 3K5NA 2O4IA 3TABA 2KW4A 4JRQA 3SUQA 1TGOA 2BANA 3S3NA 4CF8A 1NK9A 4CFDA 1NJYA 3C6TA 3DOKA 1RTHA 4O4GA 3RWUA 3ISNC 4E89A 1TVRA 3MEEA 4M3RA 3ZSZA 3AA5X 2FBYA 1MU2A 1R0AA 5JS1A 1F21A 3O3FA 4K8XA 4KFBA 4FJKA 2RKIA 4LH4A 4CEEA 1X9MA 2NUBA 4DQRA 4CK3A 3DRRA 3I0SA 4DG1A 4DU3A 3PY8A 3LALA 1NKCA 3S3OA 2BE2A 4K8ZA 1HYZA 4E7JA 3HT3A 4DU1A 4E19A 3HP9A 4HUEA 4CGFA 3LP2A 1TL3A 3E01A 1SL0A 3AO4A 1CZBA 3VQ5A 3VQ8A 3CG7A 4FLVA 3OS2A 3T3FA 4JS5A 3TR8A 2GBZA 4FK0A 1JLFA 1ZBUA 3TWHA 1WN7A 4RW7A 4J2BA 3L3VA 1C1AA 1RBRA 1NKEA 1NOYA 4W5OA 3MEDA 2PYLA 2D0CA 4FJIA 3KLFA 5HROA 1ZBFA 4GW6A 3PX4A 1LAWA 1J5OA 3VQAA 2OYQA 4CJVA 4CJQA 4XIUA 3OYKA 1LWEA 3NF9A 4CE9A 4DSFA 2KZMA 1K6YA 4DTJA 1VSFA 1T03A 1KFSA 4OPKA 3TAFA 4EP5A 1LV5A 2IS3A 1FXXA 4BE0A 4WE1A 4ELTA 2GV9A 3RMCA 3G10A 3PO5A 5FRNA 1QE1A 1KCFA 1GOAA 4CJKA 4FK4A 3MXJA 4CEOA 1HYSA 4DTMA 1TV6A 3KIOA 4EZ6A 3VQQA 3OVNA 3DYAA 4E3SA 3OYAA 3S3MA 4PUOA 1X1PA 4IFYA 4LD0A 1S1TA 2WONA 1S9EA 3LPUA 3QO9A 4DLGA 3SZ2A 4DQSA 4DFMA 4F4KA 4H4MA 4Z4IA 1EXQA 4N56A 1RT1A 3D0PA 3AVJA 3QEVA 1T8EA 1L3SA 3OYHA 4J2DA 3RR8A 2VWKA 3OYMA 1L3TA 1GOBA 4CJUA 2OA8A 2XY8A 1SKSA 4Z4FA 2DY4A 3L2UA 4ZHRA 1BCMA 4CHNA 5J2NA 2QXFA 4O0IA 1YTAA 3U3GA 4CGJA 1IKYA 1HJRA 5T7BA 4OLAA 1QQCA 3M8RA 2HHUA 5CY4A 2P51A 3TAEA 1VK0A 4CHPA 1LW0A 3M8PA 4AHTA 1CLQA 2OPQA 4DTUA 3RRHA 1FK9A 4FZZA 4B9NA 5C42A 3AVFA 3ZSXA 2YNIA 4FW2A 3U3YA 5E41A 4BE1A 4KI4A 3DLHA 1JLEA 4CGIA 3NGIA 4DSEA 2B6AA 1I39A 1NK8A 4C8LA 4ID5A 3RTVA 5SWMA 4C8MA 3OYIA 2DTUA 3OYGA 4Y1DA 3TAMA 2F8TA 4E7HA 4EZ9A 3PO4A 2FBTA 2FBXA 2KQ2A 1NKBA 5KI6A 4DSIA 2KFZA 1JLQA 5CZ1A 2HHSA 4E1NA 3BGRA 3SI6A 4CECA 3VQ6A 3OYJA 1RT7A 1DTTA 3ULDA 4FJ5A 4AHUA 4CJ5A 1Q8IA 4M3UA 1RTIA 1BQMA 2YNHA 4MQ3A 4W5QA 4KHUA 2F96A 3DMJA 4CJ4A 2HHTA 1DTQA 1RT5A 1G15A 3T19A 4J2EA 2DFEA 4ZTFA 4IKFA 4CJEA 1EETA 1S6QA 4KO0A 4LSLA 4PA1A 4CIEA 1KVCA 3VQDA 3VQ9A 4KHNA 2E6MA 3WNGA 5HRNA 1BHLA 1FKPA 3TARA 3ZSWA 2Q3SA 3MXIA 1Y97A 1VRTA 4CEZA 4DMNA 3OYBA 3B6OA 2A1RA 4OJRA 1REVA 1TKDA 3KD5E 4DFJA 2ATQA 4F3TA 1RDBA 2QKKA 3WNEA 4IFVA 2OZSA 3IS9A 4CFBA 1VRUA 1NOZA 3JSMA 3SJJA 4FJ7A 1CZ9A 3CFOA 4I2QA 3KJVA 4DTXA 2BDPA 3NH0A 1JLBA 3EZ5A 1HNIA 2YKNA 4NYNA 3IAYA 4BACA 3ZCMA 1ZBIA 3SQ0A 3LZJA 2IOCA 3TI0A 1HMVA 5HRSA 3I0RA 1NK4A 3L2QA 3HJFA 3OY9A 3AA3A 4FLTA 4CIFA 3ZT2A 3OJSA 3PX0A 2D0BA 4M3TA 4PWDA 4FLXA 1KSPA 4FJLA 3KLEA 4CERA 3SV3A 1S1XA 1YVUA 3NH1A 1BIZA 4AILC 4PY5A 3HVTA 3AVCA 1IKVA 4OGEA 3DLRA 1JLAA 1VSMA 2IGIA 2X78A 1GOCA 3NBPA 3KKRA 3VQ4A 1LWCA 4HUGA 1RBUA 4CEBA 3SV4A 4M42A 3HO1A 5I42A 2KTQA 3LDSA 3CFPA 1HPZA 5KRTA 1TKXA 1X9SA 1L3VA 1JLCA 4FJXA 4DS5A 3DI6A 2HHVA 4MFBA 4F2SA 3QEIA 1QSSA 3C6UA 4O55A 3L3UA 4FW1A 2ETJA 1BQNA 3OYLA 3NH2A 3RMBA 4OLBA 4BWJA 3HVRA 4H8KA 4OKJA 4B3OA 3K58A 1KVAA 3ASMA 3NF8A 3K5MA 1I3AA 3PV8A 1L5UA 1B92A 2GUIA 2G8WA 3L2WA 2PYJA 1TAUA 1U45A 3QNNA 3VQCA 3NHGA 2VG7A 4RW8A 2X6NA 3VA3A 1RDAA 4R5PA 3NGZA 1C1CA 1YT3A 1TK5A 2XHBA 4Z4HA 3AO3A 1TK8A 4C8KA 2FBVA 4Z4GA 4CK1A 4CJPA 3AO5A 2G8KA 3AVBA 3ZSQA 1RBVA 4FM1A 4GVMA 2XY6A 1SL1A 2O4GA 4HTUA 1Q9YA 4B9UA 1C0UA 2P5OA 4OPJA 4I9QA 4DSLA 1RBSA 1ITGA 4DQIA 4NCAA 1EKEA 4AHRA 4E0DA 4FZYA 4BE2A 3SUPA 3ZSRA 4CF1A 3V9WA 4RG8A 1QTMA 3K59A 1XHZA 3OYDA 4DU4A 3TAGA 3QEXA 3KK2A 1VSHA 5J2MA 2X74A 3K57A 3V9SA 1XI1A 3OJUA 4H4OA 4O44A 3CYMA 1WSFA 3AVAA 4CJRA 4N47A 4KHYA 4CGGA 2ZQBA 1QS4A 1WNSA 4CEQA 3TANA 1SKWA 4DQPA 2Y1JA 3NE6A 4CCHA 2E4LA 4TSXA 4E7KA 1WAFA 5SZTA 4BDPA 3RR7A 4HHTA 1HQEA 3DLBA 4HUFA 2YHAA 3AV9A 3HK2A 3ZSYA 4G1QA 4RW4A 1JKHA 2LSNA 3SUOA 3V1QA 1UA0A 4FM2A 3SQ1A 1ZBLA 2IC3A 1Z25A 3LANA 3QNOA 3VN5A 3RMAA 3B6PA 3LAKA 2Y1IA 1U48A 4M3YA 2HHXA 1J9AA 3LWLA 3AVMA 2OPSA 4FVMA 4J2AA 1BGXT 3CM6A 2YKMA 2QKBA 1BL3A 2HNYA 1CXQA 4CF9A 1ASUA 3QERA 1N5YA 1RT3A 4DTSA 3IG1A 2A1SA 1X9WA 5C24A 2XY7A 2PY5A 2HHWA 2JGUA 3AVHA 1B9FA 3SUNA 4HCBA 1JL2A 1S9GA 3T1AA 1QHTA 4CF0A 4Q5VA 3V9UA 4DSKA 4PQUA 3NDKA 5J2QA 1S5JA 4JLHA 3HP6A 3ZT3A 5CYMA 4I9LA 4DS4A 1KFDA 2D0AA 1S1UA 1TKZA 3O3HA 1Z26A 5K14A 5KGWA 1BIUA 2F8SA 4FLUA 2DFFA 4FJ8A 2E6LA 3C94A 3RMDA 1T7PA 1WAJA 2DFHA 4ID1A 3ALYA 4KKOA 4B9MA 4F3OA 1TK0A 5J1EA 4DFPA 3L2RA 1QSLA 1LWFA 3UIQA 3V1RA 4DF4A 1IH7A 4FK2A 1SUQA 1O1WA 3JYTA 4CESA 4DTOA 1W0HA 3DRPA 4F8RA 4B9SA 4Q0BA 1VSKA 1BI4A 2BGGA 1RTDA 3QEWA 1UA1A 4DWIA 4Z0UA 4HCCA 1JXBA 1RILA 4IG3A 1QSYA 2EX3A 1RTJA 1VSIA 4RW9A 3OYCA 1RT2A 3KLHA 3FFIA 4HVJA 4DQQA 4L8RB 4E7IA 4B8AB 1J53A 3NCIA 1U4BA 4FLZA 1U49A 4KI6A 2P5GA 4CF2A 1KLMA 1RDDA 2HNDA 3F9KA 3SPZA 4KHSA 3KLGA 4NCBA 1TKTA 4E1MA 3AO1A 3LPTA 4IBNA 4Y1CA 1TL1A 3KLIA 4KPYA 1RNHA 3ZT0A 4DLEA 4KV8A 1IKXA 1BCOA 3ITHA 4I2PA 3AVIA 4OKKA 5HRRA 3WNHA 2YNFA 4LH5A 2B4JA 3NGYA 1TAQA 3KK1A 1CXUA 1S1WA 1VSLA 2Z1HA 4M45A 4DSJA 5I3UA 4CGHA 3KK3A 1W9HA 1C0TA 1N6QA 4CFCA 3QIPA 3HPOA 3KD1E 1C6VA 1S1VA 3A2FA 3TAPA 1KTQA 1DLOA 5CYQA 1RCHA 3SYZA 3HL8A 4CK2A 3HPGA 3HM9A 1B9DA 1C1BA 2Z1IA 3AVGA 5C25A 1NJXA 2OPPA 3WNFA 1JL1A 1RDCA 1XHXA 3OYFA 3ZSOA 3K2PA 1UWBA 5HBMA 3DLGA 3ZT1A 1NK5A 3M8SA 3RRGA 4QCLA 5FDLA 1ZBHA 1WSGA 3AA2A 4AHVA 2OZMA 2VWJA 2ITGA 4BWMA 4AHSA 4CHOA 4I7FA 3SQ4A 1HNVA 3DLEA 2XRIA 4KTWA 3I8DA 4FLWA 2QK9A 2AJQA 4BDZA 4N76A 2HVHA 3S9HA 4AH9A 4CFAA 1NK7A 2YNGA 3O4QA 3P5JA 1RT4A 1WSJA 4GMJB 3ZT4A 4F2RA 4CIGA 1D9DA 2OPRA 4KHQA 4ZTJA 4FJMA 3QLHA 1LW2A 4OVLA 2HB5A 4CHZA 2YV0X 4AHCA 4FJHA 3AA4A 2G8FA 3ZSVA 4YNQA 3VQ7A 2RPIA 4CJWA 2RF2A 4W5TA 4FJNA 4KB1A 4KREA 2R7YA 1HRHA 4N5SA 3CQ8A 4W5RA 3VQBA 3LP3A 4CHYA 4CEAA 3QIOA 3LP0A 4NYFA 4DFKA 4ELVA 1T05A 3DLKA 3D45A 4KTZA 1LAVA 2D5RA 2WOMA 1WSHA 3QEPA 1WSIA 3HPHA 2HHQA
chains in the Genus database with same CATH superfamily
3OBYA 4FJGA 3EZWA 4FWKA 3HSTB 4NB4A 1U47A 4B9LA 4OPHA 3EKUA 3MECA 1D9FA 3NF6A 1NJZA 3SPYA 4BR9A 5DM6L 4MLEA 2G8HA 3SQ2A 1OH6A 2QWLA 3OYEA 3U6FA 3AY9A 5HP1A 3PUFA 1NMDA 1ATSA 1U04A 1RT6A 4N41A 3CHWA 4C8NA 3QETA 1Q9XA 1TUYA 1NWKA 5KGXA 3TPQA 2JLEA 3O4NA 5ADXH 2GEMA 3U9ZA 5DMRA 4GVEA 4FCYA 4KAZA 1JLGA 1RBTA 4Z4CA 3QESA 3PIOL 1MA9B 3OS0A 2A42A 3V9ZA 2HW3A 3CM5A 3I56N 4M3XA 3VQEA 3F73A 4BREA 1HUXA 5TKWA 4B3MK 4CGDA 4EP4A 1QQNA 4PKHA 3DM2A 3G0ZA 1SS6A 3OS1A 2W42A 3PX6A 4KTQA 1YTUA 4B9VA 3LP1A 3HXMA 1N33K 4BC4A 2G8IA 1NK0A 4A5AA 4JYAK 5EVZA 1XNRK 5KRSA 2PZSA 4CJSA 4CJ3A 3ATUA 3TTDA 2E8AA 3I55N 3BY5A 1QQOA 1VSEA 1XWLA 2ZGZA 1WSEA 3V6DA 4FWSA 4CEFA 4ELUA 1JCGA 5TKYA 3C95A 1ASVA 4JI2K 4DF8A 2ZD1A 3TSPA 3DJCA 2IIRA 1NJYA 3C6TA 4YDUC 2FSJA 4LFBK 4HWIA 1EWQA 4M3RA 3AA5X 3CMEN 3O6WA 5KPRA 4FJKA 4LH4A 4CEEA 1X9MA 3F2KA 4DQRA 2UUAK 2P9KA 4DU3A 3CCJN 3LALA 2UUCK 1NKCA 5GAGP 4PKGA 5AQSA 3H1QA 2P9SA 3W3DA 2D1KA 3VQ8A 2Q0UA 4FK0A 3AGRA 4BC5A 1VQ8N 1C1AA 1RBRA 3CCEN 4W5OA 3PX4A 3MMVA 2OYQA 1T3VA 1LWEA 3E1YA 1T03A 1KFSA 4EP5A 2IS3A 2GWJA 4BE0A 3THYA 2GV9A 2UXCK 1GLLO 3RSEB 1QE1A 3JAMO 3FZMA 5LJVA 3U9DA 2QI2A 4C1NI 3CCLN 1S1TA 4DLGA 1S9EA 4DQSA 4PL7A 3O08A 1EXQA 3D0PA 1T8EA 3OYHA 3C7NB 4NXMK 3SJHA 1GOBA 2OA8A 2XY8A 3L2UA 4DR3K 2QXFA 1VQLN 3RVCA 4O0IA 5T7BA 3VF4A 1BU6O 5AJ3K 1QQCA 4JI6K 1EQYA 3RRHA 4B9NA 3AVFA 3ZSXA 2YNIA 4IDHA 4DKWA 4BGAA 4IEIA 2WTUA 4DSEA 1G99A 5HL7L 4CJ7A 5EXWA 3C65A 3CJBA 2UXDK 2O8CA 2FBTA 1HJOA 2KQ2A 4JKGA 1JLQA 4E1NA 1XNQK 4BR4A 2P9IA 3FGUA 4CECA 4FJ5A 4CJ5A 4W5QA 4YY3K 2RE2A 4B3TK 4JNEA 1U2VB 1OKJA 4IKFA 3WNGA 3OHRA 4DMNA 2A1RA 4OJRA 3ID8A 4F3TA 4CFBA 3SJJA 2QK9A 3HO1A 3KJVA 2BDPA 1HNIA 3IAYA 5KPTA 4BACA 3ZCMA 2P9LA 3LZJA 2IOCA 5HRSA 3HJFA 3L2QA 2RHKA 4FJLA 5E26A 1YVUA 3NH1A 5AQQA 5FPDA 4OGEA 3UKUB 1YXQA 2IGIA 1NGJA 3G4SN 1RBUA 4FSVA 1QHAA 3C6AA 5KRTA 3G71N 3N4PA 4FJXA 3DI6A 3T1HK 3C6UA 3L3UA 4A2AA 4DB3A 3OYLA 3NH2A 5HOOA 4K43A 4DV7K 4NLCA 3K58A 4PL8A 3ULEA 3O9TA 3K5MA 3PV8A 1L5UA 1TYQB 2GUIA 2G8WA 3VQCA 3CERA 2D4WA 2VG7A 1TK5A 1YT3A 2VQEK 3AO3A 2FBVA 1RBVA 1Q9YA 2E2NA 4WFNL 1OH5A 1RBSA 4DQIA 3D2EB 4E0DA 1QTMA 3K59A 4DU4A 3TAGA 1DKGD 1XI1A 2ZGYA 3AVAA 3MWTA 5EOYA 4CJRA 1YITN 4KHYA 5M1OA 1QS4A 4CCHA 2E4LA 4E7KA 3GOIA 5SZTA 4JKEA 3RR7A 4NLBA 1VQ9N 2YHAA 3L6QA 4G1QA 1VQMN 1SQKA 3ZETA 3SUOA 3V1QA 1UA0A 2A40A 1RGIA 1Z25A 3A5LC 3IKMA 4BGBA 1C0GA 5M1QA 4FVMA 4J2AA 2HNYA 1CXQA 3QERA 4FWQA 1RDUA 3IG1A 2QM1A 2O8BA 2A1SA 2P9PA 2XY7A 4BRKA 2HBMA 4BRPA 2JGUA 1B9FA 4BRCA 4HCBA 3SAFA 3T1AA 4CF0A 3V9UA 5J2QA 1S5JA 4M7XA 3HP6A 4ILHA 1ATNA 2QWQA 1T7PA 3DAWA 2DFHA 4B9MA 1TK0A 5J1EA 4DFPA 2FSNA 3C6HA 3UIQA 3V1RA 1O1WA 4DTOA 4DR1K 4Q0BA 4FWMA 3WUHA 1RTDA 2BGGA 3WEEB 5AFUA 1RT2A 4FOIA 2NZTA 5CHIA 3BZCA 1U4BA 2P5GA 1RDDA 1IV0A 3EN9A 1W2BM 4RCHA 3VTIA 4JI7K 1RNHA 1IKXA 1BCOA 3IMXA 3AVIA 3VERA 3VEXA 2B4JA 3NGYA 2NRXA 4B3RK 4M45A 3THYB 5I3UA 1JCEA 1GLBG 1C6VA 3D6RA 2CGKA 1KTQA 2NRVA 3SYZA 1WB9A 3HM9A 2Z1IA 2BTFA 3MN6A 3AVGA 5C25A 1NJXA 