3LQ0A

Zymogen structure of crayfish astacin metallopeptidase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
SPIIPEAARALYYNDGMFEGDIKLRAGRQPARVGAAILGDEYLWSGGVIPYTFAGVSGADQSAILSGMQELEEKTCIRFVPRTTESDYVEIFTSGSGCWSYVGRISGAQQVSLQANGCVYHGTILHALMHAIGFYHEHTRMDRDNYVTINYQNVDPSMTSNFDIDTYSRYVGEDYQYYSIMHYGKYSFSIQWGVLETIVPLQNGIDLTDPYDKAHMLQTDANQINNLYTNECSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ProAstacin
publication title Proenzyme structure and activation of astacin metallopeptidase
pubmed doi rcsb
source organism Astacus astacus
molecule tags Hydrolase
total genus 65
structure length 235
sequence length 235
ec nomenclature ec 3.4.24.21: Astacin.
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lq0A00
1HOVA 1EUBA 3WV3A 1JIWP 4AYKA 3P1VA 3U1RA 2K9CA 4AXQA 830CA 5I43A 3EDHA 1QJJA 1BSWA 2RJQA 1CAQA 1SATA 1UMSA 4R3VA 1K7QA 1UEAA 3EWJA 1OM8A 1HY7A 4PKVA 1I1IP 4H30A 1XFZA 1MMQA 3WV2A 1GO7P 1AKLA 1UTZA 1HFSA 1JH1A 1GKCA 1IACA 3CKIA 3F19A 1R1IA 4ILWD 3VI1A 3EHXA 2ERQA 1R55A 1HFCA 2Y6DA 1ZXCA 3TVCA 2AYKA 3DSLA 1MMRA 3B92A 4GR3A 4XM8A 1JK3A 5I0LA 3LK8A 3DNGA 2A8HA 3LJGA 3OHOA 4JP4A 1AF0A 4JA1A 3TSKA 3ELMA 2OXUA 1R1HA 3HY7A 4DPEA 3HBUP 1OMJA 1XURA 5I2ZA 3LIKA 1ND1A 5L79A 1YQYA 4FVLA 1HV5A 2OW1A 3HBVP 4QKZA 1PWWA 2W15A 2D1OA 1R54A 1XFUA 3L0VA 2CLTA 4CTHA 1QIAA 3ZVSA 1OS2A 1Y8JA 1GKDA 3LGPA 1CGEA 1Z3JA 3F17A 4GWMA 3MA2A 4AUOA 4JIJA 1IAAA 4WK7A 2MLSA 1MMPA 2KRJA 1KUIA 1ZXVA 2OW9A 2WO9A 4XBHA 1USNA 2USNA 3B2ZA 1D8MA 2MLRA 3EHYA 4GUYA 1SRPA 3E8RA 2W14A 3RTSA 3LUMA 3LUNA 4PKSA 3HDAP 1JJ9A 2DW2A 5D3CA 3NX7A 4DF9A 1G4KA 4GQLA 2W12A 3HB2P 1PWVA 1BKCE 1MMBA 3USNA 4PKWA 2E3XA 2OY2A 1YOUA 1XFVA 4ZR5A 1I73A 4JPAA 1KUHA 2FV5A 2O36A 4IN9A 2YIGA 4H76A 2PJTA 1G49A 1CXVA 1CK7A 1D7XA 3I7IA 1IAGA 4GR0A 5BOTA 1CGLA 1DTHA 2MZIA 2O3EA 2N8RA 1B3DA 456CA 1UTTA 2X7MA 4I35A 4H49A 1WNIA 1GXDA 3N2VA 2OW2A 2JIHA 2TCLA 2JSDA 3F18A 3AIGA 3ZXHA 1XUCA 2W13A 3F15A 4PKRA 1S4BP 1KUGA 5LABA 5D1TA 3TT4A 1JAPA 2OVXA 4FXQA 3V96B 1JAOA 4IUWA 4XCTA 1KAPP 1KBCA 1KUFA 2DDFA 1R1JA 4I03A 1BM6A 2AIGP 1ZP5A 1G9KA 1B8YA 2L0RA 4L63A 3LQBA 3HDBA 1J7NA 3HYGA 2Y6CA 4H82A 4WZVA 5I4OA 5B5PA 1BKCA 3Q2HA 966CA 3EDIA 2X3BA 3G42A 3TS4A 2OZRA 3GBOA 1RMZA 2J0TA 1JAQA 1YP1A 1L6JA 2HU6A 2WO8A 1GE7A 1EAKA 1K7IA 1ZS0A 3N2UA 5D1UA 1GE5A 3KRYA 3P24A 2CKIA 1JIZA 1PWQA 1BQOA 1G05A 1SLMA 3Q2GA 5CZMA 1GO8P 2POJA 1IABA 2OVZA 3AYKA 4XM7A 3KMCA 2X3AA 1O0TA 3LJZA 1GE6A 2J83A 4HMAA 1RM8A 1C7KA 5B5OA 5I3MA 5BPAA 1OM7A 1DMTA 1SLNA 2DW0A 2X3CA 5BOYA 1PWUA 1D8FA 1Q3AA 5I12A 2OI0A 3KEKA 3HY9A 3KWVC 4A7BA 4L19A 2DDYA 3BA0A 3F1AA 2FV9A 1MNCA 2JT5A 5D2BA 1A86A 1XFYA 1HTDA 1I76A 4H84A 3LMCA 3L0TA 1UMTA 1XFWA 3B8ZA 4WF6A 3KHIA 1PWPA 2SRTA 1OO9A 1EB6A 4A3WA 4L6TA 4IJOA 2JT6A 3OHLA 4ON1A 4AIGA 3WV1A 1IADA 1BUVM 4HX3A 3DWBA 