3LPUA

Hiv integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
142
Chain Sequence
DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Rational design of small-molecule inhibitors of the LEDGF/p75-integrase interaction and HIV replication.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 47
structure length 142
sequence length 155
ec nomenclature
pdb deposition date 2010-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lpuA00
3VQ8A 3VQQA 3QO9A 3KKSA 1T05A 4N5SA 2G8UA 3V9ZA 4KTWA 3NDKA 3V6DA 3CG7A 3DLEA 2OPSA 1K6YA 4DF8A 3ZSXA 3T19A 3O3GA 3OYFA 3CFPA 4W5NA 4CJVA 3C6UA 1BIUA 2DFEA 4FJ9A 4AHVA 1NJWA 1L3UA 3QEPA 2G8HA 1CZBA 3S3OA 3TAMA 4DSEA 3V1QA 3L2RA 1SL0A 1L3SA 1RT2A 1KFDA 4HCCA 1DTTA 2WOMA 4FK2A 4LH5A 1RBVA 3L3UA 4CF0A 3WNEA 3VA0A 5FROA 3HO1A 3ZCMA 1ASVA 1IH7A 3ZT2A 3LPTA 4FVMA 1KCFA 1BGXT 3M8PA 1QSSA 2IOCA 2DY4A 1QE1A 4CJ4A 1DTQA 4OJRA 4DMNA 1QSYA 4KI6A 4M41A 4CF9A 4ELUA 3VQCA 3CQ8A 1RT7A 4IKFA 4C8KA 3AVCA 1SUQA 4CJTA 4CHZA 3SQ0A 4CFBA 3M8RA 1L5UA 1ITGA 1TAUA 3OVNA 2HHQA 1XC9A 3RMAA 4CGIA 4F3OA 2O4IA 4MQ3A 2X6SA 4GVMA 3C95A 4H8KA 4EZ6A 3K5OA 3ZSYA 2F8SA 4E0DA 3TAPA 1BL3A 2ITGA 3MECA 4OGEA 4OKJA 4NCAA 3MXMA 3A2FA 3NAEA 3QETA 4M45A 4M3WA 3SYZA 1FKOA 1LAWA 3VQ5A 4KHNA 2E6LA 2ZE2A 3V81A 3IAYA 1EX4A 4KTZA 2E6MA 4M42A 4AHSA 1EKEA 1X1PA 3H08A 4FM2A 1LW0A 3AVJA 3S3MA 3NE6A 4YNQA 1JLCA 3LAKA 3RMCA 2Z1IA 4W5OA 5C24A 3CM6A 1KVBA 4DFPA 4BACA 3DLKA 2XY7A 4M3TA 3TABA 2A1RA 1VRUA 2D5RA 1U45A 3P83D 3ZT4A 1U49A 1T7PA 1FKPA 4B9TA 4J2AA 4FYDA 3SUNA 4FJJA 2P5GA 1TL1A 1UOCA 1QHTA 3L2QA 4B8CA 3SV3A 5HROA 1CXQA 2VG6A 3V9WA 4CJLA 2YHAA 1LWEA 3D0PA 3RRHA 1KSPA 3KJVA 1KFSA 3OYCA 2R7YA 4DLEA 3ZSZA 3SQ2A 4RG8A 4NCBA 1QQCA 1WSEA 3LP3A 1QS4A 4RW4A 4FK4A 2YNIA 3NH2A 3V9XA 4HUGA 4Z4IA 3DRSA 3OYBA 3NF6A 4CHQA 1TKZA 4LSLA 3TAGA 5CYQA 2FC0A 3LZJA 3KLHA 2XY5A 3L2WA 2I5JA 4FW1A 4K8ZA 1X9SA 1YTAA 2FBVA 4E7IA 4CF1A 4PWDA 3TAQA 4I9LA 3C6TA 1RDBA 1NK8A 3VN5A 3SUQA 2HNDA 3LP1A 3HPGA 4Q5VA 1IKWA 4CIFA 1XI1A 1TKXA 5J2PA 1VSKA 5KRSA 1RBUA 3LZIA 2IGIA 5HRRA 3O3HA 4E7LA 3ALYA 1VSLA 3B6PA 3ZT3A 4OGCA 3AVKA 1I39A 4E19A 3OYIA 1LV5A 4CCHA 3EZ5A 4NCGA 1NK5A 4ID1A 4FJLA 4N76A 3HVRA 4FLTA 4B3OA 3L8BA 3LALA 1BQMA 4F3TA 4DSKA 4GW6A 4OKKA 3VQAA 4DSFA 1NJYA 3HYFA 4FLUA 3KLEA 3P1GA 3K5MA 2F8TA 2KZZA 4O5BA 4KRFA 2BDPA 4CESA 4LY7A 3TANA 2X6NA 1VRTA 3K59A 1JL2A 3S9HA 1RDDA 1NKEA 4KHYA 4E89A 4CEOA 4DFKA 4CEDA 4QCLA 5KGWA 3OYEA 2HMIA 4UQGA 4DWIA 2FBTA 1WSIA 1BIZA 3EY1A 5KRTA 1HNVA 4FLXA 4FLZA 4FJIA 2QK9A 4RW7A 3FFIA 4CK1A 1RT5A 4O55A 4PA1A 4DTPA 1HQUA 4H4OA 1Q9YA 2QKBA 2DTUA 5I3UA 3AVBA 3HXMA 1EP4A 1VSJA 1GOBA 1A5XA 2HVIA 1VSFA 3LANA 4CHYA 4CJ3A 1N5YA 3TR8A 3HP6A 4IG3A 1YVUA 1NKCA 3L3VA 4B9MA 1WLJA 1ZYQA 1FXXA 1NK7A 1D5AA 1O1WA 1C0TA 4CIEA 4E7HA 3F9KA 1JLAA 3ZSVA 3JSMA 3QEWA 1C0MA 3HVTA 2WONA 1RTJA 1G15A 4JLHA 1RCHA 2ATQA 2RPIA 4E1NA 4CF2A 3MAQA 1JLBA 1RT3A 2YKMA 4W5TA 3OJSA 3OYJA 3F73A 4FCYA 4FLVA 3LP2A 3NGYA 2O4GA 4Y1DA 4HTUA 1RTIA 4O44A 4FJHA 4FK0A 4KTQA 4PUOA 2HNYA 1Z25A 3QIOA 4GMJB 3IS9A 1NK4A 1T03A 1HNIA 4KHSA 4DG1A 3AA3A 1UA1A 4CEBA 4AHTA 3OYNA 3KK3A 1VSHA 1TK0A 2RN2A 4I9QA 2P51A 1JLQA 3VQ7A 1S9GA 3RR7A 4AHRA 1S1TA 3P5JA 3ZSOA 4B9VA 5FRMA 3AVGA 1J54A 3V4IA 2GV9A 2YNGA 3ITHA 2KTQA 3K2PA 1SV5A 4B08A 3VA3A 5K14A 4B8AB 2G8IA 4DSIA 1J9AA 2GUIA 3JYTA 2BE2A 2HW3A 3AO3A 1W0HA 3VQEA 4BE2A 4KHQA 4CIGA 1DLOA 2JLEA 3NHGA 1ZBFA 2HHXA 5KTQA 4CHOA 5SWMA 4CJWA 2NUBA 1U48A 3BDPA 4CFAA 1KVCA 1TK5A 1WSHA 5C42A 3THVA 4Z0UA 4F4KA 3VQ9A 1X9MA 3ZT0A 1BI4A 1KLMA 2BANA 4RW6A 4OPJA 1VSIA 3DRPA 1NOZA 4DFJA 1X9WA 4XIUA 4I2PA 4DF4A 2YKNA 1KLNA 4O0IA 3LWMA 2YNFA 3U6FA 3G0ZA 4OLAA 2QKKA 3C94A 4CJEA 1ZBHA 1S1WA 4DQQA 1LW2A 1ZBLA 1HPZA 1B9FA 3DRRA 4I2QA 4EP4A 4E7KA 4KHUA 2PZSA 3OYMA 2OPQA 4HUFA 2VG7A 3LP0A 3IRXA 1C1CA 3NF7A 1S6QA 3V1OA 4CK3A 3QEVA 4KB0A 2FBYA 1BISA 2P5OA 4M3XA 4FJMA 2E4LA 4Y1CA 1WSGA 4TSXA 3SUOA 1YTUA 4RW9A 3VQ4A 3ZT1A 3U3YA 3HP9A 1I3AA 4CHPA 2KQ2A 4J2BA 4CEZA 4Z4FA 3VQDA 5CZ2A 3T1AA 4KI4A 4NYFA 5T7BA 1C6VA 3OYHA 3KTQA 4RW8A 4DS4A 3DM2A 3SNNA 3I0SA 4CK2A 4N56A 1RDAA 3HL8A 1CXUA 3ZSWA 1KRPA 3ULDA 3SPYA 1RNHA 4CGGA 3SPZA 2X78A 2W42A 1CZ9A 3CFRA 3U3GA 4DQRA 3KLFA 4JS5A 1R0AA 4CFDA 4DQSA 4J2DA 3K58A 2GBZA 4AILC 4CGJA 4DU3A 3L2VA 5DK5A 2LSNA 4CEEA 1B92A 1ASWA 4FLWA 2PY5A 1RT6A 4DQIA 5KI6A 4Z4CA 1BCOA 3DYAA 4W5QA 4HUEA 4KHWA 3NFAA 1RBTA 4CGHA 3QNNA 1BI4B 1REVA 3OS0A 3NF8A 1HJRA 2HHWA 1S5JA 4CF8A 3QNOA 4CJUA 1UA0A 1ASUA 4OLBA 1NJXA 3KD5E 2AJQA 4OKEA 3QEXA 3DOKA 3KIOA 3NGZA 3MXIA 4DTOA 3OY9A 4KFBA 3SQ4A 4AH9A 4DSJA 1JLGA 2P1JA 5HP1A 2G8FA 3PY8A 4B9SA 4F2SA 1TGOA 4CHNA 2ZD1A 3DLGA 4IG0A 4CGFA 1SKSA 4CE9A 1SL2A 4DQPA 4KKOA 5I42A 1NK0A 4EP5A 4JRQA 2OA8A 4FM1A 4DSLA 4CJPA 4F2RA 1L3VA 1RILA 2KW4A 4O0JA 3VQPA 1SKRA 3AVLA 3QEIA 3AV9A 3KK2A 4HHTA 3CM5A 1T8EA 3NF9A 3NBPA 3L2UA 3K5LA 4C8LA 1IKVA 2KFZA 4E7JA 1TKDA 4DLGA 2Y1JA 1RDCA 2A1SA 1C1AA 3TWHA 4QOZB 1HYZA 3OS2A 3K5NA 3OYDA 3HK2A 3HSTB 3UIQA 1F21A 3K57A 3PO5A 3DLHA 1LWCA 5J2MA 3HPOA 4CJRA 2HVHA 2IDOA 5E41A 1WSFA 3CYMA 4KV8A 3M8QA 4YFUA 3PV8A 3QINA 3MXJA 3AVMA 1RBRA 1S1VA 3V9UA 3HT3A 2DFFA 1YT3A 4C8NA 3AA4A 1D8YA 5EU7A 5D3GA 3QERA 4JRPA 3O4QA 3LPUA 5FDLA 4ZHRA 4Z4HA 2VWKA 5KGXA 3PO4A 4BDPA 2IS3A 4OPKA 1L3TA 1A5VA 3IG1A 4BDYA 4FXDA 1TV6A 1NOYA 3VQ6A 3NH0A 4FZZA 4KAZA 4FJ5A 1XWLA 3SV4A 2EHGA 2HB5A 1MU2A 3AA5X 1C1BA 3B6OA 3RMDA 1NJZA 2KZMA 1S9EA 4F8RA 2Y1IA 4N47A 4W5RA 1JXEA 4DS5A 1HQEA 1Q8IA 4DTUA 1KVAA 1LAVA 3HJFA 1D9DA 2HHSA 4FJ7A 3E01A 1HMVA 4G1QA 1EXQA 1UWBA 1WAFA 5J1EA 2PYJA 3RWUA 4E1MA 3PX6A 4C8OA 1SKWA 2YNHA 3G10A 1LWFA 3OYLA 1ZBUA 5FRNA 5J2NA 4Z4EA 3ASMA 2OPRA 2B4JA 4CGDA 1GOAA 3PX0A 1JLEA 1ZBIA 1VSDA 1UAXA 3QIPA 3OYGA 3SQ1A 2Z1GA 2XO7A 1IG9A 3HM9A 1RTDA 3DI6A 4M3RA 4DFMA 4B9NA 3V9SA 1N6QA 1JXBA 5CZ1A 3RTVA 4EZ9A 4FJ8A 2ZQBA 3AO4A 3EYZA 1TL3A 3SI6A 5HLFA 4KREA 3LWLA 4BE1A 2B5JA 2IC3A 2RKIA 3NH1A 3I0RA 4IFVA 4ICLA 3TAFA 4BDZA 2HHUA 4CJQA 4DU1A 1JKHA 1U04A 1NKBA 3ZSQA 2YHBA 3ISNC 4Q0BA 2Z1HA 5HRNA 3KLIA 3SUPA 1U47A 1HYSA 5SZTA 3LDSA 1XHXA 4R5PA 4BWMA 3AVAA 2EX3A 3SZ2A 4CFCA 1WSJA 3AVHA 3PX4A 4CEFA 1WN7A 4FZXC 4M3UA 1EETA 1BHLA 2VG5A 3OJUA 4DU4A 2KFNA 3MEEA 4PY5A 5HRPA 3OS1A 4B9UA 4FJKA 1CLQA 1NK9A 1IO2A 1GOCA 3BGRA 4KPYA 1WNSA 2D0AA 2OZSA 4KB1A 3I8DA 1J53A 5CYMA 1TKTA 3KKRA 5CY4A 4B9LA 3D45A 3AO2A 4Z4GA 3KD1E 3TARA 4ELVA 2D0CA 4OVLA 3WNGA 2IAJA 3WNFA 3KLGA 4CJKA 3RMBA 1A5WA 1TK8A 3HPHA 5JS2A 3AVFA 4CEAA 3DLBA 2Q3SA 4ZTJA 1Q9XA 4O4GA 3SCXA 2ETJA 4ID5A 1HRHA 5DMRA 2OZMA 3S3NA 3MEDA 3AA2A 3ZSRA 4ELTA 1BQNA 3AVNA 2PYLA 4L8RB 1C0UA 5C25A 2XRIA 1VK0A 1VSEA 1W9HA 1Z26A 2VWJA 1XHZA 4E3SA 4FZYA 4M3ZA 1RBSA 3TAEA 2DFHA 2HHVA 1Y97A 4FW2A 1RTHA 1RT1A 4KO0A 2XY6A 1WAJA 1BCMA 1S1XA 4IDKA 5HBMA 4LD0A 2RF2A 1NK6A 4CJ5A 4HVJA 5HRSA 1HYVA 1S6PA 1TAQA 2JGUA 3KK1A 4DTMA 3VQBA 3SJJA 1QSLA 3O4NA 4DTXA 2Z1JA 4WE1A 4DTRA 4IBNA 3T3FA 1J5OA 5J2QA 1S1UA 3QLHA 4FJNA 2YV0X 1TVRA 3RRGA 1IKYA 2B6AA 1U4BA 3QESA 4BE0A 2HNZA 4QAGA 3DLRA 4H4MA 4CECA 3OYAA 3O3FA 2G8WA 3RR8A 4MFBA 4ZTFA 1D9FA 4HCBA 4K8XA 2X74A 1JLFA 1B9DA 4LSNA 4C8MA 4CEQA 3M8SA 3NCIA 3DOLA 5JS1A 4J2EA 2F96A 4FM0A 2XHBA 3MEGA 3NGIA 2OPPA 4M3YA 4BWJA 3OYKA 4FLYA 4CJSA 1VSMA 3V1RA 1JL1A 1RT4A 2BGGA 3AO1A 4DTJA 4NYNA 4I7FA 3WNHA 4N41A 1SL1A 2D0BA 3DMJA 3TI0A 4PQUA 2QXFA 2HHTA 1KTQA 2FBXA 3CFOA 4LH4A 4IFYA 3AVIA 4CJFA 1QTMA 4FJGA 1FK9A 2G8VA 4AHUA 2XY8A 4DTSA 4DTNA 4JS4A 3PUFA 4AHCA 3LAMA 3AO5A 1IKXA 4FJXA 2OYQA 2G8KA 4CERA
chains in the Genus database with same CATH superfamily
3VQ8A 3QO9A 3DLEA 2OPSA 4WFBL 3C6UA 3G25A 4YHHK 4CW7B 4AHVA 3MK6A 4U7BA 3TAMA 4A2BA 4DSEA 3CCRN 5AQSA 1SL0A 4YORA 4CZEA 1KFDA 3L3UA 4JKBA 3WNEA 4H03B 3ZCMA 4FVMA 1KCFA 2DY4A 4CJ4A 3QB0A 4KI6A 4CF9A 3CQ8A 2A6AA 3SQ0A 4CJTA 4CFBA 5C12A 3UKRA 3OVNA 4PKGA 4IOCL 5BN8A 4GVMA 4E0DA 3TAPA 1BL3A 2ITGA 4OKJA 5AQZA 3A2FA 4M45A 4M3WA 3VQ5A 4KHNA 2E6LA 4KTZA 1EKEA 4FM2A 4JI4K 4CZHA 4YNQA 1VQON 4NB4A 2NRTA 3BF1A 5C24A 3CM6A 1ATSA 2XY7A 2ZGZA 3P83D 4B3RK 2YX6A 4FWLA 1TL1A 3W0LA 4JI3K 3L2QA 3DXMB 4B8CA 3SV3A 1TUUA 2YHAA 5FPNA 1KFSA 2R7YA 4DLEA 2CGLA 1GLCG 4FK4A 4B3SK 1NGHA 3NF6A 3MCPA 1LOTB 4LSLA 5E84A 4CHQA 3TPQA 3LZJA 3H1VX 4K8ZA 1G99A 4BRGA 4E7IA 4DR6K 1RDBA 3SUQA 3NMUA 4CIFA 5J2PA 3LZIA 4DV6K 4E7LA 1VSLA 4JK7A 3G6EN 3AVKA 4FSVA 1I39A 4E19A 3HVRA 2CGJA 4FLTA 1BQMA 2E5LK 4GW6A 3R3LA 4OKKA 4KH5A 2F8TA 3P1GA 3K5MA 1VQMN 2KZZA 4O5BA 3KWIA 4CI6A 1VRTA 5E26A 3S9HA 1C0FA 5FPEA 1NKEA 4KHYA 5KGWA 2FBTA 1BIZA 3EY1A 3RSEA 2ZJQL 4MLHA 3H1QA 1RT5A 2P9NA 4PA1A 2OTJN 2DTUA 3OBYA 3J7YP 1A5XA 1VSFA 4RCHA 1NGIA 4CHYA 1N5YA 1NK7A 4E7HA 1JLAA 3O08A 4M7YA 3EL2A 1C0MA 2WONA 1G15A 5F0XA 4CF2A 1JLBA 3U8XA 1Q18A 4WQ4A 3LP2A 1X3NA 4BRLA 1RDWX 4A2AA 5KQDA 4KTQA 4PUOA 1T03A 4AHTA 3KK3A 1TK0A 3FZKA 1JLQA 1S9GA 1K9MO 3OA9A 3R8EA 3AGKA 3P5JA 2NRHA 4B9VA 3AVGA 3V4IA 2GV9A 3VA3A 3O9SA 4B8AB 1N32K 4EAHD 