3LPYA

Crystal structure of the rrm domain of cyp33
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
SKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase E
publication title Pro isomerization in MLL1 PHD3-bromo cassette connects H3K4me readout to CyP33 and HDAC-mediated repression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 13
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lpyA00
2YTCA 3CCES 2FY1A 2ERRA 2F9JA 1SJQA 2DO4A 2J0SD 2RRAA 5HO4A 1FO1A 2DO0A 1YITS 2A3JA 2XS7A 2CPXA 2YH1A 1X4AA 2J0QD 3RW7A 2MQQA 2EVZA 1UAWA 2J8AA 3HHNB 1A7GE 2JWNA 1R8PA 2D9PA 2DHXA 2G0CA 2M7SA 5IFMA 1S72S 1WHXA 2DGTA 2YWKA 1M1KT 2KM8B 2KXFA 2N3OA 1VQ9S 2V94A 1CVJA 2DH7A 1X5TA 1K73T 2KG1A 1M5KC 2OTLS 2XNRA 3H2VE 2DGQA 3L3CA 1WHVA 3SMZA 1YWXA 4YOEA 2HYIB 2CQ1A 3B4DA 1FJEB 5ITHA 2AYEA 2FC9A 2CPIA 2MKCA 2DNYA 2L41A 4LIRA 5JVHQ 2E44A 5GMKa 5GAHU 2MZQA 3LQVA 3K0JA 2B0GA 2MZTA 3CXCR 5D77A 1WF0A 2MZSA 5LJ3Y 1KD1T 1KC8T 1WF1A 1U1QA 2O3DA 2SXLA 2XNQA 1Q86T 1M5OC 3CC4S 4QU7A 3CMAS 3S8SA 3UCUP 1H2UX 2CQBA 1U1MA 3CC7S 1KQSR 2M0GB 2Q79A 3P3DA 3I55S 1NO8A 4WF9Q 4WFAQ 2OJ3A 1X4FA 1JMTA 5H1SV 3ZZYA 1OIAA 2XS2A 2CQCA 2DH9A 1ZZFA 3CCLS 5DETA 3P5TL 2DNGA 2MZJA 2RQ4A 2FC8A 4Y0FA 1Q81T 3CCQS 2N82B 2RVJA 2MKHA 1VC6A 3CULA 1DRZA 2LA6A 5DDPC 2JVOA 2MPUA 4CH1A 1AUDA 1H6KX 3Q2SC 1ZH5A 1WEYA 2X1AA 5BJRA 3TYTA 2CJKA 4LJMA 1VQMS 2OSRA 2K8GA 4TU8A 2MJUA 4TLQA 2KHCA 1M5PC 1ZZNA 3CD6S 1YI2S 3R27A 1KOOA 3NNAA 3VALA 1FNXH 2KRBA 1WF2A 2MB0B 1WELA 1G2EA 5LSOA 1SXLA 2CQ4A 2LYVA 2JVRA 2QA4S 4RU2A 3THPA 3US5A 4Z2XA 2DB1A 3CTRA 2DNRA 2GHPA 3VAFA 2D9OA 2G1DA 2DNHA 3G96A 3BO3A 2DH8A 3VAJA 4IO9Q 4WCEQ 3THTA 3MUMP 3TO8A 2OIHA 2CQ2A 2PE8A 1FHTA 2DIVA 2RNEA 4PR6A 2MQPA 2DGXA 4Y00A 4A8XA 2HGMA 1WWHA 2DNMA 2KT5A 4TU7A 1X5SA 1JJ4A 2U2FA 2YH0A 2E5HA 3HI9A 4C0OC 4IUFA 5FJ4A 1O0PA 1YIJS 3SDEA 3ULHA 2VODA 1HD0A 3BS9A 5HL7Q 1RKJA 3VAGA 5GADU 1WHWA 1DZ5A 2BOPA 1A9NB 2L08A 3U1LA 1S79A 4LMZA 2KXHA 2DNNA 1HL6A 1X4BA 2L9WA 2DNOA 3Q2TC 2EK6A 2M70A 2CQ0A 2M88A 3NS6A 3G9CA 1QM9A 2BZ2A 5DDQC 2CPFA 3PIPQ 2DNPA 2MZ1A 3UCGA 1VQPS 2M8DB 2RS8A 1SJ3P 1VQ8S 2M2BA 1VC5A 1N52B 1VC0A 4UQTA 1OWXA 3CCVS 2LECA 1WHYA 2LEAA 2M52A 1UW4A 2KRRA 2AYBA 3P49B 5IM0A 3R1LA 2RQCA 2MGZA 3CPWR 2MY8A 1U1PA 4QU6A 2DNQA 2LQ5A 1YJNS 2E5JA 5GAGU 2DGSA 3VAHA 2I2YA 1NU4A 3NNCA 2ZJRQ 1X0FA 2CQDA 3EGZA 3SXLA 2MXYA 2DGVA 3G71S 4IOAQ 2XS5A 1X4HA 1FT8A 2HGLA 2NZ4A 3UE2A 3U1MA 3MXHP 3UD3P 1VQ4S 2KN4A 2MQLA 1QVGR 3D2WA 5CYJA 1FJ7A 1U6FA 4OZ0A 3RW6A 2EK1A 2D3OR 3VAKA 3CMES 4CIOA 1DHMA 2MZRA 3CC2S 2G4BA 2RUGA 1WEXA 1D9AA 2E5GA 3IRWP 1H2TZ 2MQMA 2MKIA 2U1AA 3MUVP 1K8AT 3EGNA 2UP1A 2RU3A 1PO6A 1WI8A 2VOPA 3BO4A 3DLLQ 3MI7X 2KH9A 2KYXA 2LXIA 3FEXB 4F02A 4UY8T 4WFBQ 4PRFA 3G4SS 3TP2A 3P6YC 1WI6A 2KXNB 2M4MA 4C4WA 2XSFA 4BS2A 1U1OA 3G8TA 2GO9A 1WG4A 1X4EA 2MY7A 5DDRC 2KI2A 4PKDB 4J5OA 1H2VZ 4ERDA 2DGOA 3UD4P 5IQQA 5LXRA 3MUTP 1B7FA 4OZ1A 2ZJQQ 1UP1A 1YTYA 1VQOS 2N7CA 3MURP 4W92B 1JJHA 3UWTA 4IOCQ 1NJIT 5D78A 3G6ES 1HD1A 5GVQA 3S01A 4FXWA 2KM8C 2DNZA 2DHAA 3R1HA 1X5PA 2ADBA 1Q7YT 1U1RA 2LXUA 1FJCA 2CPDA 2KVIA 4U67Q 3NNHA 1VBZA 3IWNC 2MKJA 2F3JA 3SDEB 2FHOB 3V4MA 2HZCA 2LKZA 4WFNQ 1UFWA 4YB1P 1IQTA 3CCMS 2DNKA 2OTJS 5CA5A 1WTBA 5JVGQ 2KU7A 2M9KA 1U1LA 2WBRA 2E5IA 1X4CA 1SJ4P 1QVFR 2LA4A 2AYMA 2X1BA 5MLCV 1OPIA 1BY9A 1X4GA 1YHQS 1M90T 1WG1A 3PIOQ 3S6EA 2ZJPQ 2I38A 1KOHA 1VQ5S 2DIUA 2N3LA 2MJNA 4QQBA 3CF5Q 4ED5A 2K3KA 5IM0B 2NLWA 1WG5A 2F9DA 2CQIA 3J7YU 2MGZB 2YKAA 2RS2A 5DDOC 2PEHA 1X5OA 2DITA 2MYFA 2CPJA 2MSTA 2MQOA 1P27B 4C7QA 5LSLA 1YJ9S 1SJRA 1XN9A 4QPTA 1SJFA 1M5VC 2CPHA 2M8HA 2CPEA 2QEXS 4M5DB 3VF0B 2MMYA 3CCRS 3MDFA 3NS5A 3UCZP 3B4MA 2DHSA 5GAEU 2DGUA 2MHNA 3H2UB 4ZKAA 1P1TA 1X4DA 3BO2A 4W90B 3I56S 2MKSA 3BEGB 3FEYB 2QFJA 1VBYA 1K9MT 3G8SA 1WEZA 3OW2R 3CCUS 2DNLA 1VQNS 2HVZA 4YUDA 1HA1A 1OO0B 1U1NA 3DXBA 2DHGA 1DBDA 2CPYA 2KG0A 2LEBA 3J7ZT 2LMIA 4V19X 1R8HA 5DM7Q 2JX2A 4WIIA 2X1FA 3MOJB 1N88A 3MD1A 1VQKS 2CQHA 1U2FA 2OSQA 2VONA 1U6BA 4F25A 2AYGA 1N8RT 2HGNA 3CCSS 1VBXA 4CQ1A 1F9FA 2MSSA 1JJ2R 1YJWS 1VQLS 3VAMA 3VAIA 1Q82T 1FXLA 4CH0S 1URNA 1U1KA 3EX7B 3MD3A 1L3KA 1D8ZA 1VQ6S 2J76E 2CQPA 1W2BR 2CQ3A 4EGLA 4TU9A 2LCWA 3N9UC 5LJ5Y 1PGZA 2CQGA 4F26A 4P6QA 5DM6Q 3JB9k 2CPZA 1N54B 2DISA 2FPHX 2X1GA 1VQ7S 2MQNA 3CUNA 5LXYA 2DGWA 2RRBA 4FXVA 2DK2A 1RK8A 5EN1A 2JRSA 3CCJS 2AD9A 2MKKA 4WKRA 2XB2D 3ZZZA 3NMRA 2VOOA 5CXTA 2RT3A 2KFYA 3LPYA 2ADCA 3S7RA
chains in the Genus database with same CATH superfamily
