3LQ0A

Zymogen structure of crayfish astacin metallopeptidase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
b'SPIIPEAARALYYNDGMFEGDIKLRAGRQPARVGAAILGDEYLWSGGVIPYTFAGVSGADQSAILSGMQELEEKTCIRFVPRTTESDYVEIFTSGSGCWSYVGRISGAQQVSLQANGCVYHGTILHALMHAIGFYHEHTRMDRDNYVTINYQNVDPSMTSNFDIDTYSRYVGEDYQYYSIMHYGKYSFSIQWGVLETIVPLQNGIDLTDPYDKAHMLQTDANQINNLYTNECSLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ProAstacin
publication title Proenzyme structure and activation of astacin metallopeptidase
pubmed doi rcsb
source organism Astacus astacus
molecule tags Hydrolase
total genus 65
structure length 235
sequence length 235
ec nomenclature ec 3.4.24.21: Astacin.
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lq0A00
3USNA 1QIAA 1RM8A 4JA1A 1KUKA 3Q2HA 3KMCA 2KRJA 1Y8JA 1UMTA 5LABA 5CZMA 3ZXHA 3HY9A 1XFWA 1SU3A 1HOVA 1UTZA 3LKAA 5L79A 2CKIA 2A8HA 1FLSA 1UTTA 1YP1A 2CLTA 3U1RA 2D1OA 1OO9A 4A3WA 3LIRA 3OHOA 2O3EA 1KUHA 2MZEA 4IN9A 3CKIA 2FV9A 2J83A 1G12A 4DF9A 4H3XA 2OXWA 1MMRA 4H30A 2V4BA 1SMPA 2W15A 3LMCA 4FVLA 2J0TA 4FXQA 4DPEA 1PWVA 1HTDA 1G49A 1SRPA 1GE5A 1BUVM 3LJGA 2K2GA 1XUCA 4H84A 2OXZA 4PKWA 3EDGA 4G9LA 1OM8A 2EROA 1OS2A 3N2UA 2W14A 2DDFA 5I0LA 2HU6A 1R54A 1USNA 1DTHA 3EDZA 4H49A 1GE6A 4JP4A 456CA 1H71P 1ZXCA 4GR0A 4L6TA 2WO8A 4PKQA 1CK7A 2WO9A 1KUGA 4DD8A 1CXVA 1XUDA 1I1IP 3B8ZA 1CGEA 1BIWA 4GWMA 4GR8A 966CA 2PJTA 4IJOA 4HX3A 1R55A 5BOYA 1Y0VA 2E3XA 1OM6A 4H1QA 1JAOA 3F19A 4PKTA 4ZR5A 5D1SA 1OM7A 1SLNA 3F17A 4AUOA 1ZS0A 3P24A 4JQGA 2OY4A 3K7LA 1XFYA 1QUAA 4IUWA 1RMZA 3OHLA 2YIGA 4EFSA 1XFZA 1IAEA 3AIGA 1IACA 1XURA 1G9KA 4FU4A 1ZVXA 3K7NA 2L0RA 4WKIA 4Q1LA 1ROSA 1ZTQA 1PWPA 3MA2A 3LILA 4GQLA 4PKVA 5CUHA 5D2BA 1ATLA 3VTGA 4PKUA 1BQOA 4GWNA 5D7WA 2XS3A 4XM8A 3N2VA 1K7GA 3NX7A 1KUFA 3LUNA 2AYKA 2OY2A 5BPAA 2X3CA 1JIZA 1QJJA 5CXAA 3L0TA 4ILWD 2K9CA 1PWWA 1G4KA 2RJQA 3F18A 1L6JA 1MMQA 5I12A 1DMTA 3HDAP 1MNCA 1O0QA 4J4MA 3KEJA 1EB6A 1I73A 5BOTA 4H2EA 1Z3JA 4A7BA 1BZSA 1ND1A 1SATA 4R3VA 2N8RA 1QICA 5D3CA 1ZP5A 3WV2A 1D7XA 1BKCI 2YB9A 2TCLA 2O36A 1R1JA 1YOUA 1BQQM 1JANA 1Y93A 3G5CA 1QJIA 4QKZA 3DPEA 3LQ0A 3KECA 3TVCA 2OW0A 2X3BA 1AKLA 1CIZA 5I43A 2JSDA 1KAPP 1PWQA 3F1AA 2MLRA 2X7MA 3KHIA 5JMYA 1XFXA 4H82A 4ON1A 3DPFA 4WZVA 2DW2A 2JT5A 2DDYA 5I2ZA 3DSLA 3ELMA 3LE9A 3EHYA 3EHXA 1GXDA 1O0TA 4AXQA 3KWVC 2USNA 1A86A 2JNPA 5L7FA 2AIGP 1CGLA 3O2XA 3LJZA 1JAQA 1D8FA 1J7NA 3E8RA 1WNIA 1CQRA 2DW1A 2MZHA 3HBVP 1S4BP 3B92A 2DW0A 3LGPA 1XFVA 4H76A 4XM7A 1ZXVA 1FM1A 3RTTA 1YQYA 1JAPA 4XCTA 3LIKA 2RJPA 3TS4A 1G05A 3TSKA 1D8MA 3ZUKA 1HV5A 4PKSA 1Q3AA 4DV8A 3EWJA 1IADA 2FV5A 1SLMA 4JPAA 2OVZA 2JIHA 2W13A 3ZVSA 2OW1A 2W12A 1CAQA 2OW9A 1JKYA 1D5JA 1ASTA 1C3IA 3VI1A 3F15A 3TT4A 4I03A 3V96B 3LK8A 2Z2DA 830CA 1IAAA 3HY7A 2MZIA 2Y6DA 2ERQA 4AIGA 3LUMA 3LEAA 