2HW3A 4BE2A 3EE9A 4B1ZA 2P9SA 2QXLA 5KTQA 4CHOA 5SWMA 2NUBA 1ILYA 3BDPA 4JI2K 4CFAA 1WSHA 1NWKA 3ZT0A 1BI4A 4RW6A 3DRPA 3KHYA 4I2PA 1P8ZA 1KLNA 4O0IA 2F7TA 4FPAA 1T6DA 3KWGA 4CJEA 1NM1A 1ZBLA 3DRRA 4I2QA 4CZMA 3OYMA 2Q97A 1HKGA 2OPQA 4FWQA 4KB0A 1HR0K 4FJMA 3E9PA 3ID8A 4CZGA 1NGJA 3SUOA 5JMVA 3ZT1A 3U3YA 3B8AX 3ZLJA 4FOIA 1C6VA 4JD2A 3VEOA 4DS4A 1RDAA 4H5NA 1DT9A 4LF8K 4OPHA 4CGGA 2W41A 3K58A 1JJ2M 4CGJA 4DU3A 3CD6N 5HOOA 2LSNA 3VF4A 5AQQA 1BUPA 3NFAA 1W7AA 3O5BA 3L4QA 3SAHA 3GG4A 4B1WB 3QNOA 2GWJA 1UA0A 1ASUA 4OLBA 3MXIA 2VQEK 2GELA 1SQKA 3SLCA 3PY8A 1VQ9N 1HX1A 1BA1A 1TGOA 4F2SA 4CHNA 3DLGA 4CE9A 4A59A 3D6RA 4O8UA 1RILA 4IJNA 3LDNA 4B1XB 3AVLA 4HHTA 1IKVA 2KFZA 4LC9B 3UIQA 1F21A 3K57A 3PO5A 1LWCA 3HPOA 2HMPA 4KV8A 3MX2A 3OBWA 3MXJA 1RBRA 3V9UA 4H0YB 5M1FA 3UKUB 4C8NA 4BVOA 3AA4A 4WFNL 3CXCM 5ELZA 5AFUA 5KGXA 2VWKA 4OPKA 4JI8K 3IG1A 3CETA 4KAZA 3SV4A 1MU2A 3AA5X 2KZMA 1QQNA 4K25A 1S9EA 1HQEA 4DTUA 3BZKA 2HHSA 1E4FT 1QQOA 1EXQA 3RWUA 1EO1A 5TKWA 3CJBA 3G10A 3IDHA 1LWFA 4IEEA 1VQ8N 1ZBUA 1MWMA 3SBTA 4JN4A 3ASMA 2OPRA 1GOAA 4PKHA 4RWTA 1JLEA 1VSDA 3OYGA 4NXMK 3FZHA 4H5TA 1N8RO 3I56N 3DI6A 3J7AP 3HOSA 1NGEA 1ESVA 3V9SA 4EZ9A 1JXBA 5CZ1A 2ZQBA 3LWLA 5KPZA 4H0VB 4IFVA 3MWPA 4BDZA 4H0TB 3BZCA 2O8FA 3WT0A 2YHBA 3IFRA 4BWMA 3AVAA 2EWSA 4DV5K 3SZ2A 3AVHA 3FGUA 4CEFA 5AQVA 4M3UA 2VG5A 3OJUA 2D4WA 4PY5A 3SBGA 1T3VA 1CLQA 1GOCA 3I8DA 2QW9A 1J53A 5CYMA 4BRCA 1TKTA 5CY4A 3H3OB 5AZIB 4Z4GA 1O13A 3WNFA 4XH1A 3DWLA 3J80O 1Q9XA 4O4GA 2ETJA 3VGMA 2OZMA 5DMRA 3EKUA 2NRXA 1XMQK 4ELTA 5IT9O 3AVNA 1N34K 2P9KB 2QWPA 2V51B 3D2FB 3IMXA 1VSEA 3N4QA 3ZEUB 4FZYA 4M3ZA 4E3SA 2YHWA 5GINA 2P9PB 3NVMA 1Y97A 4FW2A 3ZETB 3C0BA 4KO0A 4LD0A 4CJ5A 3EO3A 3H45C 5KPRA 1YITN 3OHRA 1WOQA 2O8DB 3QLHA 1TVRA 3RRGA 4IOAL 4PL7A 4DHYA 4QAGA 3RR8A 3EN9A 4HCBA 1JLFA 1B9DA 4C8MA 3NCIA 3G4SN 4FM0A 3CMAN 3MCAB 2HSTA 4BWJA 4NLCA 3W3DA 1VSMA 1RT4A 4DTJA 3ENBA 4NYNA 4I7FA 3CJCA 5AQTA 3ENHA 1VQ5N 1SL1A 2HHTA 4PQUA 1KTQA 4C1NI 3VGKA 4IFYA 3AVIA 4CJFA 3MMVA 4AHUA 3VEZA 1YJWN 3PUFA 3LAMA 4BG8A 3AO5A 1IKXA 3L0QA 1NU0A 3VEWA 3VQQA 4N5SA 5LJVA 3V9ZA 3WQUA 3JXUA 1K6YA 4Y0WA 4A57A 3ZSXA 3T19A 2GWKA 3OYFA 2NRVA 2P9UB 2HF3A 1BIUA 4FJ9A 2E88A 5AQUA 3QEPA 3QFPA 2G8HA 4BR7A 4CZIA 1RT2A 3VEXA 4HCCA 4FK2A 3DXMA 2F9TA 3HO1A 3ZT2A 4BR4A 4GY2B 1BGXT 2QM1A 2IOCA 2YJEA 4AM6A 1DTQA 1VQ4N 3VQCA 4IKFA 1L5UA 5DM7L 4IO9L 5EY4A 4A61A 3VTIA 3FFKB 1XC9A 4CGIA 4F3OA 2X6SA 5AQGA 3C95A 2E8AA 3K5OA 1QHAA 2YCHA 2F8SA 2UU9K 2J4RA 5A2QO 4NCAA 2P9LB 5JICA 3HM8A 3NAEA 4GVEA 1FKOA 1LAWA 2V52B 4JHDB 5I9EB 3IAYA 2BH1A 5AQIA 4M42A 1S72N 1LW0A 4XH4A 1HNXK 3AVJA 3S3MA 3NE6A 5AJ3K 1XQSC 4DR5K 2QWLA 4W5OA 5LL6Z 2A41A 3DLKA 4K0KK 4WQ5C 2I7NA 3TABA 1VRUA 2D5RA 2A1RA 3ZT4A 1MA9B 3A8YA 1U49A 1T7PA 4FYDA 3SUNA 2ASMA 4JKCA 1UOCA 1CXQA 3H3NO 4CD1A 3D0PA 3MX5A 3VETA 2FXUA 3ZSZA 3HTVA 1QS4A 3VTHA 1MWKA 3DXKB 5CYQA 2FC0A 2I5JA 1YJ9N 4CF1A 3BY5A 5GIPA 4PWDA 3TAQA 4I9LA 3C6TA 2HNDA 1IKWA 1XI1A 2W6LA 2ASOA 5KRSA 1RBUA 3K0SA 4JEPA 5HRRA 3ALYA 3B6PA 3OW2M 3CIPA 4JNEA 3ZX0A 4B1VA 4ID1A 2ZGYA 4F3TA 3LALA 4PL8A 4FWRA 2WBNA 1GLAG 2JWKA 1I94K 4FLUA 1Z05A 3FE1A 4FPBA 3CJ1A 3R6MA 1NLVA 2BDPA 1GLFO 4LY7A 3MN9A 2X6NA 3LDPA 2QWOA 4BREA 4E89A 4CEOA 4DFKA 4CEDA 4FWNA 3GDQA 4LF9K 1RDUA 1WSIA 3EKSA 1HNVA 4FLZA 3CF5L 4B3TK 4RW7A 4JI7K 4DTPA 4O55A 2E20A 2VGMA 3IKMA 5BRHA 2QA4N 1EP4A 3PSIA 3LANA 4CJ3A 1YVUA 1OH6A 4CIEA 3K9JA 3AAPA 3HVTA 3MAQA 1V4TA 4BY9C 4W5TA 1KXPA 3OYJA 3F73A 3NGYA 2O4GA 4Y1DA 4HTUA 4O44A 4GMJB 4UY8O 1UA1A 3OYNA 3QMLA 1VSHA 3P38A 3RVCA 4I9QA 5CHIA 3VQ7A 1M90O 1S1TA 5IWAK 5FRMA 4M7XA 5C2DA 1J6ZA 3K2PA 4DSIA 5JLHA 1BO5O 4GNIA 2PFUA 3AO3A 3T1HK 1W0HA 2KLAA 4KHQA 4CIGA 2JLEA 3DLLL 2O8CB 4IZ9A 2HHXA 5CE3A 1GLLO 4WYBA 1KVCA 2AA4A 4XEIA 1X9MA 1NJIO 4DV0K 4BRKA 4XIUA 1BOTO 2YKNA 4KBOA 2HBJA 4OLAA 2ZM6K 3C94A 1S1WA 4BGAA 1LW2A 4ILJA 4DQQA 1HPZA 1B9FA 4EP4A 4E7KA 2WTUA 3NF7A 3V1OA 4JYAK 3EEQA 4MO5A 1WSGA 4TSXA 3VQ4A 3HP9A 1I3AA 4J2BA 2OCEA 4KI4A 2QEXN 3KTQA 4JI5K 4RW8A 3DM2A 3SNNA 3I0SA 1IJJA 4B9QA 2E2QA 1KD1O 3U3GA 3KLFA 4F9OA 4IXCA 3BP8A 4DQSA 5BN9A 1JCFA 4O5FA 3PLAA 4KH6A 3L2VA 4JKGB 5DK5A 1RT6A 2UXCK 4Z4CA 3DYAA 5C2FA 3UKUA 4HUEA 5BRFA 2BTFA 1HKCA 4XH5A 1RBTA 3QNNA 1U6ZA 3CQXA 1X9JA 1S5JA 4YOUA 2VYPA 4DKWA 3CCMN 3DOKA 3NGZA 3F9MA 3ATUA 5CR4A 3J81O 3OY9A 4KFBA 4Z94A 3SQ4A 1JLGA 2G8FA 2ZD1A 4DQPA 1SL2A 2A42A 4BQLA 4FM1A 4F2RA 3FZLA 2F4VK 3QEIA 1T8EA 3CM5A 3CC2N 3NBPA 1S22A 3THYB 3H46O 4E7JA 5EXWA 2VWBA 1C1AA 3VF2A 1EWQA 5J2MA 2HVHA 4GV3A 1WSFA 4BR0A 3M8QA 4IJAA 4H0XB 3SAGA 4JK8A 2DFFA 1YT3A 5D3GA 3CCQN 3A5MC 3QERA 4JRPA 3LPUA 4ZHRA 4Z4HA 1DEJA 5AQLA 4FXDA 1TV6A 3NH0A 3P4IA 1XWLA 4X62K 2EHGA 3Q7CA 1C1BA 2E1ZA 4YDUA 3BF3A 2Y1IA 1JXEA 1S3XA 4BR9A 2OTLN 3HJFA 4IWVA 5AZIA 4BRQA 4FJ7A 4E1MA 4C8OA 2YNHA 1YHQN 3F2KA 4A5BA 1YVNA 3OYLA 3O9RA 2Q0RA 2YI1A 4BC5A 2B4JA 3O9UA 2P9KA 3PX0A 3D2FA 1ZBIA 3ZEUA 2W40A 1IG9A 3I8BA 3HM9A 4BR5A 2P9PA 3O1WA 3ZETA 1N6QA 3EYZA 3GOIA 4BE1A 2B5JA 4GKJK 5AQHA 3TAFA 2O8DA 4OX9K 1NKBA 2Q36A 3ZSQA 2UUBK 4LF5K 1QQMA 4Q0BA 5HRNA 3CHWA 3SUPA 5SZTA 4R5PA 4BQZA 2EX3A 4MDAA 1WSJA 1XC3A 5LJWA 4DU4A 2KFNA 3OS1A 4FJKA 1NK9A 1IO2A 4KPYA 4BC4A 1OVYA 3KKRA 3TSQA 3D45A 2RHKA 4OVLA 1Z6RA 3RMBA 3HPHA 3DLBA 5GAGP 1RGIA 3MEDA 5TKYA 4MO4A 1W9HA 1XHZA 4CBXA 2QWQA 1RBSA 3S41A 3TAEA 2DFHA 4B1YB 2P9UA 1BCMA 1S1XA 5HBMA 2RF2A 3KK1A 3SJJA 3O4NA 4DTXA 5J2QA 3THXB 2Q0UA 1YUWA 1OH7A 2YV0X 2B6AA 4BE0A 3DLRA 4H4MA 4CECA 4MFBA 4ZTFA 4K8XA 4LSNA 4CEQA 1GLDG 5AQRA 2F96A 1SAZA 3OYKA 4FLYA 3V1RA 3O4WA 4HWIA 4N41A 3WNHA 1DKGD 3DMJA 3TI0A 4I6MB 4BR2A 2GEMA 4LH4A 1QTMA 3THWB 4JI0K 2P9LA 1FK9A 2G8VA 1QZ6A 4DTNA 4PHTX 1Q82O 2ASPA 4JHDA 4FJXA 5C42A 4AQYK 2FF3B 2P9IB 3KKSA 4KTWA 3CG7A 3SK3A 4W5NA 4B3MK 3E9OA 3VOVA 5JLFA 2NRWA 2DFEA 3S3OA 2HBLA 4DQ8A 3V1QA 3WUHA 3VEVA 4DV4K 1L3SA 1YI2N 1DTTA 1HLUA 1RBVA 5LY3A 4PKIA 1IH7A 4DB3A 4WCEL 3LPTA 1QSSA 3DXKA 4DMNA 3NVKA 3DJCA 4ELUA 1SUQA 4CHZA 1ITGA 1TAUA 2Q2RA 4MQ3A 3WQTA 4H8KA 4EZ6A 3LL3A 3ZSYA 2A5XA 5FLXO 4OGEA 3MXMA 4DR1K 3SYZA 2WC9A 3V81A 1EX4A 2E6MA 1Q7YO 1X1PA 3QBWA 3U4LA 1JLCA 3LAKA 4GKKK 2Z1IA 3QICA 1KVBA 2ZWHA 4DFPA 3QDKA 4M3TA 3KZBA 1K8AO 1NGFA 4J2AA 4FJJA 2P5GA 4IEIA 3V9WA 4CJLA 1KSPA 1LWEA 3KJVA 3OYCA 3SQ2A 1WSEA 1VQ6N 4JKDA 4Z4IA 3V9XA 4G9ZA 4HUGA 3DRSA 3OYBA 1T44A 2XY5A 4JKHA 4FW1A 1X9SA 1JCGA 2O8BB 1LCUA 1NK8A 3VN5A 3T7ZA 3L6QA 3LP1A 3HPGA 3SAFA 4Q5VA 4H5RA 3O3HA 1X3MA 2F9WA 3ZT3A 3E1YA 3O6WA 4LF6K 1ZBSA 1Y64A 3EZ5A 4N76A 4B3OA 3L8BA 1W2BM 5AQYA 3MN5A 4DSKA 4DSFA 3VQAA 4CZFA 4BRFA 1NJYA 1QVFM 3M3ZA 2PBDA 3TANA 3K59A 1VQLN 1RDDA 2H3GX 4QCLA 3ZX3A 4DR2K 4FLXA 2O8CA 4JAXA 2UYTA 4GV9A 3FFIA 1HQUA 1Q9YA 1RFQA 5I3UA 3AVBA 1GOBA 1VAZA 1VHXA 4GV6A 3HP6A 2NZTA 1VQPN 4CZKA 3PIPL 3O9TA 1NKCA 4B9MA 1WLJA 3ENOA 1D5AA 1C0TA 4DUYK 3CI5A 4IFEA 1M1KO 1RTJA 3VMFB 1RCHA 4FCYA 2YKMA 3OJSA 1WB9A 3CJAA 1TYQB 4FK0A 2VGNA 3PIOL 2HNYA 1Z25A 3IS9A 4CEBA 4FO0A 2P51A 4YOYA 3ZSOA 2UXBK 1W97L 2KKZA 2YNGA 2KTQA 1SV5A 2G8IA 3M5RA 5AQWA 2GUIA 3JYTA 3BUZB 2BE2A 1DLOA 5DM6L 4JKGA 1ZBFA 1HUXA 3WXMB 4LF7K 4WQ4C 4Z0UA 4F4KA 2BANA 4OPJA 1VSIA 1GLJO 5M1QA 4DFJA 1NOZA 1GLEG 1X9WA 3LWMA 3U6FA 3G0ZA 4AF1A 5BPNA 2QKKA 5JVGL 3FLCO 4DUZK 4FWPA 3GBTA 1NGAA 2VQFK 4HUFA 5ADXH 3QEVA 1C1CA 1S6QA 2FBYA 1VQ7N 2P5OA 2O8EB 3MN6A 4LFCK 2E4LA 3CMEN 3O9QA 1YTUA 4RW9A 5BR8K 4CHPA 2KQ2A 4Z4FA 4CEZA 5CZ2A 2UXDK 5T7BA 3OYHA 4LF4K 3THYA 4N56A 3WEEB 3ULDA 4BRHA 3TTCA 3SPZA 1FW6A 4JI1K 4DQRA 4JS5A 4J2DA 4FOEA 2GBZA 2AP1A 3C7NB 4CEEA 2PY5A 4FLWA 1ZXOA 2V7ZA 5KI6A 3U9DA 1BCOA 4BRPA 5M1NA 1VQNN 4KHWA 3CJ9A 5AQFA 1REVA 1FJGK 2HHWA 4H0OA 1NJXA 3KD5E 2AJQA 4BRMA 4DV2K 3KIOA 1SS6A 1MDUB 4DV7K 4LFAK 4AH9A 3G71N 4FWMA 5AQMA 1BU6O 5M1OA 4IG0A 4X65K 5KQ8A 1YJNN 4KKOA 1NK0A 3M6GA 4EP5A 4JRQA 2OA8A 4CJPA 3J7ZO 5BR9A 1SKRA 3AV9A 3KK2A 2D1KA 3I33A 3NF9A 4YOWA 2W6KA 3WXJA 5FPDA 3L2UA 4DLGA 2Y1JA 2A1SA 4H0PA 3TWHA 2CH6A 1HYZA 3OS2A 3HK2A 3HSTB 3DLHA 4CJRA 1NGBA 4YFUA 3QINA 3AVMA 3HT3A 4J8FA 5EU7A 4X66K 1NMDA 3LDLA 5FDLA 3H6EA 4BDPA 2IS3A 1L3TA 1A5VA 1D4XA 3VQ6A 3ZYYX 4FJ5A 2HB5A 1NJZA 3CJ7A 3VEYA 3CCLN 5C0YA 3TTFA 4DS5A 1KVAA 1D9DA 1XUPO 5LMNK 5BRDA 1WAFA 4H5VA 3PX6A 2IIRA 3D7EO 2ZJRL 4CD3A 3KVGA 3D2EB 1HJOA 4Z4EA 1UAXA 3QIPA 2NRRA 3SQ1A 2Z1GA 4DR4K 1RTDA 4M3RA 4YOVA 3RTVA 2CGKA 5HLFA 4ISFA 3HSCA 4H5WA 2IC3A 2RKIA 3CCVN 3VF6A 3NH1A 4ICLA 2HHUA 4CJQA 3THXA 1JKHA 1U04A 3ISNC 1U47A 1XHXA 3WXIA 4CFCA 3PX4A 3N4PA 4FZXC 1EETA 4ISGA 4B9UA 3BGRA 1WNSA 2E2NA 2OZSA 4CVNE 3KD1E 3TARA 4I6MA 3WNGA 3KLGA 1A5WA 1U2VB 1TK8A 5BREA 4CEAA 2A40A 3THWA 2FSKA 3HI0A 3Q7BA 3S3NA 4O8KA 3ZSRA 1BQNA 5AZJB 2FF6A 3ZX2A 3PSFA 1C0UA 1IBMK 1EQYA 2P9IA 2XRIA 1XNQK 1VK0A 1R59O 3ULEB 5HL7L 1RT1A 2NRZA 4IDKA 2WUSA 4DTMA 4HVJA 1HYVA 2JGUA 1C0GA 1BWFO 2HOEA 3VQBA 4DTRA 4EFHA 1EWRA 4FJNA 4B1UB 3C6HA 1IKYA 1U4BA 3A0IX 3OYAA 1KAXA 4M63C 3O3FA 2X74A 1XNRK 