4CT9A 4HT7A 1YSJA 2A3JA 2K7JA 3NAHA 2V4QA 1HWKA 1R89A 4RNOA 1UAWA 1NK6A 1YQHA 2H9ZA 2XMWA 2O01C 3N6LA 4YY3J 1SQFA 1M1KT 3BF4A 1KHVA 2W2QP 4ELUA 1JQGA 1D09B 3HX9A 1JLQB 2OO4A 1M1GA 2EFQA 2YVSA 4NYPA 2OEJA 4KO0A 4QYRA 2I5JA 3AFGA 1M0SA 4C11B 2MZTA 3A4TA 5A2QY 2HFSA 2H54B 2XY6A 4N41A 2FJVA 2LXFA 4OQJA 1S12A 4O23A 3MEGB 2HK2A 3CC7S 4NLTA 3A3OB 3GR0A 3P45B 4L76A 4G1IA 4ES1A 3W66A 4DL7A 1ZTTA 2DH9A 2VPYB 5KFHA 4KTQA 3PRBA 1TKTB 3DU6A 2ZD1B 1S1UB 5DDPC 1K44A 4JI1J 2MPUA 2PFFB 1H6KX 2BM1A 2JSXA 1OYDA 2MJUA 2C2KB 3BSAA 3IR6B 4X66J 1G2EA 1ZAXA 1FD8A 4F50A 3NLCA 4EO8A 1Y7PA 3CTRA 3OJSA 1S9EA 2UXDJ 4DMZA 2DNHA 4F0KA 3VAJA 2XY5A 4N5SA 3PYEA 4DPWA 1FHTA 5J1NA 4ZOSA 4TU7A 4HI1A 3OR1A 3RRHA 2ZHBA 4B3OA 4ICLB 3LGMA 3SSRA 4IH6A 3MM7B 3C46A 4DPTA 5JXSA 1WC4A 2XO6A 5J1EA 5L9XA 1GK8A 5KFIA 2YQ0A 4CLUA 2FGOA 4IFVA 3EVOA 2G0IA 1VQ8S 2YQ1A 4P2SA 1GX5A 3D68A 3IAS9 4I2QB 3CCVS 4WIQA 3MAQA 2WSEC 5IM0A 2DR6A 1F5CA 5K14B 1NSAA 1MG7A 2DNQA 3MCOA 1K0VA 2E5JA 1KWMA 5HROB 4X65J 4C8KA 4FYDA 2JOQA 3UE2A 2Z2ZA 4NPOA 1N33J 4F2RA 1JLAB 3HHLB 2QLWA 3KLIA 1HWIA 5FDLB 4RW7B 4ZPCA 4DL5A 2MQMA 1PC4A 4LF6F 4U7UD 3LGNA 1NCLA 3HHLD 4UOFA 1LW0B 1SC3B 2XI3A 2BX6A 3IS9B 1A0OB 2VBXA 3O8WA 2A6MA 2QL9B 1CULB 4BS2A 4ZCIA 4ERDA 4J9QA 1S6UA 1NK4A 3TUIC 3M6VA 3BGRB 4KBIA 4ZDNA 3ET6A 1RHRB 2ZNYA 4ZA1A 3PYDA 1IBKJ 3U02A 2ZWOA 1G1XA 3CDAA 3KK2B 1G6BA 3VCDA 4A8OA 1VBZA 3W63A 4MKBA 2BJDA 5JUMA 1CJKB 1U25A 4P74A 5HANA 2XMTA 2DNKA 3N5FA 1CJUB 1U1LA 3BR9A 3FSIA 2WBRA 2ASJA 3QT7A 3PW5A 3LAMA 1VQ5S 1QAYA 2HFVA 4QQBA 3CF5Q 4DPYA 2QL7B 3MF5A 4B3TJ 3V5RA 2YKAA 2MYFA 3Q8RB 1NHUA 3MEEB 2GVDB 1C1BA 1XN9A 1AZSB 2Z2LA 3DMJB 3DOLA 2MMYA 2DHSA 3ICLA 2Z0GA 3VV2B 3K8WA 2ZM6J 2GJFA 2V6AA 3NBPB 2RUSA 3BO2A 3V4IA 3DOKB 2MKSA 5CZVA 3FVYA 3V6HA 2X7IA 3OUYB 4UT4A 3GJSB 3JSRA 4YMEA 2H3EB 2B9XA 4ECWA 2YNHA 4TN2A 1BQMA 4V19X 2QSWA 5ETQA 3G6YA 2C2ZB 3T1YJ 2VONA 2WVDA 3FFIB 3CCSS 4IR9A 4DUZF 1NHVA 2BE7D 3S1TA 1S1TB 4WKYA 2CJXB 4J9NA 2LCWA 1S1WA 4AUKA 2FPHX 4YY3F 5LXYA 5A8RB 4IRCA 5D0HA 2VG7B 2V50A 4ZPDA 2VHGA 1RAAB 1UTAA 2BANA 3PCOB 2FY8A 1FRMA 1HHSA 1Q78A 2HNZA 3QGGA 3GB0A 3M1VB 4QIEA 4O3NA 3RW7A 4K5SA 2CXEA 3O2IA 2J8AA 5IFMA 5AXNA 2YWKA 2BABA 4O3PA 4OI3A 2PDAA 3N5BA 4ZITA 2CIMA 4IDKA 1N56A 1MROA 1HYSB 3T9NA 2ZBIA 3B4DA 1KFDA 5A8KA 1ZPVA 2KT2A 3MCNA 2WW8A 3O44A 3TVKA 3LP0B 3CXCR 2FJEB 2MZSA 5GAGI 4F4XA 4OYZA 4JI1F 4FXDA 3TA0A 1REGX 3DNCA 2H5EA 4O3OA 4LFAJ 2ZH2A 3D3BJ 4X66F 3PX0A 1G3OA 1OPZA 3VQTA 2MZJA 4WYWA 4IG0A 2N82B 5E3QA 2RVJA 2AMCB 2KTQA 2ZE2B 1ZH5A 4FBUA 3T3FA 4EO6A 5I42A 3HXMA 2NXNA 4FF3A 4OL8A 2XSJB 3CD7A 2LYVA 4R8UA 4WE1A 3PACA 5LL6d 2ZHOA 5K8MA 2G1DA 1RP5A 3MUMP 4XK8C 2BXJA 5D4PA 4QR1A 4RW4B 5IC4B 1BWVA 4M5HA 3TX8A 2QGFB 3NOCA 2J9EA 4WZMA 3NEKA 1L3TA 1VQSA 4LMZA 4X65F 1N6QA 3WC0A 3VGVA 2CQ0A 1NH7A 3X3UA 5HJXA 2GMLA 4FPRA 4UOGA 2WSFC 3W7BA 2WONB 3IRXA 3JTPA 3DKDA 4ED2A 1KLMB 1OWXA 3JQMA 5CCMA 4DSEA 3P49B 3AXMA 2VFVA 2I8EA 1UEKA 3CPWR 1RZMA 1WUUA 3BV8A 1NU4A 3SXLA 4QZVB 4U9RA 3OVSA 2BW7A 1H0HB 3MMCA 4ZVFA 3MXHP 3UD3P 4I0WA 1B99A 2MQLA 4AQYJ 2HBRB 5IV4A 3UN3A 4DI6A 1DHMA 1TKDA 4QR0A 3E51A 1IBKF 4XDDA 1JXEA 3M8PA 1N5YA 4ZLPA 1TELA 1ZOTA 2ROGA 2G2YA 3LALA 1U2CA 3G8TA 1RUSA 4IG3A 3UD4P 3CDEA 1JNZB 4RW6B 2ZJQQ 2KVQE 3C6TA 2FVSA 3R2CJ 3QBCA 1HHTP 3FC9A 2ADBA 2IHR1 1P6TA 1T9XA 2CPDA 2WB1D 4F3QA 4DPXA 4B3TF 5B09A 5KFWA 4ZVTB 4L72B 3IWXA 3RBXA 3DDNA 4ZJQA 5H9EJ 1HNVB 4DU7A 5JVGQ 1Y5LB 3ZC4A 3M8QB 4OI4A 5KFAA 5K8NA 3RAMA 4K8RA 3LGHA 4PEOA 2ASDA 2ZM6F 1XERA 3KYLA 2CRLA 3EJMA 2P8IA 3BGOP 2C42A 3MEKA 4DSJA 4QW8A 4QR2A 2BACA 3HF5A 2HNYB 1IBMJ 2OD4A 1JJCB 4C7QA 1TFYA 4F2SA 1FNOA 1EQMA 4DR6J 4IR1A 2X3GA 5B0BA 3RJMB 1VK8A 3MAAB 5GAEU 4USKA 4ZP7A 1VBYA 1IBLJ 4E2FB 3OW2R 2CNKB 2DHGA 1EARA 2VV5A 4ED1A 5DM7Q 4YR0A 1Z2LA 3BYPA 1RABB 3UNGC 3GLJA 3KXDA 2KZMA 1KQGB 2F1FA 1RT7B 5B0CA 3K59A 3I9ZA 4EK2A 4R0JA 5HK4A 3KJFB 3EZOA 1I94F 1RTHB 4ZK7M 3LWMA 4LIWA 4EGLA 2H1YA 3TRGA 3Q8PB 4OHXA 4P6QA 2A0FB 3D66A 4K4ZA 1GXTA 3PX6A 4CCHA 4NCGB 2VKRA 4CO5A 4K4TA 2YPYA 5KFDA 4GC6A 1S9GB 1SUQA 3ENWA 3NOGA 2CZ4A 3HZEA 2P6TA 2GO8A 1RTIA 4F3OA 1C0TB 5B08A 2XS7A 1X4AA 1AFIA 4RNMA 1VRTB 1DTTB 3VGTA 2DGTA 2DRAA 1RLCL 3HHLC 5KFLA 4AL7A 4ECVA 4ZVHA 3DRXA 4LFAF 4ZVQB 2OTLS 3H2VE 3ZO7A 3B78A 4CM0A 3ZZOA 2DTJA 4BLGA 4QPXA 2NXJA 3FBFA 4C3MA 3M2UA 4YS2A 3UNYA 1KC8T 4JBCA 4M5GA 1XMQJ 3DGPA 4TQSA 5C7PA 3OHBA 1REVB 4KFBB 3FCHA 4OZ2A 1WC5A 4O3SA 1FJGJ 1JMTA 5H1SV 3DOMA 4ZVRB 2Q3PA 1ZZFA 3DHXA 5J2MA 1FRJA 3I5AA 2FJWA 1S0NA 2VU5A 1DRZA 3TEGA 1DURA 3BDEA 1PG5B 3CD6S 4YHHJ 2YX1A 1SXLA 5M2UA 2WVFA 1EETA 1FDBA 4NASA 1FKAF 2W9BA 3VAFA 5J2QB 4ZN3A 3GYNA 3CJ0A 1FD2A 3THTA 2C1EB 4GO7X 1UKUA 2V69A 4PR6A 1N0VC 1WWHA 4ECUA 3JAMU 3IO1A 4CO3A 1KP6A 1PKUA 1V9OA 4HYKA 2VODA 2XMVA 5HL7Q 2C3YA 2Y0SD 1KQFB 2R8KA 1RBOB 3UI3A 1FRLA 5ETTA 4AQYF 3TX0A 1RT2B 2LECA 2Z58B 1GEHA 2B56A 3MMBA 3K58A 4GVBA 1QLNA 1X0FA 3EGZA 4IOAQ 4YR3A 3ILLA 1XC9A 1TL1A 5T7LB 1FT8A 1GMWD 4ID5A 3D5MA 2R8GA 5D8HB 3TQ1A 4DS5A 3IWLA 3CMES 4JYAJ 1UEVA 1D9AA 2HMIB 4O4GA 5D0EA 2FIUA 3HZGA 1UPPA 3X1LB 1KKHA 5KFVA 1YRTA 3I0SA 4Y2IA 2DR8A 2HVEA 2ZZNA 4A47A 1UJ5A 4F4WA 2AGPA 5CZXA 1ZM3A 1SH3A 4LVOP 1DAXA 2GHVC 4QIWD 3PEHA 1T9VA 3MURP 4DV0J 1T8EA 4UQGA 4ECTA 3JAMY 5GVQA 4Z7CA 1RWPB 3DYAB 2QLJB 2DHAA 2IDEA 3J81U 4DFJA 4FF2A 2B3TB 2Z57B 2GA7A 2BBEA 2FHOB 2PMWA 1FERA 3BBCA 4YB1P 1Y9OA 4K2JA 2CYYA 1ZTWA 4YB6A 5CA5A 1OQ6A 2R2TA 3CIMA 4DR6F 3DU5A 2RIJA 1X4CA 1SJ4P 2CAJA 4MKAA 3HSJA 3MR5A 3AD9C 1IBLF 2ZH7A 1LW2A 1Q8LA 1ZBTA 2F8HA 1UVIA 2CQIA 1FKOA 1YJ9S 1SJRA 4RBVA 3FGVA 1UEUA 2QEXS 2DXDA 2UUWA 3VTIA 3MDFA 3GFZA 1H73A 4HDGA 5G0RA 3HMJG 3GONA 3D6TB 1RAOA 2DNLA 2HVZA 1HA1A 1IM4A 1KVJA 4USHA 2YPZA 2LQ8A 3I9V9 5E33A 2AYGA 1V3SA 2F63A 1TKXA 4JI2F 5A6WA 1FXDA 4IH5A 3H5UA 4NA1A 1RBAA 3MD3A 4QWDA 3R5AA 4LSNA 2CQGA 2X1GA 1VQ7S 2UUAF 4TYBA 2E9TA 4FXVA 2L3MA 2DK2A 1FVQA 1U09A 2WSCC 4DR2J 1ULRA 3KG0A 2MKKA 3GFHA 8AT1B 2E29A 3IMQJ 1GXUA 3BN4A 4LF4J 5DG9A 2RKIB 1C0UA 3H59A 1T0TV 2ALYB 4KGZB 4P73A 4QBUA 1QSLA 2KO1A 2GVZA 1DLOA 2Z8QA 1APSA 4EYIB 4U7UK 1RDRA 2PA8D 1XMQF 3PRDA 4FNHA 3F73A 2KXFA 2D3O1 4KPYA 1BMQB 3PW2A 2DH7A 4ITSA 2GNKA 1I6JA 4HHHA 2ZH1A 2UV8G 1S57A 4P9SA 3GSIA 2CPIA 1HBUA 2L41A 3V6KA 4NI2B 5BYSA 2B51A 4AD6A 4LSLB 3K0JA 2ROPA 2YNFA 1PC5A 2QIFA 2VBYA 1NJXA 2V8VA 3T6BA 1S1XA 3RTVA 1Q86T 1G7CB 3TQEA 4HLBA 2M0GB 1TP7A 4YHHF 4QWCA 1Z2ZA 1X7VA 2HFNA 3ENAA 2W24A 4CYUA 1T9UA 3TUJC 2WBMA 5IOLA 4ZJOA 5CYQA 4ZJLA 4NZ6A 2V5HG 3SYZA 4CH1A 4YN3B 3DDKA 3V6DA 4LJMA 3R9LA 1VQMS 4Y28C 1H7WA 3A1YG 3RU0A 3ZZPA 2OPQB 3RB3A 5DQHA 4H4OA 2YWGA 4DL3A 3JSMB 1VIXA 2W01A 3KWMA 4W98A 2DGXA 4DZDA 5KFJA 2NR0A 2BQRA 3HI9A 1O0PA 5A0YB 5E3AA 1RT6B 3GIJA 2UU9J 2W1BA 1GXLA 3KK1A 4LRDA 1DY3A 1T7PA 4ZS6A 4AL6A 3G9CA 2CPFA 4I56A 4C6AA 4G1QB 1T03B 1FEHA 1Q1KA 3D1QA 4PAAA 4JYAF 4XPEA 4OHWA 1N52B 2M52A 4RNNA 3J7Z5 5KFMA 1WJ9A 2LQ5A 3DGVA 1B0PA 4MIWA 4EZ6A 4TVAB 2K06A 2UXBJ 4Q5VA 4DX8H 3E01A 4PG6A 4A8SA 1HQUB 1UVJA 1X4HA 2NZ4A 1SL0A 4JI6J 1J2VA 1HWLA 1UFLA 4JI5J 2MEWA 2H65B 4QYZK 4CIOA 5IC6B 3CC2S 5D4LA 2Y9HA 2GCFA 2RB7A 1H2TZ 3OV7A 2XY7A 3E2EA 2G9OA 3RR7A 3UFCX 3MI7X 2Z4PA 3D67A 1SPBP 1JWWA 5AT1B 2D3UA 3ZTPA 3QRPA 2BE2B 3R5CA 4ZLNA 3DRSA 3AY0A 3MUTP 2AF6A 4XTTA 2H5JB 4X4NA 3SQGA 1RTZA 3UWTA 5D6GA 2HSEB 2P9GA 5HP1B 2VBZA 3H98A 3NGUA 3MMAB 3JXOA 2VC0A 3MM6B 3EYZA 3M32A 1YVFA 2D7SA 4ED8A 4RLEA 2HIQA 3BGLA 5EWGA 3T19A 4KC5A 2KU7A 2XMAA 1P9QC 2Q1LA 4ECXA 2W2NP 1J27A 1N5TA 3SFUA 2VPZB 2K3KA 1WG5A 2WRMA 4C97A 2PEHA 2QMUB 2CPJA 3GJRB 1CQNA 2NSCA 3K89A 3OTEA 1AUSL 1W7WA 3BDPA 9RUBA 3DLBA 2UUCJ 3TA2A 5KFUA 3GFYA 2AJ4A 3CJ2A 1TV6B 5L39A 2RILA 1RWMB 3IG1A 2PO4A 2XC9A 3AD7C 1MNEA 3CCUS 3HSZA 3IXQA 4M5KA 5ETLA 3KK3A 5KOWA 5CABA 1RT4B 1TMJA 3C66A 4WIIA 1F60B 2OSQA 3NGRA 4NLVA 2AEMA 4NA2A 3BQ0A 3Q23A 2VPXB 4DUYJ 3VAMA 3N6NA 3GMGA 1FXLA 1LKZA 4FYVB 4DHVA 4OHYA 3TARA 5KFSA 2WTFA 3GR1A 2KDOA 4PYDA 5C42A 4J37A 3IC1A 2PN6A 1RT3B 1TKZA 4J9KA 4PUOB 3M7VA 3LH2S 4ZVOB 1T05B 3BBFA 4LREA 4RBTA 1FO1A 3CCTA 4MTPA 2J0QD 1WD6A 1R8PA 1RT1A 2D9PA 4B02A 3FBBA 1KHWA 1FRKA 4F3MA 2KM8B 1JKHA 2H4WB 3RBZA 1BE4A 3PHTA 2CADA 2QJ3A 1JLGB 2DGQA 2XG8A 2FVPA 1JK9B 4RL1A 1HR0J 1HMVA 1QUVA 4RW9A 3FCVA 3GTYX 5JVHQ 2ZZTA 5AXMA 5A6PA 3GP9A 3LQVA 2YKOA 2MQ8A 4ENOA 1D9FA 4DSKA 5KG6A 3NMAA 3MCMA 5ETNA 2RAQA 5CYMA 3HT0A 4ILRA 2AU0A 1VMBA 2GQQA 4WF9Q 1HNIB 2BOAA 3GSDA 1GFWB 4NZ7A 4H4KC 1YKWA 2HHVA 3CCQS 1C1CB 1P1LA 3FZBA 4CZCA 1VC6A 4F4KA 3TJAA 2LA6A 1XBWA 2OPRB 7AT1B 1K0TA 1M5PC 2LDIA 1FNXH 2WOMB 2HPUA 2KRBA 2QMXA 2JVRA 3US5A 1FE0A 2E5LF 2JEFA 4OIXA 3MHYA 2DH8A 3DLKA 3M05A 1EQ0A 3G6XA 3KLEB 2PE8A 3CJ8A 3KLGA 2U2FA 2YH0A 2Y1JA 3CO9A 8ATCB 1NM2A 1I1GA 5DGBA 2UXBF 3ETOA 5LT5A 1S48A 4DQQA 1RYSA 4DV2J 2GGPB 4LF8J 1QM9A 4NLYA 5SZTA 5HSPA 3IA0A 2KHDA 4M5JA 4FS1A 2PGCA 4HI2A 4P7VA 2QL5B 4PG8A 2UUTA 1FK9B 2EFGA 5KFYA 3KJVB 4CO2A 2CQDA 2YKMA 4CI0B 3HD2A 1Q95G 5LM7E 4O3QA 2BUNA 3UO0A 1FJ7A 4OZ0A 2G4BA 2IFXA 2OEMA 3WBZA 1S77D 2E5GA 3QIPB 3PR4A 1WKJA 4PPZA 4WU2A 2RU3A 2XMJA 1UWAA 3OVBA 1SBRA 2KH9A 3AJ2A 4L6V3 1KBRA 2IYIA 2GO9A 2BKPA 1N0UA 2O1PA 1R0AA 4CWBA 1XNRF 3DI6B 1VQOS 4XIUA 2JEIA 1UETA 4RW8A 3JSYA 1VLYA 3OFEA 1JXVA 1IKYA 2XGQA 1EP4A 4DG1A 2MKJA 3BSCA 3KG4A 5DLGA 2RF2B 1CC8A 3EGVA 3VHQA 1S6PB 1TL3B 3M4XA 1SKUB 2DBBA 2UUCF 3D0IE 2LA4A 2FLPA 2ZJPQ 2ZH8A 1PYTA 2XO7A 3PHEA 4X4VA 3Q8QB 3EZ5A 1PBAA 2VKZG 3J7YU 1X60A 2V2KA 3UDCA 3IGNA 4CNYA 3Q24A 5KFTA 4NLQA 2YBVA 1TTHB 1S9FA 4DN9A 4J9UE 5GAHI 2B7CB 4DUYF 2CFXA 1LWEB 2BQUA 4MJKA 1JNRB 1P1TA 1UCNA 5ETMA 4YB5A 4W90B 3C6UB 4ZPVR 4C8MA 4JI8J 4O44A 4PG4A 2AV5A 3HFZB 3ETMA 4HH0A 4K4YA 1YLXA 1H74A 2EC0A 2VG5A 3DLGB 1VDHA 4DDFA 2UXCJ 4CLPA 4JP8A 3W9JA 1QJHA 1Q82T 2J7KA 3CNQP 3EGWB 2OPSB 2VBWA 2RDDA 1T11A 3PX4A 3PW7A 1O6XA 3I0RB 3QZ7A 2A2DA 3DRPA 2DISA 4DSFA 4J9PA 4RUHA 1TVRB 3LPEA 5K8OA 4K4XA 5EN1A 2IA6A 3MTKA 4B3MJ 5EX0A 1RJJA 4NYZA 3S7RA 5DQIA 1R8BA 4Y34A 3MPWA 2ERRA 3UDEA 2V8GA 3M2RA 1J5EJ 6AT1B 2FB0A 1RAJA 2JC1A 4I1TA 1XWLA 3AODA 4I6WA 1Y5IB 1GAOA 3KMQA 1UMJA 4BC9A 2B43A 1T3NA 1HNXF 2R7TA 4BCAA 2ASYA 2EKYA 3L3CA 4P2MA 2UVUA 3MM8B 2K2PA 4I67A 3MWBA 4O4RA 2QFIA 3OL6A 1F3VA 5ETVA 1FVSA 2B0GA 2HLUA 3AOBA 4H54A 2K3IA 1NHKL 3T1HJ 3CDBA 1HW9A 4K5RA 3CC4S 1NDCA 3TVYA 2EPIA 1RT5B 3CCLS 1L3VA 1Q81T 3FSYA 1WC1A 3QGIA 5U47A 3OQ2A 1HQEB 3CULA 5B0GA 1TL5A 4KIAA 1SC4B 4FVCA 1ZA1B 4MKVA 4ZPAA 2OPPB 4LF5F 1S1VA 4RX6A 5LSOA 3SEOA 3I4HX 4DV2F 4LF8F 3MM9B 2DNRA 4KGVB 1LWFB 2C3MA 1S99A 1Y0HA 1KONA 2YX7A 3TO8A 1N5VA 1CPZA 2YNIA 5ETSA 2AIRB 2E5HA 4HHJA 4QWAA 3VAGA 5GADU 2BOPA 4OI2A 4ED6A 3GE9A 2KT3A 3AQOA 2LQJA 2M8DB 1VHIA 2HS4A 1VHFA 4DN0A 2IPOB 1LWCB 3UVJA 1YJ7A 3NRBA 1VC5A 4KV8B 4DPUA 1BUXA 2IJRA 5J2NB 3R1LA 1JXLA 4PXEA 2MGZA 3UQSA 2E9ZA 3J81j 