4DD8A 1QICA 1JKYA 3DL1A 3LQ0A 2ERPA 1KUKA 2MZEA 4J4MA 2OY4A 1ASTA 2Z2DA 3F16A 4FU4A 2V4BA 3DPEA 5CXAA 3EDGA 4H1QA 2MZHA 2RJPA 2XS4A 4JQGA 3LE9A 1XFXA 3UVCA 1ROSA 3VTGA 3LILA 3LIRA 1BZSA 1OS9A 2E2DA 1H71P 4PKTA 4H2EA 5D1SA 1D5JA 1OM6A 2K2GA 1SMPA 4GF1A 3DPFA 1ATLA 3I7GA 3LKAA 3LEAA 1BUDA 4WKIA 3LJTA 3O2XA 3KMEA 2EROA 5JMYA 2XS3A 1Y93A 1CQRA 4WKEA 1BQQM 1BKCI 4G0DA 4PKQA 1ZVXA 4FXYP 1C3IA 2YB9A 1YCMA 3RTTA 1AYKA 1SU3A 3AYUA 4Q1LA 4EFSA 3SHIA 2OXWA 4GR8A 1FM1A 3G5CA 3K7LA 2W0DA 3KEJA 3K7NA 3ZUKA 1QIBA 2OXZA 4H3XA 1O0QA 5L7FA 1FLSA 3KECA 1K7GA 1IAEA 1C8TA 4XM6A 4PKUA 4GWNA 1CIZA 5H8XA 1CGFA 2I47A 2JNPA 4G9LA 2QPJA 5D7WA 1FBLA 1Y0VA 1BIWA 3EDZA 5CUHA 2DW1A 1XUDA 1QUAA 3O64A 1JANA 2OW0A 4DV8A 2D1NA 1G12A 1ZTQA 1QJIA 2WOAA 1A85A
chains in the Genus database with same CATH superfamily
1HOVA 1EUBA 3WV3A 1JIWP 4AYKA 3P1VA 3U1RA 2K9CA 4AXQA 830CA 5I43A 3EDHA 1QJJA 1BSWA 2RJQA 1CAQA 1SATA 1UMSA 4R3VA 1K7QA 1UEAA 3EWJA 1OM8A 1HY7A 4PKVA 1I1IP 4H30A 1XFZA 1MMQA 3WV2A 1GO7P 1AKLA 1UTZA 1HFSA 1JH1A 1GKCA 1IACA 3CKIA 3F19A 1R1IA 4ILWD 3VI1A 3EHXA 2ERQA 1R55A 1HFCA 2Y6DA 1ZXCA 3TVCA 2AYKA 3DSLA 1MMRA 3B92A 4GR3A 4XM8A 1JK3A 5I0LA 3LK8A 3DTIA 3DNGA 2A8HA 3LJGA 3OHOA 4JP4A 1AF0A 4L7AA 4JA1A 3TSKA 3ELMA 2OXUA 1R1HA 3HY7A 4DPEA 3HBUP 1OMJA 1XURA 5I2ZA 3LIKA 1ND1A 5L79A 1YQYA 4FVLA 1HV5A 2OW1A 3HBVP 4QKZA 1PWWA 2W15A 2D1OA 1XAXA 1R54A 1XFUA 3L0VA 2CLTA 4CTHA 1QIAA 3ZVSA 1OS2A 1Y8JA 1GKDA 3LGPA 1CGEA 1Z3JA 3F17A 4GWMA 3MA2A 4AUOA 4JIJA 1IAAA 4WK7A 2MLSA 3DTEA 1MMPA 2KRJA 1KUIA 1ZXVA 2OW9A 2WO9A 4XBHA 1USNA 2USNA 3B2ZA 1D8MA 2MLRA 3EHYA 4GUYA 1SRPA 3E8RA 2W14A 3RTSA 3LUMA 3LUNA 4PKSA 3HDAP 1JJ9A 2DW2A 5D3CA 3NX7A 4DF9A 1G4KA 4GQLA 2W12A 3HB2P 1PWVA 1BKCE 1MMBA 3USNA 4PKWA 2E3XA 2OY2A 1YOUA 1XFVA 4ZR5A 1I73A 4JPAA 1KUHA 2FV5A 2O36A 4IN9A 2YIGA 4H76A 2PJTA 1G49A 1CXVA 1CK7A 1D7XA 3I7IA 1IAGA 4GR0A 5BOTA 1CGLA 1DTHA 2MZIA 2O3EA 2N8RA 1B3DA 456CA 1UTTA 2X7MA 4I35A 4H49A 1WNIA 1GXDA 3N2VA 2OW2A 2JIHA 2TCLA 2JSDA 3F18A 3AIGA 3ZXHA 1XUCA 2W13A 3F15A 4PKRA 1S4BP 1KUGA 5LABA 5D1TA 3TT4A 1JAPA 2OVXA 4FXQA 3V96B 1JAOA 4IUWA 4XCTA 1KAPP 1KBCA 1KUFA 2DDFA 1R1JA 4I03A 1BM6A 2AIGP 1ZP5A 1G9KA 1B8YA 2L0RA 4L63A 3LQBA 3HDBA 1J7NA 3HYGA 2Y6CA 4H82A 4WZVA 5I4OA 5B5PA 1BKCA 3Q2HA 966CA 3DTKA 3EDIA 2X3BA 3G42A 3TS4A 2OZRA 1XM5A 3GBOA 1RMZA 2J0TA 1JAQA 1YP1A 1L6JA 2HU6A 2WO8A 1GE7A 1EAKA 1K7IA 1ZS0A 3N2UA 5D1UA 1GE5A 3KRYA 3P24A 2CKIA 1JIZA 1PWQA 1BQOA 1G05A 1SLMA 3Q2GA 5CZMA 1GO8P 2POJA 1IABA 2OVZA 3AYKA 4XM7A 3KMCA 2X3AA 1O0TA 3LJZA 1GE6A 2J83A 4HMAA 1RM8A 1C7KA 5B5OA 5I3MA 5BPAA 1OM7A 1DMTA 1SLNA 2DW0A 2X3CA 5BOYA 1PWUA 1D8FA 1Q3AA 5I12A 2OI0A 3KEKA 3HY9A 3KWVC 4A7BA 4L19A 2DDYA 3BA0A 3F1AA 2FV9A 1MNCA 2JT5A 5D2BA 1A86A 1XFYA 1HTDA 1I76A 4H84A 3LMCA 3L0TA 1UMTA 1XFWA 3B8ZA 4WF6A 