3E9LA 4MLEA 4BRDA 3DOLA 5JS1A 3JAMO 3NGIA 3MEGA 2OPPA 4CJSA 4CBUA 3SJHA 3AO1A 5MLCQ 5F1XA 1HNWK 2E1YA 2D0BA 4NLBA 5GADP 2QXFA 1K73O 3A5LC 3FZFA 1JCEA 2XY8A 1K8KB 4JS4A 4AHCA 3AGRA 2HBKA 2OYQA 4CERA 5FPMA 1T05A 2G8UA 5AQPA 3SMSA 3NDKA 1V4SA 2RE2A 3CCUN 3V6DA 3JS6A 4DF8A 3O3GA 3CFPA 4CJVA 2UUCK 1NJWA 1L3UA 2E2PA 3IUCA 1CZBA 3ID6A 3CCJN 3L2RA 1HPMA 1Q81O 5EOYA 2WOMA 2D0PA 4LH5A 1ATRA 4CF0A 3VA0A 5FROA 1ASVA 3MDQA 3M8PA 1QE1A 4WQ5A 4K43A 4OJRA 1QSYA 4M41A 1RT7A 4C8KA 2DPNA 3AVCA 3M8RA 3FR0A 4ILHA 4JK9A 3WXLA 4BC2A 2HHQA 3RMAA 2O8BA 2O4IA 1KAYA 1NBWA 1Q86O 2D0OA 1OKJA 3MECA 4X64K 3VESA 3QETA 3P39A 4FVUA 1T6CA 2ITMA 2GX9A 1IV0A 2ZE2A 1DGKN 3E66A 4AHSA 2YHYA 3H08A 3T69A 4KH4A 5C10A 3RMCA 4FWKA 2NLXA 4BACA 1U45A 2IVNA 4B9TA 2IVPA 1FKPA 4AM7A 1QZ5A 3CCEN 1QHTA 2I7PA 5HROA 2VG6A 3QFUA 3RRHA 2HF4A 3VERA 4RG8A 4NCBA 1QQCA 3LP3A 4RW4A 4BRNA 2YNIA 3NH2A 3HZ6A 3TAGA 3R9PA 4WFAL 1TKZA 3VGLA 3KLHA 4ILGB 4JKFA 3L2WA 3UKRB 3GE1A 1YTAA 4CZJA 2FBVA 1OVQA 3VPZA 1NGDA 4C23A 4R79A 1YXQA 1TKXA 2KHOA 1VSKA 3I55N 1TYQA 2IGIA 2ZJPL 3EE8A 4OGCA 4L3QA 5AQNA 3CPEA 3OYIA 1LV5A 4CCHA 4NCGA 2QWMA 1NK5A 4FJLA 4BGBA 3J8AA 4DR7K 4C1NK 5GIOA 3HYFA 4JKEA 3KLEA 2QTDA 4KRFA 4CESA 3C65A 4FWSA 1JL2A 1E3MA 1NGCA 3OYEA 2HMIA 4UQGA 4DWIA 1GLBG 2QK9A 5KRTA 3A5OC 4FJIA 4CK1A 4H4OA 2QKBA 4IO8A 1NNEA 1KQSM 3HXMA 4EIAA 1VSJA 2HVIA 3TR8A 3HBTA 4IG3A 3L3VA 4BRIA 1ZYQA 1FXXA 1O1WA 4YY3K 3F9KA 3ZSVA 3JSMA 3QEWA 4JLHA 4DV1K 4E1NA 2ATQA 2RPIA 4DR3K 1RT3A 3UB5A 4FLVA 1RTIA 3GL1A 3OTOK 4FJHA 4OO1J 2O8EA 5AQXA 3QIOA 2A3ZA 1NK4A 1IBKK 1HNIA 4KHSA 4DG1A 3AA3A 2RN2A 1P90A 3RR7A 4AHRA 1KC8O 1J54A 3WEEA 3ITHA 3CQYA 4B08A 5K14A 1J9AA 4JI6K 3VQEA 2UUAK 3NHGA 3C7NA 3RSEB 5B8HA 1J5EK 4CJWA 4BVPA 2P9NB 1U48A 4KHPK 1YAGA 1TK5A 3THVA 4HTLA 3VQ9A 2BUPA 1KLMA 5AFUH 4ISEA 4DF4A 2YNFA 1ZBHA 5AQJA 4KHUA 3AY9A 3P31A 5H1SQ 2PZSA 3L4IA 2VG7A 3LP0A 3IRXA 4CK3A 3K9KA 1BISA 4M3XA 3LDOA 4Y1CA 3HOTA 2FLOA 3TSUA 5KPTA 4BRAA 3U9ZA 3TU5A 5BPMA 3VQDA 3T1AA 4NYFA 3BEXA 3MN7A 4RTFD 4CK2A 3HL8A 1CXUA 3ZSWA 1CZAN 1KRPA 4A62A 3SPYA 1RNHA 2X78A 4NO7A 2W42A 1CZ9A 3CFRA 2HHHK 1R0AA 4CFDA 2V7YA 1WBBA 4AILC 2P9SB 4DV3K 4E1JA 3CCSN 1B92A 1ASWA 4DQIA 4W5QA 3CERA 1YIJN 2GUPA 2CH5A 4CGHA 4MDBA 4EHTA 1BI4B 3OS0A 3NF8A 1HJRA 2NNWA 4YOTA 1N36K 4CF8A 2PAVA 4CJUA 4BC3A 1NG9A 4CZLA 4OKEA 3QEXA 4DTOA 5JVHL 4YOXA 4DSJA 2P1JA 5HP1A 4B9SA 5EX5A 2IVOA 4BG9A 1XMOK 4CGFA 2YJFA 1SKSA 4IOXA 5I42A 3C6AA 4DSLA 1L3VA 2KW4A 3QBXA 4O0JA 3VQPA 1NGGA 1SZ2A 1OH5A 2GTDA 3D2EA 1QVGM 4JD2B 4OPAA 3K5LA 4C8LA 2YHXA 1TKDA 1RDCA 2VCPA 1OH8A 4QOZB 3K5NA 4DCHA 3OYDA 4QS8A 3KK7A 4V19S 2OANA 2IDOA 5E41A 3CYMA 1HKBA 3PV8A 1ZC6A 2WFBA 1S1VA 2QI2A 5M1PA 1D8YA 4CJ7A 2ZF5O 3O4QA 4JKAA 3PO4A 4FL9A 3T1YK 3LM2A 5AQKA 4BDYA 2FSNA 3TTDA 4EHUA 1NOYA 4FZZA 3DAWA 3B6OA 4CBWA 3RMDA 4LFBK 2Q31A 4F8RA 3AAQA 4N47A 4W5RA 3CPWM 1N33K 1Q8IA 1YF5L 1LAVA 2QWNA 5ADXA 3E01A 1HMVA 4G1QA 1UWBA 5J1EA 2PYJA 1BDGA 1SKWA 1U2VA 3UE5A 3EZWA 3TSPA 3VENA 5FRNA 5J2NA 4CGDA 5AZJA 5AQOA 5LMUK 4WF9L 2XO7A 5GAHP 3ULEA 3M1FA 2Q1NA 4DFMA 4B9NA 3HRGA 4FJ8A 3AO4A 4IDHA 1TL3A 3SI6A 1KAZA 4KREA 3I0RA 4QS7A 4DU1A 1WBDA 4A5AA 4YDUC 2Z1HA 3KLIA 1HYSA 3O80A 3LDSA 2E2OA 1BG3A 1WN7A 1TUYA 5GAEP 1BHLA 3CC4N 3MEEA 5C15A 5HRPA 3LM9A 5F2RA 4U67L 2D0AA 3AARA 4KB1A 3SMPA 4B9LA 3AO2A 4ELVA 2D0CA 2IAJA 4CJKA 4NXNK 5JS2A 3AVFA 2Q3SA 4ZTJA 3O8MA 1NMNA 4ID5A 3SCXA 1HRHA 1K8KA 3A5NC 3AA2A 5AR0A 2PYLA 4K41A 4L8RB 4BROA 5C25A 3WXKA 1Z26A 2VWJA 1BA0A 2HHVA 1RTHA 2HBMA 2XY6A 1WAJA 1NK6A 1WUAA 5M1KA 5HRSA 3F5TA 1S6PA 1TAQA 3ATVA 1H1VA 1QSLA 2Z1JA 4WE1A 4IBNA 3T3FA 1J5OA 4QS9A 1S1UA 3LDQA 2O8FB 3QESA 1HNZK 5BPLA 2HNZA 4K42A 2G8WA 1D9FA 1ATNA 3R1XA 2FSJA 3M8SA 3O1BA 4J2EA 2XHBA 4M3YA 3CC7N 1E4GT 1JL1A 2BGGA 5EVZA 4JV5K 3FZMA 1IBLK 1VQKN 4FWOA 2QWRA 3MWTA 2FBXA 3CFOA 4FJGA 2JWLA 4DTSA 1IG8A 2G8KA
chains in the Genus database with same CATH topology
3VQ8A 3VQQA 3QO9A 3KKSA 1T05A 4N5SA 2G8UA 3V9ZA 4KTWA 3NDKA 3V6DA 3CG7A 3DLEA 2OPSA 1K6YA 4DF8A 3ZSXA 3T19A 3O3GA 3OYFA 3CFPA 4W5NA 4CJVA 3C6UA 1BIUA 2DFEA 4FJ9A 4AHVA 1NJWA 1L3UA 3QEPA 2G8HA 1CZBA 3S3OA 3TAMA 4DSEA 3V1QA 3L2RA 1SL0A 1L3SA 1RT2A 1KFDA 4HCCA 1DTTA 2WOMA 4FK2A 4LH5A 1RBVA 3L3UA 4CF0A 3WNEA 3VA0A 5FROA 3HO1A 3ZCMA 1ASVA 1IH7A 3ZT2A 3LPTA 4FVMA 1KCFA 1BGXT 3M8PA 1QSSA 2IOCA 2DY4A 1QE1A 4CJ4A 1DTQA 4OJRA 4DMNA 1QSYA 4KI6A 4M41A 4CF9A 4ELUA 3VQCA 3CQ8A 1RT7A 4IKFA 4C8KA 3AVCA 1SUQA 4CJTA 4CHZA 3SQ0A 4CFBA 3M8RA 1L5UA 1ITGA 1TAUA 3OVNA 2HHQA 1XC9A 3RMAA 4CGIA 4F3OA 2O4IA 4MQ3A 2X6SA 4GVMA 3C95A 4H8KA 4EZ6A 3K5OA 3ZSYA 2F8SA 4E0DA 3TAPA 1BL3A 2ITGA 3MECA 4OGEA 4OKJA 4NCAA 3MXMA 3A2FA 3NAEA 3QETA 4M45A 4M3WA 3SYZA 1FKOA 1LAWA 3VQ5A 4KHNA 2E6LA 2ZE2A 3V81A 3IAYA 1EX4A 4KTZA 2E6MA 4M42A 4AHSA 1EKEA 1X1PA 3H08A 4FM2A 1LW0A 3AVJA 3S3MA 3NE6A 4YNQA 1JLCA 3LAKA 3RMCA 2Z1IA 4W5OA 5C24A 3CM6A 1KVBA 4DFPA 4BACA 3DLKA 2XY7A 4M3TA 3TABA 2A1RA 1VRUA 2D5RA 1U45A 3P83D 3ZT4A 1U49A 1T7PA 1FKPA 4B9TA 4J2AA 4FYDA 3SUNA 4FJJA 2P5GA 1TL1A 1UOCA 1QHTA 3L2QA 4B8CA 3SV3A 5HROA 1CXQA 2VG6A 3V9WA 4CJLA 2YHAA 1LWEA 3D0PA 3RRHA 1KSPA 3KJVA 1KFSA 3OYCA 2R7YA 4DLEA 3ZSZA 3SQ2A 4RG8A 4NCBA 1QQCA 1WSEA 3LP3A 1QS4A 4RW4A 4FK4A 2YNIA 3NH2A 3V9XA 4HUGA 4Z4IA 3DRSA 3OYBA 3NF6A 4CHQA 1TKZA 4LSLA 3TAGA 5CYQA 2FC0A 3LZJA 3KLHA 2XY5A 3L2WA 2I5JA 4FW1A 4K8ZA 1X9SA 1YTAA 2FBVA 4E7IA 4CF1A 4PWDA 3TAQA 4I9LA 3C6TA 1RDBA 1NK8A 3VN5A 3SUQA 2HNDA 3LP1A 3HPGA 4Q5VA 1IKWA 4CIFA 1XI1A 1TKXA 5J2PA 1VSKA 5KRSA 1RBUA 3LZIA 2IGIA 5HRRA 3O3HA 4E7LA 3ALYA 1VSLA 3B6PA 3ZT3A 4OGCA 3AVKA 1I39A 4E19A 3OYIA 1LV5A 4CCHA 3EZ5A 4NCGA 1NK5A 4ID1A 4FJLA 4N76A 3HVRA 4FLTA 4B3OA 3L8BA 3LALA 1BQMA 4F3TA 4DSKA 4GW6A 4OKKA 3VQAA 4DSFA 1NJYA 3HYFA 4FLUA 3KLEA 3P1GA 3K5MA 2F8TA 2KZZA 4O5BA 4KRFA 2BDPA 4CESA 4LY7A 3TANA 2X6NA 1VRTA 3K59A 1JL2A 3S9HA 1RDDA 1NKEA 4KHYA 4E89A 4CEOA 4DFKA 4CEDA 4QCLA 5KGWA 3OYEA 2HMIA 4UQGA 4DWIA 2FBTA 1WSIA 1BIZA 3EY1A 5KRTA 1HNVA 4FLXA 4FLZA 4FJIA 2QK9A 4RW7A 3FFIA 4CK1A 1RT5A 4O55A 4PA1A 4DTPA 1HQUA 4H4OA 1Q9YA 2QKBA 2DTUA 5I3UA 3AVBA 3HXMA 1EP4A 1VSJA 1GOBA 1A5XA 2HVIA 1VSFA 3LANA 4CHYA 4CJ3A 1N5YA 3TR8A 3HP6A 4IG3A 1YVUA 1NKCA 3L3VA 4B9MA 1WLJA 1ZYQA 1FXXA 1NK7A 1D5AA 1O1WA 1C0TA 4CIEA 4E7HA 3F9KA 1JLAA 3ZSVA 3JSMA 3QEWA 1C0MA 3HVTA 2WONA 1RTJA 1G15A 4JLHA 1RCHA 2ATQA 2RPIA 4E1NA 4CF2A 3MAQA 1JLBA 1RT3A 2YKMA 4W5TA 3OJSA 3OYJA 3F73A 4FCYA 4FLVA 3LP2A 3NGYA 2O4GA 4Y1DA 4HTUA 1RTIA 4O44A 4FJHA 4FK0A 4KTQA 4PUOA 2HNYA 1Z25A 3QIOA 4GMJB 3IS9A 1NK4A 1T03A 1HNIA 4KHSA 4DG1A 3AA3A 1UA1A 4CEBA 4AHTA 3OYNA 3KK3A 1VSHA 1TK0A 2RN2A 4I9QA 2P51A 1JLQA 3VQ7A 1S9GA 3RR7A 4AHRA 1S1TA 3P5JA 3ZSOA 4B9VA 5FRMA 3AVGA 1J54A 3V4IA 2GV9A 2YNGA 3ITHA 2KTQA 3K2PA 1SV5A 4B08A 3VA3A 5K14A 4B8AB 2G8IA 4DSIA 1J9AA 2GUIA 3JYTA 2BE2A 2HW3A 3AO3A 1W0HA 3VQEA 4BE2A 4KHQA 4CIGA 1DLOA 2JLEA 3NHGA 1ZBFA 2HHXA 5KTQA 4CHOA 5SWMA 4CJWA 2NUBA 1U48A 3BDPA 4CFAA 1KVCA 1TK5A 1WSHA 5C42A 3THVA 4Z0UA 4F4KA 3VQ9A 1X9MA 3ZT0A 1BI4A 1KLMA 2BANA 4RW6A 4OPJA 1VSIA 3DRPA 1NOZA 4DFJA 1X9WA 4XIUA 4I2PA 4DF4A 2YKNA 1KLNA 4O0IA 3LWMA 2YNFA 3U6FA 3G0ZA 4OLAA 2QKKA 3C94A 4CJEA 1ZBHA 1S1WA 4DQQA 1LW2A 1ZBLA 1HPZA 1B9FA 3DRRA 4I2QA 4EP4A 4E7KA 4KHUA 2PZSA 3OYMA 2OPQA 4HUFA 2VG7A 3LP0A 3IRXA 1C1CA 3NF7A 1S6QA 3V1OA 4CK3A 3QEVA 4KB0A 2FBYA 1BISA 2P5OA 4M3XA 4FJMA 2E4LA 4Y1CA 1WSGA 4TSXA 3SUOA 1YTUA 4RW9A 3VQ4A 3ZT1A 3U3YA 3HP9A 1I3AA 4CHPA 2KQ2A 4J2BA 4CEZA 4Z4FA 3VQDA 5CZ2A 3T1AA 4KI4A 4NYFA 5T7BA 1C6VA 3OYHA 3KTQA 4RW8A 4DS4A 3DM2A 3SNNA 3I0SA 4CK2A 4N56A 1RDAA 3HL8A 1CXUA 3ZSWA 1KRPA 3ULDA 3SPYA 1RNHA 4CGGA 3SPZA 2X78A 2W42A 1CZ9A 3CFRA 3U3GA 4DQRA 3KLFA 4JS5A 1R0AA 4CFDA 4DQSA 4J2DA 3K58A 2GBZA 4AILC 4CGJA 4DU3A 3L2VA 5DK5A 2LSNA 4CEEA 1B92A 1ASWA 4FLWA 2PY5A 1RT6A 4DQIA 5KI6A 4Z4CA 1BCOA 3DYAA 4W5QA 4HUEA 4KHWA 3NFAA 1RBTA 4CGHA 3QNNA 1BI4B 1REVA 3OS0A 3NF8A 1HJRA 2HHWA 1S5JA 4CF8A 3QNOA 4CJUA 1UA0A 1ASUA 4OLBA 1NJXA 3KD5E 2AJQA 4OKEA 3QEXA 3DOKA 3KIOA 3NGZA 3MXIA 4DTOA 3OY9A 4KFBA 3SQ4A 4AH9A 4DSJA 1JLGA 2P1JA 5HP1A 2G8FA 3PY8A 4B9SA 4F2SA 1TGOA 4CHNA 2ZD1A 3DLGA 4IG0A 4CGFA 1SKSA 4CE9A 1SL2A 4DQPA 4KKOA 5I42A 1NK0A 4EP5A 4JRQA 2OA8A 4FM1A 4DSLA 4CJPA 4F2RA 1L3VA 1RILA 2KW4A 4O0JA 3VQPA 1SKRA 3AVLA 3QEIA 3AV9A 3KK2A 4HHTA 3CM5A 1T8EA 3NF9A 3NBPA 3L2UA 3K5LA 4C8LA 1IKVA 2KFZA 4E7JA 1TKDA 4DLGA 2Y1JA 1RDCA 2A1SA 1C1AA 3TWHA 4QOZB 1HYZA 3OS2A 3K5NA 3OYDA 3HK2A 3HSTB 3UIQA 1F21A 3K57A 3PO5A 3DLHA 1LWCA 5J2MA 3HPOA 4CJRA 2HVHA 2IDOA 5E41A 1WSFA 3CYMA 4KV8A 3M8QA 4YFUA 3PV8A 3QINA 3MXJA 3AVMA 1RBRA 1S1VA 3V9UA 3HT3A 2DFFA 1YT3A 4C8NA 3AA4A 1D8YA 5EU7A 5D3GA 3QERA 4JRPA 3O4QA 3LPUA 5FDLA 4ZHRA 4Z4HA 2VWKA 5KGXA 3PO4A 4BDPA 2IS3A 4OPKA 1L3TA 1A5VA 3IG1A 4BDYA 4FXDA 1TV6A 1NOYA 3VQ6A 3NH0A 4FZZA 4KAZA 4FJ5A 1XWLA 3SV4A 2EHGA 2HB5A 1MU2A 3AA5X 1C1BA 3B6OA 3RMDA 1NJZA 2KZMA 1S9EA 4F8RA 2Y1IA 4N47A 