1UMSA 1XFUA 3AYUA 4XM6A 3O64A 3UVCA 4WK7A 1KUIA 4JIJA 2OVXA 1A85A 1OS9A 3WV1A 3HB2P 2E2DA 2JT6A 1GO8P 3L0VA 1CGFA 1JK3A 2WOAA 1AF0A 3F16A 4L63A 1EAKA 3LJTA 1FBLA 2W0DA 1C7KA 1BM6A 5B5OA 1OMJA 1K7IA 5D1UA 3KEKA 2OZRA 3B2ZA 2OW2A 1GKCA 3I7GA 1BKCE 2XS4A 1YCMA 1MMBA 1R1IA 4GF1A 3DL1A 1HFCA 1I76A 5I4OA 1UEAA 1EUBA 1BKCA 4HMAA 3EDHA 4G0DA 4AYKA 2ERPA 2I47A 1C8TA 1PWUA 3I7IA 1JIWP 4XBHA 5B5PA 2D1NA 3BA0A 1IAGA 2QPJA 3DNGA 5D1TA 5I3MA 3HYGA 4CTHA 4I35A 1JJ9A 4GUYA 1B8YA 1IABA 3G42A 1GO7P 3HBUP 3P1VA 1AYKA 1HFSA 3GBOA 3WV3A 1KBCA 3LQBA 4PKRA 4GR3A 1GKDA 3DWBA 3AYKA 2SRTA 3KMEA 1HY7A 1BUDA 3SHIA 3RTSA 1QIBA 4FXYP 1GE7A 3Q2GA 2OI0A 4L19A 2X3AA 2OXUA 4WF6A 1MMPA 1BSWA 1K7QA 3HDBA 5H8XA 1JH1A 1B3DA 2Y6CA 2MLSA 4WKEA 3EDIA 3KRYA 2POJA 1R1HA
chains in the Genus database with same CATH superfamily
3USNA 1QIAA 1RM8A 4JA1A 1KUKA 3Q2HA 3KMCA 2KRJA 1Y8JA 1UMTA 5LABA 5CZMA 3ZXHA 3HY9A 1XFWA 1SU3A 1HOVA 1UTZA 3LKAA 5L79A 2CKIA 2A8HA 1FLSA 1UTTA 1YP1A 2CLTA 3U1RA 2D1OA 1OO9A 4A3WA 3LIRA 3OHOA 2O3EA 1KUHA 2MZEA 4IN9A 3CKIA 2FV9A 2J83A 1G12A 4DF9A 4L7AA 4H3XA 2OXWA 1MMRA 4H30A 2V4BA 1SMPA 2W15A 3LMCA 4FVLA 2J0TA 4FXQA 4DPEA 1PWVA 1HTDA 1G49A 1SRPA 1GE5A 1BUVM 3LJGA 2K2GA 1XUCA 4H84A 2OXZA 4PKWA 3EDGA 4G9LA 1OM8A 2EROA 1OS2A 3N2UA 2W14A 2DDFA 5I0LA 2HU6A 1R54A 1USNA 1DTHA 3EDZA 4H49A 1GE6A 4JP4A 456CA 1H71P 1ZXCA 4GR0A 4L6TA 2WO8A 4PKQA 1CK7A 2WO9A 1KUGA 4DD8A 1CXVA 1XUDA 1I1IP 3B8ZA 1CGEA 1OZ9A 1BIWA 4GWMA 4GR8A 966CA 2PJTA 4IJOA 4HX3A 1R55A 5BOYA 1Y0VA 2E3XA 1OM6A 4H1QA 1JAOA 3F19A 4PKTA 4ZR5A 5D1SA 1OM7A 1SLNA 3F17A 4AUOA 1ZS0A 3P24A 4JQGA 2OY4A 3K7LA 1XFYA 1QUAA 4IUWA 1RMZA 3OHLA 2YIGA 4EFSA 1XFZA 1IAEA 3AIGA 1IACA 1XURA 1G9KA 4FU4A 1ZVXA 3K7NA 2L0RA 4WKIA 4Q1LA 1ROSA 1ZTQA 1PWPA 3MA2A 3LILA 4GQLA 4PKVA 5CUHA 5D2BA 1ATLA 3VTGA 4PKUA 1BQOA 4GWNA 5D7WA 2XS3A 4XM8A 3N2VA 1K7GA 3NX7A 1KUFA 3LUNA 2AYKA 2OY2A 5BPAA 2X3CA 1JIZA 1QJJA 5CXAA 3L0TA 4ILWD 2K9CA 1PWWA 1G4KA 2RJQA 3F18A 1L6JA 1MMQA 5I12A 1DMTA 3HDAP 1MNCA 1O0QA 4J4MA 3KEJA 1EB6A 1I73A 5BOTA 4H2EA 1Z3JA 4A7BA 1BZSA 1ND1A 1SATA 4R3VA 2N8RA 1QICA 5D3CA 1ZP5A 3WV2A 1D7XA 1BKCI 2YB9A 2TCLA 2O36A 1R1JA 1YOUA 1BQQM 1JANA 1Y93A 3G5CA 1QJIA 4QKZA 3DPEA 3LQ0A 3KECA 3TVCA 2OW0A 2X3BA 1AKLA 1CIZA 5I43A 2JSDA 1KAPP 3DTEA 1PWQA 3F1AA 2MLRA 2X7MA 3KHIA 5JMYA 1XFXA 4H82A 4ON1A 3DPFA 4WZVA 2DW2A 2JT5A 2DDYA 5I2ZA 3DSLA 3ELMA 3LE9A 3EHYA 3EHXA 1GXDA 1O0TA 4AXQA 3KWVC 2USNA 1A86A 2JNPA 5L7FA 2AIGP 1CGLA 3O2XA 1XM5A 3LJZA 1JAQA 1D8FA 1J7NA 3E8RA 1WNIA 1CQRA 2DW1A 2MZHA 1XAXA 3HBVP 1S4BP 3B92A 2DW0A 3LGPA 1XFVA 4H76A 4XM7A 1ZXVA 1FM1A 3RTTA 1YQYA 1JAPA 4XCTA 3LIKA 2RJPA 3TS4A 1G05A 3TSKA 1D8MA 3ZUKA 1HV5A 4PKSA 1Q3AA 4DV8A 3EWJA 1IADA 2FV5A 1SLMA 2YUFA 4JPAA 2OVZA 3DTIA 2JIHA 2W13A 3ZVSA 2OW1A 2W12A 1CAQA 2OW9A 1JKYA 1D5JA 