3WNFA 2BH1A 1M90O 3IFRA 3WQUA 3DLGA 1NK5A 4QCLA 3ZYYX 1WSGA 1Q18A 4F9OA 4WQ4C 2OZMA 2ITGA 4CHOA 1XUPO 5JMVA 4KTWA 3DLEA 2XRIA 2HVHA 1E4FT 4CFAA 3ZT4A 4CBUA 4KHQA 4OVLA 2YHYA 4IO8A 2YV0X 3A5OC 4AHCA 3ZSVA 4H5TA 4YNQA 4FPBA 4W5TA 4FJNA 5ELZA 3VQBA 1NGEA 4A59A 4NYFA 4ELVA 1LAVA 3AGKA 2HBLA 3HOTA 2WOMA 1WSIA 2HHQA 2D0OA 1A5VA 4JKGB 3VA0A 4X65K 2A41A 3EY1A 3OBWA 4K41A 3V81A 4FM0A 5AQZA 5BPMA 3O9QA 4CHQA 2VG5A 4FZXC 3AVKA 3O80A 3P83D 5BPNA 1E4GT 1HQUA 1IO2A 2WC9A 4YHHK 4CJFA 1IKWA 1SV5A 3H08A 1WBDA 2F9WA 4RW6A 4AM7A 4H5VA 3SCXA 3QMLA 4M3ZA 5AR0A 4FXDA 2E20A 5C10A 3I33A 3KTQA 3MK6A 2W40A 1ASWA 3M3ZA 4KRFA 3THVA 5C2DA 1UAXA 2E88A 1IG9A 3LZIA 2YI1A 5JVGL 4FJJA 3L2VA 3C7NA 2I5JA 3CXCM 3TAQA 1DGKN 2Z1GA 4IDKA 3ULEB 3FE1A 2VG6A 4JKHA 4LSNA 3QINA 1HKGA 4CD3A 2G8UA 1D5AA 3MEGA 3CCRN 4DTNA 3CJCA 4H5RA 1ATRA 4LF5K 2FF3B 3AVNA 4B9TA 3H45C 3B8AX 1NMNA 2HBJA 5AQJA 4IG0A 4FJ9A 2HMIA 3BEXA 3MWPA 3NAEA 4LF9K 5D3GA 1X3NA 4BQZA 4GV6A 5AQNA 3EO3A 1KVBA 4BRAA 4UY8O 5FRMA 3BF1A 3L8BA 5J2PA 3UB5A 4FL9A 4H5NA 3TABA 4JRQA 2BANA 5AFUH 3PIPL 1NK9A 4G9ZA 4A57A 4O4GA 2E1YA 4DR7K 1NGAA 3MEEA 1MU2A 4K8XA 4DUZK 2QXLA 2NUBA 3ZETB 3PSFA 3S3OA 1YJWN 4K8ZA 1HYZA 4E7JA 4DU1A 4H0OA 3AO4A 4JI0K 3VQ5A 4DV6K 3CG7A 4FLVA 1Z6RA 4AM6A 3T3FA 3O8MA 2QWMA 3TR8A 4RW7A 3DLLL 4J2BA 2GWKA 2P9PB 4FJIA 4GW6A 4CJQA 4XIUA 4CE9A 1NU0A 4CVNE 3FR0A 1OVQA 5M1PA 3JXUA 1VQ5N 4X66K 3CJ9A 5DM7L 3RMCA 4FK4A 4DR4K 3MXJA 4CEOA 4DTMA 1KD1O 1TV6A 3KIOA 4EZ6A 3VQQA 4KH6A 3DYAA 4E3SA 3OYAA 4B9QA 1X1PA 2WONA 3ENHA 3QO9A 3A5MC 4ISGA 1TYQA 4H4MA 5AQPA 5EY4A 1IBLK 3QEVA 5C12A 3CF5L 2VWKA 1L3TA 4BR7A 2FF6A 3AARA 4CHNA 2YHXA 3WXLA 4CGJA 1IKYA 1HJRA 4OLAA 4B1YB 3M8RA 4CI6A 3ATVA 3D2EA 4CHPA 1CLQA 4AHTA 3MN5A 4YOVA 4DTUA 2WUSA 4FZZA 5C42A 4BE1A 4KI4A 3CETA 3LDLA 1JLEA 3DLHA 1YVNA 2B6AA 1I39A 4KHPK 4ID5A 3RTVA 3OYGA 1QZ6A 4GV3A 3TAMA 2ASMA 2JWLA 2PBDA 3HBTA 3PO4A 2FBXA 4EZ9A 3GE1A 1VQPN 1QZ5A 2HHSA 3BGRA 4YOTA 3VQ6A 1BO5O 1DTTA 2PFUA 5LJWA 4CZJA 3DXMB 5GADP 3L4IA 4M3UA 1BQMA 2YNHA 4KHUA 4JKFA 4O8UA 4CJ4A 3DMJA 1HNWK 5IT9O 2V7YA 1RT5A 4J2EA 1G15A 2DFEA 4ZTFA 2JWKA 4CJEA 1H1VA 1EETA 1S6QA 4KO0A 3VQDA 3VQ9A 2E6MA 5HRNA 3E66A 5BPLA 1Y97A 4CEZA 3VPZA 3OYBA 1RDBA 4LFCK 2QKKA 2OZSA 4IFVA 4XEIA 1NOZA 3NH0A 1JLBA 3EZ5A 4NYNA 1ZBIA 4DV5K 3TI0A 1WUAA 2V51B 3O1WA 1GLJO 4CIFA 5AQIA 3ZT2A 3J81O 2D0BA 3OJSA 4PWDA 1KSPA 1C0FA 2ASPA 3BZKA 1S1XA 4A61A 1BIZA 4PY5A 2W41A 5EX5A 4CZIA 1VSMA 2X78A 3SV4A 3KKRA 4M42A 2KTQA 4X64K 1KXPA 4YOYA 1HPZA 1X9SA 1L3VA 1JLCA 1ILYA 1LCUA 4F2SA 3WEEA 1E3MA 5JLHA 4O55A 4IZ9A 1BQNA 4FOEA 1NGFA 5GIPA 4OLBA 4BWJA 1BWFO 1KVAA 3ASMA 5AQFA 2I7NA 3L2WA 3R9PA 3QNNA 1U45A 3P38A 3Q7CA 3F5TA 1ZXOA 1GLEG 4BVOA 3GG4A 3ZSQA 4GVMA 2P5OA 4HTUA 4DSLA 5AQWA 5B8HA 1J6ZA 3WT0A 4BE2A 3V9WA 3SK3A 5BN8A 3KK2A 2PAVA 2OTJN 5J2MA 2X74A 3K57A 3V9SA 3R1XA 4JEPA 3CYMA 2ASOA 4CGGA 2ZQBA 1KQSM 1WNSA 4CEQA 1SKWA 4JV5K 3H6EA 3K0SA 4BDPA 4HHTA 5F2RA 3DLBA 4HUFA 3HK2A 3AV9A 3ZSYA 4JI4K 4RW4A 3EEQA 1LOTB 3NVMA 3B6PA 3LAKA 1U48A 4M3YA 3AVMA 5GAEP 1BGXT 2YKMA 2QKBA 1BL3A 1OVYA 4CF9A 3O5BA 2ZM6K 1N5YA 4LFAK 3O9UA 3SAGA 1X9WA 3AVHA 3SUNA 1IBMK 4IOXA 3NDKA 4JLHA 3QB0A 3ZT3A 1N34K 2ZJQL 3SBTA 4IOAL 5AQXA 4CZMA 5K14A 4B1UB 4FLUA 3C94A 2GUPA 1WAJA 4KKOA 2NRRA 3L2RA 4DF4A 4FK2A 2P9NA 4CESA 1W0HA 2CH6A 4GY2B 2QWOA 4FWNA 4DR6K 1RTJA 1SZ2A 1VSIA 3DXKB 3KLHA 3FFIA 4L8RB 3H1VX 4EAHD 1U49A 1KAXA 1KLMA 2HNDA 5BN9A 4U7BA 4NCBA 1TKTA 3J80O 3LPTA 1VQON 4Y1CA 3KLIA 2D0PA 5CR4A 3T7ZA 4CZFA 4DLEA 1T44A 5AQYA 5FLXO 3WNHA 2QTDA 3EKSA 2E2QA 1CXUA 2ZJPL 1VSLA 3CCMN 4JHDA 4WQ4A 3KK3A 3AAQA 1VQ4N 3A2FA 3HL8A 5I9EB 4JI8K 4ILGB 1JL1A 3EE8A 3ZSOA 3K2PA 4DR5K 2O8EA 3G6EN 3M8SA 5FDLA 4AF1A 3AA2A 1ZBHA 2VWJA 4BWMA 1GLCG 3SQ4A 5LMUK 4FLWA 2QEXN 2AJQA 4BDZA 3QFUA 1NK7A 2YNGA 4GMJB 1BG3A 4F2RA 1R59O 1D9DA 2O8FB 4FJMA 3QLHA 1LW2A 2HB5A 4CHZA 4IO9L 4K25A 4WQ5C 3VQ7A 1P90A 2RPIA 3R8EA 2GX9A 5JLFA 2ZJRL 3LP3A 3QIOA 3LP0A 2EWSA 2Q36A 4KTZA 3G25A 2D5RA 3E9PA 3QEPA 1XMQK 1NK6A 4O8KA 1NNEA 5HLFA 3FZKA 1UOCA 4CJTA 5C15A 2HNZA 3AO2A 5MLCQ 3M8QA 3K5LA 1A5WA 3QICA 4M63C 3QBWA 3NFAA 5KPZA 4LF6K 4ICLA 3KWIA 1KAZA 3VQPA 5JS2A 3CCQN 4B8CA 1HYVA 5KQDA 4KH5A 5C0YA 4JI3K 2IAJA 4EFHA 4M3WA 2KZZA 1J54A 4KHWA 3O4WA 3P1GA 1RFQA 2XY5A 4BRHA 1SKRA 2NRZA 2FC0A 2IDOA 4NXNK 3LAMA 4IWVA 3SNNA 4XH1A 2P1JA 4DTRA 2Q31A 1VQKN 4QOZB 4JK7A 4UQGA 1C0MA 2Z1JA 2CH5A 1EP4A 3MXMA 1KLNA 2QW9A 3J8AA 1NBWA 3OYNA 5JVHL 4LY7A 4FYDA 4MDBA 2KHOA 1KRPA 1D8YA 4DTPA 1ZC6A 5EU7A 3J7ZO 4OGCA 3TTCA 4BRQA 4YOWA 3V9XA 1VHXA 3THXA 5FROA 4O0JA 4BDYA 4E7LA 5HRPA 4YFUA 2ZE2A 4OKEA 2B5JA 2A5XA 2EHGA 1NGHA 1BISA 3GDQA 1FKOA 3O3GA 4KB0A 1VAZA 3M6GA 3HYFA 3ENBA 3MAQA 4JS4A 3DOLA 1HPMA 4IEEA 1T6DA 3U4LA 5FPMA 3V4IA 3KKSA 1WLJA 3EL2A 3K5NA 3SUQA 2KW4A 3S3NA 1TGOA 3DXMA 3DOKA 4Z94A 3RWUA 3ISNC 4E89A 2IVOA 1TVRA 1F21A 3K9KA 4KFBA 2RKIA 3TTFA 5AZIA 1N8RO 3VGKA 2A6AA 3HT3A 4E19A 2FSKA 4CGFA 4XH4A 2VCPA 3OS2A 4JS5A 2V7ZA 2GBZA 5AQGA 3O1BA 1JLFA 2Q0RA 3TWHA 3THWA 1MWKA 1NKEA 1NOYA 3MEDA 3VMFB 3C0BA 3KLFA 4CJVA 1NM1A 4BG8A 4DSFA 3D2FB 3ZX0A 3CC7N 4DTJA 1VSFA 3D7EO 4BVPA 4WE1A 3CI5A 4ELTA 1XQSC 2YX6A 1Q86O 3G10A 2V52B 2KLAA 1KCFA 1XC3A 1GOAA 1HYSA 2P9NB 4U67L 4H0VB 3S3MA 3OW2M 3SZ2A 4AQYK 4DFMA 4N56A 3AVJA 1L3SA 4J2DA 1NGGA 2WBNA 1SKSA 4Z4FA 5J2NA 4C1NK 2I7PA 3CQXA 1YI2N 1YTAA 3UKRA 1BDGA 3Q7BA 4WCEL 4YORA 4IJAA 5CY4A 1LW0A 3M8PA 4X62K 2OPQA 3HM8A 3VF6A 3U3YA 3P39A 5E41A 4CGIA 2F7TA 3NGIA 1XMOK 3O9SA 4JHDB 4XH5A 3VEZA 5SWMA 2UXBK 4Y1DA 1WBBA 1VQ6N 3VEVA 4H0TB 3K9JA 4E7HA 2QWNA 2KFZA 5KI6A 3BP8A 3AAPA 3ULDA 2VGNA 3ENOA 3HI0A 3O9RA 2O8EB 2YJEA 2F96A 5F0XA 2HHTA 5M1KA 3T19A 4FO0A 1VQNN 3CCSN 4CIEA 4LSLA 3MX5A 4KHNA 1FKPA 3GL1A 2Q3SA 1K73O 1OH8A 3B6OA 3A8YA 2F9TA 4YDUA 3IS9A 1VRUA 5JS1A 1CZ9A 4EHUA 3R3LA 4CD1A 1W7AA 2KKZA 1NK4A 1HMVA 3I0RA 3N4QA 3OY9A 3AA3A 3F9MA 4FLTA 3PX0A 1IBKK 3KLEA 4CERA 3SV3A 3CJAA 2ZF5O 3WXIA 3HVTA 1IKVA 2CGLA 3DLRA 1JLAA 1MWMA 1Z05A 1GOCA 2YCHA 3VQ4A 1LWCA 4BC2A 1N36K 4KH4A 3LDSA 4H0YB 3ZX3A 3CPEA 4DS5A 4I6MA 4MFBA 1X3MA 5KQ8A 1NJIO 1DEJA 3DXKA 4OO1J 4FW1A 2ETJA 3M5RA 3RMBA 4Y0WA 4LF4K 4H8KA 4OKJA 4B3OA 3LDQA 1I3AA 1B92A 1QQMA 1TAUA 3NHGA 4RW8A 3VA3A 1RDAA 4C8KA 4Z4HA 1TK8A 4Z4GA 4CK1A 1GLFO 3AO5A 1SL1A 1S22A 4B9UA 5AQOA 5BREA 1C0UA 2E2OA 4OPJA 4YOUA 1ITGA 4NCAA 1EKEA 2WFBA 1JJ2M 1Q81O 3ZSRA 1XHZA 3OYDA 3QEXA 1VSHA 4FVUA 4EIAA 1NGCA 3OJUA 4H4OA 3VESA 4O44A 1HLUA 4N47A 3VGLA 5C2FA 4DQPA 4MLHA 2Y1JA 1QVGM 4TSXA 1WAFA 1HQEA 2P9UB 3ID6A 4FPAA 1X9JA 4PKIA 4FM2A 3SQ1A 2IC3A 3VN5A 3ZEUB 2O8FA 4IOCL 1J9AA 3LWLA 3THXB 1BA1A 2OPSA 3CM6A 1ASUA 5AQTA 2IVNA 4DTSA 4ISEA 1YHQN 2PY5A 3A5NC 3CD6N 4K42A 1S9GA 3LDOA 3VEOA 1QHTA 4Q5VA 5AQHA 5AZJB 4DSKA 4PQUA 3MN7A 5CYMA 4I9LA 4DS4A 1S1UA 1TKZA 3O3HA 1Z26A 5KGWA 4WF9L 5GINA 5AQMA 2E6LA 4FJ8A 3RMDA 4F3OA 1NGIA 3HSCA 1QSLA 1LWFA 1IH7A 4QS9A 4BRGA 1SUQA 4BRLA 4F8RA 2VQFK 5M1FA 4C23A 2NRWA 4B9SA 1VSKA 4IXCA 5CE3A 5AZIB 1CZAN 3QEWA 1UA1A 4DWIA 1RILA 2QWRA 4IG3A 1TUUA 1HX1A 3OYCA 4HVJA 4DQQA 4GKKK 4E7IA 4B8AB 4R79A 3NCIA 4FLZA 4CF2A 3F9KA 3SPZA 4FWPA 3KLGA 1GLDG 3THWB 2UYTA 3WQTA 4LF8K 3ZT0A 4KV8A 5AQUA 3VETA 4H0PA 4CBWA 3ITHA 4BRNA 4I2PA 4OKKA 5HRRA 2YHWA 4OPAA 3KK1A 1S1WA 1C0TA 1N6QA 4CFCA 3QIPA 3HPOA 3KD1E 4K0KK 1S1VA 4J8FA 5CYQA 1RCHA 4CK2A 3NMUA 1NG9A 1C1BA 1YF5L 2OPPA 4DQ8A 2DPNA 5BRHA 1UWBA 5HBMA 3ZT1A 3TSQA 4WQ5A 1S72N 1I94K 3MDQA 4I7FA 1HNVA 3I8DA 5BRFA 5M1NA 3S9HA 2CGJA 4AH9A 3OA9A 3FLCO 1WSJA 4CIGA 2A3ZA 2OPRA 1QVFM 2O8DA 3UKRB 4FJHA 3AA4A 4KREA 4BG9A 4CJWA 2AA4A 2RF2A 3L0QA 4KB1A 3H3OB 2R7YA 1HRHA 3CQ8A 1HNZK 4W5RA 4CHYA 3SMPA 2E2PA 5AQLA 2ITMA 4DFKA 4QS7A 1T05A 3DLKA 3D45A 3WXJA 4B3SK 1J5EK 3WXMB 4RWTA 3KHYA 1YIJN 5CZ2A 5KTQA 1Q82O 1XC9A 3FZHA 2YJFA 1S6PA 4MO4A 2HF4A 2F4VK 1NJWA 3ZLJA 4JN4A 3DRSA 1K8KA 4CJLA 4YOXA 1V4TA 1BI4B 4C8OA 2E1ZA 3VF2A 4FLYA 5FPNA 3IUCA 3LDNA 3EYZA 3KZBA 2KFNA 1NGDA 3D2FA 4JI1K 1NGBA 3CCUN 1L3UA 3IRXA 4JKBA 1ZYQA 4JRPA 4QAGA 3ZX2A 2ZWHA 4O5BA 5BR8K 3V1OA 1ESVA 3WXKA 2XO7A 2HSTA 3NF7A 2HF3A 1EX4A 4MDAA 4QS8A 4M41A 4I6MB 4B08A 3CMAN 3CJ7A 2G8VA 3BDPA 4NCGA 1JXEA 3CFRA 2NNWA 4FWLA 1YJNN 3AVLA 3LWMA 2HVIA 5E84A 1SL2A 1VSJA 4CEDA 1A5XA 4W5NA 3FFKB 4DUYK 4WYBA 3SMSA 4BROA 3JS6A 2X6SA 1W97L 2RN2A 3U8XA 4Z4EA 2BUPA 2UU9K 2YHBA 2HHHK 4BR0A 5DK5A 3K5OA 1VSDA 3DWLA 2O4IA 1DT9A 4CF8A 4A2BA 5H1SQ 1T6CA 3IDHA 4CFDA 1RTHA 4FWOA 1EO1A 3J7AP 3ZSZA 2FBYA 1R0AA 2OTLN 3O3FA 3PY8A 4CK3A 3DRRA 3I0SA 4DG1A 2Q2RA 2BE2A 4GV9A 1KAYA 4B1VA 1BOTO 2QWPA 4DHYA 3HP9A 4BR5A 4HUEA 3LP2A 1TL3A 3E01A 1SL0A 1CZBA 3NVKA 1JCFA 3PLAA 3VEYA 5GAHP 1ZBUA 4DV3K 1WN7A 3L3VA 4MO5A 4BRIA 3E9OA 2PYLA 