4W5RA 1JXEA 4DS5A 1HQEA 1Q8IA 4DTUA 1KVAA 1LAVA 3HJFA 1D9DA 2HHSA 4FJ7A 3E01A 1HMVA 4G1QA 1EXQA 1UWBA 1WAFA 5J1EA 2PYJA 3RWUA 4E1MA 3PX6A 4C8OA 1SKWA 2YNHA 3G10A 1LWFA 3OYLA 1ZBUA 5FRNA 5J2NA 4Z4EA 3ASMA 2OPRA 2B4JA 4CGDA 1GOAA 3PX0A 1JLEA 1ZBIA 1VSDA 1UAXA 3QIPA 3OYGA 3SQ1A 2Z1GA 2XO7A 1IG9A 3HM9A 1RTDA 3DI6A 4M3RA 4DFMA 4B9NA 3V9SA 1N6QA 1JXBA 5CZ1A 3RTVA 4EZ9A 4FJ8A 2ZQBA 3AO4A 3EYZA 1TL3A 3SI6A 5HLFA 4KREA 3LWLA 4BE1A 2B5JA 2IC3A 2RKIA 3NH1A 3I0RA 4IFVA 4ICLA 3TAFA 4BDZA 2HHUA 4CJQA 4DU1A 1JKHA 1U04A 1NKBA 3ZSQA 2YHBA 3ISNC 4Q0BA 2Z1HA 5HRNA 3KLIA 3SUPA 1U47A 1HYSA 5SZTA 3LDSA 1XHXA 4R5PA 4BWMA 3AVAA 2EX3A 3SZ2A 4CFCA 1WSJA 3AVHA 3PX4A 4CEFA 1WN7A 4FZXC 4M3UA 1EETA 1BHLA 2VG5A 3OJUA 4DU4A 2KFNA 3MEEA 4PY5A 5HRPA 3OS1A 4B9UA 4FJKA 1CLQA 1NK9A 1IO2A 1GOCA 3BGRA 4KPYA 1WNSA 2D0AA 2OZSA 4KB1A 3I8DA 1J53A 5CYMA 1TKTA 3KKRA 5CY4A 4B9LA 3D45A 3AO2A 4Z4GA 3KD1E 3TARA 4ELVA 2D0CA 4OVLA 3WNGA 2IAJA 3WNFA 3KLGA 4CJKA 3RMBA 1A5WA 1TK8A 3HPHA 5JS2A 3AVFA 4CEAA 3DLBA 2Q3SA 4ZTJA 1Q9XA 4O4GA 3SCXA 2ETJA 4ID5A 1HRHA 5DMRA 2OZMA 3S3NA 3MEDA 3AA2A 3ZSRA 4ELTA 1BQNA 3AVNA 2PYLA 4L8RB 1C0UA 5C25A 2XRIA 1VK0A 1VSEA 1W9HA 1Z26A 2VWJA 1XHZA 4E3SA 4FZYA 4M3ZA 1RBSA 3TAEA 2DFHA 2HHVA 1Y97A 4FW2A 1RTHA 1RT1A 4KO0A 2XY6A 1WAJA 1BCMA 1S1XA 4IDKA 5HBMA 4LD0A 2RF2A 1NK6A 4CJ5A 4HVJA 5HRSA 1HYVA 1S6PA 1TAQA 2JGUA 3KK1A 4DTMA 3VQBA 3SJJA 1QSLA 3O4NA 4DTXA 2Z1JA 4WE1A 4DTRA 4IBNA 3T3FA 1J5OA 5J2QA 1S1UA 3QLHA 4FJNA 2YV0X 1TVRA 3RRGA 1IKYA 2B6AA 1U4BA 3QESA 4BE0A 2HNZA 4QAGA 3DLRA 4H4MA 4CECA 3OYAA 3O3FA 2G8WA 3RR8A 4MFBA 4ZTFA 1D9FA 4HCBA 4K8XA 2X74A 1JLFA 1B9DA 4LSNA 4C8MA 4CEQA 3M8SA 3NCIA 3DOLA 5JS1A 4J2EA 2F96A 4FM0A 2XHBA 3MEGA 3NGIA 2OPPA 4M3YA 4BWJA 3OYKA 4FLYA 4CJSA 1VSMA 3V1RA 1JL1A 1RT4A 2BGGA 3AO1A 4DTJA 4NYNA 4I7FA 3WNHA 4N41A 1SL1A 2D0BA 3DMJA 3TI0A 4PQUA 2QXFA 2HHTA 1KTQA 2FBXA 3CFOA 4LH4A 4IFYA 3AVIA 4CJFA 1QTMA 4FJGA 1FK9A 2G8VA 4AHUA 2XY8A 4DTSA 4DTNA 4JS4A 3PUFA 4AHCA 3LAMA 3AO5A 1IKXA 4FJXA 2OYQA 2G8KA 4CERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ8 A;  3VQQ A;  3QO9 A;  3KKS A;  1T05 A;  4N5S A;  2G8U A;  3V9Z A;  4KTW A;  3NDK A;  3V6D A;  3CG7 A;  3DLE A;  2OPS A;  1K6Y A;  4DF8 A;  3ZSX A;  3T19 A;  3O3G A;  3OYF A;  3CFP A;  4W5N A;  4CJV A;  3C6U A;  1BIU A;  2DFE A;  4FJ9 A;  4AHV A;  1NJW A;  1L3U A;  3QEP A;  2G8H A;  1CZB A;  3S3O A;  3TAM A;  4DSE A;  3V1Q A;  3L2R A;  1SL0 A;  1L3S A;  1RT2 A;  1KFD A;  4HCC A;  1DTT A;  2WOM A;  4FK2 A;  4LH5 A;  1RBV A;  3L3U A;  4CF0 A;  3WNE A;  3VA0 A;  5FRO A;  3HO1 A;  3ZCM A;  1ASV A;  1IH7 A;  3ZT2 A;  3LPT A;  4FVM A;  1KCF A;  1BGX T;  3M8P A;  1QSS A;  2IOC A;  2DY4 A;  1QE1 A;  4CJ4 A;  1DTQ A;  4OJR A;  4DMN A;  1QSY A;  4KI6 A;  4M41 A;  4CF9 A;  4ELU A;  3VQC A;  3CQ8 A;  1RT7 A;  4IKF A;  4C8K A;  3AVC A;  1SUQ A;  4CJT A;  4CHZ A;  3SQ0 A;  4CFB A;  3M8R A;  1L5U A;  1ITG A;  1TAU A;  3OVN A;  2HHQ A;  1XC9 A;  3RMA A;  4CGI A;  4F3O A;  2O4I A;  4MQ3 A;  2X6S A;  4GVM A;  3C95 A;  4H8K A;  4EZ6 A;  3K5O A;  3ZSY A;  2F8S A;  4E0D A;  3TAP A;  1BL3 A;  2ITG A;  3MEC A;  4OGE A;  4OKJ A;  4NCA A;  3MXM A;  3A2F A;  3NAE A;  3QET A;  4M45 A;  4M3W A;  3SYZ A;  1FKO A;  1LAW A;  3VQ5 A;  4KHN A;  2E6L A;  2ZE2 A;  3V81 A;  3IAY A;  1EX4 A;  4KTZ A;  2E6M A;  4M42 A;  4AHS A;  1EKE A;  1X1P A;  3H08 A;  4FM2 A;  1LW0 A;  3AVJ A;  3S3M A;  3NE6 A;  4YNQ A;  1JLC A;  3LAK A;  3RMC A;  2Z1I A;  4W5O A;  5C24 A;  3CM6 A;  1KVB A;  4DFP A;  4BAC A;  3DLK A;  2XY7 A;  4M3T A;  3TAB A;  2A1R A;  1VRU A;  2D5R A;  1U45 A;  3P83 D;  3ZT4 A;  1U49 A;  1T7P A;  1FKP A;  4B9T A;  4J2A A;  4FYD A;  3SUN A;  4FJJ A;  2P5G A;  1TL1 A;  1UOC A;  1QHT A;  3L2Q A;  4B8C A;  3SV3 A;  5HRO A;  1CXQ A;  2VG6 A;  3V9W A;  4CJL A;  2YHA A;  1LWE A;  3D0P A;  3RRH A;  1KSP A;  3KJV A;  1KFS A;  3OYC A;  2R7Y A;  4DLE A;  3ZSZ A;  3SQ2 A;  4RG8 A;  4NCB A;  1QQC A;  1WSE A;  3LP3 A;  1QS4 A;  4RW4 A;  4FK4 A;  2YNI A;  3NH2 A;  3V9X A;  4HUG A;  4Z4I A;  3DRS A;  3OYB A;  3NF6 A;  4CHQ A;  1TKZ A;  4LSL A;  3TAG A;  5CYQ A;  2FC0 A;  3LZJ A;  3KLH A;  2XY5 A;  3L2W A;  2I5J A;  4FW1 A;  4K8Z A;  1X9S A;  1YTA A;  2FBV A;  4E7I A;  4CF1 A;  4PWD A;  3TAQ A;  4I9L A;  3C6T A;  1RDB A;  1NK8 A;  3VN5 A;  3SUQ A;  2HND A;  3LP1 A;  3HPG A;  4Q5V A;  1IKW A;  4CIF A;  1XI1 A;  1TKX A;  5J2P A;  1VSK A;  5KRS A;  1RBU A;  3LZI A;  2IGI A;  5HRR A;  3O3H A;  4E7L A;  3ALY A;  1VSL A;  3B6P A;  3ZT3 A;  4OGC A;  3AVK A;  1I39 A;  4E19 A;  3OYI A;  1LV5 A;  4CCH A;  3EZ5 A;  4NCG A;  1NK5 A;  4ID1 A;  4FJL A;  4N76 A;  3HVR A;  4FLT A;  4B3O A;  3L8B A;  3LAL A;  1BQM A;  4F3T A;  4DSK A;  4GW6 A;  4OKK A;  3VQA A;  4DSF A;  1NJY A;  3HYF A;  4FLU A;  3KLE A;  3P1G A;  3K5M A;  2F8T A;  2KZZ A;  4O5B A;  4KRF A;  2BDP A;  4CES A;  4LY7 A;  3TAN A;  2X6N A;  1VRT A;  3K59 A;  1JL2 A;  3S9H A;  1RDD A;  1NKE A;  4KHY A;  4E89 A;  4CEO A;  4DFK A;  4CED A;  4QCL A;  5KGW A;  3OYE A;  2HMI A;  4UQG A;  4DWI A;  2FBT A;  1WSI A;  1BIZ A;  3EY1 A;  5KRT A;  1HNV A;  4FLX A;  4FLZ A;  4FJI A;  2QK9 A;  4RW7 A;  3FFI A;  4CK1 A;  1RT5 A;  4O55 A;  4PA1 A;  4DTP A;  1HQU A;  4H4O A;  1Q9Y A;  2QKB A;  2DTU A;  5I3U A;  3AVB A;  3HXM A;  1EP4 A;  1VSJ A;  1GOB A;  1A5X A;  2HVI A;  1VSF A;  3LAN A;  4CHY A;  4CJ3 A;  1N5Y A;  3TR8 A;  3HP6 A;  4IG3 A;  1YVU A;  1NKC A;  3L3V A;  4B9M A;  1WLJ A;  1ZYQ A;  1FXX A;  1NK7 A;  1D5A A;  1O1W A;  1C0T A;  4CIE A;  4E7H A;  3F9K A;  1JLA A;  3ZSV A;  3JSM A;  3QEW A;  1C0M A;  3HVT A;  2WON A;  1RTJ A;  1G15 A;  4JLH A;  1RCH A;  2ATQ A;  2RPI A;  4E1N A;  4CF2 A;  3MAQ A;  1JLB A;  1RT3 A;  2YKM A;  4W5T A;  3OJS A;  3OYJ A;  3F73 A;  4FCY A;  4FLV A;  3LP2 A;  3NGY A;  2O4G A;  4Y1D A;  4HTU A;  1RTI A;  4O44 A;  4FJH A;  4FK0 A;  4KTQ A;  4PUO A;  2HNY A;  1Z25 A;  3QIO A;  4GMJ B;  3IS9 A;  1NK4 A;  1T03 A;  1HNI A;  4KHS A;  4DG1 A;  3AA3 A;  1UA1 A;  4CEB A;  4AHT A;  3OYN A;  3KK3 A;  1VSH A;  1TK0 A;  2RN2 A;  4I9Q A;  2P51 A;  1JLQ A;  3VQ7 A;  1S9G A;  3RR7 A;  4AHR A;  1S1T A;  3P5J A;  3ZSO A;  4B9V A;  5FRM A;  3AVG A;  1J54 A;  3V4I A;  2GV9 A;  2YNG A;  3ITH A;  2KTQ A;  3K2P A;  1SV5 A;  4B08 A;  3VA3 A;  5K14 A;  4B8A B;  2G8I A;  4DSI A;  1J9A A;  2GUI A;  3JYT A;  2BE2 A;  2HW3 A;  3AO3 A;  1W0H A;  3VQE A;  4BE2 A;  4KHQ A;  4CIG A;  1DLO A;  2JLE A;  3NHG A;  1ZBF A;  2HHX A;  5KTQ A;  4CHO A;  5SWM A;  4CJW A;  2NUB A;  1U48 A;  3BDP A;  4CFA A;  1KVC A;  1TK5 A;  1WSH A;  5C42 A;  3THV A;  4Z0U A;  4F4K A;  3VQ9 A;  1X9M A;  3ZT0 A;  1BI4 A;  1KLM A;  2BAN A;  4RW6 A;  4OPJ A;  1VSI A;  3DRP A;  1NOZ A;  4DFJ A;  1X9W A;  4XIU A;  4I2P A;  4DF4 A;  2YKN A;  1KLN A;  4O0I A;  3LWM A;  2YNF A;  3U6F A;  3G0Z A;  4OLA A;  2QKK A;  3C94 A;  4CJE A;  1ZBH A;  1S1W A;  4DQQ A;  1LW2 A;  1ZBL A;  1HPZ A;  1B9F A;  3DRR A;  4I2Q A;  4EP4 A;  4E7K A;  4KHU A;  2PZS A;  3OYM A;  2OPQ A;  4HUF A;  2VG7 A;  3LP0 A;  3IRX A;  1C1C A;  3NF7 A;  1S6Q A;  3V1O A;  4CK3 A;  3QEV A;  4KB0 A;  2FBY A;  1BIS A;  2P5O A;  4M3X A;  4FJM A;  2E4L A;  4Y1C A;  1WSG A;  4TSX A;  3SUO A;  1YTU A;  4RW9 A;  3VQ4 A;  3ZT1 A;  3U3Y A;  3HP9 A;  1I3A A;  4CHP A;  2KQ2 A;  4J2B A;  4CEZ A;  4Z4F A;  3VQD A;  5CZ2 A;  3T1A A;  4KI4 A;  4NYF A;  5T7B A;  1C6V A;  3OYH A;  3KTQ A;  4RW8 A;  4DS4 A;  3DM2 A;  3SNN A;  3I0S A;  4CK2 A;  4N56 A;  1RDA A;  3HL8 A;  1CXU A;  3ZSW A;  1KRP A;  3ULD A;  3SPY A;  1RNH A;  4CGG A;  3SPZ A;  2X78 A;  2W42 A;  1CZ9 A;  3CFR A;  3U3G A;  4DQR A;  3KLF A;  4JS5 A;  1R0A A;  4CFD A;  4DQS A;  4J2D A;  3K58 A;  2GBZ A;  4AIL C;  4CGJ A;  4DU3 A;  3L2V A;  5DK5 A;  2LSN A;  4CEE A;  1B92 A;  1ASW A;  4FLW A;  2PY5 A;  1RT6 A;  4DQI A;  5KI6 A;  4Z4C A;  1BCO A;  3DYA A;  4W5Q A;  4HUE A;  4KHW A;  3NFA A;  1RBT A;  4CGH A;  3QNN A;  1BI4 B;  1REV A;  3OS0 A;  3NF8 A;  1HJR A;  2HHW A;  1S5J A;  4CF8 A;  3QNO A;  4CJU A;  1UA0 A;  1ASU A;  4OLB A;  1NJX A;  3KD5 E;  2AJQ A;  4OKE A;  3QEX A;  3DOK A;  3KIO A;  3NGZ A;  3MXI A;  4DTO A;  3OY9 A;  4KFB A;  3SQ4 A;  4AH9 A;  4DSJ A;  1JLG A;  2P1J A;  5HP1 A;  2G8F A;  3PY8 A;  4B9S A;  4F2S A;  1TGO A;  4CHN A;  2ZD1 A;  3DLG A;  4IG0 A;  4CGF A;  1SKS A;  4CE9 A;  1SL2 A;  4DQP A;  4KKO A;  5I42 A;  1NK0 A;  4EP5 A;  4JRQ A;  2OA8 A;  4FM1 A;  4DSL A;  4CJP A;  4F2R A;  1L3V A;  1RIL A;  2KW4 A;  4O0J A;  3VQP A;  1SKR A;  3AVL A;  3QEI A;  3AV9 A;  3KK2 A;  4HHT A;  3CM5 A;  1T8E A;  3NF9 A;  3NBP A;  3L2U A;  3K5L A;  4C8L A;  1IKV A;  2KFZ A;  4E7J A;  1TKD A;  4DLG A;  2Y1J A;  1RDC A;  2A1S A;  1C1A A;  3TWH A;  4QOZ B;  1HYZ A;  3OS2 A;  3K5N A;  3OYD A;  3HK2 A;  3HST B;  3UIQ A;  1F21 A;  3K57 A;  3PO5 A;  