3LQ6A

Crystal structure of murine norovirus protruding (p) domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
313
structure length
313
Chain Sequence
b'RMVDLPVIQPRLCTHARWPAPVYGLLVDPSLPSNPQWQNGRVHVDGTLLGTTPISGSWVSCFAAEAAYEFQSGTGEVATFTLIEQDGSAYVPGDRAAPLGYPDFSGQLEIEVQTETTKTGDKLKVTTFEMILGPTTNADQAPYQGRVFASVTAAASLDLVDGRVRAVPRSIYGFQDTIPEYNDGLLVPLAPPIGPFLPGEVLLRFRTYMRQIDTADAAAEAIDCALPQEFVSWFASNAFTVQSEALLLRYRNTLTGQLLFECKLYNEGYIALSYSGSGPLTFPTDGIFEVVSWVPRLYQLASVGSLATGRMLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title High-resolution x-ray structure and functional analysis of the murine norovirus 1 capsid protein protruding domain.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Viral protein
total genus 64
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3lq6A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3lq6A01
4P1VA 5F4MA 5F4JA 3ONUA 3PVDA 3Q38A 5J3OA 3ASRA 3PA2A 4WZEA 3BY2A 4P26A 5IYPA 3ONYA 4X07A 5IYWA 4QUZA 3ASSA 5HZAA 4P3IA 3RY8A 4OOVA 3PUNA 3D26A 3ASQA 2OBTA 4OPSA 4OOXA 4WZLA 2OBSA 4Z4VA 4X7EA 4X7DA 5J35A 4QVJA 4WZTA 5BSYA 5BSXA 4X06A 3PA1A 3LQ6A 4OPOA 3ASTA 4Z4YA 4X0CA 3SEJA 2ZL7A 4Z4RA 3ASPA 3V7AA 4RDKA 4P25A 3Q6RA 4QVAA 3SKBA 2ZL6A 4Z4UA 4P2NA 5HZBA 4Z4TA 4OP7A 4QV2A 2OBRA 3R6JA 2ZL5A 4Z4SA 1IHMA 4RDLA 5E6TA 3BY1A 3SJPA 4RM0A 3BQJA 4X7CA 4RPBA 4X7FA 5KW9A 3SLNA 3LQEA 4P12A 4RPDA 4X05A 4ROXA 4Z4ZA 3SLDA 5IYQA 5IYRA 3Q39A 4WZKA 5F4OA 4OPVA 4Z4WA 3Q6QA 4OOSA 4RLZA 3Q3AA 4RDJA 3PUMA 5IYNA 3R6KA
chains in the Genus database with same CATH superfamily