3KHIA 1PWPA 2SRTA 1OO9A 1EB6A 4A3WA 4L6TA 4IJOA 2JT6A 3OHLA 4ON1A 4AIGA 3WV1A 1IADA 1BUVM 4HX3A 3DWBA 4DD8A 1QICA 1JKYA 3DL1A 3LQ0A 2ERPA 1KUKA 2MZEA 4J4MA 2OY4A 1ASTA 2Z2DA 2YUFA 3F16A 4FU4A 2V4BA 3DPEA 5CXAA 3EDGA 4H1QA 2MZHA 2RJPA 2XS4A 4JQGA 3LE9A 1XFXA 3UVCA 1ROSA 3VTGA 3LILA 3LIRA 1BZSA 1OS9A 2E2DA 1H71P 4PKTA 4H2EA 5D1SA 1D5JA 1OM6A 2K2GA 1SMPA 4GF1A 3DPFA 1ATLA 3I7GA 3LKAA 3LEAA 1BUDA 4WKIA 1TVIA 3LJTA 3O2XA 3KMEA 2EROA 5JMYA 2XS3A 1Y93A 1CQRA 4WKEA 1BQQM 1BKCI 4G0DA 4PKQA 1ZVXA 4FXYP 1C3IA 2YB9A 1YCMA 3RTTA 1AYKA 1SU3A 3AYUA 4Q1LA 4EFSA 3SHIA 2OXWA 4GR8A 1FM1A 3G5CA 3K7LA 2W0DA 3KEJA 3K7NA 3ZUKA 1QIBA 2OXZA 4H3XA 1O0QA 5L7FA 1FLSA 3KECA 1K7GA 1IAEA 1C8TA 4XM6A 4PKUA 4GWNA 1CIZA 5H8XA 1CGFA 2I47A 1OZ9A 2JNPA 2QPJA 4G9LA 1FBLA 5D7WA 1Y0VA 1BIWA 3EDZA 5CUHA 2DW1A 1XUDA 1QUAA 3O64A 1JANA 2OW0A 4DV8A 2D1NA 1G12A 1ZTQA 1QJIA 2WOAA 1A85A
chains in the Genus database with same CATH topology
1HOVA 1EUBA 3WV3A 1JIWP 4AYKA 3P1VA 3U1RA 2K9CA 4AXQA 830CA 5I43A 3EDHA 1QJJA 1BSWA 2RJQA 1CAQA 1SATA 1UMSA 4R3VA 1K7QA 1UEAA 3EWJA 1OM8A 1HY7A 4PKVA 1I1IP 4H30A 1XFZA 1MMQA 3WV2A 1GO7P 1AKLA 1UTZA 1HFSA 1JH1A 1GKCA 1IACA 3CKIA 3F19A 1R1IA 4ILWD 3VI1A 3EHXA 2ERQA 1R55A 1HFCA 2Y6DA 1ZXCA 3TVCA 2AYKA 3DSLA 1MMRA 3B92A 4GR3A 4XM8A 1JK3A 5I0LA 3LK8A 3DTIA 3DNGA 2A8HA 3LJGA 3OHOA 4JP4A 1AF0A 4L7AA 4JA1A 3TSKA 3ELMA 2OXUA 1R1HA 3HY7A 4DPEA 3HBUP 1OMJA 1XURA 5I2ZA 3LIKA 1ND1A 5L79A 1YQYA 4FVLA 1HV5A 2OW1A 3HBVP 4QKZA 1PWWA 2W15A 2D1OA 1R54A 1XFUA 3L0VA 2CLTA 4CTHA 1QIAA 3ZVSA 1OS2A 1Y8JA 1GKDA 3LGPA 1CGEA 1Z3JA 3F17A 4GWMA 3MA2A 4AUOA 4JIJA 1IAAA 4WK7A 2MLSA 3DTEA 1MMPA 2KRJA 1KUIA 1ZXVA 2OW9A 2WO9A 4XBHA 1USNA 2USNA 3B2ZA 1D8MA 2MLRA 3EHYA 4GUYA 1SRPA 3E8RA 2W14A 3RTSA 3LUMA 3LUNA 4PKSA 3HDAP 1JJ9A 2DW2A 5D3CA 3NX7A 4DF9A 1G4KA 4GQLA 2W12A 3HB2P 1PWVA 1BKCE 1MMBA 3USNA 4PKWA 2E3XA 2OY2A 1YOUA 1XFVA 4ZR5A 1I73A 4JPAA 1KUHA 2FV5A 2O36A 4IN9A 2YIGA 4H76A 2PJTA 1G49A 1CXVA 1CK7A 1D7XA 3I7IA 1IAGA 4GR0A 5BOTA 1CGLA 1DTHA 2MZIA 2O3EA 2N8RA 1B3DA 456CA 1UTTA 2X7MA 4I35A 4H49A 1WNIA 1GXDA 3N2VA 2OW2A 2JIHA 2TCLA 2JSDA 3F18A 3AIGA 3ZXHA 1XUCA 2W13A 3F15A 4PKRA 1S4BP 1KUGA 5LABA 5D1TA 3TT4A 1JAPA 2OVXA 4FXQA 3V96B 1JAOA 4IUWA 4XCTA 1KAPP 1KBCA 1KUFA 2DDFA 1R1JA 4I03A 1BM6A 2AIGP 1ZP5A 1G9KA 1B8YA 2L0RA 4L63A 3LQBA 3HDBA 1J7NA 3HYGA 2Y6CA 4H82A 4WZVA 5I4OA 5B5PA 1BKCA 3Q2HA 966CA 3DTKA 3EDIA 2X3BA 3G42A 3TS4A 2OZRA 3GBOA 1RMZA 2J0TA 1JAQA 1YP1A 1L6JA 2HU6A 2WO8A 1GE7A 1EAKA 1K7IA 1ZS0A 3N2UA 5D1UA 1GE5A 3KRYA 3P24A 2CKIA 1JIZA 1PWQA 1BQOA 1G05A 1SLMA 3Q2GA 5CZMA 1GO8P 2POJA 1IABA 2OVZA 3AYKA 4XM7A 3KMCA 2X3AA 1O0TA 3LJZA 1GE6A 2J83A 4HMAA 1RM8A 1C7KA 5B5OA 5I3MA 5BPAA 1OM7A 1DMTA 1SLNA 2DW0A 2X3CA 5BOYA 1PWUA 1D8FA 1Q3AA 5I12A 2OI0A 3KEKA 3HY9A 3KWVC 4A7BA 4L19A 