3GV5B 1RTJA 2BJ3A 2UVVA 2KN4A 2BM0A 4AFFA 3G6VA 2VA3A 2FJDB 4Q7AA 3N28A 2KKHA 5B0EA 5A8WB 1X9MA 5DZ6A 3MUVP 1RXOB 3WQPA 3ISZA 4UY8T 2V4JB 2OMOA 2EBGA 3CW2C 4C48A 1X4EA 4MFBA 4QJVA 5DDRC 1FKPB 2DGOA 3HM9A 3MPVA 3QJLA 1QE1B 1E6YB 3QRQA 1NJIT 4RWWA 5L1JA 1SUQB 1UWBB 4P2XA 1GNKA 2KM8C 4LQ9A 3C16A 1S6QA 1MMDA 1FJCA 2KVIA 4U67Q 3NGDA 3IWNC 3N01A 3QIDA 1R3NA 4DQRA 4OX9F 3AXKA 4P72A 4MMOA 2W2OP 3HVWA 3KLVA 3MPDA 4GC7A 1EX8A 2OFGX 1O8BA 2CVEA 1OPIA 1TK8A 1SQGA 2JNJA 2BJEA 3JS9A 4KR0B 2GAHC 1X9SA 4JI8F 2HQFA 1K47A 4D3HA 2F9DA 1JLQA 2HVHA 4L75A 4N8OA 1GTEA 4MKYA 5E3PA 2B9EA 3GJTB 2OKQA 2HQ3A 2UXCF 1K1SA 4C11A 3CCRS 4BWMA 3NS5A 2XHCA 1VJQA 2R7SA 3UDLA 2I9SA 3MEGA 2GV1A 1DBDA 4U95A 1KVIA 3N6MA 2BRLA 3TNVA 3RB6A 1N88A 3SSQA 2C3PA 3SFGA 2BRKA 3PO5A 4B3MF 3OL7A 4MYUA 1TKTA 3NCRA 4M5IA 4TQRA 2ZD1A 3ILJA 1S1UA 4AT1B 1LQ9A 1HFEL 1TL4A 3N79A 2FVQA 5DO2A 2CG8A 3JB9k 2M5YA 2MQNA 1NDLA 5C2GA 3FBCA 4FNIA 3CCJS 3WIVA 2GIFA 2Y1IA 4OZNA 3W2VB 1HIYA 2VOOA 3W61A 2OGUA 5HAOA 2LU2A 5E7OB 1YITS 1HNWF 4ICLA 1DTQB 3MM7A 2NPFA 2AJ2A 3HVAA 4NWBA 2VFRA 1SC6A 3T1HF 4A8WA 4R5PB 1U2RA 2R7WA 1K73T 4LF9F 4ZIVA 3OVAA 3OLBA 4WTYA 2H5IB 2ZH3A 1R7IA 2VIHA 2LLZA 2EFVA 4I2QA 1FDDA 3FQKA 3BN7A 4F36A 4V19J 5KG3A 5K14A 3QYYA 4Q8EA 2JFDA 1WF0A 1V5IB 5HROA 3PYFA 4ECQA 2IVFB 5KT2A 2E1RA 2VH7A 2ZWPA 5IT0A 4TYAA 1M5OC 5ETRA 1Q16B 1JLAA 3HHLA 3K5OA 5D4NA 4Q2LA 1H98A 1KQSR 5KG2A 1SKSA 2HQGA 2B7BB 5FDLA 5HVFA 3ZZYA 2XLJA 4RW7A 3A3NB 3C2PA 5EUHA 3ZTQA 3UN5A 1CJTB 2F7VA 3D9BA 1ZM2A 2NUHA 1LW0A 4LRFA 1MSWD 3G8QA 3IS9A 2CJYB 5CD4A 1RACB 1AUDA 3CD0A 1CULA 2F8MA 2X1AA 3H90A 2CJKA 3MR6A 1ITPA 2R7VA 1C4CA 1JLBB 1FEEA 3VALA 3D7SB 1H7XA 1GT8A 3BGRA 1R6VA 2HEKA 3H4BA 2QA4S 5KFKA 2E7VA 2DCLA 1RTDB 4K50A 4ZLJA 3AH6A 4QYZJ 4IO9Q 4K4VA 3KK2A 3LP1B 5M2RA 4TNOA 1LOUA 2HGMA 2VA2A 2JJ4D 3BPSP 3D3CJ 4HTIA 1G4CA 1UFKA 1CJKA 3RBEA 3BS9A 1MU2B 3JQKA 3PW0A 2HKEA 4PQUB 4I2PB 4B9VA 1S79A 1CJUA 3ZZRA 2IC3B 4ZHRB 1HL6A 1NMEB 1RHMB 3QJPA 2HAIA 2R7QA 4DXLA 1VI7A 1C4AA 5I3QA 4C3LA 1IKVB 2OP5A 3CJ3A 1UW4A 2XMUA 3DXSX 3B8HA 1U1PA 1CS4B 2RH3A 3HKWA 2ACMA 4XAKA 1IWGA 2G1HA 2GVDA 5G0RB 3OL8A 4J9VA 1AZSA 3KLFB 1EHWA 3DMJA 2ZDOA 1H72C 3Q8VA 3A8IA 3BREA 3SBMA 4Q43A 2VB6A 3NBPA 3DOKA 2R8JA 4FPIA 3L7OA 3MECB 1RCXB 2RUGA 2FHJD 3OUYA 2AEJA 1K8AT 4A8MP 1PO6A 1WI8A 3W65A 3GQCA 1F3FA 4DR5F 3G4SS 2CNLB 2WCXA 3FFIA 4OLOA 2O66A 3FZ2A 2KZZA 1HI1A 2DR7A 1S1TA 2R8HA 2C2DA 4ANDA 1JJHA 4IKAA 4C8NA 3AD8C 2A18A 1DQ9A 5A8RA 2VG7A 4LT6A 3NNHA 4X4PA 2DY1A 4J90A 4WFNQ 4UF4A 4WP3A 1NBEB 1YRXA 3M1VA 4ILLA 4ES3A 3MCSA 4MK8A 3R97A 2J0WA 3A8KA 2YNGB 2FZCB 4EZ9A 3FMWA 2VJUA 1CEZA 3W9IA 2Z2MA 3CJRA 4QIGA 3NWRA 1PAEX 1HYSA 2C2RA 2KFNA 5LSLA 2AP6A 3QATA 1NKEA 3H20A 3QWUA 1M5VC 1XNQF 3LP0A 4LF2A 2MHNA 1TR0A 1TMMA 2QFJA 4BHQA 1K9MT 4ZP9A 5F8JA 3H40A 5GMDA 3RR8A 2HBYB 3M9NB 3RRGA 2OUGA 3TOQA 2KFZA 1U6BA 1RWWB 1VQYA 1XR5A 1RHUB 4CH0S 2ZE2A 3DFEA 1Q5YA 4CNZA 3IM9A 1JLEB 4DV3F 1NEEA 3C15B 1N54B 2XSJA 4ECZA 3D6FB 3TWZA 1Q8KA 2B6AB 2AT1B 2BVZA 4DLGA 4OJ1A 1VS3A 2CJAA 4H4MB 3KFWX 4DX7A 4JI7J 3MAHA 4RW4A 2EBEA 2IRUA 4BC7A 2NQPA 2MDAA 2YWEA 3HVTB 4OZLA 1WHXA 3TVZA 1N48A 2N3OA 4G6VB 5F8GA 4DPOA 2EG2A 4HACB 1CJVB 2F65A 1WHVA 2WONA 3SMZA 2VDHA 3M9MB 4NYOA 4UUXA 3PFOA 1RU1A 2ZITA 2XZWA 3PY8A 3ZZTA 2N7YA 1KD1T 4K4UA 4Z7YA 4P2FA 1HHQA 3M8SA 4J9RA 3B6BA 3P3DA 2EG1A 5F8LA 3EPIA 2OJ3A 3W60A 4FYXB 2IMWP 2NUUG 1NK9A 3ZZ0A 2DNGA 3IBWA 1VRUB 2FJAB 3SCJE 4Y0FA 3PKMA 3DDIA 1SL2A 3NCQA 1TU0B 2ZHAA 2JVOA 3HHEA 3OXFA 3Q2SC 1IQZA 2YKPA 1QTMA 2E1PA 1AXQA 3W2WB 3GWCA 4EUVA 4NCAA 2KHCA 2LVWA 4RW6A 5KFPA 1IM6A 2JEGA 3CO0P 4PXCA 2GHPA 2PFDA 3G96A 3AOCA 3BO3A 3MM5B 1KTVA 3I32A 4WZQA 1JB0C 2GMJA 5J1PA 5EWFA 5KFFA 2RNEA 1CQMA 2MQPA 4Y00A 1XMOF 2B8QA 4YDXA 4C0OC 1UZHA 2HRTA 1FF2A 4ZPWR 3C14B 2L08A 3M6UA 1HNVA 2P9EA 4ANCA 2QA2A 3M8QA 1F6TA 1AYEA 5ETOA 4WP9A 1XR7A 3V81B 2Y0BB 3EDQB 1BD6A 1FFWB 1RAEB 1RHKB 3W5XA 4UQTA 4E8UA 4RU9A 3HPOA 4URQU 2HNYA 1YJNS 2H48B 2G2ZA 1HPZB 2XS5A 4V1Ak 1PBUA 2HW3A 4M95A 3MAAA 1EKRA 2RDIA 3W64A 4JI4F 1N34J 1NJZA 2V2ZA 3KLHB 4FYWB 4Q0BA 4CO0A 2V4RA 2AJ0A 4KY3A 4K4SA 3FKBA 4RUBA 4CLTA 5F8NA 1RT7A 1VK3A 2D74B 2HHPA 3M30B 2W2MP 3FDSA 5AE2A 3ADAC 3EPGA 5I3UB 5HN0A 1HBMB 1RTHA 3POTB 2WVCA 5KG1A 4TKTA 3R5BA 3BKFA 4NLWA 4KHPF 2K1RB 4CO1A 2EFPA 4C8ZA 4NEYA 2KYZA 4YQWA 4NCGA 5IWAJ 5D0GA 3MPYA 1S9GA 1FX4A 1UVLA 1SKWA 1YJTA 2HQDA 4UZCA 1XEZA 3SDEB 1HW8A 1C0TA 4B9UA 1WACA 3UDVA 3TEHB 1GH8A 4OJHA 4WPAA 1I94J 4EU0A 5K5MA 1VRTA 2ZVIA 1Q7LB 4F4YA 3OJUA 3GIIA 1YHQS 5FLXU 1JX4A 1HMVB 4DCPB 1QAIA 2UUBJ 1R6YA 3KOAA 4KJIA 5HBMB 1DQAA 4HDHA 2NXUA 2CWXA 4I68A 2AKWB 1SJFA 2CPHA 3C3LA 5IZHA 4M5DB 5KFGA 3UCZP 4IO1A 3B4MA 3QWPA 2B4UA 3LP2B 3ZFVA 4XDCA 3KUGA 3JSBA 4K59A 1REVA 1YBTA 2P5VA 4KFBA 1IKXB 3DXBA 5SUHA 1JLFB 3ITHB 1O51A 2IAJB 3Q83A 1VQKS 1U2FA 2DHHA 2PD1A 2RQMA 2Y1RI 7FD1A 3VGUA 2VICA 1YK9A 4WFXA 3HT3A 1VBXA 2DEIA 4JI7F 3Q22A 4NOHA 2CJQA 3L7UA 1HI8A 2YKNB 4RPFA 4L74A 5F9LA 4J9OA 1WOOA 3GIRA 4B3SF 5B0AA 2W7PA 4DV4J 3ILOA 2K7KA 2WAQD 1RWOB 2V2QA 3AA8A 3QRRA 5J2QA 5BYRA 2JRSA 