1XFOA 4P1VA 2RC5A 1TLLA 3OZUA 3ZZUA 1VJSA 3PVDA 1K9MD 5J3OA 3ASRA 4G1BA 2OTLB 1EFUA 1V0EA 3OZVA 5IYPA 2V7QA 3ONYA 3CB4A 2C2WA 5CDFA 3ZBUA 2WZPP 4AF6A 4AF7A 1A8PA 5IYWA 2V31A 5JBQA 4FXUA 4QUZA 1N0UA 3G4SB 3W5VA 2VNKA 1BMFA 4F7DA 1E3ZA 3LO8A 4P3IA 3RY8A 1Q7YD 2DY1A 3A8KA 1E62A 1N06A 1KK0A 2OBTA 1IJEA 3ZIAA 3QFRA 4RD4A 2XEXA 1HZEA 4P3YA 1WP6A 4TMXA 3QSYA 3VNUA 3OP1A 4OOXA 4XN3A 2B7BA 2ZZEA 2ZZGA 3DDYA 4RD3A 3T56B 4TMVA 4X7DA 4QVJA 4WZTA 4II3A 5BSXA 1JJ2B 2YWHA 4PAAA 1QFYA 1YIJB 3BC9A 1ZM4A 4X06A 2CRVA 3CCSB 2WZNA 5DS0A 3CMEB 2M5SA 1W2BB 3CW2A 3SEJA 3WBKA 3QFSA 1G7RA 1OGJA 4XOTA 3CTAA 5KNLA 1FDRA 1JA1A 4RD2A 2X85A 3ZZ0A 3G71B 2WR8A 2F4NA 3Q6RA 4TN1A 2I1LA 1QVFB 1PJ6A 3AGQA 2ZL6A 4Z4UA 4B43A 1YI2B 2CC2A 1W0KA 2GPJA 1OGIA 3OAAA 5DN6A 4Z4TA 4OP7A 2C78A 4XQFA 4KKSA 5TV2A 1AMOA 2QTZA 1R5OA 2Q6OA 4Y9RA 3JU4A 4PGOA 1AIPA 2ZL5A 3VO2A 1YLOA 4QFMA 3PENA 1M90D 3QFTA 3BY1A 4HE6A 4RM0A 1QGZA 4UZFA 3OKXA 3VR6A 2YWGA 1BJKA 1OHHA 1WU8A 5KW9A 3SLNA 1EP1B 1QGAA 2BV3A 2JJ1A 2QE7A 2F43A 3CESA 2ZITA 4K1XA 4M53A 4ROXA 1PKVA 1WSVA 1ZM3A 2PE3A 2V7UA 4M1KA 3V76A 4GQNA 4XLAA 1SKQA 5IYRA 3Q39A 1VHOA 5LMZA 2OTJB 1NB0A 1T6ZA 2VBTA 2XNDA 3JQQA 4DQLA 4Z4WA 1VQ6B 3AVXA 2BPOA 2NV4A 2V7VA 2X3UA 1Q9SA 4XD7A 2E1RA 4P9SA 1VQMB 1VQPB 2GK6A 1Q86D 4P6YA 1P4MA 5A8AA 1H8EA 2VBUA 1T6YA 4TT3A 2C5BA 5IYNA 3I1FA 2GJPA 2Q6KA 3AVVA 2VBVA 4ZV4A 4PC2A 1PJ5A 4DQKA 4KKUA 4ZCMA 3WY9A 3ZBTA 2RC6A 2WSSA 5F4JA 3ONUA 3HAGA 3CC7B 3Q38A 1QFZA 4G1VA 3WNDA 1KC8D 1VQKB 1H85A 1S72B 2DIEA 4X8IA 4WZEA 2XZLA 4XONA 3GSIA 1ZM2A 5A88A 3I55B 3CMMA 3W5HA 4Y9UA 5GV7A 4WWVA 3WQZA 1FNCA 3ASSA 3ZZTA 4R71A 1SKYB 1Y0RA 5HZAA 1KD1D 3ZUGA 2X6XA 3CCJB 3ZPNA 4B3FX 4Q7JB 4N3GA 1ZM9A 5FNZA 1HVXA 3CC4B 5FA6A 4NCNA 1XQBA 4XOPA 2BGJA 4YAOA 2QGGA 2XOKA 4LBYA 1W87A 3A35A 4X7EA 5FO1A 4B47A 4Z4VA 3GIRA 4NNJA 1WOOA 1H42A 3PA1A 3AVWA 4MYUA 4OPOA 3WYAA 2F1MA 2JIZA 3ASTA 4HIZA 4XM3A 2D3NA 4LBVA 2HDNB 4L8JA 3CCVB 2BF4A 3GVLA 1VQ9B 2WYRA 2BVNA 4Z4RA 3V7AA 1WPCA 3FPPA 3B8HA 4RDKA 4P25A 5HXBA 1Y0YA 1I8DA 1IB0A 2V7XA 5TR9A 