2D0CA 5HROA 1KC8O 1ZBFA 5A2QO 1J5OA 1LAWA 3CIPA 4H0XB 3VQAA 3OYKA 2OANA 1MDUB 4PHTX 3NF9A 4DV2K 1HR0K 4NO7A 2KZMA 1K6YA 3HZ6A 4OPKA 3TAFA 1LV5A 1FXXA 3VENA 5BR9A 4JI5K 4DV4K 4GKJK 3PO5A 5FRNA 4CJKA 1NLVA 2HOEA 3SBGA 3OVNA 3MCPA 4PUOA 4IFYA 4LD0A 3BUZB 3LPUA 1GLAG 4F4KA 1SAZA 4Z4IA 1RT1A 2AP1A 3RR8A 2HMPA 3OYMA 2W6KA 4CJUA 2DY4A 3QBXA 4ZHRA 1BCMA 4JD2A 4CZEA 3U3GA 2HHUA 1HKBA 2P51A 5BRDA 3TAEA 1VK0A 1P8ZA 4IJNA 4CBXA 1FK9A 3CCVN 4LF7K 4DCHA 1K9MO 4FW2A 3MCAB 1NK8A 4C8LA 1V4SA 4C8MA 3OYIA 2DTUA 3T69A 3BF3A 5FPEA 2F8TA 4FWRA 4DSIA 1NKBA 5CZ1A 4DV1K 3SI6A 4JK8A 3OYJA 2P9UA 2J4RA 1RT7A 3HRGA 4AHUA 1Q8IA 4JKAA 1RTIA 3UE5A 3L4QA 4MQ3A 1RDWX 3T1YK 4CZHA 1DTQA 3ZEUA 4H03B 4CZLA 4PA1A 2NRTA 1KVCA 1U6ZA 4IFEA 3TARA 1BHLA 1WOQA 2P9KB 3ZSWA 4JK9A 3MXIA 1VRTA 1TKDA 1REVA 3KD5E 4DFJA 2ATQA 2O8DB 3WNEA 4FJ7A 3JSMA 3CFOA 2VGMA 4I2QA 4DTXA 4OX9K 2P9SB 2YKNA 1VQ7N 1D4XA 3SAHA 4CZGA 5AZJA 3SQ0A 3VOVA 2VYPA 3QDKA 4BRFA 4M3TA 1FW6A 4FLXA 4A5BA 2GELA 2HBKA 4AILC 3FZLA 4BR2A 3AVCA 4LC9B 4CW7B 5AQKA 1FJGK 5F1XA 3NBPA 4HUGA 2FLOA 4CEBA 5I42A 3CFPA 1TKXA 1ZBSA 3CPWM 2HHVA 3J7YP 3QEIA 1QSSA 4BC3A 2OCEA 1N32K 3VEWA 3H3NO 1K8KB 3HVRA 3LM2A 4BRDA 3NF8A 2NRHA 5AQVA 2PYJA 4JKCA 3VGMA 3TSUA 3KK7A 2X6NA 4WFAL 4R5PA 3NGZA 1C1CA 2XHBA 2GTDA 3P31A 4CJPA 5AQRA 2G8KA 3AVBA 4FM1A 2XY6A 2O4GA 4I9QA 4O5FA 4AHRA 4FZYA 4CZKA 3SUPA 4CF1A 1HNXK 4ISFA 4RG8A 3HTVA 3S41A 2UUBK 1M1KO 4L3QA 1S3XA 5LL6Z 3E9LA 3W0LA 2H3GX 5ADXA 2E5LK 1WSFA 3FZFA 3LDPA 2O8CB 3TANA 3KVGA 3NE6A 2P9IB 3CQYA 5LY3A 1HKCA 1JKHA 2LSNA 1O13A 1IG8A 2IVPA 1ZBLA 3CJ1A 3LANA 3QNOA 3RMAA 2Y1IA 3CC2N 2HHXA 1RT3A 5LMNK 3GBTA 5C24A 1BA0A 2HHWA 1JL2A 4B1WB 2Q97A 3OTOK 4B1ZA 2P9LB 4M7YA 3EE9A 1KFDA 3SLCA 2D0AA 3KWGA 1BIUA 2F8SA 1EWRA 2DFFA 4WFBL 4ID1A 3ALYA 3RSEA 1OH7A 3MN9A 4E1JA 3JYTA 3DRPA 3M1FA 1BI4A 3TU5A 1YAGA 3PSIA 2Q1NA 4Z0UA 4HCCA 1JXBA 1QSYA 4RW9A 2EX3A 2FXUA 4JAXA 4ILJA 2VWBA 4EHTA 4DR2K 1J53A 4KI6A 4HTLA 1YJ9N 3R6MA 4KHSA 1IJJA 3A0IX 4E1MA 4JKDA 3AO1A 4RTFD 4BRMA 4IBNA 1TL1A 4KPYA 3LM9A 3CC4N 3P4IA 3LL3A 2YNFA 4LH5A 1K8AO 1TAQA 4BQLA 2Z1HA 4DSJA 5JICA 4CGHA 1W9HA 3TAPA 1Q7YO 1DLOA 3HPGA 2NLXA 1B9DA 1BUPA 4GNIA 3OYFA 1RDCA 1XHXA 5IWAK 3H46O 3RRGA 1U2VA 4B1XB 4AHVA 4AHSA 4A62A 4N76A 4DV0K 3O4QA 3P5JA 4H5WA 1RT4A 4JD2B 4BY9C 4ZTJA 5GIOA 2G8FA 3MX2A 2W6LA 4N5SA 3VTHA 1Y64A 4CEAA 4V19S 2O8BB 3I8BA 4KBOA 3HOSA 2QA4N 1WSHA 3UKUA 3QFPA 3HPHA 1YUWA
chains in the Genus database with same CATH topology
1A5VA 4FJGA 3HSTB 3VA0A 5HLFA 1UOCA 4CJTA 5CZ2A 3EY1A 2HNZA 1U47A 4B9LA 3AO2A 5KTQA 3M8QA 3K5LA 3MECA 3V81A 1XC9A 1A5WA 1S6PA 3NFAA 1D9FA 4FM0A 4ICLA 3NF6A 1NJZA 3SPYA 3VQPA 5JS2A 4CHQA 4B8CA 1NJWA 1HYVA 2VG5A 2G8HA 4FZXC 3SQ2A 3DRSA 3OYEA 4CJLA 3U6FA 3AVKA 3P83D 5HP1A 2IAJA 4M3WA 1BI4B 3PUFA 2KZZA 1J54A 4KHWA 1U04A 3P1GA 4C8OA 4FLYA 1HQUA 1IO2A 2XY5A 1RT6A 4N41A 4CJFA 4C8NA 1IKWA 1SKRA 1SV5A 3H08A 3QETA 1Q9XA 3EYZA 2FC0A 2IDOA 2KFNA 5KGXA 2JLEA 3LAMA 3O4NA 4RW6A 3SNNA 3IRXA 1L3UA 3SCXA 4FXDA 4M3ZA 1ZYQA 5DMRA 4JRPA 2P1JA 4FCYA 4KAZA 1JLGA 4DTRA 4QAGA 3KTQA 1RBTA 4Z4CA 4O5BA 3QESA 1ASWA 3V1OA 4QOZB 3OS0A 3V9ZA 2HW3A 4KRFA 2XO7A 3NF7A 3THVA 3CM5A 4UQGA 1C0MA 1EX4A 4M3XA 2Z1JA 3VQEA 4M41A 3F73A 1UAXA 1IG9A 1EP4A 3MXMA 3LZIA 1KLNA 4B08A 2G8VA 3BDPA 4FJJA 3L2VA 4NCGA 1JXEA 4CGDA 3CFRA 4EP4A 3OYNA 3DM2A 2I5JA 3G0ZA 3TAQA 3OS1A 4LY7A 4FYDA 2Z1GA 2W42A 3PX6A 3AVLA 4IDKA 1KRPA 4KTQA 1D8YA 1YTUA 3LWMA 4DTPA 2VG6A 3LP1A 4LSNA 5EU7A 3HXMA 3QINA 4B9VA 2G8UA 1D5AA 3MEGA 4OGCA 2HVIA 1SL2A 4DTNA 1NK6A 3V9XA 1VSJA 4CEDA 1NK0A 2G8IA 1A5XA 3AVNA 4B9TA 4W5NA 5FROA 5KRSA 2PZSA 4CJSA 4CJ3A 4O0JA 4BDYA 4E7LA 5HRPA 4YFUA 4IG0A 4FJ9A 2HMIA 2ZE2A 4OKEA 1VSEA 2B5JA 2EHGA 1XWLA 1BISA 2X6SA 1WSEA 3V6DA 2RN2A 3NAEA 1FKOA 3O3GA 5D3GA 4KB0A 4CEFA 4ELUA 4Z4EA 3HYFA 2YHBA 3MAQA 4JS4A 1KVBA 1ASVA 3C95A 3DOLA 5DK5A 3K5OA 5FRMA 4DF8A 3L8BA 5J2PA 2ZD1A 3V4IA 1VSDA 3KKSA 1WLJA 3K5NA 2O4IA 3TABA 2KW4A 4JRQA 3SUQA 1TGOA 2BANA 3S3NA 4CF8A 1NK9A 4CFDA 1NJYA 3C6TA 3DOKA 1RTHA 4O4GA 3RWUA 3ISNC 4E89A 1TVRA 3MEEA 4M3RA 3ZSZA 3AA5X 2FBYA 1MU2A 1R0AA 5JS1A 1F21A 3O3FA 4K8XA 4KFBA 4FJKA 2RKIA 4LH4A 4CEEA 1X9MA 2NUBA 4DQRA 4CK3A 3DRRA 3I0SA 4DG1A 4DU3A 3PY8A 3LALA 1NKCA 3S3OA 2BE2A 4K8ZA 1HYZA 4E7JA 3HT3A 4DU1A 4E19A 3HP9A 4HUEA 4CGFA 3LP2A 1TL3A 3E01A 1SL0A 3AO4A 1CZBA 3VQ5A 3VQ8A 3CG7A 4FLVA 3OS2A 3T3FA 4JS5A 3TR8A 2GBZA 4FK0A 1JLFA 1ZBUA 3TWHA 1WN7A 4RW7A 4J2BA 3L3VA 1C1AA 1RBRA 1NKEA 1NOYA 4W5OA 3MEDA 2PYLA 2D0CA 4FJIA 3KLFA 5HROA 1ZBFA 4GW6A 3PX4A 1LAWA 1J5OA 3VQAA 2OYQA 4CJVA 4CJQA 4XIUA 3OYKA 1LWEA 3NF9A 4CE9A 4DSFA 2KZMA 1K6YA 4DTJA 1VSFA 1T03A 1KFSA 4OPKA 3TAFA 4EP5A 1LV5A 2IS3A 1FXXA 4BE0A 4WE1A 4ELTA 2GV9A 3RMCA 3G10A 3PO5A 5FRNA 1QE1A 1KCFA 1GOAA 4CJKA 4FK4A 3MXJA 4CEOA 1HYSA 4DTMA 1TV6A 3KIOA 4EZ6A 3VQQA 3OVNA 3DYAA 4E3SA 3OYAA 3S3MA 4PUOA 1X1PA 4IFYA 4LD0A 1S1TA 2WONA 1S9EA 3LPUA 3QO9A 4DLGA 3SZ2A 4DQSA 4DFMA 4F4KA 4H4MA 4Z4IA 1EXQA 4N56A 1RT1A 3D0PA 3AVJA 3QEVA 1T8EA 1L3SA 3OYHA 4J2DA 3RR8A 2VWKA 3OYMA 1L3TA 1GOBA 4CJUA 2OA8A 2XY8A 1SKSA 4Z4FA 2DY4A 3L2UA 4ZHRA 1BCMA 4CHNA 5J2NA 2QXFA 4O0IA 1YTAA 3U3GA 4CGJA 1IKYA 1HJRA 5T7BA 4OLAA 1QQCA 3M8RA 2HHUA 5CY4A 2P51A 3TAEA 1VK0A 4CHPA 1LW0A 3M8PA 4AHTA 1CLQA 2OPQA 4DTUA 3RRHA 1FK9A 4FZZA 4B9NA 5C42A 3AVFA 3ZSXA 2YNIA 4FW2A 3U3YA 5E41A 4BE1A 4KI4A 3DLHA 1JLEA 4CGIA 3NGIA 4DSEA 2B6AA 1I39A 1NK8A 4C8LA 4ID5A 3RTVA 5SWMA 4C8MA 3OYIA 2DTUA 3OYGA 4Y1DA 3TAMA 2F8TA 4E7HA 4EZ9A 3PO4A 2FBTA 2FBXA 2KQ2A 1NKBA 5KI6A 4DSIA 2KFZA 1JLQA 5CZ1A 2HHSA 4E1NA 3BGRA 3SI6A 4CECA 3VQ6A 3OYJA 1RT7A 1DTTA 3ULDA 4FJ5A 4AHUA 4CJ5A 1Q8IA 4M3UA 1RTIA 1BQMA 2YNHA 4MQ3A 4W5QA 4KHUA 2F96A 3DMJA 4CJ4A 2HHTA 1DTQA 1RT5A 1G15A 3T19A 4J2EA 2DFEA 4ZTFA 4IKFA 4CJEA 1EETA 1S6QA 4KO0A 4LSLA 4PA1A 4CIEA 1KVCA 3VQDA 3VQ9A 4KHNA 2E6MA 3WNGA 5HRNA 1BHLA 1FKPA 3TARA 3ZSWA 2Q3SA 3MXIA 1Y97A 1VRTA 4CEZA 4DMNA 3OYBA 3B6OA 2A1RA 4OJRA 1REVA 1TKDA 3KD5E 4DFJA 2ATQA 4F3TA 1RDBA 2QKKA 3WNEA 4IFVA 2OZSA 3IS9A 4CFBA 1VRUA 1NOZA 3JSMA 3SJJA 4FJ7A 1CZ9A 3CFOA 4I2QA 3KJVA 4DTXA 2BDPA 3NH0A 1JLBA 3EZ5A 1HNIA 2YKNA 4NYNA 3IAYA 4BACA 3ZCMA 1ZBIA 3SQ0A 3LZJA 2IOCA 3TI0A 1HMVA 5HRSA 3I0RA 1NK4A 3L2QA 3HJFA 3OY9A 3AA3A 4FLTA 4CIFA 3ZT2A 3OJSA 3PX0A 2D0BA 4M3TA 4PWDA 4FLXA 1KSPA 4FJLA 3KLEA 4CERA 3SV3A 1S1XA 1YVUA 3NH1A 1BIZA 4AILC 4PY5A 3HVTA 3AVCA 1IKVA 4OGEA 3DLRA 1JLAA 1VSMA 2IGIA 2X78A 1GOCA 3NBPA 3KKRA 3VQ4A 1LWCA 4HUGA 1RBUA 4CEBA 3SV4A 4M42A 3HO1A 5I42A 2KTQA 3LDSA 3CFPA 1HPZA 5KRTA 1TKXA 1X9SA 1L3VA 1JLCA 4FJXA 4DS5A 3DI6A 2HHVA 4MFBA 4F2SA 3QEIA 1QSSA 3C6UA 4O55A 3L3UA 4FW1A 2ETJA 1BQNA 3OYLA 3NH2A 3RMBA 4OLBA 4BWJA 3HVRA 4H8KA 4OKJA 4B3OA 3K58A 1KVAA 3ASMA 3NF8A 3K5MA 1I3AA 3PV8A 1L5UA 1B92A 2GUIA 2G8WA 3L2WA 2PYJA 1TAUA 1U45A 3QNNA 3VQCA 3NHGA 2VG7A 4RW8A 2X6NA 3VA3A 1RDAA 4R5PA 3NGZA 1C1CA 1YT3A 1TK5A 2XHBA 4Z4HA 3AO3A 1TK8A 4C8KA 2FBVA 4Z4GA 4CK1A 4CJPA 3AO5A 2G8KA 3AVBA 3ZSQA 1RBVA 4FM1A 4GVMA 2XY6A 1SL1A 2O4GA 4HTUA 1Q9YA 4B9UA 1C0UA 2P5OA 4OPJA 4I9QA 4DSLA 1RBSA 1ITGA 4DQIA 4NCAA 1EKEA 4AHRA 4E0DA 4FZYA 4BE2A 3SUPA 3ZSRA 4CF1A 3V9WA 4RG8A 1QTMA 3K59A 1XHZA 3OYDA 4DU4A 3TAGA 3QEXA 3KK2A 1VSHA 5J2MA 2X74A 3K57A 3V9SA 1XI1A 3OJUA 4H4OA 4O44A 3CYMA 1WSFA 3AVAA 4CJRA 4N47A 4KHYA 4CGGA 2ZQBA 1QS4A 1WNSA 4CEQA 3TANA 1SKWA 4DQPA 2Y1JA 3NE6A 4CCHA 2E4LA 4TSXA 4E7KA 1WAFA 5SZTA 4BDPA 3RR7A 4HHTA 1HQEA 3DLBA 4HUFA 2YHAA 3AV9A 3HK2A 3ZSYA 4G1QA 4RW4A 1JKHA 2LSNA 3SUOA 3V1QA 1UA0A 4FM2A 3SQ1A 1ZBLA 2IC3A 1Z25A 3LANA 3QNOA 3VN5A 3RMAA 3B6PA 3LAKA 2Y1IA 1U48A 4M3YA 2HHXA 1J9AA 3LWLA 3AVMA 2OPSA 4FVMA 4J2AA 1BGXT 3CM6A 2YKMA 2QKBA 1BL3A 2HNYA 1CXQA 4CF9A 1ASUA 3QERA 1N5YA 1RT3A 4DTSA 3IG1A 2A1SA 1X9WA 5C24A 2XY7A 2PY5A 2HHWA 2JGUA 3AVHA 1B9FA 3SUNA 4HCBA 1JL2A 1S9GA 3T1AA 1QHTA 4CF0A 4Q5VA 3V9UA 4DSKA 4PQUA 3NDKA 5J2QA 1S5JA 4JLHA 3HP6A 3ZT3A 5CYMA 4I9LA 4DS4A 1KFDA 2D0AA 1S1UA 1TKZA 3O3HA 1Z26A 5K14A 5KGWA 1BIUA 2F8SA 4FLUA 2DFFA 4FJ8A 2E6LA 3C94A 3RMDA 1T7PA 1WAJA 2DFHA 4ID1A 3ALYA 4KKOA 4B9MA 4F3OA 1TK0A 5J1EA 4DFPA 3L2RA 1QSLA 1LWFA 3UIQA 3V1RA 4DF4A 1IH7A 4FK2A 1SUQA 1O1WA 3JYTA 4CESA 4DTOA 1W0HA 3DRPA 4F8RA 4B9SA 4Q0BA 1VSKA 1BI4A 2BGGA 1RTDA 3QEWA 1UA1A 4DWIA 4Z0UA 4HCCA 1JXBA 1RILA 4IG3A 1QSYA 2EX3A 1RTJA 1VSIA 4RW9A 3OYCA 1RT2A 3KLHA 3FFIA 4HVJA 4DQQA 4L8RB 4E7IA 4B8AB 1J53A 3NCIA 1U4BA 4FLZA 1U49A 4KI6A 2P5GA 4CF2A 1KLMA 1RDDA 2HNDA 3F9KA 3SPZA 4KHSA 3KLGA 4NCBA 1TKTA 4E1MA 3AO1A 3LPTA 4IBNA 4Y1CA 1TL1A 3KLIA 4KPYA 1RNHA 3ZT0A 4DLEA 4KV8A 1IKXA 1BCOA 3ITHA 4I2PA 3AVIA 4OKKA 5HRRA 3WNHA 2YNFA 4LH5A 2B4JA 3NGYA 1TAQA 3KK1A 1CXUA 1S1WA 1VSLA 2Z1HA 4M45A 