1ASTA 1C3IA 3VI1A 3F15A 3TT4A 4I03A 3V96B 3LK8A 2Z2DA 830CA 1IAAA 3HY7A 2MZIA 2Y6DA 2ERQA 4AIGA 3LUMA 3LEAA 1UMSA 1XFUA 3AYUA 4XM6A 3O64A 3UVCA 4WK7A 1KUIA 4JIJA 2OVXA 1A85A 1OS9A 3WV1A 3HB2P 2E2DA 2JT6A 1GO8P 3L0VA 1CGFA 1JK3A 2WOAA 1AF0A 3F16A 1TVIA 4L63A 1EAKA 3LJTA 1FBLA 2W0DA 1C7KA 1BM6A 5B5OA 1OMJA 1K7IA 5D1UA 3KEKA 2OZRA 3B2ZA 2OW2A 1GKCA 3I7GA 1BKCE 2XS4A 1YCMA 1MMBA 1R1IA 4GF1A 3DL1A 1HFCA 1I76A 5I4OA 1UEAA 1EUBA 1BKCA 4HMAA 3EDHA 4G0DA 3DTKA 4AYKA 2ERPA 2I47A 1C8TA 1PWUA 3I7IA 1JIWP 4XBHA 5B5PA 2D1NA 3BA0A 1IAGA 2QPJA 3DNGA 5D1TA 5I3MA 3HYGA 4CTHA 4I35A 1JJ9A 4GUYA 1B8YA 1IABA 3G42A 1GO7P 3HBUP 3P1VA 1AYKA 1HFSA 3GBOA 3WV3A 1KBCA 3LQBA 4PKRA 4GR3A 1GKDA 3DWBA 3AYKA 2SRTA 3KMEA 1HY7A 1BUDA 3SHIA 3RTSA 1QIBA 4FXYP 1GE7A 3Q2GA 2OI0A 4L19A 2X3AA 2OXUA 4WF6A 1MMPA 1BSWA 1K7QA 3HDBA 5H8XA 1JH1A 1B3DA 2Y6CA 2MLSA 4WKEA 3EDIA 3KRYA 2POJA 1R1HA
chains in the Genus database with same CATH topology
3USNA 1QIAA 1RM8A 4JA1A 1KUKA 3Q2HA 3KMCA 2KRJA 1Y8JA 1UMTA 5LABA 5CZMA 3ZXHA 3HY9A 1XFWA 1SU3A 1HOVA 1UTZA 3LKAA 5L79A 2CKIA 2A8HA 1FLSA 1UTTA 1YP1A 2CLTA 3U1RA 2D1OA 1OO9A 4A3WA 3LIRA 3OHOA 2O3EA 1KUHA 2MZEA 4IN9A 3CKIA 2FV9A 2J83A 1G12A 4DF9A 4L7AA 4H3XA 2OXWA 1MMRA 4H30A 2V4BA 1SMPA 2W15A 3LMCA 4FVLA 2J0TA 4FXQA 4DPEA 1PWVA 1HTDA 1G49A 1SRPA 1GE5A 1BUVM 3LJGA 2K2GA 1XUCA 4H84A 2OXZA 4PKWA 3EDGA 4G9LA 1OM8A 2EROA 1OS2A 3N2UA 2W14A 2DDFA 5I0LA 2HU6A 1R54A 1USNA 1DTHA 3EDZA 4H49A 1GE6A 4JP4A 456CA 1H71P 1ZXCA 4GR0A 4L6TA 2WO8A 4PKQA 1CK7A 2WO9A 1KUGA 4DD8A 1CXVA 1XUDA 1I1IP 3B8ZA 1CGEA 1BIWA 4GWMA 4GR8A 966CA 2PJTA 4IJOA 4HX3A 1R55A 5BOYA 1Y0VA 2E3XA 1OM6A 4H1QA 1JAOA 3F19A 4PKTA 4ZR5A 5D1SA 1OM7A 1SLNA 3F17A 4AUOA 1ZS0A 3P24A 4JQGA 2OY4A 3K7LA 1XFYA 1QUAA 4IUWA 1RMZA 3OHLA 2YIGA 4EFSA 1XFZA 1IAEA 3AIGA 1IACA 1XURA 1G9KA 4FU4A 1ZVXA 3K7NA 2L0RA 4WKIA 4Q1LA 1ROSA 1ZTQA 1PWPA 3MA2A 3LILA 4GQLA 4PKVA 5CUHA 5D2BA 1ATLA 3VTGA 4PKUA 1BQOA 4GWNA 5D7WA 2XS3A 4XM8A 3N2VA 1K7GA 3NX7A 1KUFA 3LUNA 2AYKA 2OY2A 5BPAA 2X3CA 1JIZA 1QJJA 5CXAA 3L0TA 4ILWD 2K9CA 1PWWA 1G4KA 2RJQA 3F18A 1L6JA 1MMQA 5I12A 1DMTA 3HDAP 1MNCA 1O0QA 4J4MA 3KEJA 1EB6A 1I73A 5BOTA 4H2EA 1Z3JA 4A7BA 1BZSA 1ND1A 1SATA 4R3VA 2N8RA 1QICA 5D3CA 1ZP5A 3WV2A 1D7XA 1BKCI 2YB9A 2TCLA 2O36A 1R1JA 1YOUA 1BQQM 1JANA 1Y93A 3G5CA 1QJIA 4QKZA 3DPEA 3LQ0A 3KECA 3TVCA 2OW0A 2X3BA 1AKLA 1CIZA 5I43A 2JSDA 1KAPP 3DTEA 1PWQA 3F1AA 2MLRA 2X7MA 3KHIA 5JMYA 1XFXA 4H82A 4ON1A 3DPFA 4WZVA 2DW2A 2JT5A 2DDYA 5I2ZA 3DSLA 3ELMA 3LE9A 3EHYA 3EHXA 1GXDA 1O0TA 4AXQA 3KWVC 2USNA 1A86A 2JNPA 5L7FA 2AIGP 1CGLA 3O2XA 3LJZA 1JAQA 1D8FA 1J7NA 3E8RA 1WNIA 1CQRA 2DW1A 2MZHA 3HBVP 1S4BP 3B92A 2DW0A 3LGPA 1XFVA 4H76A 4XM7A 1ZXVA 1FM1A 3RTTA 1YQYA 1JAPA 4XCTA 3LIKA 2RJPA 3TS4A 1G05A 3TSKA 1D8MA 3ZUKA 1HV5A 4PKSA 1Q3AA 4DV8A 