1VQOB 4XORA 1EXMA 4P2NA 1NJID 1I18A 3CC2B 4HE5A 1V5VA 3W2IA 4XLFA 4QV2A 2QN6A 2OBRA 1J9ZA 2B5OA 2GK7A 1S0UA 4DK1A 2ZXIA 4Z4SA 2R9VA 3OEHA 2VZLA 3FKSA 1IHMA 2ZZFA 3G05A 3E1YE 4YAFA 3SJPA 1WOPA 3CP8A 4G7WA 2PMDA 3AVTA 2FX3A 4UAJA 1CNFA 4TMTA 1T6XA 3MHPA 4H9GA 3LQEA 1T5EA 1ZUNB 1WTHD 2X6YA 4B44A 1SM4A 5FO0A 3CP2A 5FL7A 3QFCA 2ZTGA 1G7TA 4X05A 4XMYA 1W9XA 2VJJA 3ES9A 3OW2B 1Q82D 1E64A 2F1LA 4PC3A 3FPKA 5F4OA 1NB9A 1UD8A 3BH4A 2XZOA 3I56B 4OPVA 4E0FA 3Q6QA 2CF4A 1MRZA 4CQJA 2VYQA 2X53S 1GAQA 3B82A 3Q3AA 2LZJA 5DSZA 4ZGQB 3OPOA 4ZGNB 4B3XA 1GAWA 3VO1A 4B4DA 2VNIA 2HCJB 3WNCA 4MYTA 3SJZA 3U6KA 3NE5B 4M0LA 3VMFA 4G7XA 3OE7A 2Z6BD 1WDTA 2P3MA 1GO2A 2CBXA 1KMHA 4C43A 4ACBA 2DETA 1D2EA 2JDIA 1R5BA 4YALA 1VQ7B 1V0FA 1YX2A 4FWTA 3QE2A 3OW7A 3CXCB 3BY2A 3CCMB 1WOSA 1B2RA 3CMAB 1EFTA 2D3LA 2GJKA 3T51B 4X07A 1QFJA 4ACAA 2WPDA 2Q6IA 4RD6A 4AC9A 1VHEA 1S4MA 1QG0A 3D26A 5H59A 4YAWA 5FIUA 2HMAA 1OB5A 1UMKA 1CQXA 4RCYA 4XNFA 2VNHA 3GVKA 5A89A 1VQ8B 4M2LA 3AVUA 1B23P 3JQRA 4J0QA 4WZLA 3BNWA 3OJXA 1UD4A 5THXA 5IK2A 2DEUA 1YJ9B 1VQ5B 1QUFA 3H9NA 3U2QA 2V7WA 1YJWB 3WBJA 1K73D 2J7KA 2ZBUA 4PC7A 5J35A 1BX0A 5BSYA 4YXWA 4YAUA 3A3BA 1JNYA 3AGPA 2HLDA 4PC6A 3LQ6A 4DNTB 4Z4YA 1N0VC 4G6IA 4ZCLA 2OK7A 3W2FA 1TTTA 3OFNA 1H8HA 1OB2A 2VJIA 1KK1A 1EWYA 1FX0A 2OYNA 4QVAA 4RD0A 3W2GA 3SKBA 4II2A 5L46A 4LBWA 2PLFA 1ELOA 1NBMA 1GVHA 3P26A 3VNVA 4ASUA 4UZEA 1WORA 1RQPA 2QMUA 5GV8A 3CPWB 1E79A 2D9RA 2GREA 3R6JA 2NPFA 3BCDA 1RQRA 4AVZA 5TRDA 2YWFA 3CRZA 1NDHA 1VQ4B 1QH0A 3P27A 1KK3A 1KZLA 1UD6A 3H94A 4RDLA 5E6TA 5H5JA 1K8AD 3W2HA 2XZPA 3CCQB 2OK8A 1EP2B 3BQJA 3E20A 4X7CA 3ZC3A 1E43A 1D1NA 2EFGA 3A3GA 4X7FA 1G7SA 2YWEA 4XLCA 2JJ2A 1BPLA 2CNDA 4XN0A 5HKKA 3W5UA 2QTLA 1N08A 4XKVA 2R6HA 1E1RA 1GJRA 2BMWA 4C0SA 4XR6A 4P12A 1QX4A 2C4TA 1E1QA 2CK3A 