4DSJA 5I3UA 4CGHA 3KK3A 1W9HA 1C0TA 1N6QA 4CFCA 3QIPA 3HPOA 3KD1E 1C6VA 1S1VA 3A2FA 3TAPA 1KTQA 1DLOA 5CYQA 1RCHA 3SYZA 3HL8A 4CK2A 3HPGA 3HM9A 1B9DA 1C1BA 2Z1IA 3AVGA 5C25A 1NJXA 2OPPA 3WNFA 1JL1A 1RDCA 1XHXA 3OYFA 3ZSOA 3K2PA 1UWBA 5HBMA 3DLGA 3ZT1A 1NK5A 3M8SA 3RRGA 4QCLA 5FDLA 1ZBHA 1WSGA 3AA2A 4AHVA 2OZMA 2VWJA 2ITGA 4BWMA 4AHSA 4CHOA 4I7FA 3SQ4A 1HNVA 3DLEA 2XRIA 4KTWA 3I8DA 4FLWA 2QK9A 2AJQA 4BDZA 4N76A 2HVHA 3S9HA 4AH9A 4CFAA 1NK7A 2YNGA 3O4QA 3P5JA 1RT4A 1WSJA 4GMJB 3ZT4A 4F2RA 4CIGA 1D9DA 2OPRA 4KHQA 4ZTJA 4FJMA 3QLHA 1LW2A 4OVLA 2HB5A 4CHZA 2YV0X 4AHCA 4FJHA 3AA4A 2G8FA 3ZSVA 4YNQA 3VQ7A 2RPIA 4CJWA 2RF2A 4W5TA 4FJNA 4KB1A 4KREA 2R7YA 1HRHA 4N5SA 3CQ8A 4W5RA 3VQBA 3LP3A 4CHYA 4CEAA 3QIOA 3LP0A 4NYFA 4DFKA 4ELVA 1T05A 3DLKA 3D45A 4KTZA 1LAVA 2D5RA 2WOMA 1WSHA 3QEPA 1WSIA 3HPHA 2HHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5V A;  4FJG A;  3HST B;  3VA0 A;  5HLF A;  1UOC A;  4CJT A;  5CZ2 A;  3EY1 A;  2HNZ A;  1U47 A;  4B9L A;  3AO2 A;  5KTQ A;  3M8Q A;  3K5L A;  3MEC A;  3V81 A;  1XC9 A;  1A5W A;  1S6P A;  3NFA A;  1D9F A;  4FM0 A;  4ICL A;  3NF6 A;  1NJZ A;  3SPY A;  3VQP A;  5JS2 A;  4CHQ A;  4B8C A;  1NJW A;  1HYV A;  2VG5 A;  2G8H A;  4FZX C;  3SQ2 A;  3DRS A;  3OYE A;  4CJL A;  3U6F A;  3AVK A;  3P83 D;  5HP1 A;  2IAJ A;  4M3W A;  1BI4 B;  3PUF A;  2KZZ A;  1J54 A;  4KHW A;  1U04 A;  3P1G A;  4C8O A;  4FLY A;  1HQU A;  1IO2 A;  2XY5 A;  1RT6 A;  4N41 A;  4CJF A;  4C8N A;  1IKW A;  1SKR A;  1SV5 A;  3H08 A;  3QET A;  1Q9X A;  3EYZ A;  2FC0 A;  2IDO A;  2KFN A;  5KGX A;  2JLE A;  3LAM A;  3O4N A;  4RW6 A;  3SNN A;  3IRX A;  1L3U A;  3SCX A;  4FXD A;  4M3Z A;  1ZYQ A;  5DMR A;  4JRP A;  2P1J A;  4FCY A;  4KAZ A;  1JLG A;  4DTR A;  4QAG A;  3KTQ A;  1RBT A;  4Z4C A;  4O5B A;  3QES A;  1ASW A;  3V1O A;  4QOZ B;  3OS0 A;  3V9Z A;  2HW3 A;  4KRF A;  2XO7 A;  3NF7 A;  3THV A;  3CM5 A;  4UQG A;  1C0M A;  1EX4 A;  4M3X A;  2Z1J A;  3VQE A;  4M41 A;  3F73 A;  1UAX A;  1IG9 A;  1EP4 A;  3MXM A;  3LZI A;  1KLN A;  4B08 A;  2G8V A;  3BDP A;  4FJJ A;  3L2V A;  4NCG A;  1JXE A;  4CGD A;  3CFR A;  4EP4 A;  3OYN A;  3DM2 A;  2I5J A;  3G0Z A;  3TAQ A;  3OS1 A;  4LY7 A;  4FYD A;  2Z1G A;  2W42 A;  3PX6 A;  3AVL A;  4IDK A;  1KRP A;  4KTQ A;  1D8Y A;  1YTU A;  3LWM A;  4DTP A;  2VG6 A;  3LP1 A;  4LSN A;  5EU7 A;  3HXM A;  3QIN A;  4B9V A;  2G8U A;  1D5A A;  3MEG A;  4OGC A;  2HVI A;  1SL2 A;  4DTN A;  1NK6 A;  3V9X A;  1VSJ A;  4CED A;  1NK0 A;  2G8I A;  1A5X A;  3AVN A;  4B9T A;  4W5N A;  5FRO A;  5KRS A;  2PZS A;  4CJS A;  4CJ3 A;  4O0J A;  4BDY A;  4E7L A;  5HRP A;  4YFU A;  4IG0 A;  4FJ9 A;  2HMI A;  2ZE2 A;  4OKE A;  1VSE A;  2B5J A;  2EHG A;  1XWL A;  1BIS A;  2X6S A;  1WSE A;  3V6D A;  2RN2 A;  3NAE A;  1FKO A;  3O3G A;  5D3G A;  4KB0 A;  4CEF A;  4ELU A;  4Z4E A;  3HYF A;  2YHB A;  3MAQ A;  4JS4 A;  1KVB A;  1ASV A;  3C95 A;  3DOL A;  5DK5 A;  3K5O A;  5FRM A;  4DF8 A;  3L8B A;  5J2P A;  2ZD1 A;  3V4I A;  1VSD A;  3KKS A;  1WLJ A;  3K5N A;  2O4I A;  3TAB A;  2KW4 A;  4JRQ A;  3SUQ A;  1TGO A;  2BAN A;  3S3N A;  4CF8 A;  1NK9 A;  4CFD A;  1NJY A;  3C6T A;  3DOK A;  1RTH A;  4O4G A;  3RWU A;  3ISN C;  4E89 A;  1TVR A;  3MEE A;  4M3R A;  3ZSZ A;  3AA5 X;  2FBY A;  1MU2 A;  1R0A A;  5JS1 A;  1F21 A;  3O3F A;  4K8X A;  4KFB A;  4FJK A;  2RKI A;  4LH4 A;  4CEE A;  1X9M A;  2NUB A;  4DQR A;  4CK3 A;  3DRR A;  3I0S A;  4DG1 A;  4DU3 A;  3PY8 A;  3LAL A;  1NKC A;  3S3O A;  2BE2 A;  4K8Z A;  1HYZ A;  4E7J A;  3HT3 A;  4DU1 A;  4E19 A;  3HP9 A;  4HUE A;  4CGF A;  3LP2 A;  1TL3 A;  3E01 A;  1SL0 A;  3AO4 A;  1CZB A;  3VQ5 A;  3VQ8 A;  3CG7 A;  4FLV A;  3OS2 A;  3T3F A;  4JS5 A;  3TR8 A;  2GBZ A;  4FK0 A;  1JLF A;  1ZBU A;  3TWH A;  1WN7 A;  4RW7 A;  4J2B A;  3L3V A;  1C1A A;  1RBR A;  1NKE A;  1NOY A;  4W5O A;  3MED A;  2PYL A;  2D0C A;  4FJI A;  3KLF A;  5HRO A;  1ZBF A;  4GW6 A;  3PX4 A;  1LAW A;  1J5O A;  3VQA A;  2OYQ A;  4CJV A;  4CJQ A;  4XIU A;  3OYK A;  1LWE A;  3NF9 A;  4CE9 A;  4DSF A;  2KZM A;  1K6Y A;  4DTJ A;  1VSF A;  1T03 A;  1KFS A;  4OPK A;  3TAF A;  4EP5 A;  1LV5 A;  2IS3 A;  1FXX A;  4BE0 A;  4WE1 A;  4ELT A;  2GV9 A;  3RMC A;  3G10 A;  3PO5 A;  5FRN A;  1QE1 A;  1KCF A;  1GOA A;  4CJK A;  4FK4 A;  3MXJ A;  4CEO A;  1HYS A;  4DTM A;  1TV6 A;  3KIO A;  4EZ6 A;  3VQQ A;  3OVN A;  3DYA A;  4E3S A;  3OYA A;  3S3M A;  4PUO A;  1X1P A;  4IFY A;  4LD0 A;  1S1T A;  2WON A;  1S9E A;  3LPU A;  3QO9 A;  4DLG A;  3SZ2 A;  4DQS A;  4DFM A;  4F4K A;  4H4M A;  4Z4I A;  1EXQ A;  4N56 A;  1RT1 A;  3D0P A;  3AVJ A;  3QEV A;  1T8E A;  1L3S A;  3OYH A;  4J2D A;  3RR8 A;  2VWK A;  3OYM A;  1L3T A;  1GOB A;  4CJU A;  2OA8 A;  2XY8 A;  1SKS A;  4Z4F A;  2DY4 A;  3L2U A;  4ZHR A;  1BCM A;  4CHN A;  5J2N A;  2QXF A;  4O0I A;  1YTA A;  3U3G A;  4CGJ A;  1IKY A;  1HJR A;  5T7B A;  4OLA A;  1QQC A;  3M8R A;  2HHU A;  5CY4 A;  2P51 A;  3TAE A;  1VK0 A;  4CHP A;  1LW0 A;  3M8P A;  4AHT A;  1CLQ A;  2OPQ A;  4DTU A;  3RRH A;  1FK9 A;  4FZZ A;  4B9N A;  5C42 A;  3AVF A;  3ZSX A;  2YNI A;  4FW2 A;  3U3Y A;  5E41 A;  4BE1 A;  4KI4 A;  3DLH A;  1JLE A;  4CGI A;  3NGI A;  4DSE A;  2B6A A;  1I39 A;  1NK8 A;  4C8L A;  4ID5 A;  3RTV A;  5SWM A;  4C8M A;  3OYI A;  2DTU A;  3OYG A;  4Y1D A;  3TAM A;  2F8T A;  4E7H A;  4EZ9 A;  3PO4 A;  2FBT A;  2FBX A;  2KQ2 A;  1NKB A;  5KI6 A;  4DSI A;  2KFZ A;  1JLQ A;  5CZ1 A;  2HHS A;  4E1N A;  3BGR A;  3SI6 A;  4CEC A;  3VQ6 A;  3OYJ A;  1RT7 A;  1DTT A;  3ULD A;  4FJ5 A;  4AHU A;  4CJ5 A;  1Q8I A;  4M3U A;  1RTI A;  1BQM A;  2YNH A;  4MQ3 A;  4W5Q A;  4KHU A;  2F96 A;  3DMJ A;  4CJ4 A;  2HHT A;  1DTQ A;  1RT5 A;  1G15 A;  3T19 A;  4J2E A;  2DFE A;  4ZTF A;  4IKF A;  4CJE A;  1EET A;  1S6Q A;  4KO0 A;  4LSL A;  4PA1 A;  4CIE A;  1KVC A;  3VQD A;  3VQ9 A;  4KHN A;  2E6M A;  3WNG A;  5HRN A;  1BHL A;  1FKP A;  3TAR A;  3ZSW A;  2Q3S A;  3MXI A;  1Y97 A;  1VRT A;  4CEZ A;  4DMN A;  3OYB A;  3B6O A;  2A1R A;  4OJR A;  1REV A;  1TKD A;  3KD5 E;  4DFJ A;  2ATQ A;  4F3T A;  1RDB A;  2QKK A;  3WNE A;  4IFV A;  2OZS A;  3IS9 A;  4CFB A;  1VRU A;  1NOZ A;  3JSM A;  3SJJ A;  4FJ7 A;  1CZ9 A;  3CFO A;  4I2Q A;  3KJV A;  4DTX A;  2BDP A;  3NH0 A;  1JLB A;  3EZ5 A;  1HNI A;  2YKN A;  4NYN A;  3IAY A;  4BAC A;  3ZCM A;  1ZBI A;  3SQ0 A;  3LZJ A;  2IOC A;  3TI0 A;  1HMV A;  5HRS A;  3I0R A;  1NK4 A;  3L2Q A;  3HJF A;  3OY9 A;  3AA3 A;  4FLT A;  4CIF A;  3ZT2 A;  3OJS A;  3PX0 A;  2D0B A;  4M3T A;  4PWD A;  4FLX A;  1KSP A;  4FJL A;  3KLE A;  4CER A;  3SV3 A;  1S1X A;  1YVU A;  3NH1 A;  1BIZ A;  4AIL C;  4PY5 A;  3HVT A;  3AVC A;  1IKV A;  4OGE A;  3DLR A;  1JLA A;  1VSM A;  2IGI A;  2X78 A;  1GOC A;  3NBP A;  3KKR A;  3VQ4 A;  1LWC A;  4HUG A;  1RBU A;  4CEB A;  3SV4 A;  4M42 A;  3HO1 A;  5I42 A;  2KTQ A;  3LDS A;  3CFP A;  1HPZ A;  5KRT A;  1TKX A;  1X9S A;  1L3V A;  1JLC A;  4FJX A;  4DS5 A;  3DI6 A;  2HHV A;  4MFB A;  4F2S A;  3QEI A;  1QSS A;  3C6U A;  4O55 A;  3L3U A;  4FW1 A;  2ETJ A;  1BQN A;  3OYL A;  3NH2 A;  3RMB A;  4OLB A;  4BWJ A;  3HVR A;  4H8K A;  4OKJ A;  4B3O A;  3K58 A;  1KVA A;  3ASM A;  3NF8 A;  3K5M A;  1I3A A;  3PV8 A;  1L5U A;  1B92 A;  2GUI A;  2G8W A;  3L2W A;  2PYJ A;  1TAU A;  1U45 A;  3QNN A;  3VQC A;  3NHG A;  2VG7 A;  4RW8 A;  2X6N A;  3VA3 A;  1RDA A;  4R5P A;  3NGZ A;  1C1C A;  1YT3 A;  1TK5 A;  2XHB A;  4Z4H A;  3AO3 A;  1TK8 A;  4C8K A;  2FBV A;  4Z4G A;  4CK1 A;  4CJP A;  3AO5 A;  2G8K A;  3AVB A;  3ZSQ A;  1RBV A;  4FM1 A;  4GVM A;  2XY6 A;  1SL1 A;  2O4G A;  4HTU A;  1Q9Y A;  4B9U A;  1C0U A;  2P5O A;  4OPJ A;  4I9Q A;  4DSL A;  1RBS A;  1ITG A;  4DQI A;  4NCA A;  1EKE A;  4AHR A;  4E0D A;  4FZY A;  4BE2 A;  3SUP A;  3ZSR A;  4CF1 A;  3V9W A;  4RG8 A;  1QTM A;  3K59 A;  1XHZ A;  3OYD A;  4DU4 A;  3TAG A;  3QEX A;  3KK2 A;  1VSH A;  5J2M A;  2X74 A;  3K57 A;  3V9S A;  1XI1 A;  3OJU A;  4H4O A;  4O44 A;  3CYM A;  1WSF A;  3AVA A;  4CJR A;  4N47 A;  4KHY A;  4CGG A;  2ZQB A;  1QS4 A;  1WNS A;  4CEQ A;  3TAN A;  1SKW A;  4DQP A;  2Y1J A;  3NE6 A;  4CCH A;  2E4L A;  4TSX A;  4E7K A;  1WAF A;  5SZT A;  4BDP A;  3RR7 A;  4HHT A;  1HQE A;  3DLB A;  4HUF A;  2YHA A;  3AV9 A;  3HK2 A;  3ZSY A;  4G1Q A;  4RW4 A;  1JKH A;  2LSN A;  3SUO A;  3V1Q A;  1UA0 A;  4FM2 A;  3SQ1 A;  1ZBL A;  2IC3 A;  1Z25 A;  3LAN A;  3QNO A;  3VN5 A;  3RMA A;  3B6P A;  3LAK A;  2Y1I A;  1U48 A;  4M3Y A;  2HHX A;  1J9A A;  3LWL A;  3AVM A;  2OPS A;  4FVM A;  4J2A A;  1BGX T;  3CM6 A;  2YKM A;  2QKB A;  1BL3 A;  2HNY A;  1CXQ A;  4CF9 A;  1ASU A;  3QER A;  1N5Y A;  1RT3 A;  4DTS A;  3IG1 A;  2A1S A;  1X9W A;  5C24 A;  2XY7 A;  2PY5 A;  2HHW A;  2JGU A;  3AVH A;  1B9F A;  3SUN A;  4HCB A;  1JL2 A;  1S9G A;  3T1A A;  1QHT A;  4CF0 A;  4Q5V A;  3V9U A;  4DSK A;  4PQU A;  3NDK A;  5J2Q A;  1S5J A;  4JLH A;  3HP6 A;  3ZT3 A;  5CYM A;  4I9L A;  4DS4 A;  1KFD A;  2D0A A;  1S1U A;  1TKZ A;  3O3H A;  1Z26 A;  5K14 A;  5KGW A;  1BIU A;  2F8S A;  4FLU A;  2DFF A;  4FJ8 A;  2E6L A;  3C94 A;  3RMD A;  1T7P A;  1WAJ A;  2DFH A;  4ID1 A;  3ALY A;  4KKO A;  4B9M A;  4F3O A;  1TK0 A;  5J1E A;  4DFP A;  3L2R A;  1QSL A;  1LWF A;  3UIQ A;  3V1R A;  4DF4 A;  1IH7 A;  4FK2 A;  1SUQ A;  1O1W A;  3JYT A;  4CES A;  4DTO A;  1W0H A;  3DRP A;  4F8R A;  4B9S A;  4Q0B A;  1VSK A;  1BI4 A;  2BGG A;  1RTD A;  3QEW A;  1UA1 A;  4DWI A;  4Z0U A;  4HCC A;  1JXB A;  1RIL A;  4IG3 A;  1QSY A;  2EX3 A;  1RTJ A;  1VSI A;  4RW9 A;  3OYC A;  1RT2 A;  3KLH A;  3FFI A;  4HVJ A;  4DQQ A;  4L8R B;  4E7I A;  4B8A B;  1J53 A;  3NCI A;  1U4B A;  4FLZ A;  1U49 A;  4KI6 A;  2P5G A;  4CF2 A;  1KLM A;  1RDD A;  2HND A;  3F9K A;  3SPZ A;  4KHS A;  3KLG A;  4NCB A;  1TKT A;  4E1M A;  3AO1 A;  3LPT A;  4IBN A;  4Y1C A;  1TL1 A;  3KLI A;  4KPY A;  1RNH A;  3ZT0 A;  4DLE A;  4KV8 A;  1IKX A;  1BCO A;  3ITH A;  4I2P A;  3AVI A;  4OKK A;  5HRR A;  3WNH A;  2YNF A;  4LH5 A;  2B4J A;  3NGY A;  1TAQ A;  3KK1 A;  1CXU A;  1S1W A;  1VSL A;  2Z1H A;  4M45 A;  4DSJ A;  5I3U A;  4CGH A;  3KK3 A;  1W9H A;  1C0T A;  1N6Q A;  4CFC A;  3QIP A;  3HPO A;  3KD1 E;  1C6V A;  1S1V A;  3A2F A;  3TAP A;  1KTQ A;  1DLO A;  5CYQ A;  1RCH A;  3SYZ A;  3HL8 A;  4CK2 A;  3HPG A;  3HM9 A;  1B9D A;  1C1B A;  2Z1I A;  3AVG A;  5C25 A;  1NJX A;  2OPP A;  3WNF A;  1JL1 A;  1RDC A;  1XHX A;  3OYF A;  3ZSO A;  3K2P A;  1UWB A;  5HBM A;  3DLG A;  3ZT1 A;  1NK5 A;  3M8S A;  3RRG A;  4QCL A;  5FDL A;  1ZBH A;  1WSG A;  3AA2 A;  4AHV A;  2OZM A;  2VWJ A;  2ITG A;  4BWM A;  4AHS A;  4CHO A;  4I7F A;  3SQ4 A;  1HNV A;  3DLE A;  2XRI A;  4KTW A;  3I8D A;  4FLW A;  2QK9 A;  2AJQ A;  4BDZ A;  4N76 A;  2HVH A;  3S9H A;  4AH9 A;  4CFA A;  1NK7 A;  2YNG A;  3O4Q A;  3P5J A;  1RT4 A;  1WSJ A;  4GMJ B;  3ZT4 A;  4F2R A;  4CIG A;  1D9D A;  2OPR A;  4KHQ A;  4ZTJ A;  4FJM A;  3QLH A;  1LW2 A;  4OVL A;  2HB5 A;  4CHZ A;  2YV0 X;  4AHC A;  4FJH A;  3AA4 A;  2G8F A;  3ZSV A;  4YNQ A;  3VQ7 A;  2RPI A;  4CJW A;  2RF2 A;  4W5T A;  4FJN A;  4KB1 A;  4KRE A;  2R7Y A;  1HRH A;  4N5S A;  3CQ8 A;  4W5R A;  3VQB A;  3LP3 A;  4CHY A;  4CEA A;  3QIO A;  3LP0 A;  4NYF A;  4DFK A;  4ELV A;  1T05 A;  3DLK A;  3D45 A;  4KTZ A;  1LAV A;  2D5R A;  2WOM A;  1WSH A;  3QEP A;  1WSI A;  3HPH A;  2HHQ A; 
#chains in the Genus database with same CATH topology
 3OBY A;  4FJG A;  3EZW A;  4FWK A;  3HST B;  4NB4 A;  1U47 A;  4B9L A;  4OPH A;  3EKU A;  3MEC A;  1D9F A;  3NF6 A;  1NJZ A;  3SPY A;  4BR9 A;  5DM6 L;  4MLE A;  2G8H A;  3SQ2 A;  1OH6 A;  2QWL A;  3OYE A;  3U6F A;  3AY9 A;  5HP1 A;  3PUF A;  1NMD A;  1ATS A;  1U04 A;  1RT6 A;  4N41 A;  3CHW A;  4C8N A;  3QET A;  1Q9X A;  1TUY A;  1NWK A;  5KGX A;  3TPQ A;  2JLE A;  3O4N A;  5ADX H;  2GEM A;  3U9Z A;  5DMR A;  4GVE A;  4FCY A;  4KAZ A;  1JLG A;  1RBT A;  4Z4C A;  3QES A;  3PIO L;  1MA9 B;  3OS0 A;  2A42 A;  3V9Z A;  2HW3 A;  3CM5 A;  3I56 N;  4M3X A;  3VQE A;  3F73 A;  4BRE A;  1HUX A;  5TKW A;  4B3M K;  4CGD A;  4EP4 A;  1QQN A;  4PKH A;  3DM2 A;  3G0Z A;  1SS6 A;  3OS1 A;  2W42 A;  3PX6 A;  4KTQ A;  1YTU A;  4B9V A;  3LP1 A;  3HXM A;  1N33 K;  4BC4 A;  2G8I A;  1NK0 A;  4A5A A;  4JYA K;  5EVZ A;  1XNR K;  5KRS A;  2PZS A;  4CJS A;  4CJ3 A;  3ATU A;  3TTD A;  2E8A A;  3I55 N;  3BY5 A;  1QQO A;  1VSE A;  1XWL A;  2ZGZ A;  1WSE A;  3V6D A;  4FWS A;  4CEF A;  4ELU A;  1JCG A;  5TKY A;  3C95 A;  1ASV A;  4JI2 K;  4DF8 A;  2ZD1 A;  3TSP A;  3DJC A;  2IIR A;  1NJY A;  3C6T A;  4YDU C;  2FSJ A;  4LFB K;  4HWI A;  1EWQ A;  4M3R A;  3AA5 X;  3CME N;  3O6W A;  5KPR A;  4FJK A;  4LH4 A;  4CEE A;  1X9M A;  3F2K A;  4DQR A;  2UUA K;  2P9K A;  4DU3 A;  3CCJ N;  3LAL A;  2UUC K;  1NKC A;  5GAG P;  4PKG A;  5AQS A;  3H1Q A;  2P9S A;  3W3D A;  2D1K A;  3VQ8 A;  2Q0U A;  4FK0 A;  3AGR A;  4BC5 A;  1VQ8 N;  1C1A A;  1RBR A;  3CCE N;  4W5O A;  3PX4 A;  3MMV A;  2OYQ A;  1T3V A;  1LWE A;  3E1Y A;  1T03 A;  1KFS A;  4EP5 A;  2IS3 A;  2GWJ A;  4BE0 A;  3THY A;  2GV9 A;  2UXC K;  1GLL O;  3RSE B;  1QE1 A;  3JAM O;  3FZM A;  5LJV A;  3U9D A;  2QI2 A;  4C1N I;  3CCL N;  1S1T A;  4DLG A;  1S9E A;  4DQS A;  4PL7 A;  3O08 A;  1EXQ A;  3D0P A;  1T8E A;  3OYH A;  3C7N B;  4NXM K;  3SJH A;  1GOB A;  2OA8 A;  2XY8 A;  3L2U A;  4DR3 K;  2QXF A;  1VQL N;  3RVC A;  4O0I A;  5T7B A;  3VF4 A;  1BU6 O;  5AJ3 K;  1QQC A;  4JI6 K;  1EQY A;  3RRH A;  4B9N A;  3AVF A;  3ZSX A;  2YNI A;  4IDH A;  4DKW A;  4BGA A;  4IEI A;  2WTU A;  4DSE A;  1G99 A;  5HL7 L;  4CJ7 A;  5EXW A;  3C65 A;  3CJB A;  2UXD K;  2O8C A;  2FBT A;  1HJO A;  2KQ2 A;  4JKG A;  1JLQ A;  4E1N A;  1XNQ K;  4BR4 A;  2P9I A;  3FGU A;  4CEC A;  4FJ5 A;  4CJ5 A;  4W5Q A;  4YY3 K;  2RE2 A;  4B3T K;  4JNE A;  1U2V B;  1OKJ A;  4IKF A;  3WNG A;  3OHR A;  4DMN A;  2A1R A;  4OJR A;  3ID8 A;  4F3T A;  4CFB A;  3SJJ A;  2QK9 A;  3HO1 A;  3KJV A;  2BDP A;  1HNI A;  3IAY A;  5KPT A;  4BAC A;  3ZCM A;  2P9L A;  3LZJ A;  2IOC A;  5HRS A;  3HJF A;  3L2Q A;  2RHK A;  4FJL A;  5E26 A;  1YVU A;  3NH1 A;  5AQQ A;  5FPD A;  4OGE A;  3UKU B;  1YXQ A;  2IGI A;  1NGJ A;  3G4S N;  1RBU A;  4FSV A;  1QHA A;  3C6A A;  5KRT A;  3G71 N;  3N4P A;  4FJX A;  3DI6 A;  3T1H K;  3C6U A;  3L3U A;  4A2A A;  4DB3 A;  3OYL A;  3NH2 A;  5HOO A;  4K43 A;  4DV7 K;  4NLC A;  3K58 A;  4PL8 A;  3ULE A;  3O9T A;  3K5M A;  3PV8 A;  1L5U A;  1TYQ B;  2GUI A;  2G8W A;  3VQC A;  3CER A;  2D4W A;  2VG7 A;  1TK5 A;  1YT3 A;  2VQE K;  3AO3 A;  2FBV A;  1RBV A;  1Q9Y A;  2E2N A;  4WFN L;  1OH5 A;  1RBS A;  4DQI A;  3D2E B;  4E0D A;  1QTM A;  3K59 A;  4DU4 A;  3TAG A;  1DKG D;  1XI1 A;  2ZGY A;  3AVA A;  3MWT A;  5EOY A;  4CJR A;  1YIT N;  4KHY A;  5M1O A;  1QS4 A;  4CCH A;  2E4L A;  4E7K A;  3GOI A;  5SZT A;  4JKE A;  3RR7 A;  4NLB A;  1VQ9 N;  2YHA A;  3L6Q A;  4G1Q A;  1VQM N;  1SQK A;  3ZET A;  3SUO A;  3V1Q A;  1UA0 A;  2A40 A;  1RGI A;  1Z25 A;  3A5L C;  3IKM A;  4BGB A;  1C0G A;  5M1Q A;  4FVM A;  4J2A A;  2HNY A;  1CXQ A;  3QER A;  4FWQ A;  1RDU A;  3IG1 A;  2QM1 A;  2O8B A;  2A1S A;  2P9P A;  2XY7 A;  4BRK A;  2HBM A;  4BRP A;  2JGU A;  1B9F A;  4BRC A;  4HCB A;  3SAF A;  3T1A A;  4CF0 A;  3V9U A;  5J2Q A;  1S5J A;  4M7X A;  3HP6 A;  4ILH A;  1ATN A;  2QWQ A;  1T7P A;  3DAW A;  2DFH A;  4B9M A;  1TK0 A;  5J1E A;  4DFP A;  2FSN A;  3C6H A;  3UIQ A;  3V1R A;  1O1W A;  4DTO A;  4DR1 K;  4Q0B A;  4FWM A;  3WUH A;  1RTD A;  2BGG A;  3WEE B;  5AFU A;  1RT2 A;  4FOI A;  2NZT A;  5CHI A;  3BZC A;  1U4B A;  2P5G A;  1RDD A;  1IV0 A;  3EN9 A;  1W2B M;  4RCH A;  3VTI A;  4JI7 K;  1RNH A;  1IKX A;  1BCO A;  3IMX A;  3AVI A;  3VER A;  3VEX A;  2B4J A;  3NGY A;  2NRX A;  4B3R K;  4M45 A;  3THY B;  5I3U A;  1JCE A;  1GLB G;  1C6V A;  3D6R A;  2CGK A;  1KTQ A;  2NRV A;  3SYZ A;  1WB9 A;  3HM9 A;  2Z1I A;  2BTF A;  3MN6 A;  3AVG A;  5C25 A;  1NJX A;  3WNF A;  2BH1 A;  1M90 O;  3IFR A;  3WQU A;  3DLG A;  1NK5 A;  4QCL A;  3ZYY X;  1WSG A;  1Q18 A;  4F9O A;  4WQ4 C;  2OZM A;  2ITG A;  4CHO A;  1XUP O;  5JMV A;  4KTW A;  3DLE A;  2XRI A;  2HVH A;  1E4F T;  4CFA A;  3ZT4 A;  4CBU A;  4KHQ A;  4OVL A;  2YHY A;  4IO8 A;  2YV0 X;  3A5O C;  4AHC A;  3ZSV A;  4H5T A;  4YNQ A;  4FPB A;  4W5T A;  4FJN A;  5ELZ A;  3VQB A;  1NGE A;  4A59 A;  4NYF A;  4ELV A;  1LAV A;  3AGK A;  2HBL A;  3HOT A;  2WOM A;  1WSI A;  2HHQ A;  2D0O A;  1A5V A;  4JKG B;  3VA0 A;  4X65 K;  2A41 A;  3EY1 A;  3OBW A;  4K41 A;  3V81 A;  4FM0 A;  5AQZ A;  5BPM A;  3O9Q A;  4CHQ A;  2VG5 A;  4FZX C;  3AVK A;  3O80 A;  3P83 D;  5BPN A;  1E4G T;  1HQU A;  1IO2 A;  2WC9 A;  4YHH K;  4CJF A;  1IKW A;  1SV5 A;  3H08 A;  1WBD A;  2F9W A;  4RW6 A;  4AM7 A;  4H5V A;  3SCX A;  3QML A;  4M3Z A;  5AR0 A;  4FXD A;  2E20 A;  5C10 A;  3I33 A;  3KTQ A;  3MK6 A;  2W40 A;  1ASW A;  3M3Z A;  4KRF A;  3THV A;  5C2D A;  1UAX A;  2E88 A;  1IG9 A;  3LZI A;  2YI1 A;  5JVG L;  4FJJ A;  3L2V A;  3C7N A;  2I5J A;  3CXC M;  3TAQ A;  1DGK N;  2Z1G A;  4IDK A;  3ULE B;  3FE1 A;  2VG6 A;  4JKH A;  4LSN A;  3QIN A;  1HKG A;  4CD3 A;  2G8U A;  1D5A A;  3MEG A;  3CCR N;  4DTN A;  3CJC A;  4H5R A;  1ATR A;  4LF5 K;  2FF3 B;  