2DDYA 3BA0A 3F1AA 2FV9A 1MNCA 2JT5A 5D2BA 1A86A 1XFYA 1HTDA 1I76A 4H84A 3LMCA 3L0TA 1UMTA 1XFWA 3B8ZA 4WF6A 3KHIA 1PWPA 2SRTA 1OO9A 1EB6A 4A3WA 4L6TA 4IJOA 2JT6A 3OHLA 4ON1A 4AIGA 3WV1A 1IADA 1BUVM 4HX3A 3DWBA 4DD8A 1QICA 1JKYA 3DL1A 3LQ0A 2ERPA 1KUKA 2MZEA 4J4MA 2OY4A 1ASTA 2Z2DA 2YUFA 3F16A 4FU4A 2V4BA 3DPEA 5CXAA 3EDGA 4H1QA 2MZHA 2RJPA 2XS4A 4JQGA 3LE9A 1XFXA 3UVCA 1ROSA 3VTGA 3LILA 3LIRA 1BZSA 1OS9A 2E2DA 1H71P 4PKTA 4H2EA 5D1SA 1D5JA 1OM6A 2K2GA 1SMPA 4GF1A 3DPFA 1ATLA 3I7GA 3LKAA 3LEAA 1BUDA 4WKIA 3LJTA 3O2XA 3KMEA 2EROA 5JMYA 2XS3A 1Y93A 1CQRA 4WKEA 1BQQM 1BKCI 4G0DA 4PKQA 1ZVXA 4FXYP 1C3IA 2YB9A 1YCMA 3RTTA 1AYKA 1SU3A 3AYUA 4Q1LA 4EFSA 3SHIA 2OXWA 4GR8A 1FM1A 3G5CA 3K7LA 2W0DA 3KEJA 3K7NA 3ZUKA 1QIBA 2OXZA 4H3XA 1O0QA 5L7FA 1FLSA 3KECA 1K7GA 1IAEA 1C8TA 4XM6A 4PKUA 4GWNA 1CIZA 5H8XA 1CGFA 2I47A 2JNPA 4G9LA 2QPJA 5D7WA 1FBLA 1Y0VA 1BIWA 3EDZA 5CUHA 2DW1A 1XUDA 1QUAA 3O64A 1JANA 2OW0A 4DV8A 2D1NA 1G12A 1ZTQA 1QJIA 2WOAA 1A85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HOV A;  1EUB A;  3WV3 A;  1JIW P;  4AYK A;  3P1V A;  3U1R A;  2K9C A;  4AXQ A;  830C A;  5I43 A;  3EDH A;  1QJJ A;  1BSW A;  2RJQ A;  1CAQ A;  1SAT A;  1UMS A;  4R3V A;  1K7Q A;  1UEA A;  3EWJ A;  1OM8 A;  1HY7 A;  4PKV A;  1I1I P;  4H30 A;  1XFZ A;  1MMQ A;  3WV2 A;  1GO7 P;  1AKL A;  1UTZ A;  1HFS A;  1JH1 A;  1GKC A;  1IAC A;  3CKI A;  3F19 A;  1R1I A;  4ILW D;  3VI1 A;  3EHX A;  2ERQ A;  1R55 A;  1HFC A;  2Y6D A;  1ZXC A;  3TVC A;  2AYK A;  3DSL A;  1MMR A;  3B92 A;  4GR3 A;  4XM8 A;  1JK3 A;  5I0L A;  3LK8 A;  3DNG A;  2A8H A;  3LJG A;  3OHO A;  4JP4 A;  1AF0 A;  4JA1 A;  3TSK A;  3ELM A;  2OXU A;  1R1H A;  3HY7 A;  4DPE A;  3HBU P;  1OMJ A;  1XUR A;  5I2Z A;  3LIK A;  1ND1 A;  5L79 A;  1YQY A;  4FVL A;  1HV5 A;  2OW1 A;  3HBV P;  4QKZ A;  1PWW A;  2W15 A;  2D1O A;  1R54 A;  1XFU A;  3L0V A;  2CLT A;  4CTH A;  1QIA A;  3ZVS A;  1OS2 A;  1Y8J A;  1GKD A;  3LGP A;  1CGE A;  1Z3J A;  3F17 A;  4GWM A;  3MA2 A;  4AUO A;  4JIJ A;  1IAA A;  4WK7 A;  2MLS A;  1MMP A;  2KRJ A;  1KUI A;  1ZXV A;  2OW9 A;  2WO9 A;  4XBH A;  1USN A;  2USN A;  3B2Z A;  1D8M A;  2MLR A;  3EHY A;  4GUY A;  1SRP A;  3E8R A;  2W14 A;  3RTS A;  3LUM A;  3LUN A;  4PKS A;  3HDA P;  1JJ9 A;  2DW2 A;  5D3C A;  3NX7 A;  4DF9 A;  1G4K A;  4GQL A;  2W12 A;  3HB2 P;  1PWV A;  1BKC E;  1MMB A;  3USN A;  4PKW A;  2E3X A;  2OY2 A;  1YOU A;  1XFV A;  4ZR5 A;  1I73 A;  4JPA A;  1KUH A;  2FV5 A;  2O36 A;  4IN9 A;  2YIG A;  4H76 A;  2PJT A;  1G49 A;  1CXV A;  1CK7 A;  1D7X A;  3I7I A;  1IAG A;  4GR0 A;  5BOT A;  1CGL A;  1DTH A;  2MZI A;  2O3E A;  2N8R A;  1B3D A;  456C A;  1UTT A;  2X7M A;  4I35 A;  4H49 A;  1WNI A;  1GXD A;  3N2V A;  2OW2 A;  2JIH A;  2TCL A;  2JSD A;  3F18 A;  3AIG A;  3ZXH A;  