3PXGa 2AD9A 3R3TA 1LK5A 5E3RA 3WIUA 5CXTA 3Q0AA 5HMYA 3ENQA 5D0RA 1VR6A 3NGSA 4LFBJ 2FHMA 4A46A 4GRSA 2ZBQA 2MQQA 1VLOA 4KPCA 3IM8A 2A2CA 2JHEA 1NJWA 4NLGA 3D0HE 3MOZA 2M7SA 4I6AA 1H3DA 3I31A 5B0DA 2ZKUA 1VGYA 2GJ2A 1RT2A 1MN9A 1GMWA 3VVUA 1OYEA 2JEJA 3KHGA 4ZVUB 1F1BB 5LJ3Y 2V9WA 1F9EB 1RAIB 2B5JB 5T7LA 5D3GB 4I7FB 3QMQA 2ZOFA 4C2MA 3PZPA 2J6TA 3NP5A 4I69A 4ZPTR 2W8LA 4DV1F 1X4FA 1H38A 5DGAA 4R0EA 2ZEJA 2V9KA 4F0HA 2HMIA 3CWJA 2OFHX 4AYBD 4DU8A 1WOSA 2FC8A 5L1LA 4KHMA 1AW0A 2EFOA 2YXLA 4L3KA 1HARA 1F2GA 4TLQA 5DG8A 1HBOB 4CLFA 4TY8B 2R2RA 2CQ4A 4RU2A 3THPA 4Z2XA 4ED3A 3KTQA 4H4KA 5LSRA 1V6HA 8RUCA 3DYAA 2Q6BA 1OMSA 3KHLA 2Y8YA 3L7PA 3D0GE 3AJDA 3A13A 4K7QA 1HD0A 1KFSA 4NL5A 3MEDA 1DZ5A 3U1LA 2BJ9A 2BJ1A 2KXHA 4ELTA 3OTBA 2M88A 1XTZA 5G4DA 1N34F 2CWKA 2ZUAA 4TLRA 1WHYA 2LEAA 3R6LB 4QU6A 5F9NA 1P8GA 3O6QA 2MXYA 5HMXA 4O44B 1NZ8A 4A8QA 2VDIA 4JI3F 5E3CA 5CD4H 5GAEI 1LFWA 5KFZA 1U6FA 5KG0A 3RW6A 2D3OR 3BZQA 2MZRA 2XYGB 1RAFB 3IN5A 2W9CB 2GW8A 1LWXA 1S10A 5IWAF 3QLHB 4PRFA 2JDJA 3TP2A 4R25A 3L9ZA 3OL9A 5KFXA 2KI2A 2AZ3A 5H9FJ 2N4CA 5IQQA 1FESA 2CZVC 2J9CA 4IOCQ 5D78A 4ETZA 2QYCA 1HD1A 1R43A 4FXWA 1Q4RA 5KT5A 3D6MB 3BM7A 2DNZA 4EYHB 2OI2A 2UUBF 4NMLA 2LU1A 1HI0P 4OZJA 1Q8BA 4JI2J 2RKIA 2Q43A 2OAUA 1CC7A 4DV5F 3AT1B 3O5TB 3PR5B 1BLUA 1HKAA 3IAM9 2VFUA 1X4GA 4PZVA 3H2LA 2UUAJ 3K2YA 4CO4A 4K4WA 2C28A 4ED7A 2EC2A 4B08A 2AHOB 4LSLA 2HQCA 1NSPA 5I4MA 4LBPA 3PJWA 3H2UB 4IFYB 4N8NA 4IH7A 4EMDA 2WVEA 4LSZB 3OR2B 2FUG9 2F8EX 1UPMB 4CTAB 4DV4F 2KG0A 3RYLA 2OLWA 4DLEA 2X1FA 3MD1A 4X4TA 3I96A 4TXSA 1F9FA 1UZDA 3SV4A 1JJ2R 2FYXA 3WHIA 3BBBA 3DRRB 5C25B 1DJ0A 3GZ7A 3NGTA 2IRYA 4CDIA 1D8ZA 1VQ6S 4LFBF 3QPIA 4DR7F 4OYWA 3WX4A 2OPQA 2KB2A 1Y4ZB 3CJKB 2O5DA 4KH1B 1MN7A 1U4BA 3IGVA 1RWNB 3JSMA 4N7TA 4WKRA 4IOBA 3DLEB 1OSDA 2RT3A 3LPYA 2PSZA 3CCES 4P10A 2V8PA 3OTDA 4L73A 1TAUA 3M6XA 1RT6A 1U0HB 5CCLA 2I1RA 7FDRA 4B9NA 3VZHA 3D4JA 2JWNA 3G82B 3H25A 1X0PA 2IRXA 2P6SA 5KT4A 2E7WA 4G1QA 3D54A 4DSLA 3GV8B 1SV5B 2HLTA 2AX1A 1IR2A 4EI2A 2W7OA 3CJTA 2ZH6A 2HYIB 4ECRA 1R31A 2IM2A 4DFPA 5ITHA 2CDRB 4LIRA 2XHWA 5DLFA 3NXZA 2UV8A 4I4BA 2BMBA 3NY0A 5D77A 4G65A 4LBHA 3TZZA 1WF1A 3CGIA 1FDNA 3S8SA 3BSNA 4OHZA 2HZAA 5A2QU 3FEZA 1E6VB 3HP6A 4WFAQ 1FA0A 1F5AA 1B0VA 1OIAA 1FWKA 4RJVA 3SZ2A 3ENVA 1B7YB 3CJQA 2HNDB 1OQ3A 1PYOB 5JMNA 2N4DA 1GMVA 1WEYA 2R2UA 3TYTA 4UZBA 3EUNA 1UVMA 2BE2A 5K9FA 3NKYA 4ZVPB 4OX7A 5L9NA 2GQCA 1FE4A 5HJYA 3K17A 3CD5A 4X84A 4DL4A 4RUCA 1RKIA 3MR3A 2ZC4A 2L9DA 4X62J 1SCJB 4DL2A 5HP1A 3MMAA 2FZGB 2OH2A 2KT5A 1JJ4A 1X5SA 4JV2A 4IUFA 3MM6A 4YR2A 5FJ4A 1YIJS 1RAHB 2M3DA 2P9CA 1Y11A 4ETXA 3QAEA 1QAXA 3EICA 2EK6A 1HBNB 1TL7B 2VG6B 3EVWA 2ZH4A 3QO9B 3ONQA 1NPRA 3H0PA 2F40A 4KT0C 1WC6A 3TZXA 1X9WA 4LF1A 4PG5A 2DGVA 1Q53A 5D4OA 3K5NA 5HMZA 3M6WA 3WZ0A 3U1MA 1VQ4S 3JYTB 1TV6A 1J5OB 2WB4A 3VAKA 5KTQA 5CQGA 2HIYA 1S76D 1WSVA 4WBFA 5LOQA 2OHDA 1RT4A 2JC0A 4QOTA 1UW9A 3LOUA 5CH7B 5C5JA 1KDNA 2NZCA 2W2PP 1WI6A 4IQXA 2CNNB 2W4DA 4WFYA 2ROEA 3OSPA 1FRIA 4J5OA 5C24B 3G2XA 1B7FA 4PWDB 2XGPA 3J81Y 1NB7A 3PNIA 4DR3F 4OI6A 4KKOB 3CSKA 2XMKA 1U0SA 1RT3A 1R27B 3CB4A 4PUOA 3R8YA 1T05A 1UFWA 1NDKA 5J2PB 3UR0A 4KYZA 3CT9A 4WWSA 1QTNB 2GHWA 1SH0A 5E41A 1QVFR 1IJEB 2FLLA 5F8HA 1EB0A 1UA1A 4Y2CA 2IM1A 2VD3A 1JLGA 2CUYA 1X5OA 2QTWA 1M5SA 3EZUA 3I87A 1BQNB 5BR8J 2VQFJ 1JLCB 2G13A 2ZBPA 3CIZA 2NREA 3BGUA 3K8VA 2RU9A 1OO0B 3NGKA 2LEPA 1HNIA 2QA1A 2LDYA 3IR7B 2F4FA 1M1HA 1C1CA 3OFGA 4HL9A 1URNA 2OPRA 2BV3A 1VJWA 3TAQA 4AE5A 2KL8A 5THWA 1S0MA 4NCBA 2CQ3A 1XJWB 2IDLA 1CSJA 2CPZA 2Y8WA 2WOMA 2XM3A 4QIVA 2FD2A 2HHSA 2XZTB 4OLPA 4NXMJ 4WTOB 3PM9A 3IBCB 4ZCLA 2ADCA 3KLEA 1R8AA 2IYGA 3RB4A 1WSRA 2CPXA 1R0CB 5M2PA 2BQ3A 1A7GE 1MWQA 5HLFB 4L3NA 1LEOA 2GGPA 2ZFHA 1L3SA 1QAJA 2E5LJ 2BR0A 3CE8A 4Q44A 2XBPA 1BQXA 3DRYA 3WC2A 1YWXA 4OYAA 2AJQA 3M2VB 2FC9A 2CVIA 1FK9A 4ED0A 1EKSA 4ZP6A 3TAMB 3KJVA 1ZPWX 5BYQA 3HJFA 2WHOA 2XNQA 3UCUP 2ZC3A 2KJWA 1IKWB 3I55S 2C2NA 2MTLA 5HQLA 2HS3A 3L09A 3E3XA 2XS2A 2CQCA 2IIHA 3QIPA 1ELOA 1GQEA 2HFOA 3P5TL 2XEXA 3ELHA 1BXNA 4X62F 4KE5A 3DM2B 1LK7A 4ED4A 2NYHA 3KUHA 2DT9A 4ZLLA 1KOOA 2CNOB 2QV6A 3QGPA 3DI6A 3C19A 1Q0NA 2PC6A 2H51B 4B9TA 2D9OA 3HCXA 2AGOA 1L3UA 2DIVA 5HQMA 3TZWA 4P7TA 5KG5A 4Y6IA 4EEYA 4GMKA 2RF2A 3QGHA 5L1KA 4ES2A 3FQLA 1S6PA 3QJJA 1TL3A 3H5YA 1XNRJ 3NS7B 1ZYQA 1B4SA 2ZBCA 2M70A 2Q6CA 2M2BA 1RBLA 1SL1A 4KGMA 3W62A 3RAXA 1KNZA 4KO0B 2BW2A 2ZNZA 3TANA 4P75A 2I5JB 5FD1A 4P52A 2HBZB 3GG0A 5GAGU 2DGSA 3VAHA 1FFGB 4PQAA 4OMFG 1S59A 4W4MA 5ETKA 2XZDB 1LWEA 1TUGB 4GKJJ 1QDUB 4DS4A 2ILYA 3D2WA 4ILMA 3C6UA 1N5QA 4USWA 1ZAWA 3BSOA 3W1YC 1NXIA 2UXDF 4RO0A 2R9LA 2MKIA 2HVDA 2GX8A 2QLXA 3A3PB 3PYGA 3R2DJ 3DLGA 2AJFE 1NK7A 1PIEA 1U6ZA 2KXNB 2DKOB 1RYRA 2JH3A 4A8FA 1U26A 3GYGA 2QO3A 2OPSA 2W4CA 1YJUA 3T5JA 2C3UA 3I0RA 2GIQA 3S01A 1S9EB 2X51A 2JLEA 4FP9A 2HK3A 1TVRA 3T9ZA 1U1RA 2O67A 3N0VA 3CCZA 3Q89A 6FDRA 4ANEA 1D9DA 3OR1B 1OY6A 2LKZA 4YFUA 4B3OB 3CCMS 4DR1J 4J9SA 3FSXA 1RISA 2PT0A 4HEA9 5BR8F 2VQFF 5J1EB 2IJFA 1N33F 2R7RA 2ZOGA 4FZVA 4IFVB 1M90T 1OY8A 