3AVN A;  4B9T A;  3H45 C;  3B8A X;  1NMN A;  2HBJ A;  5AQJ A;  4IG0 A;  4FJ9 A;  2HMI A;  3BEX A;  3MWP A;  3NAE A;  4LF9 K;  5D3G A;  1X3N A;  4BQZ A;  4GV6 A;  5AQN A;  3EO3 A;  1KVB A;  4BRA A;  4UY8 O;  5FRM A;  3BF1 A;  3L8B A;  5J2P A;  3UB5 A;  4FL9 A;  4H5N A;  3TAB A;  4JRQ A;  2BAN A;  5AFU H;  3PIP L;  1NK9 A;  4G9Z A;  4A57 A;  4O4G A;  2E1Y A;  4DR7 K;  1NGA A;  3MEE A;  1MU2 A;  4K8X A;  4DUZ K;  2QXL A;  2NUB A;  3ZET B;  3PSF A;  3S3O A;  1YJW N;  4K8Z A;  1HYZ A;  4E7J A;  4DU1 A;  4H0O A;  3AO4 A;  4JI0 K;  3VQ5 A;  4DV6 K;  3CG7 A;  4FLV A;  1Z6R A;  4AM6 A;  3T3F A;  3O8M A;  2QWM A;  3TR8 A;  4RW7 A;  3DLL L;  4J2B A;  2GWK A;  2P9P B;  4FJI A;  4GW6 A;  4CJQ A;  4XIU A;  4CE9 A;  1NU0 A;  4CVN E;  3FR0 A;  1OVQ A;  5M1P A;  3JXU A;  1VQ5 N;  4X66 K;  3CJ9 A;  5DM7 L;  3RMC A;  4FK4 A;  4DR4 K;  3MXJ A;  4CEO A;  4DTM A;  1KD1 O;  1TV6 A;  3KIO A;  4EZ6 A;  3VQQ A;  4KH6 A;  3DYA A;  4E3S A;  3OYA A;  4B9Q A;  1X1P A;  2WON A;  3ENH A;  3QO9 A;  3A5M C;  4ISG A;  1TYQ A;  4H4M A;  5AQP A;  5EY4 A;  1IBL K;  3QEV A;  5C12 A;  3CF5 L;  2VWK A;  1L3T A;  4BR7 A;  2FF6 A;  3AAR A;  4CHN A;  2YHX A;  3WXL A;  4CGJ A;  1IKY A;  1HJR A;  4OLA A;  4B1Y B;  3M8R A;  4CI6 A;  3ATV A;  3D2E A;  4CHP A;  1CLQ A;  4AHT A;  3MN5 A;  4YOV A;  4DTU A;  2WUS A;  4FZZ A;  5C42 A;  4BE1 A;  4KI4 A;  3CET A;  3LDL A;  1JLE A;  3DLH A;  1YVN A;  2B6A A;  1I39 A;  4KHP K;  4ID5 A;  3RTV A;  3OYG A;  1QZ6 A;  4GV3 A;  3TAM A;  2ASM A;  2JWL A;  2PBD A;  3HBT A;  3PO4 A;  2FBX A;  4EZ9 A;  3GE1 A;  1VQP N;  1QZ5 A;  2HHS A;  3BGR A;  4YOT A;  3VQ6 A;  1BO5 O;  1DTT A;  2PFU A;  5LJW A;  4CZJ A;  3DXM B;  5GAD P;  3L4I A;  4M3U A;  1BQM A;  2YNH A;  4KHU A;  4JKF A;  4O8U A;  4CJ4 A;  3DMJ A;  1HNW K;  5IT9 O;  2V7Y A;  1RT5 A;  4J2E A;  1G15 A;  2DFE A;  4ZTF A;  2JWK A;  4CJE A;  1H1V A;  1EET A;  1S6Q A;  4KO0 A;  3VQD A;  3VQ9 A;  2E6M A;  5HRN A;  3E66 A;  5BPL A;  1Y97 A;  4CEZ A;  3VPZ A;  3OYB A;  1RDB A;  4LFC K;  2QKK A;  2OZS A;  4IFV A;  4XEI A;  1NOZ A;  3NH0 A;  1JLB A;  3EZ5 A;  4NYN A;  1ZBI A;  4DV5 K;  3TI0 A;  1WUA A;  2V51 B;  3O1W A;  1GLJ O;  4CIF A;  5AQI A;  3ZT2 A;  3J81 O;  2D0B A;  3OJS A;  4PWD A;  1KSP A;  1C0F A;  2ASP A;  3BZK A;  1S1X A;  4A61 A;  1BIZ A;  4PY5 A;  2W41 A;  5EX5 A;  4CZI A;  1VSM A;  2X78 A;  3SV4 A;  3KKR A;  4M42 A;  2KTQ A;  4X64 K;  1KXP A;  4YOY A;  1HPZ A;  1X9S A;  1L3V A;  1JLC A;  1ILY A;  1LCU A;  4F2S A;  3WEE A;  1E3M A;  5JLH A;  4O55 A;  4IZ9 A;  1BQN A;  4FOE A;  1NGF A;  5GIP A;  4OLB A;  4BWJ A;  1BWF O;  1KVA A;  3ASM A;  5AQF A;  2I7N A;  3L2W A;  3R9P A;  3QNN A;  1U45 A;  3P38 A;  3Q7C A;  3F5T A;  1ZXO A;  1GLE G;  4BVO A;  3GG4 A;  3ZSQ A;  4GVM A;  2P5O A;  4HTU A;  4DSL A;  5AQW A;  5B8H A;  1J6Z A;  3WT0 A;  4BE2 A;  3V9W A;  3SK3 A;  5BN8 A;  3KK2 A;  2PAV A;  2OTJ N;  5J2M A;  2X74 A;  3K57 A;  3V9S A;  3R1X A;  4JEP A;  3CYM A;  2ASO A;  4CGG A;  2ZQB A;  1KQS M;  1WNS A;  4CEQ A;  1SKW A;  4JV5 K;  3H6E A;  3K0S A;  4BDP A;  4HHT A;  5F2R A;  3DLB A;  4HUF A;  3HK2 A;  3AV9 A;  3ZSY A;  4JI4 K;  4RW4 A;  3EEQ A;  1LOT B;  3NVM A;  3B6P A;  3LAK A;  1U48 A;  4M3Y A;  3AVM A;  5GAE P;  1BGX T;  2YKM A;  2QKB A;  1BL3 A;  1OVY A;  4CF9 A;  3O5B A;  2ZM6 K;  1N5Y A;  4LFA K;  3O9U A;  3SAG A;  1X9W A;  3AVH A;  3SUN A;  1IBM K;  4IOX A;  3NDK A;  4JLH A;  3QB0 A;  3ZT3 A;  1N34 K;  2ZJQ L;  3SBT A;  4IOA L;  5AQX A;  4CZM A;  5K14 A;  4B1U B;  4FLU A;  3C94 A;  2GUP A;  1WAJ A;  4KKO A;  2NRR A;  3L2R A;  4DF4 A;  4FK2 A;  2P9N A;  4CES A;  1W0H A;  2CH6 A;  4GY2 B;  2QWO A;  4FWN A;  4DR6 K;  1RTJ A;  1SZ2 A;  1VSI A;  3DXK B;  3KLH A;  3FFI A;  4L8R B;  3H1V X;  4EAH D;  1U49 A;  1KAX A;  1KLM A;  2HND A;  5BN9 A;  4U7B A;  4NCB A;  1TKT A;  3J80 O;  3LPT A;  1VQO N;  4Y1C A;  3KLI A;  2D0P A;  5CR4 A;  3T7Z A;  4CZF A;  4DLE A;  1T44 A;  5AQY A;  5FLX O;  3WNH A;  2QTD A;  3EKS A;  2E2Q A;  1CXU A;  2ZJP L;  1VSL A;  3CCM N;  4JHD A;  4WQ4 A;  3KK3 A;  3AAQ A;  1VQ4 N;  3A2F A;  3HL8 A;  5I9E B;  4JI8 K;  4ILG B;  1JL1 A;  3EE8 A;  3ZSO A;  3K2P A;  4DR5 K;  2O8E A;  3G6E N;  3M8S A;  5FDL A;  4AF1 A;  3AA2 A;  1ZBH A;  2VWJ A;  4BWM A;  1GLC G;  3SQ4 A;  5LMU K;  4FLW A;  2QEX N;  2AJQ A;  4BDZ A;  3QFU A;  1NK7 A;  2YNG A;  4GMJ B;  1BG3 A;  4F2R A;  1R59 O;  1D9D A;  2O8F B;  4FJM A;  3QLH A;  1LW2 A;  2HB5 A;  4CHZ A;  4IO9 L;  4K25 A;  4WQ5 C;  3VQ7 A;  1P90 A;  2RPI A;  3R8E A;  2GX9 A;  5JLF A;  2ZJR L;  3LP3 A;  3QIO A;  3LP0 A;  2EWS A;  2Q36 A;  4KTZ A;  3G25 A;  2D5R A;  3E9P A;  3QEP A;  1XMQ K;  1NK6 A;  4O8K A;  1NNE A;  5HLF A;  3FZK A;  1UOC A;  4CJT A;  5C15 A;  2HNZ A;  3AO2 A;  5MLC Q;  3M8Q A;  3K5L A;  1A5W A;  3QIC A;  4M63 C;  3QBW A;  3NFA A;  5KPZ A;  4LF6 K;  4ICL A;  3KWI A;  1KAZ A;  3VQP A;  5JS2 A;  3CCQ N;  4B8C A;  1HYV A;  5KQD A;  4KH5 A;  5C0Y A;  4JI3 K;  2IAJ A;  4EFH A;  4M3W A;  2KZZ A;  1J54 A;  4KHW A;  3O4W A;  3P1G A;  1RFQ A;  2XY5 A;  4BRH A;  1SKR A;  2NRZ A;  2FC0 A;  2IDO A;  4NXN K;  3LAM A;  4IWV A;  3SNN A;  4XH1 A;  2P1J A;  4DTR A;  2Q31 A;  1VQK N;  4QOZ B;  4JK7 A;  4UQG A;  1C0M A;  2Z1J A;  2CH5 A;  1EP4 A;  3MXM A;  1KLN A;  2QW9 A;  3J8A A;  1NBW A;  3OYN A;  5JVH L;  4LY7 A;  4FYD A;  4MDB A;  2KHO A;  1KRP A;  1D8Y A;  4DTP A;  1ZC6 A;  5EU7 A;  3J7Z O;  4OGC A;  3TTC A;  4BRQ A;  4YOW A;  3V9X A;  1VHX A;  3THX A;  5FRO A;  4O0J A;  4BDY A;  4E7L A;  5HRP A;  4YFU A;  2ZE2 A;  4OKE A;  2B5J A;  2A5X A;  2EHG A;  1NGH A;  1BIS A;  3GDQ A;  1FKO A;  3O3G A;  4KB0 A;  1VAZ A;  3M6G A;  3HYF A;  3ENB A;  3MAQ A;  4JS4 A;  3DOL A;  1HPM A;  4IEE A;  1T6D A;  3U4L A;  5FPM A;  3V4I A;  3KKS A;  1WLJ A;  3EL2 A;  3K5N A;  3SUQ A;  2KW4 A;  3S3N A;  1TGO A;  3DXM A;  3DOK A;  4Z94 A;  3RWU A;  3ISN C;  4E89 A;  2IVO A;  1TVR A;  1F21 A;  3K9K A;  4KFB A;  2RKI A;  3TTF A;  5AZI A;  1N8R O;  3VGK A;  2A6A A;  3HT3 A;  4E19 A;  2FSK A;  4CGF A;  4XH4 A;  2VCP A;  3OS2 A;  4JS5 A;  2V7Z A;  2GBZ A;  5AQG A;  3O1B A;  1JLF A;  2Q0R A;  3TWH A;  3THW A;  1MWK A;  1NKE A;  1NOY A;  3MED A;  3VMF B;  3C0B A;  3KLF A;  4CJV A;  1NM1 A;  4BG8 A;  4DSF A;  3D2F B;  3ZX0 A;  3CC7 N;  4DTJ A;  1VSF A;  3D7E O;  4BVP A;  4WE1 A;  3CI5 A;  4ELT A;  1XQS C;  2YX6 A;  1Q86 O;  3G10 A;  2V52 B;  2KLA A;  1KCF A;  1XC3 A;  1GOA A;  1HYS A;  2P9N B;  4U67 L;  4H0V B;  3S3M A;  3OW2 M;  3SZ2 A;  4AQY K;  4DFM A;  4N56 A;  3AVJ A;  1L3S A;  4J2D A;  1NGG A;  2WBN A;  1SKS A;  4Z4F A;  5J2N A;  4C1N K;  2I7P A;  3CQX A;  1YI2 N;  1YTA A;  3UKR A;  1BDG A;  3Q7B A;  4WCE L;  4YOR A;  4IJA A;  5CY4 A;  1LW0 A;  3M8P A;  4X62 K;  2OPQ A;  3HM8 A;  3VF6 A;  3U3Y A;  3P39 A;  5E41 A;  4CGI A;  2F7T A;  3NGI A;  1XMO K;  3O9S A;  4JHD B;  4XH5 A;  3VEZ A;  5SWM A;  2UXB K;  4Y1D A;  1WBB A;  1VQ6 N;  3VEV A;  4H0T B;  3K9J A;  4E7H A;  2QWN A;  2KFZ A;  5KI6 A;  3BP8 A;  3AAP A;  3ULD A;  2VGN A;  3ENO A;  3HI0 A;  3O9R A;  2O8E B;  2YJE A;  2F96 A;  5F0X A;  2HHT A;  5M1K A;  3T19 A;  4FO0 A;  1VQN N;  3CCS N;  4CIE A;  4LSL A;  3MX5 A;  4KHN A;  1FKP A;  3GL1 A;  2Q3S A;  1K73 O;  1OH8 A;  3B6O A;  3A8Y A;  2F9T A;  4YDU A;  3IS9 A;  1VRU A;  5JS1 A;  1CZ9 A;  4EHU A;  3R3L A;  4CD1 A;  1W7A A;  2KKZ A;  1NK4 A;  1HMV A;  3I0R A;  3N4Q A;  3OY9 A;  3AA3 A;  3F9M A;  4FLT A;  3PX0 A;  1IBK K;  3KLE A;  4CER A;  3SV3 A;  3CJA A;  2ZF5 O;  3WXI A;  3HVT A;  1IKV A;  2CGL A;  3DLR A;  1JLA A;  1MWM A;  1Z05 A;  1GOC A;  2YCH A;  3VQ4 A;  1LWC A;  4BC2 A;  1N36 K;  4KH4 A;  3LDS A;  4H0Y B;  3ZX3 A;  3CPE A;  4DS5 A;  4I6M A;  4MFB A;  1X3M A;  5KQ8 A;  1NJI O;  1DEJ A;  3DXK A;  4OO1 J;  4FW1 A;  2ETJ A;  3M5R A;  3RMB A;  4Y0W A;  4LF4 K;  4H8K A;  4OKJ A;  4B3O A;  3LDQ A;  1I3A A;  1B92 A;  1QQM A;  1TAU A;  3NHG A;  4RW8 A;  3VA3 A;  1RDA A;  4C8K A;  4Z4H A;  1TK8 A;  4Z4G A;  4CK1 A;  1GLF O;  3AO5 A;  1SL1 A;  1S22 A;  4B9U A;  5AQO A;  5BRE A;  1C0U A;  2E2O A;  4OPJ A;  4YOU A;  1ITG A;  4NCA A;  1EKE A;  2WFB A;  1JJ2 M;  1Q81 O;  3ZSR A;  1XHZ A;  3OYD A;  3QEX A;  1VSH A;  4FVU A;  4EIA A;  1NGC A;  3OJU A;  4H4O A;  3VES A;  4O44 A;  1HLU A;  4N47 A;  3VGL A;  5C2F A;  4DQP A;  4MLH A;  2Y1J A;  1QVG M;  4TSX A;  1WAF A;  1HQE A;  2P9U B;  3ID6 A;  4FPA A;  1X9J A;  4PKI A;  4FM2 A;  3SQ1 A;  2IC3 A;  3VN5 A;  3ZEU B;  2O8F A;  4IOC L;  1J9A A;  3LWL A;  3THX B;  1BA1 A;  2OPS A;  3CM6 A;  1ASU A;  5AQT A;  2IVN A;  