1XUC A;  2W13 A;  3F15 A;  4PKR A;  1S4B P;  1KUG A;  5LAB A;  5D1T A;  3TT4 A;  1JAP A;  2OVX A;  4FXQ A;  3V96 B;  1JAO A;  4IUW A;  4XCT A;  1KAP P;  1KBC A;  1KUF A;  2DDF A;  1R1J A;  4I03 A;  1BM6 A;  2AIG P;  1ZP5 A;  1G9K A;  1B8Y A;  2L0R A;  4L63 A;  3LQB A;  3HDB A;  1J7N A;  3HYG A;  2Y6C A;  4H82 A;  4WZV A;  5I4O A;  5B5P A;  1BKC A;  3Q2H A;  966C A;  3EDI A;  2X3B A;  3G42 A;  3TS4 A;  2OZR A;  3GBO A;  1RMZ A;  2J0T A;  1JAQ A;  1YP1 A;  1L6J A;  2HU6 A;  2WO8 A;  1GE7 A;  1EAK A;  1K7I A;  1ZS0 A;  3N2U A;  5D1U A;  1GE5 A;  3KRY A;  3P24 A;  2CKI A;  1JIZ A;  1PWQ A;  1BQO A;  1G05 A;  1SLM A;  3Q2G A;  5CZM A;  1GO8 P;  2POJ A;  1IAB A;  2OVZ A;  3AYK A;  4XM7 A;  3KMC A;  2X3A A;  1O0T A;  3LJZ A;  1GE6 A;  2J83 A;  4HMA A;  1RM8 A;  1C7K A;  5B5O A;  5I3M A;  5BPA A;  1OM7 A;  1DMT A;  1SLN A;  2DW0 A;  2X3C A;  5BOY A;  1PWU A;  1D8F A;  1Q3A A;  5I12 A;  2OI0 A;  3KEK A;  3HY9 A;  3KWV C;  4A7B A;  4L19 A;  2DDY A;  3BA0 A;  3F1A A;  2FV9 A;  1MNC A;  2JT5 A;  5D2B A;  1A86 A;  1XFY A;  1HTD A;  1I76 A;  4H84 A;  3LMC A;  3L0T A;  1UMT A;  1XFW A;  3B8Z A;  4WF6 A;  3KHI A;  1PWP A;  2SRT A;  1OO9 A;  1EB6 A;  4A3W A;  4L6T A;  4IJO A;  2JT6 A;  3OHL A;  4ON1 A;  4AIG A;  3WV1 A;  1IAD A;  1BUV M;  4HX3 A;  3DWB A;  4DD8 A;  1QIC A;  1JKY A;  3DL1 A;  3LQ0 A;  2ERP A;  1KUK A;  2MZE A;  4J4M A;  2OY4 A;  1AST A;  2Z2D A;  3F16 A;  4FU4 A;  2V4B A;  3DPE A;  5CXA A;  3EDG A;  4H1Q A;  2MZH A;  2RJP A;  2XS4 A;  4JQG A;  3LE9 A;  1XFX A;  3UVC A;  1ROS A;  3VTG A;  3LIL A;  3LIR A;  1BZS A;  1OS9 A;  2E2D A;  1H71 P;  4PKT A;  4H2E A;  5D1S A;  1D5J A;  1OM6 A;  2K2G A;  1SMP A;  4GF1 A;  3DPF A;  1ATL A;  3I7G A;  3LKA A;  3LEA A;  1BUD A;  4WKI A;  3LJT A;  3O2X A;  3KME A;  2ERO A;  5JMY A;  2XS3 A;  1Y93 A;  1CQR A;  4WKE A;  1BQQ M;  1BKC I;  4G0D A;  4PKQ A;  1ZVX A;  4FXY P;  1C3I A;  2YB9 A;  1YCM A;  3RTT A;  1AYK A;  1SU3 A;  3AYU A;  4Q1L A;  4EFS A;  3SHI A;  2OXW A;  4GR8 A;  1FM1 A;  3G5C A;  3K7L A;  2W0D A;  3KEJ A;  3K7N A;  3ZUK A;  1QIB A;  2OXZ A;  4H3X A;  1O0Q A;  5L7F A;  1FLS A;  3KEC A;  1K7G A;  1IAE A;  1C8T A;  4XM6 A;  4PKU A;  4GWN A;  1CIZ A;  5H8X A;  1CGF A;  2I47 A;  2JNP A;  4G9L A;  2QPJ A;  5D7W A;  1FBL A;  1Y0V A;  1BIW A;  3EDZ A;  5CUH A;  2DW1 A;  1XUD A;  1QUA A;  3O64 A;  1JAN A;  2OW0 A;  4DV8 A;  2D1N A;  1G12 A;  1ZTQ A;  1QJI A;  2WOA A;  1A85 A; 
#chains in the Genus database with same CATH topology