3EWJA 1IADA 2FV5A 1SLMA 2YUFA 4JPAA 2OVZA 3DTIA 2JIHA 2W13A 3ZVSA 2OW1A 2W12A 1CAQA 2OW9A 1JKYA 1D5JA 1ASTA 1C3IA 3VI1A 3F15A 3TT4A 4I03A 3V96B 3LK8A 2Z2DA 830CA 1IAAA 3HY7A 2MZIA 2Y6DA 2ERQA 4AIGA 3LUMA 3LEAA 1UMSA 1XFUA 3AYUA 4XM6A 3O64A 3UVCA 4WK7A 1KUIA 4JIJA 2OVXA 1A85A 1OS9A 3WV1A 3HB2P 2E2DA 2JT6A 1GO8P 3L0VA 1CGFA 1JK3A 2WOAA 1AF0A 3F16A 4L63A 1EAKA 3LJTA 1FBLA 2W0DA 1C7KA 1BM6A 5B5OA 1OMJA 1K7IA 5D1UA 3KEKA 2OZRA 3B2ZA 2OW2A 1GKCA 3I7GA 1BKCE 2XS4A 1YCMA 1MMBA 1R1IA 4GF1A 3DL1A 1HFCA 1I76A 5I4OA 1UEAA 1EUBA 1BKCA 4HMAA 3EDHA 4G0DA 3DTKA 4AYKA 2ERPA 2I47A 1C8TA 1PWUA 3I7IA 1JIWP 4XBHA 5B5PA 2D1NA 3BA0A 1IAGA 2QPJA 3DNGA 5D1TA 5I3MA 3HYGA 4CTHA 4I35A 1JJ9A 4GUYA 1B8YA 1IABA 3G42A 1GO7P 3HBUP 3P1VA 1AYKA 1HFSA 3GBOA 3WV3A 1KBCA 3LQBA 4PKRA 4GR3A 1GKDA 3DWBA 3AYKA 2SRTA 3KMEA 1HY7A 1BUDA 3SHIA 3RTSA 1QIBA 4FXYP 1GE7A 3Q2GA 2OI0A 4L19A 2X3AA 2OXUA 4WF6A 1MMPA 1BSWA 1K7QA 3HDBA 5H8XA 1JH1A 1B3DA 2Y6CA 2MLSA 4WKEA 3EDIA 3KRYA 2POJA 1R1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USN A;  1QIA A;  1RM8 A;  4JA1 A;  1KUK A;  3Q2H A;  3KMC A;  2KRJ A;  1Y8J A;  1UMT A;  5LAB A;  5CZM A;  3ZXH A;  3HY9 A;  1XFW A;  1SU3 A;  1HOV A;  1UTZ A;  3LKA A;  5L79 A;  2CKI A;  2A8H A;  1FLS A;  1UTT A;  1YP1 A;  2CLT A;  3U1R A;  2D1O A;  1OO9 A;  4A3W A;  3LIR A;  3OHO A;  2O3E A;  1KUH A;  2MZE A;  4IN9 A;  3CKI A;  2FV9 A;  2J83 A;  1G12 A;  4DF9 A;  4H3X A;  2OXW A;  1MMR A;  4H30 A;  2V4B A;  1SMP A;  2W15 A;  3LMC A;  4FVL A;  2J0T A;  4FXQ A;  4DPE A;  1PWV A;  1HTD A;  1G49 A;  1SRP A;  1GE5 A;  1BUV M;  3LJG A;  2K2G A;  1XUC A;  4H84 A;  2OXZ A;  4PKW A;  3EDG A;  4G9L A;  1OM8 A;  2ERO A;  1OS2 A;  3N2U A;  2W14 A;  2DDF A;  5I0L A;  2HU6 A;  1R54 A;  1USN A;  1DTH A;  3EDZ A;  4H49 A;  1GE6 A;  4JP4 A;  456C A;  1H71 P;  1ZXC A;  4GR0 A;  4L6T A;  2WO8 A;  4PKQ A;  1CK7 A;  2WO9 A;  1KUG A;  4DD8 A;  1CXV A;  1XUD A;  1I1I P;  3B8Z A;  1CGE A;  1BIW A;  4GWM A;  4GR8 A;  966C A;  2PJT A;  4IJO A;  4HX3 A;  1R55 A;  5BOY A;  1Y0V A;  2E3X A;  1OM6 A;  4H1Q A;  1JAO A;  3F19 A;  4PKT A;  4ZR5 A;  5D1S A;  1OM7 A;  1SLN A;  3F17 A;  4AUO A;  1ZS0 A;  3P24 A;  4JQG A;  2OY4 A;  3K7L A;  1XFY A;  1QUA A;  4IUW A;  1RMZ A;  3OHL A;  2YIG A;  4EFS A;  1XFZ A;  1IAE A;  3AIG A;  1IAC A;  1XUR A;  1G9K A;  4FU4 A;  1ZVX A;  3K7N A;  2L0R A;  4WKI A;  4Q1L A;  1ROS A;  1ZTQ A;  1PWP A;  3MA2 A;  3LIL A;  4GQL A;  4PKV A;  5CUH A;  5D2B A;  1ATL A;  3VTG A;  4PKU A;  1BQO A;  4GWN A;  5D7W A;  2XS3 A;  4XM8 A;  3N2V A;  1K7G A;  3NX7 A;  1KUF A;  3LUN A;  2AYK A;  2OY2 A;  5BPA A;  2X3C A;  1JIZ A;  1QJJ A;  5CXA A;  3L0T A;  4ILW D;  2K9C A;  1PWW A;  1G4K A;  2RJQ A;  3F18 A;  1L6J A;  1MMQ A;  5I12 A;  1DMT A;  3HDA P;  1MNC A;  1O0Q