4DTS A;  4ISE A;  1YHQ N;  2PY5 A;  3A5N C;  3CD6 N;  4K42 A;  1S9G A;  3LDO A;  3VEO A;  1QHT A;  4Q5V A;  5AQH A;  5AZJ B;  4DSK A;  4PQU A;  3MN7 A;  5CYM A;  4I9L A;  4DS4 A;  1S1U A;  1TKZ A;  3O3H A;  1Z26 A;  5KGW A;  4WF9 L;  5GIN A;  5AQM A;  2E6L A;  4FJ8 A;  3RMD A;  4F3O A;  1NGI A;  3HSC A;  1QSL A;  1LWF A;  1IH7 A;  4QS9 A;  4BRG A;  1SUQ A;  4BRL A;  4F8R A;  2VQF K;  5M1F A;  4C23 A;  2NRW A;  4B9S A;  1VSK A;  4IXC A;  5CE3 A;  5AZI B;  1CZA N;  3QEW A;  1UA1 A;  4DWI A;  1RIL A;  2QWR A;  4IG3 A;  1TUU A;  1HX1 A;  3OYC A;  4HVJ A;  4DQQ A;  4GKK K;  4E7I A;  4B8A B;  4R79 A;  3NCI A;  4FLZ A;  4CF2 A;  3F9K A;  3SPZ A;  4FWP A;  3KLG A;  1GLD G;  3THW B;  2UYT A;  3WQT A;  4LF8 K;  3ZT0 A;  4KV8 A;  5AQU A;  3VET A;  4H0P A;  4CBW A;  3ITH A;  4BRN A;  4I2P A;  4OKK A;  5HRR A;  2YHW A;  4OPA A;  3KK1 A;  1S1W A;  1C0T A;  1N6Q A;  4CFC A;  3QIP A;  3HPO A;  3KD1 E;  4K0K K;  1S1V A;  4J8F A;  5CYQ A;  1RCH A;  4CK2 A;  3NMU A;  1NG9 A;  1C1B A;  1YF5 L;  2OPP A;  4DQ8 A;  2DPN A;  5BRH A;  1UWB A;  5HBM A;  3ZT1 A;  3TSQ A;  4WQ5 A;  1S72 N;  1I94 K;  3MDQ A;  4I7F A;  1HNV A;  3I8D A;  5BRF A;  5M1N A;  3S9H A;  2CGJ A;  4AH9 A;  3OA9 A;  3FLC O;  1WSJ A;  4CIG A;  2A3Z A;  2OPR A;  1QVF M;  2O8D A;  3UKR B;  4FJH A;  3AA4 A;  4KRE A;  4BG9 A;  4CJW A;  2AA4 A;  2RF2 A;  3L0Q A;  4KB1 A;  3H3O B;  2R7Y A;  1HRH A;  3CQ8 A;  1HNZ K;  4W5R A;  4CHY A;  3SMP A;  2E2P A;  5AQL A;  2ITM A;  4DFK A;  4QS7 A;  1T05 A;  3DLK A;  3D45 A;  3WXJ A;  4B3S K;  1J5E K;  3WXM B;  4RWT A;  3KHY A;  1YIJ N;  5CZ2 A;  5KTQ A;  1Q82 O;  1XC9 A;  3FZH A;  2YJF A;  1S6P A;  4MO4 A;  2HF4 A;  2F4V K;  1NJW A;  3ZLJ A;  4JN4 A;  3DRS A;  1K8K A;  4CJL A;  4YOX A;  1V4T A;  1BI4 B;  4C8O A;  2E1Z A;  3VF2 A;  4FLY A;  5FPN A;  3IUC A;  3LDN A;  3EYZ A;  3KZB A;  2KFN A;  1NGD A;  3D2F A;  4JI1 K;  1NGB A;  3CCU N;  1L3U A;  3IRX A;  4JKB A;  1ZYQ A;  4JRP A;  4QAG A;  3ZX2 A;  2ZWH A;  4O5B A;  5BR8 K;  3V1O A;  1ESV A;  3WXK A;  2XO7 A;  2HST A;  3NF7 A;  2HF3 A;  1EX4 A;  4MDA A;  4QS8 A;  4M41 A;  4I6M B;  4B08 A;  3CMA N;  3CJ7 A;  2G8V A;  3BDP A;  4NCG A;  1JXE A;  3CFR A;  2NNW A;  4FWL A;  1YJN N;  3AVL A;  3LWM A;  2HVI A;  5E84 A;  1SL2 A;  1VSJ A;  4CED A;  1A5X A;  4W5N A;  3FFK B;  4DUY K;  4WYB A;  3SMS A;  4BRO A;  3JS6 A;  2X6S A;  1W97 L;  2RN2 A;  3U8X A;  4Z4E A;  2BUP A;  2UU9 K;  2YHB A;  2HHH K;  4BR0 A;  5DK5 A;  3K5O A;  1VSD A;  3DWL A;  2O4I A;  1DT9 A;  4CF8 A;  4A2B A;  5H1S Q;  1T6C A;  3IDH A;  4CFD A;  1RTH A;  4FWO A;  1EO1 A;  3J7A P;  3ZSZ A;  2FBY A;  1R0A A;  2OTL N;  3O3F A;  3PY8 A;  4CK3 A;  3DRR A;  3I0S A;  4DG1 A;  2Q2R A;  2BE2 A;  4GV9 A;  1KAY A;  4B1V A;  1BOT O;  2QWP A;  4DHY A;  3HP9 A;  4BR5 A;  4HUE A;  3LP2 A;  1TL3 A;  3E01 A;  1SL0 A;  1CZB A;  3NVK A;  1JCF A;  3PLA A;  3VEY A;  5GAH P;  1ZBU A;  4DV3 K;  1WN7 A;  3L3V A;  4MO5 A;  4BRI A;  3E9O A;  2PYL A;  2D0C A;  5HRO A;  1KC8 O;  1ZBF A;  5A2Q O;  1J5O A;  1LAW A;  3CIP A;  4H0X B;  3VQA A;  3OYK A;  2OAN A;  1MDU B;  4PHT X;  3NF9 A;  4DV2 K;  1HR0 K;  4NO7 A;  2KZM A;  1K6Y A;  3HZ6 A;  4OPK A;  3TAF A;  1LV5 A;  1FXX A;  3VEN A;  5BR9 A;  4JI5 K;  4DV4 K;  4GKJ K;  3PO5 A;  5FRN A;  4CJK A;  1NLV A;  2HOE A;  3SBG A;  3OVN A;  3MCP A;  4PUO A;  4IFY A;  4LD0 A;  3BUZ B;  3LPU A;  1GLA G;  4F4K A;  1SAZ A;  4Z4I A;  1RT1 A;  2AP1 A;  3RR8 A;  2HMP A;  3OYM A;  2W6K A;  4CJU A;  2DY4 A;  3QBX A;  4ZHR A;  1BCM A;  4JD2 A;  4CZE A;  3U3G A;  2HHU A;  1HKB A;  2P51 A;  5BRD A;  3TAE A;  1VK0 A;  1P8Z A;  4IJN A;  4CBX A;  1FK9 A;  3CCV N;  4LF7 K;  4DCH A;  1K9M O;  4FW2 A;  3MCA B;  1NK8 A;  4C8L A;  1V4S A;  4C8M A;  3OYI A;  2DTU A;  3T69 A;  3BF3 A;  5FPE A;  2F8T A;  4FWR A;  4DSI A;  1NKB A;  5CZ1 A;  4DV1 K;  3SI6 A;  4JK8 A;  3OYJ A;  2P9U A;  2J4R A;  1RT7 A;  3HRG A;  4AHU A;  1Q8I A;  4JKA A;  1RTI A;  3UE5 A;  3L4Q A;  4MQ3 A;  1RDW X;  3T1Y K;  4CZH A;  1DTQ A;  3ZEU A;  4H03 B;  4CZL A;  4PA1 A;  2NRT A;  1KVC A;  1U6Z A;  4IFE A;  3TAR A;  1BHL A;  1WOQ A;  2P9K B;  3ZSW A;  4JK9 A;  3MXI A;  1VRT A;  1TKD A;  1REV A;  3KD5 E;  4DFJ A;  2ATQ A;  2O8D B;  3WNE A;  4FJ7 A;  3JSM A;  3CFO A;  2VGM A;  4I2Q A;  4DTX A;  4OX9 K;  2P9S B;  2YKN A;  1VQ7 N;  1D4X A;  3SAH A;  4CZG A;  5AZJ A;  3SQ0 A;  3VOV A;  2VYP A;  3QDK A;  4BRF A;  4M3T A;  1FW6 A;  4FLX A;  4A5B A;  2GEL A;  2HBK A;  4AIL C;  3FZL A;  4BR2 A;  3AVC A;  4LC9 B;  4CW7 B;  5AQK A;  1FJG K;  5F1X A;  3NBP A;  4HUG A;  2FLO A;  4CEB A;  5I42 A;  3CFP A;  1TKX A;  1ZBS A;  3CPW M;  2HHV A;  3J7Y P;  3QEI A;  1QSS A;  4BC3 A;  2OCE A;  1N32 K;  3VEW A;  3H3N O;  1K8K B;  3HVR A;  3LM2 A;  4BRD A;  3NF8 A;  2NRH A;  5AQV A;  2PYJ A;  4JKC A;  3VGM A;  3TSU A;  3KK7 A;  2X6N A;  4WFA L;  4R5P A;  3NGZ A;  1C1C A;  2XHB A;  2GTD A;  3P31 A;  4CJP A;  5AQR A;  2G8K A;  3AVB A;  4FM1 A;  2XY6 A;  2O4G A;  4I9Q A;  4O5F A;  4AHR A;  4FZY A;  4CZK A;  3SUP A;  4CF1 A;  1HNX K;  4ISF A;  4RG8 A;  3HTV A;  3S41 A;  2UUB K;  1M1K O;  4L3Q A;  1S3X A;  5LL6 Z;  3E9L A;  3W0L A;  2H3G X;  5ADX A;  2E5L K;  1WSF A;  3FZF A;  3LDP A;  2O8C B;  3TAN A;  3KVG A;  3NE6 A;  2P9I B;  3CQY A;  5LY3 A;  1HKC A;  1JKH A;  2LSN A;  1O13 A;  1IG8 A;  2IVP A;  1ZBL A;  3CJ1 A;  3LAN A;  3QNO A;  3RMA A;  2Y1I A;  3CC2 N;  2HHX A;  1RT3 A;  5LMN K;  3GBT A;  5C24 A;  1BA0 A;  2HHW A;  1JL2 A;  4B1W B;  2Q97 A;  3OTO K;  4B1Z A;  2P9L B;  4M7Y A;  3EE9 A;  1KFD A;  3SLC A;  2D0A A;  3KWG A;  1BIU A;  2F8S A;  1EWR A;  2DFF A;  4WFB L;  4ID1 A;  3ALY A;  3RSE A;  1OH7 A;  3MN9 A;  4E1J A;  3JYT A;  3DRP A;  3M1F A;  1BI4 A;  3TU5 A;  1YAG A;  3PSI A;  2Q1N A;  4Z0U A;  4HCC A;  1JXB A;  1QSY A;  4RW9 A;  2EX3 A;  2FXU A;  4JAX A;  4ILJ A;  2VWB A;  4EHT A;  4DR2 K;  1J53 A;  4KI6 A;  4HTL A;  1YJ9 N;  3R6M A;  4KHS A;  1IJJ A;  3A0I X;  4E1M A;  4JKD A;  3AO1 A;  4RTF D;  4BRM A;  4IBN A;  1TL1 A;  4KPY A;  3LM9 A;  3CC4 N;  3P4I A;  3LL3 A;  2YNF A;  4LH5 A;  1K8A O;  1TAQ A;  4BQL A;  2Z1H A;  4DSJ A;  5JIC A;  4CGH A;  1W9H A;  3TAP A;  1Q7Y O;  1DLO A;  3HPG A;  2NLX A;  1B9D A;  1BUP A;  4GNI A;  3OYF A;  1RDC A;  1XHX A;  5IWA K;  3H46 O;  3RRG A;  1U2V A;  4B1X B;  4AHV A;  4AHS A;  4A62 A;  4N76 A;  4DV0 K;  3O4Q A;  3P5J A;  4H5W A;  1RT4 A;  4JD2 B;  4BY9 C;  4ZTJ A;  5GIO A;  2G8F A;  3MX2 A;  2W6L A;  4N5S A;  3VTH A;  1Y64 A;  4CEA A;  4V19 S;  2O8B B;  3I8B A;  4KBO A;  3HOS A;  2QA4 N;  1WSH A;  3UKU A;  3QFP A;  3HPH A;  1YUW A; 
#chains in the Genus database with same CATH homology
 1A5V A;  4FJG A;  3HST B;  3VA0 A;  5HLF A;  1UOC A;  4CJT A;  5CZ2 A;  3EY1 A;  2HNZ A;  1U47 A;  4B9L A;  3AO2 A;  5KTQ A;  3M8Q A;  3K5L A;  3MEC A;  3V81 A;  1XC9 A;  1A5W A;  1S6P A;  3NFA A;  1D9F A;  4FM0 A;  4ICL A;  3NF6 A;  1NJZ A;  3SPY A;  3VQP A;  5JS2 A;  4CHQ A;  4B8C A;  1NJW A;  1HYV A;  2VG5 A;  2G8H A;  4FZX C;  3SQ2 A;  3DRS A;  3OYE A;  4CJL A;  3U6F A;  3AVK A;  3P83 D;  5HP1 A;  2IAJ A;  4M3W A;  1BI4 B;  3PUF A;  2KZZ A;  1J54 A;  4KHW A;  1U04 A;  3P1G A;  4C8O A;  4FLY A;  1HQU A;  1IO2 A;  2XY5 A;  1RT6 A;  4N41 A;  4CJF A;  4C8N A;  1IKW A;  1SKR A;  1SV5 A;  3H08 A;  3QET A;  1Q9X A;  3EYZ A;  2FC0 A;  2IDO A;  2KFN A;  5KGX A;  2JLE A;  3LAM A;  3O4N A;  4RW6 A;  3SNN A;  3IRX A;  1L3U A;  3SCX A;  4FXD A;  4M3Z A;  1ZYQ A;  5DMR A;  4JRP A;  2P1J A;  4FCY A;  4KAZ A;  1JLG A;  4DTR A;  4QAG A;  3KTQ A;  1RBT A;  4Z4C A;  4O5B A;  3QES A;  1ASW A;  3V1O A;  4QOZ B;  3OS0 A;  3V9Z A;  2HW3 A;  4KRF A;  2XO7 A;  3NF7 A;  3THV A;  3CM5 A;  4UQG A;  1C0M A;  1EX4 A;  4M3X A;  2Z1J A;  3VQE A;  4M41 A;  3F73 A;  1UAX A;  1IG9 A;  1EP4 A;  3MXM A;  3LZI A;  1KLN A;  4B08 A;  2G8V A;  3BDP A;  4FJJ A;  3L2V A;  4NCG A;  1JXE A;  4CGD A;  3CFR A;  4EP4 A;  3OYN A;  3DM2 A;  2I5J A;  3G0Z A;  3TAQ A;  3OS1 A;  4LY7 A;  4FYD A;  2Z1G A;  2W42 A;  3PX6 A;  3AVL A;  4IDK A;  1KRP A;  4KTQ A;  1D8Y A;  1YTU A;  3LWM A;  4DTP A;  2VG6 A;  3LP1 A;  4LSN A;  5EU7 A;  3HXM A;  3QIN A;  4B9V A;  2G8U A;  1D5A A;  3MEG A;  4OGC A;  2HVI A;  1SL2 A;  4DTN A;  1NK6 A;  3V9X A;  1VSJ A;  4CED A;  1NK0 A;  2G8I A;  1A5X A;  3AVN A;  4B9T A;  4W5N A;  5FRO A;  5KRS A;  2PZS A;  4CJS A;  4CJ3 A;  4O0J A;  4BDY A;  4E7L A;  5HRP A;  4YFU A;  4IG0 A;  4FJ9 A;  2HMI A;  2ZE2 A;  4OKE A;  1VSE A;  2B5J A;  2EHG A;  1XWL A;  1BIS A;  2X6S A;  1WSE A;  3V6D A;  2RN2 A;  3NAE