 1HOV A;  1EUB A;  3WV3 A;  1JIW P;  4AYK A;  3P1V A;  3U1R A;  2K9C A;  4AXQ A;  830C A;  5I43 A;  3EDH A;  1QJJ A;  1BSW A;  2RJQ A;  1CAQ A;  1SAT A;  1UMS A;  4R3V A;  1K7Q A;  1UEA A;  3EWJ A;  1OM8 A;  1HY7 A;  4PKV A;  1I1I P;  4H30 A;  1XFZ A;  1MMQ A;  3WV2 A;  1GO7 P;  1AKL A;  1UTZ A;  1HFS A;  1JH1 A;  1GKC A;  1IAC A;  3CKI A;  3F19 A;  1R1I A;  4ILW D;  3VI1 A;  3EHX A;  2ERQ A;  1R55 A;  1HFC A;  2Y6D A;  1ZXC A;  3TVC A;  2AYK A;  3DSL A;  1MMR A;  3B92 A;  4GR3 A;  4XM8 A;  1JK3 A;  5I0L A;  3LK8 A;  3DTI A;  3DNG A;  2A8H A;  3LJG A;  3OHO A;  4JP4 A;  1AF0 A;  4L7A A;  4JA1 A;  3TSK A;  3ELM A;  2OXU A;  1R1H A;  3HY7 A;  4DPE A;  3HBU P;  1OMJ A;  1XUR A;  5I2Z A;  3LIK A;  1ND1 A;  5L79 A;  1YQY A;  4FVL A;  1HV5 A;  2OW1 A;  3HBV P;  4QKZ A;  1PWW A;  2W15 A;  2D1O A;  1XAX A;  1R54 A;  1XFU A;  3L0V A;  2CLT A;  4CTH A;  1QIA A;  3ZVS A;  1OS2 A;  1Y8J A;  1GKD A;  3LGP A;  1CGE A;  1Z3J A;  3F17 A;  4GWM A;  3MA2 A;  4AUO A;  4JIJ A;  1IAA A;  4WK7 A;  2MLS A;  3DTE A;  1MMP A;  2KRJ A;  1KUI A;  1ZXV A;  2OW9 A;  2WO9 A;  4XBH A;  1USN A;  2USN A;  3B2Z A;  1D8M A;  2MLR A;  3EHY A;  4GUY A;  1SRP A;  3E8R A;  2W14 A;  3RTS A;  3LUM A;  3LUN A;  4PKS A;  3HDA P;  1JJ9 A;  2DW2 A;  5D3C A;  3NX7 A;  4DF9 A;  1G4K A;  4GQL A;  2W12 A;  3HB2 P;  1PWV A;  1BKC E;  1MMB A;  3USN A;  4PKW A;  2E3X A;  2OY2 A;  1YOU A;  1XFV A;  4ZR5 A;  1I73 A;  4JPA A;  1KUH A;  2FV5 A;  2O36 A;  4IN9 A;  2YIG A;  4H76 A;  2PJT A;  1G49 A;  1CXV A;  1CK7 A;  1D7X A;  3I7I A;  1IAG A;  4GR0 A;  5BOT A;  1CGL A;  1DTH A;  2MZI A;  2O3E A;  2N8R A;  1B3D A;  456C A;  1UTT A;  2X7M A;  4I35 A;  4H49 A;  1WNI A;  1GXD A;  3N2V A;  2OW2 A;  2JIH A;  2TCL A;  2JSD A;  3F18 A;  3AIG A;  3ZXH A;  1XUC A;  2W13 A;  3F15 A;  4PKR A;  1S4B P;  1KUG A;  5LAB A;  5D1T A;  3TT4 A;  1JAP A;  2OVX A;  4FXQ A;  3V96 B;  1JAO A;  4IUW A;  4XCT A;  1KAP P;  1KBC A;  1KUF A;  2DDF A;  1R1J A;  4I03 A;  1BM6 A;  2AIG P;  1ZP5 A;  1G9K A;  1B8Y A;  2L0R A;  4L63 A;  3LQB A;  3HDB A;  1J7N A;  3HYG A;  2Y6C A;  4H82 A;  4WZV A;  5I4O A;  5B5P A;  1BKC A;  3Q2H A;  966C A;  3DTK A;  3EDI A;  2X3B A;  3G42 A;  3TS4 A;  2OZR A;  1XM5 A;  3GBO A;  1RMZ A;  2J0T A;  1JAQ A;  1YP1 A;  1L6J A;  2HU6 A;  2WO8 A;  1GE7 A;  1EAK A;  1K7I A;  1ZS0 A;  3N2U A;  5D1U A;  1GE5 A;  3KRY A;  3P24 A;  2CKI A;  1JIZ A;  1PWQ A;  1BQO A;  1G05 A;  1SLM A;  3Q2G A;  5CZM A;  1GO8 P;  2POJ A;  1IAB A;  2OVZ A;  3AYK A;  4XM7 A;  3KMC A;  2X3A A;  1O0T A;  3LJZ A;  1GE6 A;  2J83 A;  4HMA A;  1RM8 A;  1C7K A;  5B5O A;  5I3M A;  5BPA A;  1OM7 A;  1DMT A;  1SLN A;  2DW0 A;  2X3C A;  5BOY A;  1PWU A;  1D8F A;  1Q3A A;  5I12 A;  2OI0 A;  3KEK A;  3HY9 A;  3KWV C;  4A7B A;  4L19 A;  2DDY A;  3BA0 A;  3F1A A;  2FV9 A;  1MNC A;  2JT5 A;  5D2B A;  1A86 A;  1XFY A;  1HTD A;  1I76 A;  4H84 A;  3LMC A;  3L0T A;  1UMT A;  1XFW A;  3B8Z A;  4WF6 A;  3KHI A;  1PWP A;  2SRT A;  1OO9 A;  1EB6 A;  4A3W A;  4L6T A;  4IJO A;  2JT6 A;  3OHL A;  4ON1 A;  4AIG A;  