A;  4J4M A;  3KEJ A;  1EB6 A;  1I73 A;  5BOT A;  4H2E A;  1Z3J A;  4A7B A;  1BZS A;  1ND1 A;  1SAT A;  4R3V A;  2N8R A;  1QIC A;  5D3C A;  1ZP5 A;  3WV2 A;  1D7X A;  1BKC I;  2YB9 A;  2TCL A;  2O36 A;  1R1J A;  1YOU A;  1BQQ M;  1JAN A;  1Y93 A;  3G5C A;  1QJI A;  4QKZ A;  3DPE A;  3LQ0 A;  3KEC A;  3TVC A;  2OW0 A;  2X3B A;  1AKL A;  1CIZ A;  5I43 A;  2JSD A;  1KAP P;  1PWQ A;  3F1A A;  2MLR A;  2X7M A;  3KHI A;  5JMY A;  1XFX A;  4H82 A;  4ON1 A;  3DPF A;  4WZV A;  2DW2 A;  2JT5 A;  2DDY A;  5I2Z A;  3DSL A;  3ELM A;  3LE9 A;  3EHY A;  3EHX A;  1GXD A;  1O0T A;  4AXQ A;  3KWV C;  2USN A;  1A86 A;  2JNP A;  5L7F A;  2AIG P;  1CGL A;  3O2X A;  3LJZ A;  1JAQ A;  1D8F A;  1J7N A;  3E8R A;  1WNI A;  1CQR A;  2DW1 A;  2MZH A;  3HBV P;  1S4B P;  3B92 A;  2DW0 A;  3LGP A;  1XFV A;  4H76 A;  4XM7 A;  1ZXV A;  1FM1 A;  3RTT A;  1YQY A;  1JAP A;  4XCT A;  3LIK A;  2RJP A;  3TS4 A;  1G05 A;  3TSK A;  1D8M A;  3ZUK A;  1HV5 A;  4PKS A;  1Q3A A;  4DV8 A;  3EWJ A;  1IAD A;  2FV5 A;  1SLM A;  4JPA A;  2OVZ A;  2JIH A;  2W13 A;  3ZVS A;  2OW1 A;  2W12 A;  1CAQ A;  2OW9 A;  1JKY A;  1D5J A;  1AST A;  1C3I A;  3VI1 A;  3F15 A;  3TT4 A;  4I03 A;  3V96 B;  3LK8 A;  2Z2D A;  830C A;  1IAA A;  3HY7 A;  2MZI A;  2Y6D A;  2ERQ A;  4AIG A;  3LUM A;  3LEA A;  1UMS A;  1XFU A;  3AYU A;  4XM6 A;  3O64 A;  3UVC A;  4WK7 A;  1KUI A;  4JIJ A;  2OVX A;  1A85 A;  1OS9 A;  3WV1 A;  3HB2 P;  2E2D A;  2JT6 A;  1GO8 P;  3L0V A;  1CGF A;  1JK3 A;  2WOA A;  1AF0 A;  3F16 A;  4L63 A;  1EAK A;  3LJT A;  1FBL A;  2W0D A;  1C7K A;  1BM6 A;  5B5O A;  1OMJ A;  1K7I A;  5D1U A;  3KEK A;  2OZR A;  3B2Z A;  2OW2 A;  1GKC A;  3I7G A;  1BKC E;  2XS4 A;  1YCM A;  1MMB A;  1R1I A;  4GF1 A;  3DL1 A;  1HFC A;  1I76 A;  5I4O A;  1UEA A;  1EUB A;  1BKC A;  4HMA A;  3EDH A;  4G0D A;  4AYK A;  2ERP A;  2I47 A;  1C8T A;  1PWU A;  3I7I A;  1JIW P;  4XBH A;  5B5P A;  2D1N A;  3BA0 A;  1IAG A;  2QPJ A;  3DNG A;  5D1T A;  5I3M A;  3HYG A;  4CTH A;  4I35 A;  1JJ9 A;  4GUY A;  1B8Y A;  1IAB A;  3G42 A;  1GO7 P;  3HBU P;  3P1V A;  1AYK A;  1HFS A;  3GBO A;  3WV3 A;  1KBC A;  3LQB A;  4PKR A;  4GR3 A;  1GKD A;  3DWB A;  3AYK A;  2SRT A;  3KME A;  1HY7 A;  1BUD A;  3SHI A;  3RTS A;  1QIB A;  4FXY P;  1GE7 A;  3Q2G A;  2OI0 A;  4L19 A;  2X3A A;  2OXU A;  4WF6 A;  1MMP A;  1BSW A;  1K7Q A;  3HDB A;  5H8X A;  1JH1 A;  1B3D A;  2Y6C A;  2MLS A;  4WKE A;  3EDI A;  3KRY A;  2POJ A;  1R1H A; 
#chains in the Genus database with same CATH topology