3DLH A;  1LWC A;  5J2M A;  3HPO A;  4CJR A;  2HVH A;  2IDO A;  5E41 A;  1WSF A;  3CYM A;  4KV8 A;  3M8Q A;  4YFU A;  3PV8 A;  3QIN A;  3MXJ A;  3AVM A;  1RBR A;  1S1V A;  3V9U A;  3HT3 A;  2DFF A;  1YT3 A;  4C8N A;  3AA4 A;  1D8Y A;  5EU7 A;  5D3G A;  3QER A;  4JRP A;  3O4Q A;  3LPU A;  5FDL A;  4ZHR A;  4Z4H A;  2VWK A;  5KGX A;  3PO4 A;  4BDP A;  2IS3 A;  4OPK A;  1L3T A;  1A5V A;  3IG1 A;  4BDY A;  4FXD A;  1TV6 A;  1NOY A;  3VQ6 A;  3NH0 A;  4FZZ A;  4KAZ A;  4FJ5 A;  1XWL A;  3SV4 A;  2EHG A;  2HB5 A;  1MU2 A;  3AA5 X;  1C1B A;  3B6O A;  3RMD A;  1NJZ A;  2KZM A;  1S9E A;  4F8R A;  2Y1I A;  4N47 A;  4W5R A;  1JXE A;  4DS5 A;  1HQE A;  1Q8I A;  4DTU A;  1KVA A;  1LAV A;  3HJF A;  1D9D A;  2HHS A;  4FJ7 A;  3E01 A;  1HMV A;  4G1Q A;  1EXQ A;  1UWB A;  1WAF A;  5J1E A;  2PYJ A;  3RWU A;  4E1M A;  3PX6 A;  4C8O A;  1SKW A;  2YNH A;  3G10 A;  1LWF A;  3OYL A;  1ZBU A;  5FRN A;  5J2N A;  4Z4E A;  3ASM A;  2OPR A;  2B4J A;  4CGD A;  1GOA A;  3PX0 A;  1JLE A;  1ZBI A;  1VSD A;  1UAX A;  3QIP A;  3OYG A;  3SQ1 A;  2Z1G A;  2XO7 A;  1IG9 A;  3HM9 A;  1RTD A;  3DI6 A;  4M3R A;  4DFM A;  4B9N A;  3V9S A;  1N6Q A;  1JXB A;  5CZ1 A;  3RTV A;  4EZ9 A;  4FJ8 A;  2ZQB A;  3AO4 A;  3EYZ A;  1TL3 A;  3SI6 A;  5HLF A;  4KRE A;  3LWL A;  4BE1 A;  2B5J A;  2IC3 A;  2RKI A;  3NH1 A;  3I0R A;  4IFV A;  4ICL A;  3TAF A;  4BDZ A;  2HHU A;  4CJQ A;  4DU1 A;  1JKH A;  1U04 A;  1NKB A;  3ZSQ A;  2YHB A;  3ISN C;  4Q0B A;  2Z1H A;  5HRN A;  3KLI A;  3SUP A;  1U47 A;  1HYS A;  5SZT A;  3LDS A;  1XHX A;  4R5P A;  4BWM A;  3AVA A;  2EX3 A;  3SZ2 A;  4CFC A;  1WSJ A;  3AVH A;  3PX4 A;  4CEF A;  1WN7 A;  4FZX C;  4M3U A;  1EET A;  1BHL A;  2VG5 A;  3OJU A;  4DU4 A;  2KFN A;  3MEE A;  4PY5 A;  5HRP A;  3OS1 A;  4B9U A;  4FJK A;  1CLQ A;  1NK9 A;  1IO2 A;  1GOC A;  3BGR A;  4KPY A;  1WNS A;  2D0A A;  2OZS A;  4KB1 A;  3I8D A;  1J53 A;  5CYM A;  1TKT A;  3KKR A;  5CY4 A;  4B9L A;  3D45 A;  3AO2 A;  4Z4G A;  3KD1 E;  3TAR A;  4ELV A;  2D0C A;  4OVL A;  3WNG A;  2IAJ A;  3WNF A;  3KLG A;  4CJK A;  3RMB A;  1A5W A;  1TK8 A;  3HPH A;  5JS2 A;  3AVF A;  4CEA A;  3DLB A;  2Q3S A;  4ZTJ A;  1Q9X A;  4O4G A;  3SCX A;  2ETJ A;  4ID5 A;  1HRH A;  5DMR A;  2OZM A;  3S3N A;  3MED A;  3AA2 A;  3ZSR A;  4ELT A;  1BQN A;  3AVN A;  2PYL A;  4L8R B;  1C0U A;  5C25 A;  2XRI A;  1VK0 A;  1VSE A;  1W9H A;  1Z26 A;  2VWJ A;  1XHZ A;  4E3S A;  4FZY A;  4M3Z A;  1RBS A;  3TAE A;  2DFH A;  2HHV A;  1Y97 A;  4FW2 A;  1RTH A;  1RT1 A;  4KO0 A;  2XY6 A;  1WAJ A;  1BCM A;  1S1X A;  4IDK A;  5HBM A;  4LD0 A;  2RF2 A;  1NK6 A;  4CJ5 A;  4HVJ A;  5HRS A;  1HYV A;  1S6P A;  1TAQ A;  2JGU A;  3KK1 A;  4DTM A;  3VQB A;  3SJJ A;  1QSL A;  3O4N A;  4DTX A;  2Z1J A;  4WE1 A;  4DTR A;  4IBN A;  3T3F A;  1J5O A;  5J2Q A;  1S1U A;  3QLH A;  4FJN A;  2YV0 X;  1TVR A;  3RRG A;  1IKY A;  2B6A A;  1U4B A;  3QES A;  4BE0 A;  2HNZ A;  4QAG A;  3DLR A;  4H4M A;  4CEC A;  3OYA A;  3O3F A;  2G8W A;  3RR8 A;  4MFB A;  4ZTF A;  1D9F A;  4HCB A;  4K8X A;  2X74 A;  1JLF A;  1B9D A;  4LSN A;  4C8M A;  4CEQ A;  3M8S A;  3NCI A;  3DOL A;  5JS1 A;  4J2E A;  2F96 A;  4FM0 A;  2XHB A;  3MEG A;  3NGI A;  2OPP A;  4M3Y A;  4BWJ A;  3OYK A;  4FLY A;  4CJS A;  1VSM A;  3V1R A;  1JL1 A;  1RT4 A;  2BGG A;  3AO1 A;  4DTJ A;  4NYN A;  4I7F A;  3WNH A;  4N41 A;  1SL1 A;  2D0B A;  3DMJ A;  3TI0 A;  4PQU A;  2QXF A;  2HHT A;  1KTQ A;  2FBX A;  3CFO A;  4LH4 A;  4IFY A;  3AVI A;  4CJF A;  1QTM A;  4FJG A;  1FK9 A;  2G8V A;  4AHU A;  2XY8 A;  4DTS A;  4DTN A;  4JS4 A;  3PUF A;  4AHC A;  3LAM A;  3AO5 A;  1IKX A;  4FJX A;  2OYQ A;  2G8K A;  4CER A; 
#chains in the Genus database with same CATH topology
 3VQ8 A;  3QO9 A;  3DLE A;  2OPS A;  4WFB L;  3C6U A;  3G25 A;  4YHH K;  4CW7 B;  4AHV A;  3MK6 A;  4U7B A;  3TAM A;  4A2B A;  4DSE A;  3CCR N;  5AQS A;  1SL0 A;  4YOR A;  4CZE A;  1KFD A;  3L3U A;  4JKB A;  3WNE A;  4H03 B;  3ZCM A;  4FVM A;  1KCF A;  2DY4 A;  4CJ4 A;  3QB0 A;  4KI6 A;  4CF9 A;  3CQ8 A;  2A6A A;  3SQ0 A;  4CJT A;  4CFB A;  5C12 A;  3UKR A;  3OVN A;  4PKG A;  4IOC L;  5BN8 A;  4GVM A;  4E0D A;  3TAP A;  1BL3 A;  2ITG A;  4OKJ A;  5AQZ A;  3A2F A;  4M45 A;  4M3W A;  3VQ5 A;  4KHN A;  2E6L A;  4KTZ A;  1EKE A;  4FM2 A;  4JI4 K;  4CZH A;  4YNQ A;  1VQO N;  4NB4 A;  2NRT A;  3BF1 A;  5C24 A;  3CM6 A;  1ATS A;  2XY7 A;  2ZGZ A;  3P83 D;  4B3R K;  2YX6 A;  4FWL A;  1TL1 A;  3W0L A;  4JI3 K;  3L2Q A;  3DXM B;  4B8C A;  3SV3 A;  1TUU A;  2YHA A;  5FPN A;  1KFS A;  2R7Y A;  4DLE A;  2CGL A;  1GLC G;  4FK4 A;  4B3S K;  1NGH A;  3NF6 A;  3MCP A;  1LOT B;  4LSL A;  5E84 A;  4CHQ A;  3TPQ A;  3LZJ A;  3H1V X;  4K8Z A;  1G99 A;  4BRG A;  4E7I A;  4DR6 K;  1RDB A;  3SUQ A;  3NMU A;  4CIF A;  5J2P A;  3LZI A;  4DV6 K;  4E7L A;  1VSL A;  4JK7 A;  3G6E N;  3AVK A;  4FSV A;  1I39 A;  4E19 A;  3HVR A;  2CGJ A;  4FLT A;  1BQM A;  2E5L K;  4GW6 A;  3R3L A;  4OKK A;  4KH5 A;  2F8T A;  3P1G A;  3K5M A;  1VQM N;  2KZZ A;  4O5B A;  3KWI A;  4CI6 A;  1VRT A;  5E26 A;  3S9H A;  1C0F A;  5FPE A;  1NKE A;  4KHY A;  5KGW A;  2FBT A;  1BIZ A;  3EY1 A;  3RSE A;  2ZJQ L;  4MLH A;  3H1Q A;  1RT5 A;  2P9N A;  4PA1 A;  2OTJ N;  2DTU A;  3OBY A;  3J7Y P;  1A5X A;  1VSF A;  4RCH A;  1NGI A;  4CHY A;  1N5Y A;  1NK7 A;  4E7H A;  1JLA A;  3O08 A;  4M7Y A;  3EL2 A;  1C0M A;  2WON A;  1G15 A;  5F0X A;  4CF2 A;  1JLB A;  3U8X A;  1Q18 A;  4WQ4 A;  3LP2 A;  1X3N A;  4BRL A;  1RDW X;  4A2A A;  5KQD A;  4KTQ A;  4PUO A;  1T03 A;  4AHT A;  3KK3 A;  1TK0 A;  3FZK A;  1JLQ A;  1S9G A;  1K9M O;  3OA9 A;  3R8E A;  3AGK A;  3P5J A;  2NRH A;  4B9V A;  3AVG A;  3V4I A;  2GV9 A;  3VA3 A;  3O9S A;  4B8A B;  1N32 K;  4EAH D;  2HW3 A;  4BE2 A;  3EE9 A;  4B1Z A;  2P9S A;  2QXL A;  5KTQ A;  4CHO A;  5SWM A;  2NUB A;  1ILY A;  3BDP A;  4JI2 K;  4CFA A;  1WSH A;  1NWK A;  3ZT0 A;  1BI4 A;  4RW6 A;  3DRP A;  3KHY A;  4I2P A;  1P8Z A;  1KLN A;  4O0I A;  2F7T A;  4FPA A;  1T6D A;  3KWG A;  4CJE A;  1NM1 A;  1ZBL A;  3DRR A;  4I2Q A;  4CZM A;  3OYM A;  2Q97 A;  1HKG A;  2OPQ A;  4FWQ A;  4KB0 A;  1HR0 K;  4FJM A;  3E9P A;  3ID8 A;  4CZG A;  1NGJ A;  3SUO A;  5JMV A;  3ZT1 A;  3U3Y A;  3B8A X;  3ZLJ A;  4FOI A;  1C6V A;  4JD2 A;  3VEO A;  4DS4 A;  1RDA A;  4H5N A;  1DT9 A;  4LF8 K;  4OPH A;  4CGG A;  2W41 A;  3K58 A;  1JJ2 M;  4CGJ A;  4DU3 A;  3CD6 N;  5HOO A;  2LSN A;  3VF4 A;  5AQQ A;  1BUP A;  3NFA A;  1W7A A;  3O5B A;  3L4Q A;  3SAH A;  3GG4 A;  4B1W B;  3QNO A;  2GWJ A;  1UA0 A;  1ASU A;  4OLB A;  3MXI A;  2VQE K;  2GEL A;  1SQK A;  3SLC A;  3PY8 A;  1VQ9 N;  1HX1 A;  1BA1 A;  1TGO A;  4F2S A;  4CHN A;  3DLG A;  4CE9 A;  4A59 A;  3D6R A;  4O8U A;  1RIL A;  4IJN A;  3LDN A;  4B1X B;  3AVL A;  4HHT A;  1IKV A;  2KFZ A;  4LC9 B;  3UIQ A;  1F21 A;  3K57 A;  3PO5 A;  1LWC A;  3HPO A;  2HMP A;  4KV8 A;  3MX2 A;  3OBW A;  3MXJ A;  1RBR A;  3V9U A;  4H0Y B;  5M1F A;  3UKU B;  4C8N A;  4BVO A;  3AA4 A;  4WFN L;  3CXC M;  5ELZ A;  5AFU A;  5KGX A;  2VWK A;  4OPK A;  4JI8 K;  3IG1 A;  3CET A;  4KAZ A;  3SV4 A;  1MU2 A;  3AA5 X;  2KZM A;  1QQN A;  4K25 A;  1S9E A;  1HQE A;  4DTU A;  3BZK A;  2HHS A;  1E4F T;  1QQO A;  1EXQ A;  3RWU A;  1EO1 A;  5TKW A;  3CJB A;  3G10 A;  3IDH A;  1LWF A;  4IEE A;  1VQ8 N;  1ZBU A;  1MWM A;  3SBT A;  4JN4 A;  3ASM A;  2OPR A;  1GOA A;  4PKH A;  4RWT A;  1JLE A;  1VSD A;  3OYG A;  4NXM K;  3FZH A;  4H5T A;  1N8R O;  3I56 N;  3DI6 A;  3J7A P;  3HOS A;  1NGE A;  1ESV A;  3V9S A;  4EZ9 A;  1JXB A;  5CZ1 A;  2ZQB A;  3LWL A;  5KPZ A;  4H0V B;  4IFV A;  3MWP A;  4BDZ A;  4H0T B;  3BZC A;  2O8F A;  3WT0 A;  2YHB A;  3IFR A;  4BWM A;  3AVA A;  2EWS A;  4DV5 K;  3SZ2 A;  3AVH A;  3FGU A;  4CEF A;  5AQV A;  4M3U A;  2VG5 A;  3OJU A;  2D4W A;  4PY5 A;  3SBG A;  1T3V A;  1CLQ A;  1GOC A;  3I8D A;  2QW9 A;  1J53 A;  5CYM A;  4BRC A;  1TKT A;  5CY4 A;  3H3O B;  5AZI B;  4Z4G A;  1O13 A;  3WNF A;  4XH1 A;  3DWL A;  3J80 O;  1Q9X A;  4O4G A;  2ETJ A;  3VGM A;  2OZM A;  5DMR A;  3EKU A;  2NRX A;  1XMQ K;  4ELT A;  5IT9 O;  3AVN A;  1N34 K;  2P9K B;  2QWP A;  2V51 B;  3D2F B;  3IMX A;  1VSE A;  3N4Q A;  3ZEU B;  4FZY A;  4M3Z A;  4E3S A;  2YHW A;  5GIN A;  2P9P B;  3NVM A;  1Y97 A;  4FW2 A;  3ZET B;  3C0B A;  4KO0 A;  4LD0 A;  4CJ5 A;  3EO3 A;  3H45 C;  5KPR A;  1YIT N;  3OHR A;  1WOQ A;  2O8D B;  3QLH A;  1TVR A;  3RRG A;  4IOA L;  4PL7 A;  4DHY A;  4QAG A;  3RR8 A;  3EN9 A;  4HCB A;  1JLF A;  1B9D A;  4C8M A;  3NCI A;  3G4S N;  4FM0 A;  3CMA N;  3MCA B;  2HST A;  4BWJ A;  4NLC A;  3W3D A;  1VSM A;  1RT4 A;  4DTJ A;  3ENB A;  4NYN A;  4I7F A;  3CJC A;  5AQT A;  3ENH A;  1VQ5 N;  1SL1 A;  2HHT A;  4PQU A;  1KTQ A;  4C1N I;  3VGK A;  4IFY A;  3AVI A;  4CJF A;  3MMV A;  4AHU A;  3VEZ A;  1YJW N;  