3WV1 A;  1IAD A;  1BUV M;  4HX3 A;  3DWB A;  4DD8 A;  1QIC A;  1JKY A;  3DL1 A;  3LQ0 A;  2ERP A;  1KUK A;  2MZE A;  4J4M A;  2OY4 A;  1AST A;  2Z2D A;  2YUF A;  3F16 A;  4FU4 A;  2V4B A;  3DPE A;  5CXA A;  3EDG A;  4H1Q A;  2MZH A;  2RJP A;  2XS4 A;  4JQG A;  3LE9 A;  1XFX A;  3UVC A;  1ROS A;  3VTG A;  3LIL A;  3LIR A;  1BZS A;  1OS9 A;  2E2D A;  1H71 P;  4PKT A;  4H2E A;  5D1S A;  1D5J A;  1OM6 A;  2K2G A;  1SMP A;  4GF1 A;  3DPF A;  1ATL A;  3I7G A;  3LKA A;  3LEA A;  1BUD A;  4WKI A;  1TVI A;  3LJT A;  3O2X A;  3KME A;  2ERO A;  5JMY A;  2XS3 A;  1Y93 A;  1CQR A;  4WKE A;  1BQQ M;  1BKC I;  4G0D A;  4PKQ A;  1ZVX A;  4FXY P;  1C3I A;  2YB9 A;  1YCM A;  3RTT A;  1AYK A;  1SU3 A;  3AYU A;  4Q1L A;  4EFS A;  3SHI A;  2OXW A;  4GR8 A;  1FM1 A;  3G5C A;  3K7L A;  2W0D A;  3KEJ A;  3K7N A;  3ZUK A;  1QIB A;  2OXZ A;  4H3X A;  1O0Q A;  5L7F A;  1FLS A;  3KEC A;  1K7G A;  1IAE A;  1C8T A;  4XM6 A;  4PKU A;  4GWN A;  1CIZ A;  5H8X A;  1CGF A;  2I47 A;  1OZ9 A;  2JNP A;  2QPJ A;  4G9L A;  1FBL A;  5D7W A;  1Y0V A;  1BIW A;  3EDZ A;  5CUH A;  2DW1 A;  1XUD A;  1QUA A;  3O64 A;  1JAN A;  2OW0 A;  4DV8 A;  2D1N A;  1G12 A;  1ZTQ A;  1QJI A;  2WOA A;  1A85 A; 
#chains in the Genus database with same CATH homology
 1HOV A;  1EUB A;  3WV3 A;  1JIW P;  4AYK A;  3P1V A;  3U1R A;  2K9C A;  4AXQ A;  830C A;  5I43 A;  3EDH A;  1QJJ A;  1BSW A;  2RJQ A;  1CAQ A;  1SAT A;  1UMS A;  4R3V A;  1K7Q A;  1UEA A;  3EWJ A;  1OM8 A;  1HY7 A;  4PKV A;  1I1I P;  4H30 A;  1XFZ A;  1MMQ A;  3WV2 A;  1GO7 P;  1AKL A;  1UTZ A;  1HFS A;  1JH1 A;  1GKC A;  1IAC A;  3CKI A;  3F19 A;  1R1I A;  4ILW D;  3VI1 A;  3EHX A;  2ERQ A;  1R55 A;  1HFC A;  2Y6D A;  1ZXC A;  3TVC A;  2AYK A;  3DSL A;  1MMR A;  3B92 A;  4GR3 A;  4XM8 A;  1JK3 A;  5I0L A;  3LK8 A;  3DTI A;  3DNG A;  2A8H A;  3LJG A;  3OHO A;  4JP4 A;  1AF0 A;  4L7A A;  4JA1 A;  3TSK A;  3ELM A;  2OXU A;  1R1H A;  3HY7 A;  4DPE A;  3HBU P;  1OMJ A;  1XUR A;  5I2Z A;  3LIK A;  1ND1 A;  5L79 A;  1YQY A;  4FVL A;  1HV5 A;  2OW1 A;  3HBV P;  4QKZ A;  1PWW A;  2W15 A;  2D1O A;  1R54 A;  1XFU A;  3L0V A;  2CLT A;  4CTH A;  1QIA A;  3ZVS A;  1OS2 A;  1Y8J A;  1GKD A;  3LGP A;  1CGE A;  1Z3J A;  3F17 A;  4GWM A;  3MA2 A;  4AUO A;  4JIJ A;  1IAA A;  4WK7 A;  2MLS A;  3DTE A;  1MMP A;  2KRJ A;  1KUI A;  1ZXV A;  2OW9 A;  2WO9 A;  4XBH A;  1USN A;  2USN A;  3B2Z A;  1D8M A;  2MLR A;  3EHY A;  4GUY A;  1SRP A;  3E8R A;  2W14 A;  3RTS A;  3LUM A;  3LUN A;  4PKS A;  3HDA P;  1JJ9 A;  2DW2 A;  5D3C A;  3NX7 A;  4DF9 A;  1G4K A;  4GQL A;  2W12 A;  3HB2 P;  1PWV A;  1BKC E;  1MMB A;  3USN A;  4PKW A;  2E3X A;  2OY2 A;  1YOU A;  1XFV A;  4ZR5 A;  1I73 A;  4JPA A;  1KUH A;  2FV5 A;  2O36 A;  4IN9 A;  2YIG A;  4H76 A;  2PJT A;  1G49 