 3USN A;  1QIA A;  1RM8 A;  4JA1 A;  1KUK A;  3Q2H A;  3KMC A;  2KRJ A;  1Y8J A;  1UMT A;  5LAB A;  5CZM A;  3ZXH A;  3HY9 A;  1XFW A;  1SU3 A;  1HOV A;  1UTZ A;  3LKA A;  5L79 A;  2CKI A;  2A8H A;  1FLS A;  1UTT A;  1YP1 A;  2CLT A;  3U1R A;  2D1O A;  1OO9 A;  4A3W A;  3LIR A;  3OHO A;  2O3E A;  1KUH A;  2MZE A;  4IN9 A;  3CKI A;  2FV9 A;  2J83 A;  1G12 A;  4DF9 A;  4L7A A;  4H3X A;  2OXW A;  1MMR A;  4H30 A;  2V4B A;  1SMP A;  2W15 A;  3LMC A;  4FVL A;  2J0T A;  4FXQ A;  4DPE A;  1PWV A;  1HTD A;  1G49 A;  1SRP A;  1GE5 A;  1BUV M;  3LJG A;  2K2G A;  1XUC A;  4H84 A;  2OXZ A;  4PKW A;  3EDG A;  4G9L A;  1OM8 A;  2ERO A;  1OS2 A;  3N2U A;  2W14 A;  2DDF A;  5I0L A;  2HU6 A;  1R54 A;  1USN A;  1DTH A;  3EDZ A;  4H49 A;  1GE6 A;  4JP4 A;  456C A;  1H71 P;  1ZXC A;  4GR0 A;  4L6T A;  2WO8 A;  4PKQ A;  1CK7 A;  2WO9 A;  1KUG A;  4DD8 A;  1CXV A;  1XUD A;  1I1I P;  3B8Z A;  1CGE A;  1OZ9 A;  1BIW A;  4GWM A;  4GR8 A;  966C A;  2PJT A;  4IJO A;  4HX3 A;  1R55 A;  5BOY A;  1Y0V A;  2E3X A;  1OM6 A;  4H1Q A;  1JAO A;  3F19 A;  4PKT A;  4ZR5 A;  5D1S A;  1OM7 A;  1SLN A;  3F17 A;  4AUO A;  1ZS0 A;  3P24 A;  4JQG A;  2OY4 A;  3K7L A;  1XFY A;  1QUA A;  4IUW A;  1RMZ A;  3OHL A;  2YIG A;  4EFS A;  1XFZ A;  1IAE A;  3AIG A;  1IAC A;  1XUR A;  1G9K A;  4FU4 A;  1ZVX A;  3K7N A;  2L0R A;  4WKI A;  4Q1L A;  1ROS A;  1ZTQ A;  1PWP A;  3MA2 A;  3LIL A;  4GQL A;  4PKV A;  5CUH A;  5D2B A;  1ATL A;  3VTG A;  4PKU A;  1BQO A;  4GWN A;  5D7W A;  2XS3 A;  4XM8 A;  3N2V A;  1K7G A;  3NX7 A;  1KUF A;  3LUN A;  2AYK A;  2OY2 A;  5BPA A;  2X3C A;  1JIZ A;  1QJJ A;  5CXA A;  3L0T A;  4ILW D;  2K9C A;  1PWW A;  1G4K A;  2RJQ A;  3F18 A;  1L6J A;  1MMQ A;  5I12 A;  1DMT A;  3HDA P;  1MNC A;  1O0Q A;  4J4M A;  3KEJ A;  1EB6 A;  1I73 A;  5BOT A;  4H2E A;  1Z3J A;  4A7B A;  1BZS A;  1ND1 A;  1SAT A;  4R3V A;  2N8R A;  1QIC A;  5D3C A;  1ZP5 A;  3WV2 A;  1D7X A;  1BKC I;  2YB9 A;  2TCL A;  2O36 A;  1R1J A;  1YOU A;  1BQQ M;  1JAN A;  1Y93 A;  3G5C A;  1QJI A;  4QKZ A;  3DPE A;  3LQ0 A;  3KEC A;  3TVC A;  2OW0 A;  2X3B A;  1AKL A;  1CIZ A;  5I43 A;  2JSD A;  1KAP P;  3DTE A;  1PWQ A;  3F1A A;  2MLR A;  2X7M A;  3KHI A;  5JMY A;  1XFX A;  4H82 A;  4ON1 A;  3DPF A;  4WZV A;  2DW2 A;  2JT5 A;  2DDY A;  5I2Z A;  3DSL A;  3ELM A;  3LE9 A;  3EHY A;  3EHX A;  1GXD A;  1O0T A;  4AXQ A;  3KWV C;  2USN A;  1A86 A;  2JNP A;  5L7F A;  2AIG P;  1CGL A;  3O2X A;  1XM5 A;  3LJZ A;  1JAQ A;  1D8F A;  1J7N A;  3E8R A;  1WNI A;  1CQR A;  2DW1 A;  2MZH A;  1XAX A;  3HBV P;  1S4B P;  3B92 A;  2DW0 A;  3LGP A;  1XFV A;  4H76 A;  4XM7 A;  1ZXV A;  1FM1 A;  3RTT A;  1YQY A;  1JAP A;  4XCT A;  3LIK A;  2RJP A;  3TS4 A;  1G05 A;  3TSK A;  1D8M A;  3ZUK A;  1HV5 A;  4PKS A;  1Q3A A;  4DV8 A;  3EWJ A;  1IAD A;  2FV5 A;  1SLM A;  2YUF A;  4JPA A;  2OVZ A;  3DTI A;  2JIH A;  2W13 A;  3ZVS A;  2OW1 A;  2W12 A;  1CAQ A;  2OW9 A;  1JKY A;  1D5J A;  1AST A;  1C3I A;  3VI1 A;  3F15 A;  3TT4 A;  4I03 A;  3V96 B;  3LK8 A;  2Z2D A;  830C A;  1IAA A;  3HY7 A;  2MZI