2DERA 5IYQA 4JMQA 4RCZA 4WZKA 1DDIA 4DK0A 1VLOA 2ZXHA 4M4SA 2X8KA 4FN5A 1EFRA 5B6IA 2FVGA 2X0KA 4RD1A 4YELA 1BLIA 2B7CA 1PJ7A 2BM1A 3KL9A 2BN4A 3PUMA 4N3NA 3CCUB 1DARA 3OOCA 2V7TA 1EFCA 1KQSB 4EH1A 3U6BA 1N07A 1XE1A 3R6KA 3A1PA 2ZTNA 3ISXA 1QGYA 1D8TA 4Y7CA 4TSFA 3CD6B 1W35A 4RJLA 5F4MA 2ZZQA 3T53B 1KTVA 3LNNA 1FRQA 1XB2A 3PA2A 4U9UA 3W2EA 1UD5A 1IJFA 4P26A 3OZWA 2KVOA 1KJZA 3FJOA 1QVGB 2DOGA 1MABA 1HA3A 2DYIA 2C4UA 2C77A 1WSRA 4OOVA 4P6VF 2BSAA 1JA0A 1NRKA 3PUNA 2GJRA 3ASQA 2EIXA 1CNEA 5KSWB 4OPSA 4B3GA 3JQPA 3CCEB 1QUEA 3B78A 1GR1A 3AVYA 4Z1MA 2WJYA 1E3XA 1BQEA 3WXMA 1W34A 4XLHA 3J81k 4XKWA 2OBSA 2ZBVA 3OEEA 1COWA 2WJVA 1R5NA 2VBSA 4BPRA 1VQLB 4ZCIA 2V4DA 4TKOB 1FNDA 1N05A 2E1BA 2PIAA 2QDXA 2GQFA 4X0CA 1FNMA 1Q81D 2AHOA 2ZL7A 3GQBA 4NBSA 3ASPA 3KEWA 2XNJA 2XGJA 2D74A 3LVBA 4YEJA 4QHYA 2XNCA 5HZBA 1JB9A 1VLYA 1YJNB 4IW3B 1FRNA 1G7CA 1DG1G 4G5GA 1KRHA 1YHQB 1UD3A 3A8JA 1OB0A 2X6WA 1YITB 4YHBA 1FNBA 2W6IA 1M1KD 3CPXA 1E63A 2VNJA 2BM0A 3GVJA 2Q6LA 4RPBA 1EP3B 3MCAA 4PC1A 5TY0A 1W0JA 3WNBA 3OJWA 3BCFA 1DDGA 3G6EB 4FK8A 4TMWA 1VQNB 4P22A 3MMPA 1N8RD 2W6JA 4WQMA 4RPDA 3CCLB 2JN9A 4XLEA 1I7PA 4Z4ZA 4UZUA 3SLDA 4LBZA 1UD2A 1BX1A 4LC0A 2C5HA 4TMZA 4KKTA 2CW5A 4XL9A 1U2RA 2QA4B 1F60A 3A8IA 4OOSA 5EMNA 4PABA 4RLZA 2BGIA 3CCRB 4RDJA 5AN9A 4DNRB 2DCUA 1TUIA 1K28D 4B48A 1TVCA 1F20A 1KK2A 2QEXB 1VF7A
chains in the Genus database with same CATH topology
4P1VA 5F4MA 5F4JA 3ONUA 3PVDA 3Q38A 5J3OA 3ASRA 3PA2A 4WZEA 3BY2A 4P26A 5IYPA 3ONYA 4X07A 5IYWA 4QUZA 3ASSA 5HZAA 4P3IA 3RY8A 4OOVA 3PUNA 3D26A 3ASQA 2OBTA 4OPSA 4OOXA 4WZLA 2OBSA 4Z4VA 4X7EA 4X7DA 5J35A 4QVJA 4WZTA 5BSYA 5BSXA 4X06A 3PA1A 3LQ6A 4OPOA 3ASTA 4Z4YA 4X0CA 3SEJA 2ZL7A 4Z4RA 3ASPA 3V7AA 4RDKA 4P25A 3Q6RA 4QVAA 3SKBA 2ZL6A 4Z4UA 4P2NA 5HZBA 4Z4TA 4OP7A 