2FHKA 2YY3A 3HHDA 2QRRA 5IM0B 2A1BA 2NLWA 2XWYA 1FWPA 4UTGA 5DDOC 2PMZD 3LTOA 1BWEA 4DQPA 1UJ4A 3MM8A 3TUPA 3HD1A 3GPAA 4QPTA 1GMUA 5KFBA 1EIYB 3FRZA 5E0OA 4ECYA 1D1UA 3VGSA 2WVBA 4RKUC 4AL5A 2FVRA 3KLIB 4JI0J 1FNMA 4M5LA 2ZKTA 1LNQA 4A8YA 4ZP8A 1T9TA 4YUDA 4NE9C 3VR1A 1HNXJ 1W2IA 4LR7A 3THVA 1RT5A 2JX2A 3BJYA 1DFDA 2XULA 2CQHA 4F25A 4LR9A 3CMQA 2COLA 2ZZMA 4ALZA 2B4PA 4NXMF 1YJWS 4FDFA 1HQEA 4CT8A 3IBFB 4YDDB 4USIA 1U1KA 5T41A 2HBQB 2CQPA 2VC1A 1C2PA 3ET6B 2I0XA 2B8PA 3N9UC 4F26A 2HZVA 4I6YA 2OPPA 1BHNA 2UVRA 4GKKJ 1MW7A 1ICEB 2KJVA 3MM9A 1LWFA 2XB2D 1D8YA 2MLZA 4CLWA 4EBCA 3KDOA 1M5HA 1SI9A 2YTCA 3W8PA 4DCOB 1PILA 2DO0A 1CBKA 4IQMA 1VFJA 4LF5J 3OFHA 4FBTA 4CLSA 4BBYA 3AQPA 1VQ9S 1CVJA 4ECSA 3TR5A 1VISA 1LWCA 1RI7A 3CVKA 4DR4J 4YOEA 4KV8A 3T1YF 2MKYA 5J2NA 1TQLA 1NK5A 1C1BB 2NXCA 3SV3A 2MZQA 3DOLB 4JV0A 4X4OA 4M5NA 4RWXA 3V4IB 1ROFA 4Q0BB 4DX5A 2ZH5A 3Q8SB 2PMHA 2BDPA 3FNNA 2YNHB 4CLZA 1BQMB 2IBOA 1XR6A 4FVMA 5A8WA 3G86A 2GZOA 3BB5A 1ZM9A 4DSIA 1IR0A 3LAKA 1N4LA 4KAIA 3GIKA 1MMNA 3QT5A 1VRQC 4ZVEA 1OSCA 2V4JA 3R7SB 3I6PA 5BJRA 2OSRA 4Q45A 1VOMA 2IBKA 1FKPA 1S1WB 4ZVGA 1Y00A 2Z56B 1QE1A 1E6YA 4EBDA 2ILZA 1L5UA 1UWBA 2FLOA 2E1CA 4NLXA 2BANB 3A8EA 3GCWP 3LWLA 4MIBA 2HNZB 3I4PA 2C22A 3HHKA 2RE1A 2DRDA 1R8CA 2JLGA 4DF4A 3EWGA 4CM2A 2XLKA 2D3ZA 1TUVA 2DNNA 1X4BA 1P9YA 3HSGA 5L38A 3OBIA 4NX9A 3PIPQ 4GKJF 1KQKA 3NL0A 9ATCB 1HNZJ 4IDKB 2RS8A 1MROB 3OT9A 3R7NB 4KH0B 2VL1A 3J7AN 5A8KB 4PG7A 1I5OB 2RQCA 5C2CA 3J7YI 1LFPA 4OX9J 1MWZA 3GJQB 2HGLA 2QN6B 4F04B 1PSDA 1F0XA 1IXKA 2XTJP 4NLPA 3J7A1 3HJVA 3PJXA 1RA6A 5JJBA 3UN2A 4IG0B 3QZ8A 1W25A 1RHQB 4FYYB 4OI1A 2KYXA 2LXIA 2FDNA 4G1PA 2QC3A 4B9MA 3BH6B 2XSFA 4N47A 1BC6A 2ZUGA 1NUEA 2A6OA 5I42B 4PKDB 3AJ1A 1OJ4A 1CG2A 3HLUA 4DR1F 2RHSB 3ZTSA 1S6OA 4W92B 2VASA 4R8UB 5K20B 1WDTA 4WE1B 3G6ES 1DQ8A 4KB7A 4J9LA 4LVNP 4YB7A 3CDWA 2WZ1A 1IUJA 2LXUA 2HHTA 3W2VA 2F3JA 4AXIA 4N76A 4F4AA 2OTJS 3MGJA 3MZIA 4EBEA 3RB0A 5FIIA 1N6QB 3OD2A 1RHJB 2AYMA 1DTQA 3SCIE 1BY9A 1WG1A 4JI0F 3S6EA 4R5PA 2N3LA 3IRXB 4WP8A 2LP4A 1EJ7L 4OV6A 2XLIA 4Q2MA 2RS2A 2QZ8A 4PABA 4JV5J 3NCPA 3SI8A 2B4OA 1AB8A 2R7OA 4P71A 2DR5A 2Y3YA 3ILIA 2YQ3A 2C2MB 2HS0A 3MMCB 4EWTA 1RAGB 1HNWJ 3VF0B 2VZ9A 2IY5B 4ZKAA 3H4DA 1TAQA 2DYAA 1PJ6A 2JL9A 1RSCA 3E8OA 2MLXA 4LF9J 4DFKA 4GKKF 4QIFA 2LMIA 3UW1A 3M8PB 1N5YB 3MOJB 1CJTA 1N8RT 3N4WA 2HGNA 3PTWA 2UZAA 3KJNB 3LF0A 4NLOA 4IG3B 1RWVB 1SIZA 4URGA 1L3KA 3VZIA 1ACMB 3C6TB 1JLBA 1FXRA 5LJ5Y 3CDUA 4ZCKA 4GO5X 1PJ7A 1SVDA 1UJ6A 2R2SA 1RTDA 2NCKL 4WK3A 3NMRA 2AW0A 2D1CA 1IBMF 3MEDB 3LP1A 4DQIA 4OX6A 4DR4F 2RRAA 5HO4A 3R5JB 2DR9A 5DJBA 1N36J 1RGVA 3GG1A 1S97A 2DPIA 2YH1A 1MU2A 1RA7A 3F44A 2EVZA 3CEDA 4PQUA 2XI2A 3F56A 4I2PA 5GADI 5KT3A 2IC3A 4ZHRA 3K5PA 2EWHA 4X4RA 3PRVA 3ZXWA 4S0MA 2MLYA 1RU2A 2CG4A 3A8JA 3PO4A 3BKUA 2KG1A 4LR8A 4PXBA 1IKVA 2CQ1A 1FJEB 2BKOA 1NDPA 4DWIA 1CS4A 4D3GA 4ZPBA 3QAUA 4UY85 1T94A 2VFSA 2FHJA 3KLFA 1U1QA 4KGKA 1RQ0A 3MECA 1X31C 2ZOMA 4RZRA 5AXKA 4USJC 4DF8A 3R5GA 3EE3A 4NZ0A 4LRCA 1YBUA 4BWJA 4DX6A 3GV7B 4ELVA 3O3LA 1Y10A 2PEBA 4URSA 4OJ3A 1T95A 3C8YA 5LMNJ 1ZM4A 1Y3JA 4C98A 4LQ3A 4WCEQ 1HNZF 1U49A 2OIHA 1URRA 1RTIB 4Z37A 3Q86A 3T5HA 3EXCX 4DR5J 2QMWA 5L46A 1NPPA 3P4UB 1O5JA 2POKA 3ISND 5F3TA 2XCPA 2LQBA 3JTOA 4HHUA 4KQZA 2VJVA 5DDQC 4DL6A 1YDLA 2YNGA 1VQPS 4Y2MA 3RBDA 2HFZA 4PWUA 1FJGF 3W3SA 4M94A 4RUAA 1UL3A 3KNGA 1TFWA 2D69A 2D41A 3M2UB 4MK7A 3NNCA 1BGXT 1WKLA 1WNEA 2ZJRQ 5H9FK 4MIAA 2V63A 4WK1A 2VFTA 3FRYA 3DGPB 1D3WA 5KT6A 2DXFA 5F0UA 3DOMB 1FX2A 5L8RC 5J2MB 4NEZA 2U1AA 2J6UA 2PI5A 4N77A 1NH8A 5KFNA 5HVHA 1TK0A 1VBKA 2XCAA 3BO4A 1A6LA 2HAFA 4IYQA 3K5MA 3W5ZA 4X4UA 1AT1B 2M4MA 4CP5A 1U1OA 4U7CA 1XNQJ 4MK9A 3OLAA 2MY7A 2CZ9A 1JLEA 1RWUA 3MR2A 1EETB 5MAOA 3C15A 2W9BB 2E66A 2ACYA 2J8SA 2V8DA 1FRHA 3LANA 3I5CA 5IS2A 2HHWA 2B6AA 2EI5A 1WOPA 4H4MA 5DZ7A 4MH8A 4JV5F 2HZCA 1U24A 3CJSA 3R6GB 2BJ8A 1NRKA 1Q5VA 2W7AA 3CCWA 2E5IA 4E98A 2RMLA 1NB2A 5CHCB 4DV3J 2HG4A 3HVTA 2I38A 1KOHA 2QT7A 2DIUA 3UR3C 3GFXA 2MJNA 2LQ9A 1MMLA 1SKRA 1ZA2B 1S0VA 4Y3CA 3AAWB 3MMBB 1CJVA 4HACA 2QA4G 1UVNA 2DITA 3IR5B 2GC8A 4GVBB 3T41A 1TL1B 2M8HA 4ID5B 3OXLA 3SIPB 2DGUA 1QSSA 3HDSA 2PA3A 4DV0F 2WW4A 1IR1A 4A8KA 2IMOA 4M1KA 4O4GB 3J80U 3MPUB 4FF4A 2W4PA 4MAKA 5HQ8A 1QSYA 3J7ZT 5L1IA 1VRUA 4C9DA 3I0SB 4C3KA 1YZ7A 5F3ZA 5BXIA 3PG9A 1N36F 1KR4A 3W2WA 1K1QA 4DFMA 1Z4UA 3NAIA 4TU9A 1PGZA 4WXWA 4K2XA 4OYBA 2E9RX 1RK8A 2W25A 1XMBA 4CRJA 1GX6A 3MM5A 4OFZA 5IV3A 2V34A 3ZZUA 1Y5NB 2DRBA 3HFVA 3QSYB 1FDAA 4C0HA 2DO4A 3BH7B 2HHQA 1F2HA 2HWTA 4K0KJ 4OX8A 3C14A 4CLKA 3HHNB 2ZH9A 3GCXP 2G0CA 4F67A 4USVA 2Y1LB 3SCKE 1LW2B 3KHHA 3V81A 1M5KC 2CKWA 2J9DE 1ZAVA 3VQSA 2XNRA 4FKXA 3QSIA 3AA9A 4RBUA 3M8RA 1KVKA 1XMOJ 4B9LA 1FKOB 2DNYA 4F8RA 3J80Y 5IXUA 1FFSB 3JTNA 3MEEA 1HPZA 2GJIA 3CJ4A 3BYRA 2O3DA 2CQBA 1U1MA 1N5SA 2PI4A 3KLHA 2AWZA 3P96A 2V8HA 2AX0A 4DR2F 3DLHA 3G87A 5DETA 2HHHJ 5LMNF 3PV8A 4OYMA 2HFUA 3SQOP 3U27A 1SIWB 3BQ2A 1YG0A 4PPDA 1TKXB 2MKHA 4ZMMA 3FK4A 4LF4F 4A48A 3D1HA 5EX3A 1TZ0A 4CLLA 1VCTA 3TAPA 1NAQA 3M30A 