3PUF A;  3LAM A;  4BG8 A;  3AO5 A;  1IKX A;  3L0Q A;  1NU0 A;  3VEW A;  3VQQ A;  4N5S A;  5LJV A;  3V9Z A;  3WQU A;  3JXU A;  1K6Y A;  4Y0W A;  4A57 A;  3ZSX A;  3T19 A;  2GWK A;  3OYF A;  2NRV A;  2P9U B;  2HF3 A;  1BIU A;  4FJ9 A;  2E88 A;  5AQU A;  3QEP A;  3QFP A;  2G8H A;  4BR7 A;  4CZI A;  1RT2 A;  3VEX A;  4HCC A;  4FK2 A;  3DXM A;  2F9T A;  3HO1 A;  3ZT2 A;  4BR4 A;  4GY2 B;  1BGX T;  2QM1 A;  2IOC A;  2YJE A;  4AM6 A;  1DTQ A;  1VQ4 N;  3VQC A;  4IKF A;  1L5U A;  5DM7 L;  4IO9 L;  5EY4 A;  4A61 A;  3VTI A;  3FFK B;  1XC9 A;  4CGI A;  4F3O A;  2X6S A;  5AQG A;  3C95 A;  2E8A A;  3K5O A;  1QHA A;  2YCH A;  2F8S A;  2UU9 K;  2J4R A;  5A2Q O;  4NCA A;  2P9L B;  5JIC A;  3HM8 A;  3NAE A;  4GVE A;  1FKO A;  1LAW A;  2V52 B;  4JHD B;  5I9E B;  3IAY A;  2BH1 A;  5AQI A;  4M42 A;  1S72 N;  1LW0 A;  4XH4 A;  1HNX K;  3AVJ A;  3S3M A;  3NE6 A;  5AJ3 K;  1XQS C;  4DR5 K;  2QWL A;  4W5O A;  5LL6 Z;  2A41 A;  3DLK A;  4K0K K;  4WQ5 C;  2I7N A;  3TAB A;  1VRU A;  2D5R A;  2A1R A;  3ZT4 A;  1MA9 B;  3A8Y A;  1U49 A;  1T7P A;  4FYD A;  3SUN A;  2ASM A;  4JKC A;  1UOC A;  1CXQ A;  3H3N O;  4CD1 A;  3D0P A;  3MX5 A;  3VET A;  2FXU A;  3ZSZ A;  3HTV A;  1QS4 A;  3VTH A;  1MWK A;  3DXK B;  5CYQ A;  2FC0 A;  2I5J A;  1YJ9 N;  4CF1 A;  3BY5 A;  5GIP A;  4PWD A;  3TAQ A;  4I9L A;  3C6T A;  2HND A;  1IKW A;  1XI1 A;  2W6L A;  2ASO A;  5KRS A;  1RBU A;  3K0S A;  4JEP A;  5HRR A;  3ALY A;  3B6P A;  3OW2 M;  3CIP A;  4JNE A;  3ZX0 A;  4B1V A;  4ID1 A;  2ZGY A;  4F3T A;  3LAL A;  4PL8 A;  4FWR A;  2WBN A;  1GLA G;  2JWK A;  1I94 K;  4FLU A;  1Z05 A;  3FE1 A;  4FPB A;  3CJ1 A;  3R6M A;  1NLV A;  2BDP A;  1GLF O;  4LY7 A;  3MN9 A;  2X6N A;  3LDP A;  2QWO A;  4BRE A;  4E89 A;  4CEO A;  4DFK A;  4CED A;  4FWN A;  3GDQ A;  4LF9 K;  1RDU A;  1WSI A;  3EKS A;  1HNV A;  4FLZ A;  3CF5 L;  4B3T K;  4RW7 A;  4JI7 K;  4DTP A;  4O55 A;  2E20 A;  2VGM A;  3IKM A;  5BRH A;  2QA4 N;  1EP4 A;  3PSI A;  3LAN A;  4CJ3 A;  1YVU A;  1OH6 A;  4CIE A;  3K9J A;  3AAP A;  3HVT A;  3MAQ A;  1V4T A;  4BY9 C;  4W5T A;  1KXP A;  3OYJ A;  3F73 A;  3NGY A;  2O4G A;  4Y1D A;  4HTU A;  4O44 A;  4GMJ B;  4UY8 O;  1UA1 A;  3OYN A;  3QML A;  1VSH A;  3P38 A;  3RVC A;  4I9Q A;  5CHI A;  3VQ7 A;  1M90 O;  1S1T A;  5IWA K;  5FRM A;  4M7X A;  5C2D A;  1J6Z A;  3K2P A;  4DSI A;  5JLH A;  1BO5 O;  4GNI A;  2PFU A;  3AO3 A;  3T1H K;  1W0H A;  2KLA A;  4KHQ A;  4CIG A;  2JLE A;  3DLL L;  2O8C B;  4IZ9 A;  2HHX A;  5CE3 A;  1GLL O;  4WYB A;  1KVC A;  2AA4 A;  4XEI A;  1X9M A;  1NJI O;  4DV0 K;  4BRK A;  4XIU A;  1BOT O;  2YKN A;  4KBO A;  2HBJ A;  4OLA A;  2ZM6 K;  3C94 A;  1S1W A;  4BGA A;  1LW2 A;  4ILJ A;  4DQQ A;  1HPZ A;  1B9F A;  4EP4 A;  4E7K A;  2WTU A;  3NF7 A;  3V1O A;  4JYA K;  3EEQ A;  4MO5 A;  1WSG A;  4TSX A;  3VQ4 A;  3HP9 A;  1I3A A;  4J2B A;  2OCE A;  4KI4 A;  2QEX N;  3KTQ A;  4JI5 K;  4RW8 A;  3DM2 A;  3SNN A;  3I0S A;  1IJJ A;  4B9Q A;  2E2Q A;  1KD1 O;  3U3G A;  3KLF A;  4F9O A;  4IXC A;  3BP8 A;  4DQS A;  5BN9 A;  1JCF A;  4O5F A;  3PLA A;  4KH6 A;  3L2V A;  4JKG B;  5DK5 A;  1RT6 A;  2UXC K;  4Z4C A;  3DYA A;  5C2F A;  3UKU A;  4HUE A;  5BRF A;  2BTF A;  1HKC A;  4XH5 A;  1RBT A;  3QNN A;  1U6Z A;  3CQX A;  1X9J A;  1S5J A;  4YOU A;  2VYP A;  4DKW A;  3CCM N;  3DOK A;  3NGZ A;  3F9M A;  3ATU A;  5CR4 A;  3J81 O;  3OY9 A;  4KFB A;  4Z94 A;  3SQ4 A;  1JLG A;  2G8F A;  2ZD1 A;  4DQP A;  1SL2 A;  2A42 A;  4BQL A;  4FM1 A;  4F2R A;  3FZL A;  2F4V K;  3QEI A;  1T8E A;  3CM5 A;  3CC2 N;  3NBP A;  1S22 A;  3THY B;  3H46 O;  4E7J A;  5EXW A;  2VWB A;  1C1A A;  3VF2 A;  1EWQ A;  5J2M A;  2HVH A;  4GV3 A;  1WSF A;  4BR0 A;  3M8Q A;  4IJA A;  4H0X B;  3SAG A;  4JK8 A;  2DFF A;  1YT3 A;  5D3G A;  3CCQ N;  3A5M C;  3QER A;  4JRP A;  3LPU A;  4ZHR A;  4Z4H A;  1DEJ A;  5AQL A;  4FXD A;  1TV6 A;  3NH0 A;  3P4I A;  1XWL A;  4X62 K;  2EHG A;  3Q7C A;  1C1B A;  2E1Z A;  4YDU A;  3BF3 A;  2Y1I A;  1JXE A;  1S3X A;  4BR9 A;  2OTL N;  3HJF A;  4IWV A;  5AZI A;  4BRQ A;  4FJ7 A;  4E1M A;  4C8O A;  2YNH A;  1YHQ N;  3F2K A;  4A5B A;  1YVN A;  3OYL A;  3O9R A;  2Q0R A;  2YI1 A;  4BC5 A;  2B4J A;  3O9U A;  2P9K A;  3PX0 A;  3D2F A;  1ZBI A;  3ZEU A;  2W40 A;  1IG9 A;  3I8B A;  3HM9 A;  4BR5 A;  2P9P A;  3O1W A;  3ZET A;  1N6Q A;  3EYZ A;  3GOI A;  4BE1 A;  2B5J A;  4GKJ K;  5AQH A;  3TAF A;  2O8D A;  4OX9 K;  1NKB A;  2Q36 A;  3ZSQ A;  2UUB K;  4LF5 K;  1QQM A;  4Q0B A;  5HRN A;  3CHW A;  3SUP A;  5SZT A;  4R5P A;  4BQZ A;  2EX3 A;  4MDA A;  1WSJ A;  1XC3 A;  5LJW A;  4DU4 A;  2KFN A;  3OS1 A;  4FJK A;  1NK9 A;  1IO2 A;  4KPY A;  4BC4 A;  1OVY A;  3KKR A;  3TSQ A;  3D45 A;  2RHK A;  4OVL A;  1Z6R A;  3RMB A;  3HPH A;  3DLB A;  5GAG P;  1RGI A;  3MED A;  5TKY A;  4MO4 A;  1W9H A;  1XHZ A;  4CBX A;  2QWQ A;  1RBS A;  3S41 A;  3TAE A;  2DFH A;  4B1Y B;  2P9U A;  1BCM A;  1S1X A;  5HBM A;  2RF2 A;  3KK1 A;  3SJJ A;  3O4N A;  4DTX A;  5J2Q A;  3THX B;  2Q0U A;  1YUW A;  1OH7 A;  2YV0 X;  2B6A A;  4BE0 A;  3DLR A;  4H4M A;  4CEC A;  4MFB A;  4ZTF A;  4K8X A;  4LSN A;  4CEQ A;  1GLD G;  5AQR A;  2F96 A;  1SAZ A;  3OYK A;  4FLY A;  3V1R A;  3O4W A;  4HWI A;  4N41 A;  3WNH A;  1DKG D;  3DMJ A;  3TI0 A;  4I6M B;  4BR2 A;  2GEM A;  4LH4 A;  1QTM A;  3THW B;  4JI0 K;  2P9L A;  1FK9 A;  2G8V A;  1QZ6 A;  4DTN A;  4PHT X;  1Q82 O;  2ASP A;  4JHD A;  4FJX A;  5C42 A;  4AQY K;  2FF3 B;  2P9I B;  3KKS A;  4KTW A;  3CG7 A;  3SK3 A;  4W5N A;  4B3M K;  3E9O A;  3VOV A;  5JLF A;  2NRW A;  2DFE A;  3S3O A;  2HBL A;  4DQ8 A;  3V1Q A;  3WUH A;  3VEV A;  4DV4 K;  1L3S A;  1YI2 N;  1DTT A;  1HLU A;  1RBV A;  5LY3 A;  4PKI A;  1IH7 A;  4DB3 A;  4WCE L;  3LPT A;  1QSS A;  3DXK A;  4DMN A;  3NVK A;  3DJC A;  4ELU A;  1SUQ A;  4CHZ A;  1ITG A;  1TAU A;  2Q2R A;  4MQ3 A;  3WQT A;  4H8K A;  4EZ6 A;  3LL3 A;  3ZSY A;  2A5X A;  5FLX O;  4OGE A;  3MXM A;  4DR1 K;  3SYZ A;  2WC9 A;  3V81 A;  1EX4 A;  2E6M A;  1Q7Y O;  1X1P A;  3QBW A;  3U4L A;  1JLC A;  3LAK A;  4GKK K;  2Z1I A;  3QIC A;  1KVB A;  2ZWH A;  4DFP A;  3QDK A;  4M3T A;  3KZB A;  1K8A O;  1NGF A;  4J2A A;  4FJJ A;  2P5G A;  4IEI A;  3V9W A;  4CJL A;  1KSP A;  1LWE A;  3KJV A;  3OYC A;  3SQ2 A;  1WSE A;  1VQ6 N;  4JKD A;  4Z4I A;  3V9X A;  4G9Z A;  4HUG A;  3DRS A;  3OYB A;  1T44 A;  2XY5 A;  4JKH A;  4FW1 A;  1X9S A;  1JCG A;  2O8B B;  1LCU A;  1NK8 A;  3VN5 A;  3T7Z A;  3L6Q A;  3LP1 A;  3HPG A;  3SAF A;  4Q5V A;  4H5R A;  3O3H A;  1X3M A;  2F9W A;  3ZT3 A;  3E1Y A;  3O6W A;  4LF6 K;  1ZBS A;  1Y64 A;  3EZ5 A;  4N76 A;  4B3O A;  3L8B A;  1W2B M;  5AQY A;  3MN5 A;  4DSK A;  4DSF A;  3VQA A;  4CZF A;  4BRF A;  1NJY A;  1QVF M;  3M3Z A;  2PBD A;  3TAN A;  3K59 A;  1VQL N;  1RDD A;  2H3G X;  4QCL A;  3ZX3 A;  4DR2 K;  4FLX A;  2O8C A;  4JAX A;  2UYT A;  4GV9 A;  3FFI A;  1HQU A;  1Q9Y A;  1RFQ A;  5I3U A;  3AVB A;  1GOB A;  1VAZ A;  1VHX A;  4GV6 A;  3HP6 A;  2NZT A;  1VQP N;  4CZK A;  3PIP L;  3O9T A;  1NKC A;  4B9M A;  1WLJ A;  3ENO A;  1D5A A;  1C0T A;  4DUY K;  3CI5 A;  4IFE A;  1M1K O;  1RTJ A;  3VMF B;  1RCH A;  4FCY A;  2YKM A;  3OJS A;  1WB9 A;  3CJA A;  1TYQ B;  4FK0 A;  2VGN A;  3PIO L;  2HNY A;  1Z25 A;  3IS9 A;  4CEB A;  4FO0 A;  2P51 A;  4YOY A;  3ZSO A;  2UXB K;  1W97 L;  2KKZ A;  2YNG A;  2KTQ A;  1SV5 A;  2G8I A;  3M5R A;  5AQW A;  2GUI A;  3JYT A;  3BUZ B;  2BE2 A;  1DLO A;  5DM6 L;  4JKG A;  1ZBF A;  1HUX A;  3WXM B;  4LF7 K;  4WQ4 C;  4Z0U A;  4F4K A;  2BAN A;  4OPJ A;  1VSI A;  1GLJ O;  5M1Q A;  4DFJ A;  1NOZ A;  1GLE G;  1X9W A;  3LWM A;  3U6F A;  3G0Z A;  4AF1 A;  5BPN A;  2QKK A;  5JVG L;  3FLC O;  4DUZ K;  4FWP A;  3GBT A;  1NGA A;  2VQF K;  4HUF A;  5ADX H;  3QEV A;  1C1C A;  1S6Q A;  2FBY A;  1VQ7 N;  2P5O A;  2O8E B;  3MN6 A;  4LFC K;  2E4L A;  3CME N;  3O9Q A;  1YTU A;  4RW9 A;  5BR8 K;  4CHP A;  2KQ2 A;  4Z4F A;  4CEZ A;  5CZ2 A;  2UXD K;  5T7B A;  3OYH A;  4LF4 K;  3THY A;  4N56 A;  3WEE B;  3ULD A;  4BRH A;  3TTC A;  3SPZ A;  1FW6 A;  4JI1 K;  4DQR A;  4JS5 A;  4J2D A;  4FOE A;  2GBZ A;  2AP1 A;  3C7N B;  4CEE A;  2PY5 A;  4FLW A;  1ZXO A;  2V7Z A;  5KI6 A;  3U9D A;  1BCO A;  4BRP A;  5M1N A;  1VQN N;  4KHW A;  3CJ9 A;  5AQF A;  1REV A;  1FJG K;  2HHW A;  4H0O A;  1NJX A;  3KD5 E;  2AJQ A;  4BRM A;  4DV2 K;  3KIO A;  1SS6 A;  1MDU B;  4DV7 K;  4LFA K;  4AH9 A;  3G71 N;  4FWM A;  5AQM A;  1BU6 O;  5M1O A;  4IG0 A;  4X65 K;  5KQ8 A;  1YJN N;  4KKO A;  1NK0 A;  3M6G A;  4EP5 A;  4JRQ A;  2OA8 A;  4CJP A;  3J7Z O;  5BR9 A;  1SKR A;  3AV9 A;  3KK2 A;  2D1K A;  3I33 A;  3NF9 A;  4YOW A;  2W6K A;  3WXJ A;  5FPD A;  3L2U A;  4DLG A;  2Y1J A;  2A1S A;  4H0P A;  3TWH A;  2CH6 A;  1HYZ A;  3OS2 A;  3HK2 A;  3HST B;  3DLH A;  4CJR A;  1NGB A;  4YFU A;  3QIN A;  3AVM A;  