A;  2Y6D A;  2ERQ A;  4AIG A;  3LUM A;  3LEA A;  1UMS A;  1XFU A;  3AYU A;  4XM6 A;  3O64 A;  3UVC A;  4WK7 A;  1KUI A;  4JIJ A;  2OVX A;  1A85 A;  1OS9 A;  3WV1 A;  3HB2 P;  2E2D A;  2JT6 A;  1GO8 P;  3L0V A;  1CGF A;  1JK3 A;  2WOA A;  1AF0 A;  3F16 A;  1TVI A;  4L63 A;  1EAK A;  3LJT A;  1FBL A;  2W0D A;  1C7K A;  1BM6 A;  5B5O A;  1OMJ A;  1K7I A;  5D1U A;  3KEK A;  2OZR A;  3B2Z A;  2OW2 A;  1GKC A;  3I7G A;  1BKC E;  2XS4 A;  1YCM A;  1MMB A;  1R1I A;  4GF1 A;  3DL1 A;  1HFC A;  1I76 A;  5I4O A;  1UEA A;  1EUB A;  1BKC A;  4HMA A;  3EDH A;  4G0D A;  3DTK A;  4AYK A;  2ERP A;  2I47 A;  1C8T A;  1PWU A;  3I7I A;  1JIW P;  4XBH A;  5B5P A;  2D1N A;  3BA0 A;  1IAG A;  2QPJ A;  3DNG A;  5D1T A;  5I3M A;  3HYG A;  4CTH A;  4I35 A;  1JJ9 A;  4GUY A;  1B8Y A;  1IAB A;  3G42 A;  1GO7 P;  3HBU P;  3P1V A;  1AYK A;  1HFS A;  3GBO A;  3WV3 A;  1KBC A;  3LQB A;  4PKR A;  4GR3 A;  1GKD A;  3DWB A;  3AYK A;  2SRT A;  3KME A;  1HY7 A;  1BUD A;  3SHI A;  3RTS A;  1QIB A;  4FXY P;  1GE7 A;  3Q2G A;  2OI0 A;  4L19 A;  2X3A A;  2OXU A;  4WF6 A;  1MMP A;  1BSW A;  1K7Q A;  3HDB A;  5H8X A;  1JH1 A;  1B3D A;  2Y6C A;  2MLS A;  4WKE A;  3EDI A;  3KRY A;  2POJ A;  1R1H A; 
#chains in the Genus database with same CATH homology
 3USN A;  1QIA A;  1RM8 A;  4JA1 A;  1KUK A;  3Q2H A;  3KMC A;  2KRJ A;  1Y8J A;  1UMT A;  5LAB A;  5CZM A;  3ZXH A;  3HY9 A;  1XFW A;  1SU3 A;  1HOV A;  1UTZ A;  3LKA A;  5L79 A;  2CKI A;  2A8H A;  1FLS A;  1UTT A;  1YP1 A;  2CLT A;  3U1R A;  2D1O A;  1OO9 A;  4A3W A;  3LIR A;  3OHO A;  2O3E A;  1KUH A;  2MZE A;  4IN9 A;  3CKI A;  2FV9 A;  2J83 A;  1G12 A;  4DF9 A;  4L7A A;  4H3X A;  2OXW A;  1MMR A;  4H30 A;  2V4B A;  1SMP A;  2W15 A;  3LMC A;  4FVL A;  2J0T A;  4FXQ A;  4DPE A;  1PWV A;  1HTD A;  1G49 A;  1SRP A;  1GE5 A;  1BUV M;  3LJG A;  2K2G A;  1XUC A;  4H84 A;  2OXZ A;  4PKW A;  3EDG A;  4G9L A;  1OM8 A;  2ERO A;  1OS2 A;  3N2U A;  2W14 A;  2DDF A;  5I0L A;  2HU6 A;  1R54 A;  1USN A;  1DTH A;  3EDZ A;  4H49 A;  1GE6 A;  4JP4 A;  456C A;  1H71 P;  1ZXC A;  4GR0 A;  4L6T A;  2WO8 A;  4PKQ A;  1CK7 A;  2WO9 A;  1KUG A;  4DD8 A;  1CXV A;  1XUD A;  1I1I P;  3B8Z A;  1CGE A;  1BIW A;  4GWM A;  4GR8 A;  966C A;  2PJT A;  4IJO A;  4HX3 A;  1R55 A;  5BOY A;  1Y0V A;  2E3X A;  1OM6 A;  4H1Q A;  1JAO A;  3F19 A;  4PKT A;  4ZR5 A;  5D1S A;  1OM7 A;  1SLN A;  3F17 A;  4AUO A;  1ZS0 A;  3P24 A;  4JQG A;  2OY4 A;  3K7L A;  1XFY A;  1QUA A;  4IUW A;  1RMZ A;  3OHL A;  2YIG A;  4EFS A;  1XFZ A;  1IAE A;  3AIG A;  1IAC A;  1XUR A;  1G9K A;  4FU4 A;  1ZVX A;  3K7N A;  2L0R A;  4WKI A;  4Q1L A;  1ROS A;  1ZTQ A;  1PWP A;  3MA2 A;  3LIL A;  4GQL A;  4PKV A;  5CUH A;  5D2B A;  1ATL A;  3VTG A;  4PKU A;  1BQO A;  4GWN A;  5D7W A;  2XS3 A;  4XM8 