A;  1FKO A;  3O3G A;  5D3G A;  4KB0 A;  4CEF A;  4ELU A;  4Z4E A;  3HYF A;  2YHB A;  3MAQ A;  4JS4 A;  1KVB A;  1ASV A;  3C95 A;  3DOL A;  5DK5 A;  3K5O A;  5FRM A;  4DF8 A;  3L8B A;  5J2P A;  2ZD1 A;  3V4I A;  1VSD A;  3KKS A;  1WLJ A;  3K5N A;  2O4I A;  3TAB A;  2KW4 A;  4JRQ A;  3SUQ A;  1TGO A;  2BAN A;  3S3N A;  4CF8 A;  1NK9 A;  4CFD A;  1NJY A;  3C6T A;  3DOK A;  1RTH A;  4O4G A;  3RWU A;  3ISN C;  4E89 A;  1TVR A;  3MEE A;  4M3R A;  3ZSZ A;  3AA5 X;  2FBY A;  1MU2 A;  1R0A A;  5JS1 A;  1F21 A;  3O3F A;  4K8X A;  4KFB A;  4FJK A;  2RKI A;  4LH4 A;  4CEE A;  1X9M A;  2NUB A;  4DQR A;  4CK3 A;  3DRR A;  3I0S A;  4DG1 A;  4DU3 A;  3PY8 A;  3LAL A;  1NKC A;  3S3O A;  2BE2 A;  4K8Z A;  1HYZ A;  4E7J A;  3HT3 A;  4DU1 A;  4E19 A;  3HP9 A;  4HUE A;  4CGF A;  3LP2 A;  1TL3 A;  3E01 A;  1SL0 A;  3AO4 A;  1CZB A;  3VQ5 A;  3VQ8 A;  3CG7 A;  4FLV A;  3OS2 A;  3T3F A;  4JS5 A;  3TR8 A;  2GBZ A;  4FK0 A;  1JLF A;  1ZBU A;  3TWH A;  1WN7 A;  4RW7 A;  4J2B A;  3L3V A;  1C1A A;  1RBR A;  1NKE A;  1NOY A;  4W5O A;  3MED A;  2PYL A;  2D0C A;  4FJI A;  3KLF A;  5HRO A;  1ZBF A;  4GW6 A;  3PX4 A;  1LAW A;  1J5O A;  3VQA A;  2OYQ A;  4CJV A;  4CJQ A;  4XIU A;  3OYK A;  1LWE A;  3NF9 A;  4CE9 A;  4DSF A;  2KZM A;  1K6Y A;  4DTJ A;  1VSF A;  1T03 A;  1KFS A;  4OPK A;  3TAF A;  4EP5 A;  1LV5 A;  2IS3 A;  1FXX A;  4BE0 A;  4WE1 A;  4ELT A;  2GV9 A;  3RMC A;  3G10 A;  3PO5 A;  5FRN A;  1QE1 A;  1KCF A;  1GOA A;  4CJK A;  4FK4 A;  3MXJ A;  4CEO A;  1HYS A;  4DTM A;  1TV6 A;  3KIO A;  4EZ6 A;  3VQQ A;  3OVN A;  3DYA A;  4E3S A;  3OYA A;  3S3M A;  4PUO A;  1X1P A;  4IFY A;  4LD0 A;  1S1T A;  2WON A;  1S9E A;  3LPU A;  3QO9 A;  4DLG A;  3SZ2 A;  4DQS A;  4DFM A;  4F4K A;  4H4M A;  4Z4I A;  1EXQ A;  4N56 A;  1RT1 A;  3D0P A;  3AVJ A;  3QEV A;  1T8E A;  1L3S A;  3OYH A;  4J2D A;  3RR8 A;  2VWK A;  3OYM A;  1L3T A;  1GOB A;  4CJU A;  2OA8 A;  2XY8 A;  1SKS A;  4Z4F A;  2DY4 A;  3L2U A;  4ZHR A;  1BCM A;  4CHN A;  5J2N A;  2QXF A;  4O0I A;  1YTA A;  3U3G A;  4CGJ A;  1IKY A;  1HJR A;  5T7B A;  4OLA A;  1QQC A;  3M8R A;  2HHU A;  5CY4 A;  2P51 A;  3TAE A;  1VK0 A;  4CHP A;  1LW0 A;  3M8P A;  4AHT A;  1CLQ A;  2OPQ A;  4DTU A;  3RRH A;  1FK9 A;  4FZZ A;  4B9N A;  5C42 A;  3AVF A;  3ZSX A;  2YNI A;  4FW2 A;  3U3Y A;  5E41 A;  4BE1 A;  4KI4 A;  3DLH A;  1JLE A;  4CGI A;  3NGI A;  4DSE A;  2B6A A;  1I39 A;  1NK8 A;  4C8L A;  4ID5 A;  3RTV A;  5SWM A;  4C8M A;  3OYI A;  2DTU A;  3OYG A;  4Y1D A;  3TAM A;  2F8T A;  4E7H A;  4EZ9 A;  3PO4 A;  2FBT A;  2FBX A;  2KQ2 A;  1NKB A;  5KI6 A;  4DSI A;  2KFZ A;  1JLQ A;  5CZ1 A;  2HHS A;  4E1N A;  3BGR A;  3SI6 A;  4CEC A;  3VQ6 A;  3OYJ A;  1RT7 A;  1DTT A;  3ULD A;  4FJ5 A;  4AHU A;  4CJ5 A;  1Q8I A;  4M3U A;  1RTI A;  1BQM A;  2YNH A;  4MQ3 A;  4W5Q A;  4KHU A;  2F96 A;  3DMJ A;  4CJ4 A;  2HHT A;  1DTQ A;  1RT5 A;  1G15 A;  3T19 A;  4J2E A;  2DFE A;  4ZTF A;  4IKF A;  4CJE A;  1EET A;  1S6Q A;  4KO0 A;  4LSL A;  4PA1 A;  4CIE A;  1KVC A;  3VQD A;  3VQ9 A;  4KHN A;  2E6M A;  3WNG A;  5HRN A;  1BHL A;  1FKP A;  3TAR A;  3ZSW A;  2Q3S A;  3MXI A;  1Y97 A;  1VRT A;  4CEZ A;  4DMN A;  3OYB A;  3B6O A;  2A1R A;  4OJR A;  1REV A;  1TKD A;  3KD5 E;  4DFJ A;  2ATQ A;  4F3T A;  1RDB A;  2QKK A;  3WNE A;  4IFV A;  2OZS A;  3IS9 A;  4CFB A;  1VRU A;  1NOZ A;  3JSM A;  3SJJ A;  4FJ7 A;  1CZ9 A;  3CFO A;  4I2Q A;  3KJV A;  4DTX A;  2BDP A;  3NH0 A;  1JLB A;  3EZ5 A;  1HNI A;  2YKN A;  4NYN A;  3IAY A;  4BAC A;  3ZCM A;  1ZBI A;  3SQ0 A;  3LZJ A;  2IOC A;  3TI0 A;  1HMV A;  5HRS A;  3I0R A;  1NK4 A;  3L2Q A;  3HJF A;  3OY9 A;  3AA3 A;  4FLT A;  4CIF A;  3ZT2 A;  3OJS A;  3PX0 A;  2D0B A;  4M3T A;  4PWD A;  4FLX A;  1KSP A;  4FJL A;  3KLE A;  4CER A;  3SV3 A;  1S1X A;  1YVU A;  3NH1 A;  1BIZ A;  4AIL C;  4PY5 A;  3HVT A;  3AVC A;  1IKV A;  4OGE A;  3DLR A;  1JLA A;  1VSM A;  2IGI A;  2X78 A;  1GOC A;  3NBP A;  3KKR A;  3VQ4 A;  1LWC A;  4HUG A;  1RBU A;  4CEB A;  3SV4 A;  4M42 A;  3HO1 A;  5I42 A;  2KTQ A;  3LDS A;  3CFP A;  1HPZ A;  5KRT A;  1TKX A;  1X9S A;  1L3V A;  1JLC A;  4FJX A;  4DS5 A;  3DI6 A;  2HHV A;  4MFB A;  4F2S A;  3QEI A;  1QSS A;  3C6U A;  4O55 A;  3L3U A;  4FW1 A;  2ETJ A;  1BQN A;  3OYL A;  3NH2 A;  3RMB A;  4OLB A;  4BWJ A;  3HVR A;  4H8K A;  4OKJ A;  4B3O A;  3K58 A;  1KVA A;  3ASM A;  3NF8 A;  3K5M A;  1I3A A;  3PV8 A;  1L5U A;  1B92 A;  2GUI A;  2G8W A;  3L2W A;  2PYJ A;  1TAU A;  1U45 A;  3QNN A;  3VQC A;  3NHG A;  2VG7 A;  4RW8 A;  2X6N A;  3VA3 A;  1RDA A;  4R5P A;  3NGZ A;  1C1C A;  1YT3 A;  1TK5 A;  2XHB A;  4Z4H A;  3AO3 A;  1TK8 A;  4C8K A;  2FBV A;  4Z4G A;  4CK1 A;  4CJP A;  3AO5 A;  2G8K A;  3AVB A;  3ZSQ A;  1RBV A;  4FM1 A;  4GVM A;  2XY6 A;  1SL1 A;  2O4G A;  4HTU A;  1Q9Y A;  4B9U A;  1C0U A;  2P5O A;  4OPJ A;  4I9Q A;  4DSL A;  1RBS A;  1ITG A;  4DQI A;  4NCA A;  1EKE A;  4AHR A;  4E0D A;  4FZY A;  4BE2 A;  3SUP A;  3ZSR A;  4CF1 A;  3V9W A;  4RG8 A;  1QTM A;  3K59 A;  1XHZ A;  3OYD A;  4DU4 A;  3TAG A;  3QEX A;  3KK2 A;  1VSH A;  5J2M A;  2X74 A;  3K57 A;  3V9S A;  1XI1 A;  3OJU A;  4H4O A;  4O44 A;  3CYM A;  1WSF A;  3AVA A;  4CJR A;  4N47 A;  4KHY A;  4CGG A;  2ZQB A;  1QS4 A;  1WNS A;  4CEQ A;  3TAN A;  1SKW A;  4DQP A;  2Y1J A;  3NE6 A;  4CCH A;  2E4L A;  4TSX A;  4E7K A;  1WAF A;  5SZT A;  4BDP A;  3RR7 A;  4HHT A;  1HQE A;  3DLB A;  4HUF A;  2YHA A;  3AV9 A;  3HK2 A;  3ZSY A;  4G1Q A;  4RW4 A;  1JKH A;  2LSN A;  3SUO A;  3V1Q A;  1UA0 A;  4FM2 A;  3SQ1 A;  1ZBL A;  2IC3 A;  1Z25 A;  3LAN A;  3QNO A;  3VN5 A;  3RMA A;  3B6P A;  3LAK A;  2Y1I A;  1U48 A;  4M3Y A;  2HHX A;  1J9A A;  3LWL A;  3AVM A;  2OPS A;  4FVM A;  4J2A A;  1BGX T;  3CM6 A;  2YKM A;  2QKB A;  1BL3 A;  2HNY A;  1CXQ A;  4CF9 A;  1ASU A;  3QER A;  1N5Y A;  1RT3 A;  4DTS A;  3IG1 A;  2A1S A;  1X9W A;  5C24 A;  2XY7 A;  2PY5 A;  2HHW A;  2JGU A;  3AVH A;  1B9F A;  3SUN A;  4HCB A;  1JL2 A;  1S9G A;  3T1A A;  1QHT A;  4CF0 A;  4Q5V A;  3V9U A;  4DSK A;  4PQU A;  3NDK A;  5J2Q A;  1S5J A;  4JLH A;  3HP6 A;  3ZT3 A;  5CYM A;  4I9L A;  4DS4 A;  1KFD A;  2D0A A;  1S1U A;  1TKZ A;  3O3H A;  1Z26 A;  5K14 A;  5KGW A;  1BIU A;  2F8S A;  4FLU A;  2DFF A;  4FJ8 A;  2E6L A;  3C94 A;  3RMD A;  1T7P A;  1WAJ A;  2DFH A;  4ID1 A;  3ALY A;  4KKO A;  4B9M A;  4F3O A;  1TK0 A;  5J1E A;  4DFP A;  3L2R A;  1QSL A;  1LWF A;  3UIQ A;  3V1R A;  4DF4 A;  1IH7 A;  4FK2 A;  1SUQ A;  1O1W A;  3JYT A;  4CES A;  4DTO A;  1W0H A;  3DRP A;  4F8R A;  4B9S A;  4Q0B A;  1VSK A;  1BI4 A;  2BGG A;  1RTD A;  3QEW A;  1UA1 A;  4DWI A;  4Z0U A;  4HCC A;  1JXB A;  1RIL A;  4IG3 A;  1QSY A;  2EX3 A;  1RTJ A;  1VSI A;  4RW9 A;  3OYC A;  1RT2 A;  3KLH A;  3FFI A;  4HVJ A;  4DQQ A;  4L8R B;  4E7I A;  4B8A B;  1J53 A;  3NCI A;  1U4B A;  4FLZ A;  1U49 A;  4KI6 A;  2P5G A;  4CF2 A;  1KLM A;  1RDD A;  2HND A;  3F9K A;  3SPZ A;  4KHS A;  3KLG A;  4NCB A;  1TKT A;  4E1M A;  3AO1 A;  3LPT A;  4IBN A;  4Y1C A;  1TL1 A;  3KLI A;  4KPY A;  1RNH A;  3ZT0 A;  4DLE A;  4KV8 A;  1IKX A;  1BCO A;  3ITH A;  4I2P A;  3AVI A;  4OKK A;  5HRR A;  3WNH A;  2YNF A;  4LH5 A;  2B4J A;  3NGY A;  1TAQ A;  3KK1 A;  1CXU A;  1S1W A;  1VSL A;  2Z1H A;  4M45 A;  4DSJ A;  5I3U A;  4CGH A;  3KK3 A;  1W9H A;  1C0T A;  1N6Q A;  4CFC A;  3QIP A;  3HPO A;  3KD1 E;  1C6V A;  1S1V A;  3A2F A;  3TAP A;  1KTQ A;  1DLO A;  5CYQ A;  1RCH A;  3SYZ A;  3HL8 A;  4CK2 A;  3HPG A;  3HM9 A;  1B9D A;  1C1B A;  2Z1I A;  3AVG A;  5C25 A;  1NJX A;  2OPP A;  3WNF A;  1JL1 A;  1RDC A;  1XHX A;  3OYF A;  3ZSO A;  3K2P A;  1UWB A;  5HBM A;  3DLG A;  3ZT1 A;  1NK5 A;  3M8S A;  3RRG A;  4QCL A;  5FDL A;  1ZBH A;  1WSG A;  3AA2 A;  4AHV A;  2OZM A;  2VWJ A;  2ITG A;  4BWM A;  4AHS A;  4CHO A;  4I7F A;  3SQ4 A;  1HNV A;  3DLE A;  2XRI A;  4KTW A;  3I8D A;  4FLW A;  2QK9 A;  2AJQ A;  4BDZ A;  4N76 A;  2HVH A;  3S9H A;  4AH9 A;  4CFA A;  1NK7 A;  2YNG A;  3O4Q A;  3P5J A;  1RT4 A;  1WSJ A;  4GMJ B;  3ZT4 A;  4F2R A;  4CIG A;  1D9D A;  2OPR A;  4KHQ A;  4ZTJ A;  4FJM A;  3QLH A;  1LW2 A;  4OVL A;  2HB5 A;  4CHZ A;  2YV0 X;  4AHC A;  4FJH A;  3AA4 A;  2G8F A;  3ZSV A;  4YNQ A;  3VQ7 A;  2RPI A;  4CJW A;  2RF2 A;  4W5T A;  4FJN A;  4KB1 A;  4KRE A;  2R7Y A;  1HRH A;  4N5S A;  3CQ8 A;  4W5R A;  3VQB A;  3LP3 A;  4CHY A;  4CEA A;  3QIO A;  3LP0 A;  4NYF A;  4DFK A;  4ELV A;  1T05 A;  3DLK A;  3D45 A;  4KTZ A;  1LAV A;  2D5R A;  2WOM A;  1WSH A;  3QEP A;  1WSI A;  3HPH A;  2HHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...