3HT3 A;  4J8F A;  5EU7 A;  4X66 K;  1NMD A;  3LDL A;  5FDL A;  3H6E A;  4BDP A;  2IS3 A;  1L3T A;  1A5V A;  1D4X A;  3VQ6 A;  3ZYY X;  4FJ5 A;  2HB5 A;  1NJZ A;  3CJ7 A;  3VEY A;  3CCL N;  5C0Y A;  3TTF A;  4DS5 A;  1KVA A;  1D9D A;  1XUP O;  5LMN K;  5BRD A;  1WAF A;  4H5V A;  3PX6 A;  2IIR A;  3D7E O;  2ZJR L;  4CD3 A;  3KVG A;  3D2E B;  1HJO A;  4Z4E A;  1UAX A;  3QIP A;  2NRR A;  3SQ1 A;  2Z1G A;  4DR4 K;  1RTD A;  4M3R A;  4YOV A;  3RTV A;  2CGK A;  5HLF A;  4ISF A;  3HSC A;  4H5W A;  2IC3 A;  2RKI A;  3CCV N;  3VF6 A;  3NH1 A;  4ICL A;  2HHU A;  4CJQ A;  3THX A;  1JKH A;  1U04 A;  3ISN C;  1U47 A;  1XHX A;  3WXI A;  4CFC A;  3PX4 A;  3N4P A;  4FZX C;  1EET A;  4ISG A;  4B9U A;  3BGR A;  1WNS A;  2E2N A;  2OZS A;  4CVN E;  3KD1 E;  3TAR A;  4I6M A;  3WNG A;  3KLG A;  1A5W A;  1U2V B;  1TK8 A;  5BRE A;  4CEA A;  2A40 A;  3THW A;  2FSK A;  3HI0 A;  3Q7B A;  3S3N A;  4O8K A;  3ZSR A;  1BQN A;  5AZJ B;  2FF6 A;  3ZX2 A;  3PSF A;  1C0U A;  1IBM K;  1EQY A;  2P9I A;  2XRI A;  1XNQ K;  1VK0 A;  1R59 O;  3ULE B;  5HL7 L;  1RT1 A;  2NRZ A;  4IDK A;  2WUS A;  4DTM A;  4HVJ A;  1HYV A;  2JGU A;  1C0G A;  1BWF O;  2HOE A;  3VQB A;  4DTR A;  4EFH A;  1EWR A;  4FJN A;  4B1U B;  3C6H A;  1IKY A;  1U4B A;  3A0I X;  3OYA A;  1KAX A;  4M63 C;  3O3F A;  2X74 A;  1XNR K;  3E9L A;  4MLE A;  4BRD A;  3DOL A;  5JS1 A;  3JAM O;  3NGI A;  3MEG A;  2OPP A;  4CJS A;  4CBU A;  3SJH A;  3AO1 A;  5MLC Q;  5F1X A;  1HNW K;  2E1Y A;  2D0B A;  4NLB A;  5GAD P;  2QXF A;  1K73 O;  3A5L C;  3FZF A;  1JCE A;  2XY8 A;  1K8K B;  4JS4 A;  4AHC A;  3AGR A;  2HBK A;  2OYQ A;  4CER A;  5FPM A;  1T05 A;  2G8U A;  5AQP A;  3SMS A;  3NDK A;  1V4S A;  2RE2 A;  3CCU N;  3V6D A;  3JS6 A;  4DF8 A;  3O3G A;  3CFP A;  4CJV A;  2UUC K;  1NJW A;  1L3U A;  2E2P A;  3IUC A;  1CZB A;  3ID6 A;  3CCJ N;  3L2R A;  1HPM A;  1Q81 O;  5EOY A;  2WOM A;  2D0P A;  4LH5 A;  1ATR A;  4CF0 A;  3VA0 A;  5FRO A;  1ASV A;  3MDQ A;  3M8P A;  1QE1 A;  4WQ5 A;  4K43 A;  4OJR A;  1QSY A;  4M41 A;  1RT7 A;  4C8K A;  2DPN A;  3AVC A;  3M8R A;  3FR0 A;  4ILH A;  4JK9 A;  3WXL A;  4BC2 A;  2HHQ A;  3RMA A;  2O8B A;  2O4I A;  1KAY A;  1NBW A;  1Q86 O;  2D0O A;  1OKJ A;  3MEC A;  4X64 K;  3VES A;  3QET A;  3P39 A;  4FVU A;  1T6C A;  2ITM A;  2GX9 A;  1IV0 A;  2ZE2 A;  1DGK N;  3E66 A;  4AHS A;  2YHY A;  3H08 A;  3T69 A;  4KH4 A;  5C10 A;  3RMC A;  4FWK A;  2NLX A;  4BAC A;  1U45 A;  2IVN A;  4B9T A;  2IVP A;  1FKP A;  4AM7 A;  1QZ5 A;  3CCE N;  1QHT A;  2I7P A;  5HRO A;  2VG6 A;  3QFU A;  3RRH A;  2HF4 A;  3VER A;  4RG8 A;  4NCB A;  1QQC A;  3LP3 A;  4RW4 A;  4BRN A;  2YNI A;  3NH2 A;  3HZ6 A;  3TAG A;  3R9P A;  4WFA L;  1TKZ A;  3VGL A;  3KLH A;  4ILG B;  4JKF A;  3L2W A;  3UKR B;  3GE1 A;  1YTA A;  4CZJ A;  2FBV A;  1OVQ A;  3VPZ A;  1NGD A;  4C23 A;  4R79 A;  1YXQ A;  1TKX A;  2KHO A;  1VSK A;  3I55 N;  1TYQ A;  2IGI A;  2ZJP L;  3EE8 A;  4OGC A;  4L3Q A;  5AQN A;  3CPE A;  3OYI A;  1LV5 A;  4CCH A;  4NCG A;  2QWM A;  1NK5 A;  4FJL A;  4BGB A;  3J8A A;  4DR7 K;  4C1N K;  5GIO A;  3HYF A;  4JKE A;  3KLE A;  2QTD A;  4KRF A;  4CES A;  3C65 A;  4FWS A;  1JL2 A;  1E3M A;  1NGC A;  3OYE A;  2HMI A;  4UQG A;  4DWI A;  1GLB G;  2QK9 A;  5KRT A;  3A5O C;  4FJI A;  4CK1 A;  4H4O A;  2QKB A;  4IO8 A;  1NNE A;  1KQS M;  3HXM A;  4EIA A;  1VSJ A;  2HVI A;  3TR8 A;  3HBT A;  4IG3 A;  3L3V A;  4BRI A;  1ZYQ A;  1FXX A;  1O1W A;  4YY3 K;  3F9K A;  3ZSV A;  3JSM A;  3QEW A;  4JLH A;  4DV1 K;  4E1N A;  2ATQ A;  2RPI A;  4DR3 K;  1RT3 A;  3UB5 A;  4FLV A;  1RTI A;  3GL1 A;  3OTO K;  4FJH A;  4OO1 J;  2O8E A;  5AQX A;  3QIO A;  2A3Z A;  1NK4 A;  1IBK K;  1HNI A;  4KHS A;  4DG1 A;  3AA3 A;  2RN2 A;  1P90 A;  3RR7 A;  4AHR A;  1KC8 O;  1J54 A;  3WEE A;  3ITH A;  3CQY A;  4B08 A;  5K14 A;  1J9A A;  4JI6 K;  3VQE A;  2UUA K;  3NHG A;  3C7N A;  3RSE B;  5B8H A;  1J5E K;  4CJW A;  4BVP A;  2P9N B;  1U48 A;  4KHP K;  1YAG A;  1TK5 A;  3THV A;  4HTL A;  3VQ9 A;  2BUP A;  1KLM A;  5AFU H;  4ISE A;  4DF4 A;  2YNF A;  1ZBH A;  5AQJ A;  4KHU A;  3AY9 A;  3P31 A;  5H1S Q;  2PZS A;  3L4I A;  2VG7 A;  3LP0 A;  3IRX A;  4CK3 A;  3K9K A;  1BIS A;  4M3X A;  3LDO A;  4Y1C A;  3HOT A;  2FLO A;  3TSU A;  5KPT A;  4BRA A;  3U9Z A;  3TU5 A;  5BPM A;  3VQD A;  3T1A A;  4NYF A;  3BEX A;  3MN7 A;  4RTF D;  4CK2 A;  3HL8 A;  1CXU A;  3ZSW A;  1CZA N;  1KRP A;  4A62 A;  3SPY A;  1RNH A;  2X78 A;  4NO7 A;  2W42 A;  1CZ9 A;  3CFR A;  2HHH K;  1R0A A;  4CFD A;  2V7Y A;  1WBB A;  4AIL C;  2P9S B;  4DV3 K;  4E1J A;  3CCS N;  1B92 A;  1ASW A;  4DQI A;  4W5Q A;  3CER A;  1YIJ N;  2GUP A;  2CH5 A;  4CGH A;  4MDB A;  4EHT A;  1BI4 B;  3OS0 A;  3NF8 A;  1HJR A;  2NNW A;  4YOT A;  1N36 K;  4CF8 A;  2PAV A;  4CJU A;  4BC3 A;  1NG9 A;  4CZL A;  4OKE A;  3QEX A;  4DTO A;  5JVH L;  4YOX A;  4DSJ A;  2P1J A;  5HP1 A;  4B9S A;  5EX5 A;  2IVO A;  4BG9 A;  1XMO K;  4CGF A;  2YJF A;  1SKS A;  4IOX A;  5I42 A;  3C6A A;  4DSL A;  1L3V A;  2KW4 A;  3QBX A;  4O0J A;  3VQP A;  1NGG A;  1SZ2 A;  1OH5 A;  2GTD A;  3D2E A;  1QVG M;  4JD2 B;  4OPA A;  3K5L A;  4C8L A;  2YHX A;  1TKD A;  1RDC A;  2VCP A;  1OH8 A;  4QOZ B;  3K5N A;  4DCH A;  3OYD A;  4QS8 A;  3KK7 A;  4V19 S;  2OAN A;  2IDO A;  5E41 A;  3CYM A;  1HKB A;  3PV8 A;  1ZC6 A;  2WFB A;  1S1V A;  2QI2 A;  5M1P A;  1D8Y A;  4CJ7 A;  2ZF5 O;  3O4Q A;  4JKA A;  3PO4 A;  4FL9 A;  3T1Y K;  3LM2 A;  5AQK A;  4BDY A;  2FSN A;  3TTD A;  4EHU A;  1NOY A;  4FZZ A;  3DAW A;  3B6O A;  4CBW A;  3RMD A;  4LFB K;  2Q31 A;  4F8R A;  3AAQ A;  4N47 A;  4W5R A;  3CPW M;  1N33 K;  1Q8I A;  1YF5 L;  1LAV A;  2QWN A;  5ADX A;  3E01 A;  1HMV A;  4G1Q A;  1UWB A;  5J1E A;  2PYJ A;  1BDG A;  1SKW A;  1U2V A;  3UE5 A;  3EZW A;  3TSP A;  3VEN A;  5FRN A;  5J2N A;  4CGD A;  5AZJ A;  5AQO A;  5LMU K;  4WF9 L;  2XO7 A;  5GAH P;  3ULE A;  3M1F A;  2Q1N A;  4DFM A;  4B9N A;  3HRG A;  4FJ8 A;  3AO4 A;  4IDH A;  1TL3 A;  3SI6 A;  1KAZ A;  4KRE A;  3I0R A;  4QS7 A;  4DU1 A;  1WBD A;  4A5A A;  4YDU C;  2Z1H A;  3KLI A;  1HYS A;  3O80 A;  3LDS A;  2E2O A;  1BG3 A;  1WN7 A;  1TUY A;  5GAE P;  1BHL A;  3CC4 N;  3MEE A;  5C15 A;  5HRP A;  3LM9 A;  5F2R A;  4U67 L;  2D0A A;  3AAR A;  4KB1 A;  3SMP A;  4B9L A;  3AO2 A;  4ELV A;  2D0C A;  2IAJ A;  4CJK A;  4NXN K;  5JS2 A;  3AVF A;  2Q3S A;  4ZTJ A;  3O8M A;  1NMN A;  4ID5 A;  3SCX A;  1HRH A;  1K8K A;  3A5N C;  3AA2 A;  5AR0 A;  2PYL A;  4K41 A;  4L8R B;  4BRO A;  5C25 A;  3WXK A;  1Z26 A;  2VWJ A;  1BA0 A;  2HHV A;  1RTH A;  2HBM A;  2XY6 A;  1WAJ A;  1NK6 A;  1WUA A;  5M1K A;  5HRS A;  3F5T A;  1S6P A;  1TAQ A;  3ATV A;  1H1V A;  1QSL A;  2Z1J A;  4WE1 A;  4IBN A;  3T3F A;  1J5O A;  4QS9 A;  1S1U A;  3LDQ A;  2O8F B;  3QES A;  1HNZ K;  5BPL A;  2HNZ A;  4K42 A;  2G8W A;  1D9F A;  1ATN A;  3R1X A;  2FSJ A;  3M8S A;  3O1B A;  4J2E A;  2XHB A;  4M3Y A;  3CC7 N;  1E4G T;  1JL1 A;  2BGG A;  5EVZ A;  4JV5 K;  3FZM A;  1IBL K;  1VQK N;  4FWO A;  2QWR A;  3MWT A;  2FBX A;  3CFO A;  4FJG A;  2JWL A;  4DTS A;  1IG8 A;  2G8K A; 
#chains in the Genus database with same CATH homology
 3VQ8 A;  3VQQ A;  3QO9 A;  3KKS A;  1T05 A;  4N5S A;  2G8U A;  3V9Z A;  4KTW A;  3NDK A;  3V6D A;  3CG7 A;  3DLE A;  2OPS A;  1K6Y A;  4DF8 A;  3ZSX A;  3T19 A;  3O3G A;  3OYF A;  3CFP A;  4W5N A;  4CJV A;  3C6U A;  1BIU A;  2DFE A;  4FJ9 A;  4AHV A;  1NJW A;  1L3U A;  3QEP A;  2G8H A;  1CZB A;  3S3O A;  3TAM A;  4DSE A;  3V1Q A;  3L2R A;  1SL0 A;  1L3S A;  1RT2 A;  1KFD A;  4HCC A;  1DTT A;  2WOM A;  4FK2 A;  4LH5 A;  1RBV A;  3L3U A;  4CF0 A;  3WNE A;  3VA0 A;  5FRO A;  3HO1 A;  3ZCM A;  1ASV A;  1IH7 A;  3ZT2 A;  3LPT A;  4FVM A;  1KCF A;  1BGX T;  3M8P A;  1QSS A;  2IOC A;  2DY4 A;  1QE1 A;  4CJ4 A;  1DTQ A;  4OJR A;  4DMN A;  1QSY A;  4KI6 A;  4M41 A;  4CF9 A;  4ELU A;  3VQC A;  3CQ8 A;  1RT7 A;  4IKF A;  4C8K A;  3AVC A;  1SUQ A;  4CJT A;  4CHZ A;  3SQ0 A;  4CFB A;  3M8R A;  1L5U A;  1ITG A;  1TAU A;  3OVN A;  2HHQ A;  1XC9 A;  3RMA A;  4CGI A;  4F3O A;  2O4I A;  4MQ3 A;  2X6S A;  4GVM A;  3C95 A;  4H8K A;  4EZ6 A;  3K5O A;  3ZSY A;  2F8S A;  4E0D A;  3TAP A;  1BL3 A;  2ITG A;  3MEC A;  4OGE A;  4OKJ A;  4NCA A;  3MXM A;  3A2F A;  3NAE A;  3QET A;  4M45 A;  4M3W A;  3SYZ A;  1FKO A;  1LAW A;  3VQ5 A;  4KHN A;  2E6L A;  2ZE2 A;  3V81 A;  3IAY A;  1EX4 A;  4KTZ A;  2E6M A;  4M42 A;  4AHS A;  1EKE A;  1X1P A;  3H08 A;  4FM2 A;  1LW0 A;  3AVJ A;  3S3M A;  3NE6 A;  4YNQ A;  1JLC A;  3LAK A;  3RMC A;  2Z1I A;  4W5O A;  5C24 A;  3CM6 A;  1KVB A;  4DFP A;  4BAC A;  3DLK A;  2XY7 A;  4M3T A;  3TAB A;  2A1R A;  1VRU A;  2D5R A;  1U45 A;  3P83 D;  3ZT4 A;  1U49 A;  1T7P A;  1FKP A;  4B9T A;  4J2A A;  4FYD A;  3SUN A;  4FJJ A;  2P5G A;  1TL1 A;  1UOC A;  1QHT