A;  3N2V A;  1K7G A;  3NX7 A;  1KUF A;  3LUN A;  2AYK A;  2OY2 A;  5BPA A;  2X3C A;  1JIZ A;  1QJJ A;  5CXA A;  3L0T A;  4ILW D;  2K9C A;  1PWW A;  1G4K A;  2RJQ A;  3F18 A;  1L6J A;  1MMQ A;  5I12 A;  1DMT A;  3HDA P;  1MNC A;  1O0Q A;  4J4M A;  3KEJ A;  1EB6 A;  1I73 A;  5BOT A;  4H2E A;  1Z3J A;  4A7B A;  1BZS A;  1ND1 A;  1SAT A;  4R3V A;  2N8R A;  1QIC A;  5D3C A;  1ZP5 A;  3WV2 A;  1D7X A;  1BKC I;  2YB9 A;  2TCL A;  2O36 A;  1R1J A;  1YOU A;  1BQQ M;  1JAN A;  1Y93 A;  3G5C A;  1QJI A;  4QKZ A;  3DPE A;  3LQ0 A;  3KEC A;  3TVC A;  2OW0 A;  2X3B A;  1AKL A;  1CIZ A;  5I43 A;  2JSD A;  1KAP P;  3DTE A;  1PWQ A;  3F1A A;  2MLR A;  2X7M A;  3KHI A;  5JMY A;  1XFX A;  4H82 A;  4ON1 A;  3DPF A;  4WZV A;  2DW2 A;  2JT5 A;  2DDY A;  5I2Z A;  3DSL A;  3ELM A;  3LE9 A;  3EHY A;  3EHX A;  1GXD A;  1O0T A;  4AXQ A;  3KWV C;  2USN A;  1A86 A;  2JNP A;  5L7F A;  2AIG P;  1CGL A;  3O2X A;  3LJZ A;  1JAQ A;  1D8F A;  1J7N A;  3E8R A;  1WNI A;  1CQR A;  2DW1 A;  2MZH A;  3HBV P;  1S4B P;  3B92 A;  2DW0 A;  3LGP A;  1XFV A;  4H76 A;  4XM7 A;  1ZXV A;  1FM1 A;  3RTT A;  1YQY A;  1JAP A;  4XCT A;  3LIK A;  2RJP A;  3TS4 A;  1G05 A;  3TSK A;  1D8M A;  3ZUK A;  1HV5 A;  4PKS A;  1Q3A A;  4DV8 A;  3EWJ A;  1IAD A;  2FV5 A;  1SLM A;  2YUF A;  4JPA A;  2OVZ A;  3DTI A;  2JIH A;  2W13 A;  3ZVS A;  2OW1 A;  2W12 A;  1CAQ A;  2OW9 A;  1JKY A;  1D5J A;  1AST A;  1C3I A;  3VI1 A;  3F15 A;  3TT4 A;  4I03 A;  3V96 B;  3LK8 A;  2Z2D A;  830C A;  1IAA A;  3HY7 A;  2MZI A;  2Y6D A;  2ERQ A;  4AIG A;  3LUM A;  3LEA A;  1UMS A;  1XFU A;  3AYU A;  4XM6 A;  3O64 A;  3UVC A;  4WK7 A;  1KUI A;  4JIJ A;  2OVX A;  1A85 A;  1OS9 A;  3WV1 A;  3HB2 P;  2E2D A;  2JT6 A;  1GO8 P;  3L0V A;  1CGF A;  1JK3 A;  2WOA A;  1AF0 A;  3F16 A;  4L63 A;  1EAK A;  3LJT A;  1FBL A;  2W0D A;  1C7K A;  1BM6 A;  5B5O A;  1OMJ A;  1K7I A;  5D1U A;  3KEK A;  2OZR A;  3B2Z A;  2OW2 A;  1GKC A;  3I7G A;  1BKC E;  2XS4 A;  1YCM A;  1MMB A;  1R1I A;  4GF1 A;  3DL1 A;  1HFC A;  1I76 A;  5I4O A;  1UEA A;  1EUB A;  1BKC A;  4HMA A;  3EDH A;  4G0D A;  3DTK A;  4AYK A;  2ERP A;  2I47 A;  1C8T A;  1PWU A;  3I7I A;  1JIW P;  4XBH A;  5B5P A;  2D1N A;  3BA0 A;  1IAG A;  2QPJ A;  3DNG A;  5D1T A;  5I3M A;  3HYG A;  4CTH A;  4I35 A;  1JJ9 A;  4GUY A;  1B8Y A;  1IAB A;  3G42 A;  1GO7 P;  3HBU P;  3P1V A;  1AYK A;  1HFS A;  3GBO A;  3WV3 A;  1KBC A;  3LQB A;  4PKR A;  4GR3 A;  1GKD A;  3DWB A;  3AYK A;  2SRT A;  3KME A;  1HY7 A;  1BUD A;  3SHI A;  3RTS A;  1QIB A;  4FXY P;  1GE7 A;  3Q2G A;  2OI0 A;  4L19 A;  2X3A A;  2OXU A;  4WF6 A;  1MMP A;  1BSW A;  1K7Q A;  3HDB A;  5H8X A;  1JH1 A;  1B3D A;  2Y6C A;  2MLS A;  4WKE A;  3EDI A;  3KRY A;  2POJ A;  1R1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...