A;  1CXV A;  1CK7 A;  1D7X A;  3I7I A;  1IAG A;  4GR0 A;  5BOT A;  1CGL A;  1DTH A;  2MZI A;  2O3E A;  2N8R A;  1B3D A;  456C A;  1UTT A;  2X7M A;  4I35 A;  4H49 A;  1WNI A;  1GXD A;  3N2V A;  2OW2 A;  2JIH A;  2TCL A;  2JSD A;  3F18 A;  3AIG A;  3ZXH A;  1XUC A;  2W13 A;  3F15 A;  4PKR A;  1S4B P;  1KUG A;  5LAB A;  5D1T A;  3TT4 A;  1JAP A;  2OVX A;  4FXQ A;  3V96 B;  1JAO A;  4IUW A;  4XCT A;  1KAP P;  1KBC A;  1KUF A;  2DDF A;  1R1J A;  4I03 A;  1BM6 A;  2AIG P;  1ZP5 A;  1G9K A;  1B8Y A;  2L0R A;  4L63 A;  3LQB A;  3HDB A;  1J7N A;  3HYG A;  2Y6C A;  4H82 A;  4WZV A;  5I4O A;  5B5P A;  1BKC A;  3Q2H A;  966C A;  3DTK A;  3EDI A;  2X3B A;  3G42 A;  3TS4 A;  2OZR A;  3GBO A;  1RMZ A;  2J0T A;  1JAQ A;  1YP1 A;  1L6J A;  2HU6 A;  2WO8 A;  1GE7 A;  1EAK A;  1K7I A;  1ZS0 A;  3N2U A;  5D1U A;  1GE5 A;  3KRY A;  3P24 A;  2CKI A;  1JIZ A;  1PWQ A;  1BQO A;  1G05 A;  1SLM A;  3Q2G A;  5CZM A;  1GO8 P;  2POJ A;  1IAB A;  2OVZ A;  3AYK A;  4XM7 A;  3KMC A;  2X3A A;  1O0T A;  3LJZ A;  1GE6 A;  2J83 A;  4HMA A;  1RM8 A;  1C7K A;  5B5O A;  5I3M A;  5BPA A;  1OM7 A;  1DMT A;  1SLN A;  2DW0 A;  2X3C A;  5BOY A;  1PWU A;  1D8F A;  1Q3A A;  5I12 A;  2OI0 A;  3KEK A;  3HY9 A;  3KWV C;  4A7B A;  4L19 A;  2DDY A;  3BA0 A;  3F1A A;  2FV9 A;  1MNC A;  2JT5 A;  5D2B A;  1A86 A;  1XFY A;  1HTD A;  1I76 A;  4H84 A;  3LMC A;  3L0T A;  1UMT A;  1XFW A;  3B8Z A;  4WF6 A;  3KHI A;  1PWP A;  2SRT A;  1OO9 A;  1EB6 A;  4A3W A;  4L6T A;  4IJO A;  2JT6 A;  3OHL A;  4ON1 A;  4AIG A;  3WV1 A;  1IAD A;  1BUV M;  4HX3 A;  3DWB A;  4DD8 A;  1QIC A;  1JKY A;  3DL1 A;  3LQ0 A;  2ERP A;  1KUK A;  2MZE A;  4J4M A;  2OY4 A;  1AST A;  2Z2D A;  2YUF A;  3F16 A;  4FU4 A;  2V4B A;  3DPE A;  5CXA A;  3EDG A;  4H1Q A;  2MZH A;  2RJP A;  2XS4 A;  4JQG A;  3LE9 A;  1XFX A;  3UVC A;  1ROS A;  3VTG A;  3LIL A;  3LIR A;  1BZS A;  1OS9 A;  2E2D A;  1H71 P;  4PKT A;  4H2E A;  5D1S A;  1D5J A;  1OM6 A;  2K2G A;  1SMP A;  4GF1 A;  3DPF A;  1ATL A;  3I7G A;  3LKA A;  3LEA A;  1BUD A;  4WKI A;  3LJT A;  3O2X A;  3KME A;  2ERO A;  5JMY A;  2XS3 A;  1Y93 A;  1CQR A;  4WKE A;  1BQQ M;  1BKC I;  4G0D A;  4PKQ A;  1ZVX A;  4FXY P;  1C3I A;  2YB9 A;  1YCM A;  3RTT A;  1AYK A;  1SU3 A;  3AYU A;  4Q1L A;  4EFS A;  3SHI A;  2OXW A;  4GR8 A;  1FM1 A;  3G5C A;  3K7L A;  2W0D A;  3KEJ A;  3K7N A;  3ZUK A;  1QIB A;  2OXZ A;  4H3X A;  1O0Q A;  5L7F A;  1FLS A;  3KEC A;  1K7G A;  1IAE A;  1C8T A;  4XM6 A;  4PKU A;  4GWN A;  1CIZ A;  5H8X A;  1CGF A;  2I47 A;  2JNP A;  4G9L A;  2QPJ A;  5D7W A;  1FBL A;  1Y0V A;  1BIW A;  3EDZ A;  5CUH A;  2DW1 A;  1XUD A;  1QUA A;  3O64 A;  1JAN A;  2OW0 A;  4DV8 A;  2D1N A;  1G12 A;  1ZTQ A;  1QJI A;  2WOA A;  1A85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...