A;  3L2Q A;  4B8C A;  3SV3 A;  5HRO A;  1CXQ A;  2VG6 A;  3V9W A;  4CJL A;  2YHA A;  1LWE A;  3D0P A;  3RRH A;  1KSP A;  3KJV A;  1KFS A;  3OYC A;  2R7Y A;  4DLE A;  3ZSZ A;  3SQ2 A;  4RG8 A;  4NCB A;  1QQC A;  1WSE A;  3LP3 A;  1QS4 A;  4RW4 A;  4FK4 A;  2YNI A;  3NH2 A;  3V9X A;  4HUG A;  4Z4I A;  3DRS A;  3OYB A;  3NF6 A;  4CHQ A;  1TKZ A;  4LSL A;  3TAG A;  5CYQ A;  2FC0 A;  3LZJ A;  3KLH A;  2XY5 A;  3L2W A;  2I5J A;  4FW1 A;  4K8Z A;  1X9S A;  1YTA A;  2FBV A;  4E7I A;  4CF1 A;  4PWD A;  3TAQ A;  4I9L A;  3C6T A;  1RDB A;  1NK8 A;  3VN5 A;  3SUQ A;  2HND A;  3LP1 A;  3HPG A;  4Q5V A;  1IKW A;  4CIF A;  1XI1 A;  1TKX A;  5J2P A;  1VSK A;  5KRS A;  1RBU A;  3LZI A;  2IGI A;  5HRR A;  3O3H A;  4E7L A;  3ALY A;  1VSL A;  3B6P A;  3ZT3 A;  4OGC A;  3AVK A;  1I39 A;  4E19 A;  3OYI A;  1LV5 A;  4CCH A;  3EZ5 A;  4NCG A;  1NK5 A;  4ID1 A;  4FJL A;  4N76 A;  3HVR A;  4FLT A;  4B3O A;  3L8B A;  3LAL A;  1BQM A;  4F3T A;  4DSK A;  4GW6 A;  4OKK A;  3VQA A;  4DSF A;  1NJY A;  3HYF A;  4FLU A;  3KLE A;  3P1G A;  3K5M A;  2F8T A;  2KZZ A;  4O5B A;  4KRF A;  2BDP A;  4CES A;  4LY7 A;  3TAN A;  2X6N A;  1VRT A;  3K59 A;  1JL2 A;  3S9H A;  1RDD A;  1NKE A;  4KHY A;  4E89 A;  4CEO A;  4DFK A;  4CED A;  4QCL A;  5KGW A;  3OYE A;  2HMI A;  4UQG A;  4DWI A;  2FBT A;  1WSI A;  1BIZ A;  3EY1 A;  5KRT A;  1HNV A;  4FLX A;  4FLZ A;  4FJI A;  2QK9 A;  4RW7 A;  3FFI A;  4CK1 A;  1RT5 A;  4O55 A;  4PA1 A;  4DTP A;  1HQU A;  4H4O A;  1Q9Y A;  2QKB A;  2DTU A;  5I3U A;  3AVB A;  3HXM A;  1EP4 A;  1VSJ A;  1GOB A;  1A5X A;  2HVI A;  1VSF A;  3LAN A;  4CHY A;  4CJ3 A;  1N5Y A;  3TR8 A;  3HP6 A;  4IG3 A;  1YVU A;  1NKC A;  3L3V A;  4B9M A;  1WLJ A;  1ZYQ A;  1FXX A;  1NK7 A;  1D5A A;  1O1W A;  1C0T A;  4CIE A;  4E7H A;  3F9K A;  1JLA A;  3ZSV A;  3JSM A;  3QEW A;  1C0M A;  3HVT A;  2WON A;  1RTJ A;  1G15 A;  4JLH A;  1RCH A;  2ATQ A;  2RPI A;  4E1N A;  4CF2 A;  3MAQ A;  1JLB A;  1RT3 A;  2YKM A;  4W5T A;  3OJS A;  3OYJ A;  3F73 A;  4FCY A;  4FLV A;  3LP2 A;  3NGY A;  2O4G A;  4Y1D A;  4HTU A;  1RTI A;  4O44 A;  4FJH A;  4FK0 A;  4KTQ A;  4PUO A;  2HNY A;  1Z25 A;  3QIO A;  4GMJ B;  3IS9 A;  1NK4 A;  1T03 A;  1HNI A;  4KHS A;  4DG1 A;  3AA3 A;  1UA1 A;  4CEB A;  4AHT A;  3OYN A;  3KK3 A;  1VSH A;  1TK0 A;  2RN2 A;  4I9Q A;  2P51 A;  1JLQ A;  3VQ7 A;  1S9G A;  3RR7 A;  4AHR A;  1S1T A;  3P5J A;  3ZSO A;  4B9V A;  5FRM A;  3AVG A;  1J54 A;  3V4I A;  2GV9 A;  2YNG A;  3ITH A;  2KTQ A;  3K2P A;  1SV5 A;  4B08 A;  3VA3 A;  5K14 A;  4B8A B;  2G8I A;  4DSI A;  1J9A A;  2GUI A;  3JYT A;  2BE2 A;  2HW3 A;  3AO3 A;  1W0H A;  3VQE A;  4BE2 A;  4KHQ A;  4CIG A;  1DLO A;  2JLE A;  3NHG A;  1ZBF A;  2HHX A;  5KTQ A;  4CHO A;  5SWM A;  4CJW A;  2NUB A;  1U48 A;  3BDP A;  4CFA A;  1KVC A;  1TK5 A;  1WSH A;  5C42 A;  3THV A;  4Z0U A;  4F4K A;  3VQ9 A;  1X9M A;  3ZT0 A;  1BI4 A;  1KLM A;  2BAN A;  4RW6 A;  4OPJ A;  1VSI A;  3DRP A;  1NOZ A;  4DFJ A;  1X9W A;  4XIU A;  4I2P A;  4DF4 A;  2YKN A;  1KLN A;  4O0I A;  3LWM A;  2YNF A;  3U6F A;  3G0Z A;  4OLA A;  2QKK A;  3C94 A;  4CJE A;  1ZBH A;  1S1W A;  4DQQ A;  1LW2 A;  1ZBL A;  1HPZ A;  1B9F A;  3DRR A;  4I2Q A;  4EP4 A;  4E7K A;  4KHU A;  2PZS A;  3OYM A;  2OPQ A;  4HUF A;  2VG7 A;  3LP0 A;  3IRX A;  1C1C A;  3NF7 A;  1S6Q A;  3V1O A;  4CK3 A;  3QEV A;  4KB0 A;  2FBY A;  1BIS A;  2P5O A;  4M3X A;  4FJM A;  2E4L A;  4Y1C A;  1WSG A;  4TSX A;  3SUO A;  1YTU A;  4RW9 A;  3VQ4 A;  3ZT1 A;  3U3Y A;  3HP9 A;  1I3A A;  4CHP A;  2KQ2 A;  4J2B A;  4CEZ A;  4Z4F A;  3VQD A;  5CZ2 A;  3T1A A;  4KI4 A;  4NYF A;  5T7B A;  1C6V A;  3OYH A;  3KTQ A;  4RW8 A;  4DS4 A;  3DM2 A;  3SNN A;  3I0S A;  4CK2 A;  4N56 A;  1RDA A;  3HL8 A;  1CXU A;  3ZSW A;  1KRP A;  3ULD A;  3SPY A;  1RNH A;  4CGG A;  3SPZ A;  2X78 A;  2W42 A;  1CZ9 A;  3CFR A;  3U3G A;  4DQR A;  3KLF A;  4JS5 A;  1R0A A;  4CFD A;  4DQS A;  4J2D A;  3K58 A;  2GBZ A;  4AIL C;  4CGJ A;  4DU3 A;  3L2V A;  5DK5 A;  2LSN A;  4CEE A;  1B92 A;  1ASW A;  4FLW A;  2PY5 A;  1RT6 A;  4DQI A;  5KI6 A;  4Z4C A;  1BCO A;  3DYA A;  4W5Q A;  4HUE A;  4KHW A;  3NFA A;  1RBT A;  4CGH A;  3QNN A;  1BI4 B;  1REV A;  3OS0 A;  3NF8 A;  1HJR A;  2HHW A;  1S5J A;  4CF8 A;  3QNO A;  4CJU A;  1UA0 A;  1ASU A;  4OLB A;  1NJX A;  3KD5 E;  2AJQ A;  4OKE A;  3QEX A;  3DOK A;  3KIO A;  3NGZ A;  3MXI A;  4DTO A;  3OY9 A;  4KFB A;  3SQ4 A;  4AH9 A;  4DSJ A;  1JLG A;  2P1J A;  5HP1 A;  2G8F A;  3PY8 A;  4B9S A;  4F2S A;  1TGO A;  4CHN A;  2ZD1 A;  3DLG A;  4IG0 A;  4CGF A;  1SKS A;  4CE9 A;  1SL2 A;  4DQP A;  4KKO A;  5I42 A;  1NK0 A;  4EP5 A;  4JRQ A;  2OA8 A;  4FM1 A;  4DSL A;  4CJP A;  4F2R A;  1L3V A;  1RIL A;  2KW4 A;  4O0J A;  3VQP A;  1SKR A;  3AVL A;  3QEI A;  3AV9 A;  3KK2 A;  4HHT A;  3CM5 A;  1T8E A;  3NF9 A;  3NBP A;  3L2U A;  3K5L A;  4C8L A;  1IKV A;  2KFZ A;  4E7J A;  1TKD A;  4DLG A;  2Y1J A;  1RDC A;  2A1S A;  1C1A A;  3TWH A;  4QOZ B;  1HYZ A;  3OS2 A;  3K5N A;  3OYD A;  3HK2 A;  3HST B;  3UIQ A;  1F21 A;  3K57 A;  3PO5 A;  3DLH A;  1LWC A;  5J2M A;  3HPO A;  4CJR A;  2HVH A;  2IDO A;  5E41 A;  1WSF A;  3CYM A;  4KV8 A;  3M8Q A;  4YFU A;  3PV8 A;  3QIN A;  3MXJ A;  3AVM A;  1RBR A;  1S1V A;  3V9U A;  3HT3 A;  2DFF A;  1YT3 A;  4C8N A;  3AA4 A;  1D8Y A;  5EU7 A;  5D3G A;  3QER A;  4JRP A;  3O4Q A;  3LPU A;  5FDL A;  4ZHR A;  4Z4H A;  2VWK A;  5KGX A;  3PO4 A;  4BDP A;  2IS3 A;  4OPK A;  1L3T A;  1A5V A;  3IG1 A;  4BDY A;  4FXD A;  1TV6 A;  1NOY A;  3VQ6 A;  3NH0 A;  4FZZ A;  4KAZ A;  4FJ5 A;  1XWL A;  3SV4 A;  2EHG A;  2HB5 A;  1MU2 A;  3AA5 X;  1C1B A;  3B6O A;  3RMD A;  1NJZ A;  2KZM A;  1S9E A;  4F8R A;  2Y1I A;  4N47 A;  4W5R A;  1JXE A;  4DS5 A;  1HQE A;  1Q8I A;  4DTU A;  1KVA A;  1LAV A;  3HJF A;  1D9D A;  2HHS A;  4FJ7 A;  3E01 A;  1HMV A;  4G1Q A;  1EXQ A;  1UWB A;  1WAF A;  5J1E A;  2PYJ A;  3RWU A;  4E1M A;  3PX6 A;  4C8O A;  1SKW A;  2YNH A;  3G10 A;  1LWF A;  3OYL A;  1ZBU A;  5FRN A;  5J2N A;  4Z4E A;  3ASM A;  2OPR A;  2B4J A;  4CGD A;  1GOA A;  3PX0 A;  1JLE A;  1ZBI A;  1VSD A;  1UAX A;  3QIP A;  3OYG A;  3SQ1 A;  2Z1G A;  2XO7 A;  1IG9 A;  3HM9 A;  1RTD A;  3DI6 A;  4M3R A;  4DFM A;  4B9N A;  3V9S A;  1N6Q A;  1JXB A;  5CZ1 A;  3RTV A;  4EZ9 A;  4FJ8 A;  2ZQB A;  3AO4 A;  3EYZ A;  1TL3 A;  3SI6 A;  5HLF A;  4KRE A;  3LWL A;  4BE1 A;  2B5J A;  2IC3 A;  2RKI A;  3NH1 A;  3I0R A;  4IFV A;  4ICL A;  3TAF A;  4BDZ A;  2HHU A;  4CJQ A;  4DU1 A;  1JKH A;  1U04 A;  1NKB A;  3ZSQ A;  2YHB A;  3ISN C;  4Q0B A;  2Z1H A;  5HRN A;  3KLI A;  3SUP A;  1U47 A;  1HYS A;  5SZT A;  3LDS A;  1XHX A;  4R5P A;  4BWM A;  3AVA A;  2EX3 A;  3SZ2 A;  4CFC A;  1WSJ A;  3AVH A;  3PX4 A;  4CEF A;  1WN7 A;  4FZX C;  4M3U A;  1EET A;  1BHL A;  2VG5 A;  3OJU A;  4DU4 A;  2KFN A;  3MEE A;  4PY5 A;  5HRP A;  3OS1 A;  4B9U A;  4FJK A;  1CLQ A;  1NK9 A;  1IO2 A;  1GOC A;  3BGR A;  4KPY A;  1WNS A;  2D0A A;  2OZS A;  4KB1 A;  3I8D A;  1J53 A;  5CYM A;  1TKT A;  3KKR A;  5CY4 A;  4B9L A;  3D45 A;  3AO2 A;  4Z4G A;  3KD1 E;  3TAR A;  4ELV A;  2D0C A;  4OVL A;  3WNG A;  2IAJ A;  3WNF A;  3KLG A;  4CJK A;  3RMB A;  1A5W A;  1TK8 A;  3HPH A;  5JS2 A;  3AVF A;  4CEA A;  3DLB A;  2Q3S A;  4ZTJ A;  1Q9X A;  4O4G A;  3SCX A;  2ETJ A;  4ID5 A;  1HRH A;  5DMR A;  2OZM A;  3S3N A;  3MED A;  3AA2 A;  3ZSR A;  4ELT A;  1BQN A;  3AVN A;  2PYL A;  4L8R B;  1C0U A;  5C25 A;  2XRI A;  1VK0 A;  1VSE A;  1W9H A;  1Z26 A;  2VWJ A;  1XHZ A;  4E3S A;  4FZY A;  4M3Z A;  1RBS A;  3TAE A;  2DFH A;  2HHV A;  1Y97 A;  4FW2 A;  1RTH A;  1RT1 A;  4KO0 A;  2XY6 A;  1WAJ A;  1BCM A;  1S1X A;  4IDK A;  5HBM A;  4LD0 A;  2RF2 A;  1NK6 A;  4CJ5 A;  4HVJ A;  5HRS A;  1HYV A;  1S6P A;  1TAQ A;  2JGU A;  3KK1 A;  4DTM A;  3VQB A;  3SJJ A;  1QSL A;  3O4N A;  4DTX A;  2Z1J A;  4WE1 A;  4DTR A;  4IBN A;  3T3F A;  1J5O A;  5J2Q A;  1S1U A;  3QLH A;  4FJN A;  2YV0 X;  1TVR A;  3RRG A;  1IKY A;  2B6A A;  1U4B A;  3QES A;  4BE0 A;  2HNZ A;  4QAG A;  3DLR A;  4H4M A;  4CEC A;  3OYA A;  3O3F A;  2G8W A;  3RR8 A;  4MFB A;  4ZTF A;  1D9F A;  4HCB A;  4K8X A;  2X74 A;  1JLF A;  1B9D A;  4LSN A;  4C8M A;  4CEQ A;  3M8S A;  3NCI A;  3DOL A;  5JS1 A;  4J2E A;  2F96 A;  4FM0 A;  2XHB A;  3MEG A;  3NGI A;  2OPP A;  4M3Y A;  4BWJ A;  3OYK A;  4FLY A;  4CJS A;  1VSM A;  3V1R A;  1JL1 A;  1RT4 A;  2BGG A;  3AO1 A;  4DTJ A;  4NYN A;  4I7F A;  3WNH A;  4N41 A;  1SL1 A;  2D0B A;  3DMJ A;  3TI0 A;  4PQU A;  2QXF A;  2HHT A;  1KTQ A;  2FBX A;  3CFO A;  4LH4 A;  4IFY A;  3AVI A;  4CJF A;  1QTM A;  4FJG A;  1FK9 A;  2G8V A;  4AHU A;  2XY8 A;  4DTS A;  4DTN A;  4JS4 A;  3PUF A;  4AHC A;  3LAM A;  3AO5 A;  1IKX A;  4FJX A;  2OYQ A;  2G8K A;  4CER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...