2K8GA 4EFAC 2HHXA 5I3UA 4LSNB 1S7IA 1YI2S 3R27A 4JI4J 1RB0A 3FMBA 3NNAA 3PFEA 3UD5A 1WELA 1HBMA 1WORA 3POTA 1XIQA 2R4FA 2F5GA 4WYLA 2RHQB 2RSQA 2GFFA 2F4VJ 2K1RA 3OFFA 1NKCA 1JIHA 4ER8A 2CQ2A 4USTA 3Q8UA 1C0UB 1AROP 4HR2A 3SDEA 3ULHA 2GVZB 1RKJA 1DLOB 3DCAA 3ZTOA 1B0TA 2XYHB 1S0OA 4E0DA 2DNOA 3Q2TC 2FVCA 1D0EA 1UVKA 5CAAA 4KHPJ 3HSDA 2MZ1A 5IT4A 6FD1A 1NPKA 3VVTA 1ZS6A 2EEYA 5HBMA 1HBUB 4OYIA 3IP0A 4USUA 4B9SA 4N56A 1KS2A 1FCAA 3RG6A 2YNFB 2NSBA 4M5DA 2GMHA 3AOAA 1S1XB 1I51B 2BKNA 3P8BB 2YKQA 1FTCA 4LFCJ 3H5SA 3OTOJ 3KDNA 3LP2A 4JB8B 2EK1A 1HLWA 5RUBA 2CDQA 2EW9A 4CYUB 1F9HA 3WDOA 3IRWP 1IKXA 1JLFA 3EGNA 2UP1A 2C2OB 3ITHA 3T6JA 1KLNA 3D1OA 2DJWA 3RZAA 2IAJA 5CYQB 3M8YA 3P6YC 2IA0A 4OZ3A 4C4WA 3V6DB 5HATA 2UU9F 5IT9U 5KFRA 5B7WA 4RNHA 2YKNA 1YTYA 2N7CA 5F0WA 2G2OA 4H4OB 4M63A 1FRXA 1U8WA 2ZBRA 2J7UA 3L4BC 3R1HA 3HFKA 1AA1B 4U8VA 2LFVA 1TK5A 2OD6A 2E1MC 3GU0A 1LXJA 3RUBL 1F5BA 2JZ5A 2P2CB 5EWEA 4ZIWA 3KK1B 4OJGA 4JI6F 3AHPA 4B3SJ 4FF1A 4JI5F 5MLCV 4ATNA 3M8WA 2ABYA 1OS5A 2FGCA 3QFHA 4F4ZA 2NPIA 3OHAA 1YJVA 3OSNA 1YGYA 2JFKA 3TA1A 3VWSA 4QWEA 2MQOA 1KLMA 4NRUA 3E01B 4B3RJ 1WC3A 3ZNJ1 4FKYA 3W8GA 3HK2A 3H7HB 4OZ5A 1RLDA 3T5KA 2B5JA 5D3GA 4I7FA 3FEYB 1SQEA 2FJBB 3OTCA 1U1NA 4MYTA 2R7UA 5IT9Y 4A4JA 2AZ1A 1CLFA 4UUWA 3MFHA 3V6JA 1S4FA 3ISNC 1MWYA 3GIMA 2BJ7A 1VQLS 3VAIA 3OPKA 3GILA 2CA9A 3DRSB 4PWWA 2DD8S 3D28A 3SQGB 1HBOA 3LO3A 4TY8A 3NG8A 4K0KF 4J91A 2YWWA 2XMMA 1WDDA 4DV1J 3U7JA 2IVMA 1XK8A 4U96A 1KEKA 1HWJA 2VF3A 3EVMA 4UOHA 4PXDA 3M32B 3FCWA 1SJQA 1IJFB 2WK4A 2DCUB 1TUWA 2FQQB 3CJ5A 2RDJA 2NXEA 3RRKA 2BEFA 3B82A 3QFWA 3TW0A 1PYSB 2DHXA 3BQ1A 1S72S 2B4VA 2ZVSA 1S7HA 4NLUA 3KG1A 2APOA 1V3RA 4HTJA 1EAYC 3K5LA 3T1AA 3H42A 4ZVSB 2MKCA 2E44A 2HHHF 5GMKa 1U45A 5GAHU 3PKYA 3ZNUA 1DARA 1WC0A 4NA3A 2HWIA 2XQCA 4ZN1A 1NKBA 2DXEA 2X3DA 3FUYA 3IG1B 1KSPA 4TY9A 4DOZA 4ZCMA 3DC2A 3CMAS 4KRWA 3KK3B 2C2EA 2IJNA 5IQ6A 4DCJB 4XO0A 3R7BB 4LUBA 4C8YA 2F4VF 3AB4B 5AXLA 2RQ4A 4YEAA 1Q8IA 2W9CA 5HMWA 4DL0C 4O3RA 3QLHA 4Q8FA 4DV7J 2W8KA 5HVGA 1LXNA 1RCOB 3TJ9A 4JI3J 1NZAA 5C42B 1WF2A 2MB0B 1ZETA 2V0NA 2OEKA 1TKZB 4PYAA 3SSSA 2AQ4A 1U47A 1Y3KA 4OI0A 5E2QA 3M8ZA 2FJXA 4KGXB 1HR0F 5AE3A 4KSEB 4AXJA 4A8XA 5KAKA 4GVLA 2HVIA 5B0FA 5KG7A 4G3IA 1QD1A 1RT1B 3I5BA 4HKQA 3MTJA 2EXUA 4MT1A 1MLAA 1PJ5A 1JKHB 1U02A 1S4EA 3UCGA 1RWXB 4LFCF 3OTOF 3SCLE 2IM3A 1DTTA 1SJ3P 1YZ6A 1I3OB 4RNFA 2KRRA 4RW9B 3KHRA 1KTQA 1UA0A 2G0JA 2R3VA 5F41A 3FBEA 2E1AA 4DV5J 2R7XA 4DV6J 2NS1B 3EM1A 5CYMB 4NRTA 4IFYA 5CYJA 3NWGA 4X4QA 4RR5A 2VQEJ 3HO1A 4X64J 3OR2A 2L48A 4CTAA 4U6PA 5LMUJ 3OXGA 2VOPA 3DLLQ 5DS7A 2YWHA 4OHVA 5EGYA 4WFBQ 3PJ9A 4F7VA 3DRRA 2J9DA 1NSKL 1H2VZ 2Z30B 1HQ2A 5C25A 5LXRA 5DG7A 1AFJA 1VIOA 4UOCA 1R0BG 4LF7J 1NJYA 3CJKA 2AJ1A 2BYCA 3DLKB 1X5PA 4C8LA 1Q7YT 2QG9B 3KLGB 3DLEA 4DQSA 1W26A 2BE9B 5ETPA 4XPCA 1KRPA 1V5VA 1IQTA 3DLJA 3I82A 5FLXY 2M9KA 3PEJA 4I64A 1NK8A 4B3RF 1U0HA 3F41A 1RWKB 4DR7J 3G82A 3EXYA 2E7XA 4DZ6A 2HURA 4B17A 2HQIA 3R5DA 2HRYA 3AB2B 1U8SA 4ED5A 2CJ9A 3W9HA 1SV5A 5KFQA 2FZKB 2B9YA 2MSTA 3P5BP 4LRBA 1X8DA 1P27B 3O1LA 2YKMB 2XWXA 1S49A 2OELA 3K7RA 5K8PA 4NXNJ 1U48A 1OY9A 1X4DA 1N32J 3I56S 3BEGB 2QE5A 3UPFA 2IVYA 3KKFA 4DEZA 2DEJA 2EKNA 1KN6A 1E6VA 2CPYA 2LEBA 5AJ3J 1SB6A 5H9EK 2JLFA 4USMA 2HNDA 3HULA 3MMJA 4CQ1A 2MSSA 5DQGA 4J7CA 4OYPA 3A12A 1R0AB 3DHWC 4X4SA 1Z1ZA 4RW8B 2DPJA 4QW9A 3CUNA 4M8LA 2DGWA 1IKYB 2VUGA 5EHHA 2V67A 1S5ZA 3GYXB 1EP4B 1QUPA 4DG1B 2QYGA 2KFYA 2ZDPA 4CH7A 1XQIA 3TUZC 2I6WA 2FY1A 4WFZA 5I3PA 2F9JA 2J0SD 4NLRA 4WU3A 3LUYA 2J5AA 4NLSA 4CLYA 3PDNA 4HT5A 2CJBA 4OV1A 2RRNA 4QWBA 3HKZD 1V3ZA 1HBNA 1TL7A 4O0NA 2EFNA 2VG6A 2V94A 3TZYA 1X5TA 1T02A 3MR7A 3QO9A 5KFOA 2B9WA 2GS8A 2AYEA 4J9MA 1Q79A 1T3OA 2J6SA 4PCQA 2HRUA 3BPDA 5A76A 2XYPB 4WXOA 1WKKA 4DV7F 3LA0A 2SXLA 2RJZA 3LW5C 1NK0A 4QU7A 3QQCD 3JYTA 1H2UX 1J5OA 4BDPA 2Q79A 1NO8A 1RE1B 4C8OA 4JOUA 2R8IA 2J7WA 1YJRA 2VG5B 3W5YA 2ASLA 4DBQA 5KT7A 2ATLA 5GMEA 1J5EF 4TU8A 1ZZNA 5ADZA 3FJ2A 4NLDA 5C24A 3DRPB 1LV5A 4QCLA 4PWDA 3T5LA 2HHUA 2QX0A 2DB1A 4DJBA 3EMTA 4X2BA 2ATCB 4KKOA 5KOXA 1PCAA 2Q66A 2V68A 4Y2KA 5KFEA 5E5NA 1NLKL 2DNMA 3M2RB 1PAUB 2C3OA 5DRKA 1WHWA 1IBCB 1A9NB 5J2PA 3PW4A 2L9WA 5D15A 3WX8A 2YX4A 3NS6A 1T9YA 2QLFB 2BZ2A 4DV6F 2DNPA 1YRUA 4DR3J 1NSQA 1B3TA 2FTRA 2VQEF 5KFCA 4WJBA 4X64F 2IM0A 1VC0A 2AYBA 3QT8A 2ALZA 5LMUF 4ID8A 2MY8A 3EDRB 2I2YA 5F8IA 2H4YB 3G71S 3B54A 3MFIA 1BQNA 3TI0A 4NI2A 4LBIA 1IN0A 1JLCA 4Y65A 2RD5C 1QVGR 3BKTA 2RQKA 1IVZA 2Z2YB 2QSFA 1WEXA 3D6HB 4LF7F 1HWUA 3F0NA 1NNDA 3JQJA 3RAQA 3FEXB 4F02A 3Q8YA 1WG4A 5F8MA 1S1VB 5AE1A 4OZ1A 1UP1A 1B64A 1EZZB 1VYAA 5HI7A 2DVIA 3QNWB 4YP3A 1T9WA 2A10A 4LF6J 3V2UC 3K57A 4HVZA 4O0IA 3QT6A 2YNIB 4LRAA 2R42A 2HWHA 1SH2A 1IWAA 3KUEA 3V4MA 2AEFA 4DUTA 3HVRA 1WTBA 1YBAA 2L9NA 3U1NA 5A0YA 2GQ2A 2BA9A 3L95X 4IRKA 2X1BA 4NXNF 2V2VA 4OYXA 4NMXA 5HLFA 3PIOQ 1N32F 1FWLA 3UVJB 5EDWA 5T14A 1RADB 1T03A 3RGIA 2UVWA 2MGZB 3KNAA 3BGFA 3TJ8A 4IRDA 5AJ3F 4KHRA 3M2VA 2FLNA 4C0BA 1FTRA 2CPEA 1YX2A 1RTJB 3TAMA 4HH1A 2GAGC 1GTHA 2QLBB 2AGQA 1HQUA 3G8SA 2OMLA 1WEZA 1WTFA 2VPWB 1VQNS 4OYOA 1U7LA 3ZTRA 1IKWA 3H8YA 4JV1A 1R8HA 3M9OB 3IFEA 3KJQB 3DN9A 4F0MA 2PIIA 3BR8A 3PVXA 3DM2A 2DY9A 4MFBB 2W9AA 1B70B 4UW2A 2NYIA 3EX7B 4Y2AA 2J0XA 3H5XA 2J76E 4JUZA 1W2BR 2YWFA 4M5MA 2GIRA 5DM6Q 3KMSA 1FI4A 4FN5A 1QY7A 1SJ1A 2RRBA 1SC1B 3C16B 4U8YA 5KG4A 1S6QB 4FS2A 3ZZZA 4DUZJ 2MHEA
chains in the Genus database with same CATH topology
3LP1A 4DQIA 5HMYA 4OX6A 4DR4F 4CT9A 4HT7A 1YSJA 2RRAA 3ENQA 5HO4A 4RBTA 2DR9A 1FO1A 5DJBA 1RGVA 2A3JA 2K7JA 3GG1A 3CCTA 2FHMA 4A46A 3NAHA 2YH1A 1S97A 2DPIA 4MTPA 2J0QD 1MU2A 2V4QA 1RA7A 3F44A 1HWKA 2EVZA 2MQQA 1R89A 3CEDA 4RNOA 1UAWA 4PQUA 1WD6A 2XI2A 3F56A 4I2PA 5GADI 1R8PA 1RT1A 2A2CA 2D9PA 4B02A 1YQHA 5KT3A 1KHWA 2JHEA 1NJWA 2IC3A 4ZHRA 2H9ZA 3D0HE 3K5PA 3MOZA 2EWHA 2XMWA 2O01C 2M7SA 3N6LA 4I6AA 4X4RA 1FRKA 1M1KT 3BF4A 1H3DA 2CG4A 4F3MA 1KHVA 2KM8B 1JKHA 4ELUA 3I31A 5B0DA 3PO4A 3HX9A 2KG1A 2ZKUA 1VGYA 1JLGB 2GJ2A 1JLQB 2DGQA 2OO4A 2XG8A 2FVPA 1JK9B 4PXBA 1RT2A 2EFQA 1IKVA 2YVSA 2CQ1A 4NYPA 1FJEB 1HMVA 1QUVA 4KO0A 4RW9A 4QYRA 5JVHQ 4DWIA 2JEJA 2I5JA 5AXMA 4D3GA 5A6PA 4ZPBA 3LQVA 3KHGA 2YKOA 1M0SA 3QAUA 2MZTA 4C11B 4UY85 1T94A 5A2QY 5LJ3Y 2VFSA 1D9FA 2V9WA 4DSKA 5KG6A 2XY6A 2FHJA 2B5JB 4N41A 3KLFA 5T7LA 2FJVA 3NMAA 2LXFA 1U1QA 4OQJA 5D3GB 4I7FB 4KGKA 3QMQA 4O23A 5CYMA 2ZOFA 3MEGB 4ILRA 1RQ0A 4C2MA 3PZPA 4NLTA 2AU0A 3GR0A 2J6TA 3CC7S 3NP5A 1VMBA 2GQQA 4WF9Q 4I69A 4ZPTR 2W8LA 1HNIB 4G1IA 3GSDA 1X4FA 4ES1A 4DV1F 3MECA 1H38A 5DGAA 4NZ7A 4DL7A 2ZOMA 4H4KC 4R0EA 2V9KA 1ZTTA 2HMIA 3CWJA 2DH9A 2OFHX 2VPYB 4AYBD 5KFHA 2HHVA 4RZRA 5AXKA 2FC8A 4KTQA 3CCQS 4USJC 5L1LA 4KHMA 1C1CB 1P1LA 3FZBA 1AW0A 3PRBA 1TKTB 4CZCA 3DU6A 2EFOA 4DF8A 2ZD1B 1VC6A 1S1UB 4F4KA 4NZ0A 2LA6A 1XBWA 5DDPC 2MPUA 2PFFB 1H6KX 2BM1A 2OPRB 1HARA 4BWJA 1F2GA 2JSXA 2MJUA 4TLQA 5DG8A 1K0TA 1HBOB 3GV7B 1M5PC 4TY8B 4ELVA 3O3LA 2LDIA 3BSAA 3IR6B 1FNXH 2WOMB 2HPUA 2KRBA 2R2RA 1G2EA 2QMXA 2CQ4A 1ZAXA 1FD8A 4F50A 2JVRA 4URSA 3NLCA 4RU2A 3THPA 3US5A 4EO8A 4Z2XA 1FE0A 1Y7PA 3CTRA 4OJ3A 1T95A 2E5LF 4ED3A 3OJSA 1S9EA 3C8YA 2JEFA 3KTQA 4H4KA 4OIXA 4DMZA 5LSRA 1V6HA 2DNHA 3MHYA 2DH8A 1ZM4A 1Y3JA 3VAJA 3DYAA 4C98A 2XY5A 4LQ3A 2Q6BA 3DLKA 4WCEQ 1HNZF 1U49A 3M05A 4N5SA 2OIHA 1URRA 3G6XA 1RTIB 3KHLA 3KLEB 2PE8A 1FHTA 3L7PA 5J1NA 3D0GE 4Z37A 3T5HA 4ZOSA 3EXCX 3KLGA 4TU7A 2QMWA 2U2FA 2YH0A 2Y1JA 4HI1A 3OR1A 3CO9A 3RRHA 1O5JA 2ZHBA 1HD0A 1KFSA 2POKA 4B3OA 4NL5A 1I1GA 3MEDA 4ICLB 1DZ5A 3ISND 3LGMA 5F3TA 4IH6A 3SSRA 5DGBA 3ETOA 3U1LA 2XCPA 3MM7B 2UXBF 5LT5A 2LQBA 2KXHA 4ELTA 1S48A 4DQQA 1RYSA 3C46A 3JTOA 3OTBA 5JXSA 4KQZA 2M88A 2GGPB 5J1EA 1QM9A 5L9XA 1XTZA 5DDQC 4DL6A 5KFIA 2FGOA 5G4DA 2YNGA 1VQPS 4NLYA 4Y2MA 5SZTA 1N34F 3RBDA 4IFVA 2HFZA 3IA0A 2KHDA 4FS1A 1VQ8S 2PGCA 4PWUA 1FJGF 3W3SA 4P2SA 4M94A 4TLRA 1GX5A 4RUAA 4HI2A 4P7VA 1UL3A 3IAS9 3KNGA 1TFWA 4I2QB 3CCVS 1WHYA 2LEAA 3MAQA 4PG8A 2UUTA 2WSEC 5IM0A 1F5CA 1FK9B 2EFGA 5K14B 2D41A 3M2UB 4MK7A 2DNQA 5F9NA 4QU6A 5KFYA 1P8GA 1K0VA 2E5JA 3KJVB 3NNCA 1BGXT 4CO2A 1WNEA 3O6QA 5HROB 2ZJRQ 2CQDA 2YKMA 2MXYA 4C8KA 4FYDA 5HMXA 4CI0B 4MIAA 4O44B 2JOQA 4WK1A 2VFTA 3UE2A 3FRYA 4A8QA 4JI3F 4NPOA 1D3WA 4O3QA 5E3CA 4F2RA 1JLAB 3HHLB 5CD4H 2QLWA 2BUNA 5GAEI 1LFWA 5KFZA 1FJ7A 1U6FA 4OZ0A 5KG0A 3KLIA 5KT6A 3RW6A 2D3OR 1HWIA 5F0UA 3BZQA 2MZRA 2G4BA 5FDLB 4RW7B 2IFXA 3WBZA 1S77D 2E5GA 3QIPB 5L8RC 3PR4A 4ZPCA 4PPZA 4DL5A 2MQMA 4WU2A 1PC4A 5J2MB 2U1AA 4LF6F 3LGNA 4N77A 1NH8A 2J6UA 3HHLD 3IN5A 2PI5A 5KFNA 2RU3A 1TK0A 2XMJA 2XCAA 3BO4A 1A6LA 2GW8A 2W9CB 1LW0B 2XI3A 3OVBA 1SBRA 1S10A 3IS9B 5IWAF 2KH9A 2VBXA 4IYQA 3K5MA 3O8WA 3QLHB 4PRFA 4X4UA 2JDJA 3AJ2A 3TP2A 4L6V3 4R25A 2M4MA 2IYIA 4BS2A 1U1OA 2GO9A 4U7CA 4MK9A 3OLAA 1N0UA 3OL9A 2MY7A 4ZCIA 5KFXA 2O1PA 2KI2A 4ERDA 5H9FJ 4J9QA 1R0AA 1S6UA 2N4CA 5IQQA 3TUIC 1NK4A 1XNRF 3M6VA 3DI6B 1FESA 3BGRB 1VQOS 2CZVC 4XIUA 1JLEA 4KBIA 1RWUA 4ZDNA 3MR2A 2J9CA 2JEIA 1UETA 4RW8A 1EETB 2ZNYA 3JSYA 5D78A 5MAOA 4IOCQ 4ETZA 2QYCA 1HD1A 1R43A 4ZA1A 2W9BB 2E66A 4FXWA 1Q4RA 1VLYA 5KT5A 3OFEA 2ACYA 3U02A 3BM7A 1IKYA 2DNZA 2V8DA 2XGQA 4EYHB 1G1XA 1FRHA 3LANA 3I5CA 3CDAA 3KK2B 5IS2A 1G6BA 2HHWA 3VCDA 2B6AA 2UUBF 4NMLA 2LU1A 4A8OA 1EP4A 2EI5A 1VBZA 4DG1A 4H4MA 2MKJA 4MKBA 3BSCA 2BJDA 3KG4A 5DLGA 5JUMA 1U25A 4MH8A 1HI0P 4JV5F 2RF2B 4OZJA 2HZCA 1U24A 1CC8A 1Q8BA 2RKIA 2XMTA 2DNKA 1S6PB 3N5FA 2Q43A 1NRKA 1TL3B 2OAUA 2W7AA 3M4XA 1CC7A 4DV5F 1U1LA 3BR9A 3FSIA 3CCWA 2WBRA 2E5IA 3O5TB 4E98A 3PR5B 2DBBA 1BLUA 2ASJA 2RMLA 5CHCB 2UUCF 3PW5A 3D0IE 2LA4A 3IAM9 2VFUA 2HG4A 1X4GA 3LAMA 3HVTA 2FLPA 3H2LA 2ZJPQ 2ZH8A 2I38A 1KOHA 1VQ5S 2QT7A 3K2YA 2XO7A 2DIUA 3PHEA 1QAYA 3UR3C 4X4VA 3GFXA 2MJNA 4CO4A 2LQ9A 4K4WA 1MMLA 1SKRA 2C28A 3Q8QB 4QQBA 3CF5Q 3EZ5A 1S0VA 4Y3CA 4ED7A 3MF5A 3AAWB 2VKZG 3MMBB 3J7YU 1UVNA 3V5RA 2YKAA 2QA4G 2V2KA 2DITA 2MYFA 3Q8RB 1NHUA 3IR5B 3UDCA 3IGNA 4CNYA 3MEEB 2GC8A 4B08A 3Q24A 5KFTA 1C1BA 1XN9A 4NLQA 2Z2LA 1TL1B 2M8HA 3DMJB 4ID5B 4DN9A 1S9FA 3DOLA 4LSLA 3OXLA 5GAHI 2MMYA 5I4MA 2B7CB 4DUYF 2CFXA 1LWEB 2DHSA 2BQUA 2DGUA 3ICLA 3PJWA 1QSSA 3H2UB 2Z0GA 3K8WA