4QV2A 2OBRA 3R6JA 2ZL5A 4Z4SA 1IHMA 4RDLA 5E6TA 3BY1A 3SJPA 4RM0A 3BQJA 4X7CA 4RPBA 4X7FA 5KW9A 3SLNA 3LQEA 4P12A 4RPDA 4X05A 4ROXA 4Z4ZA 3SLDA 5IYQA 5IYRA 3Q39A 4WZKA 5F4OA 4OPVA 4Z4WA 3Q6QA 4OOSA 4RLZA 3Q3AA 4RDJA 3PUMA 5IYNA 3R6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1V A;  5F4M A;  5F4J A;  3ONU A;  3PVD A;  3Q38 A;  5J3O A;  3ASR A;  3PA2 A;  4WZE A;  3BY2 A;  4P26 A;  5IYP A;  3ONY A;  4X07 A;  5IYW A;  4QUZ A;  3ASS A;  5HZA A;  4P3I A;  3RY8 A;  4OOV A;  3PUN A;  3D26 A;  3ASQ A;  2OBT A;  4OPS A;  4OOX A;  4WZL A;  2OBS A;  4Z4V A;  4X7E A;  4X7D A;  5J35 A;  4QVJ A;  4WZT A;  5BSY A;  5BSX A;  4X06 A;  3PA1 A;  3LQ6 A;  4OPO A;  3AST A;  4Z4Y A;  4X0C A;  3SEJ A;  2ZL7 A;  4Z4R A;  3ASP A;  3V7A A;  4RDK A;  4P25 A;  3Q6R A;  4QVA A;  3SKB A;  2ZL6 A;  4Z4U A;  4P2N A;  5HZB A;  4Z4T A;  4OP7 A;  4QV2 A;  2OBR A;  3R6J A;  2ZL5 A;  4Z4S A;  1IHM A;  4RDL A;  5E6T A;  3BY1 A;  3SJP A;  4RM0 A;  3BQJ A;  4X7C A;  4RPB A;  4X7F A;  5KW9 A;  3SLN A;  3LQE A;  4P12 A;  4RPD A;  4X05 A;  4ROX A;  4Z4Z A;  3SLD A;  5IYQ A;  5IYR A;  3Q39 A;  4WZK A;  5F4O A;  4OPV A;  4Z4W A;  3Q6Q A;  4OOS A;  4RLZ A;  3Q3A A;  4RDJ A;  3PUM A;  5IYN A;  3R6K A; 
#chains in the Genus database with same CATH topology
 1XFO A;  4P1V A;  2RC5 A;  1TLL A;  3OZU A;  3ZZU A;  1VJS A;  3PVD A;  1K9M D;  5J3O A;  3ASR A;  4G1B A;  2OTL B;  1EFU A;  1V0E A;  3OZV A;  5IYP A;  2V7Q A;  3ONY A;  3CB4 A;  2C2W A;  5CDF A;  3ZBU A;  2WZP P;  4AF6 A;  4AF7 A;  1A8P A;  5IYW A;  2V31 A;  5JBQ A;  4FXU A;  4QUZ A;  1N0U A;  3G4S B;  3W5V A;  2VNK A;  1BMF A;  4F7D A;  1E3Z A;  3LO8 A;  4P3I A;  3RY8 A;  1Q7Y D;  2DY1 A;  3A8K A;  1E62 A;  1N06 A;  1KK0 A;  2OBT A;  1IJE A;  3ZIA A;  3QFR A;  4RD4 A;  2XEX A;  1HZE A;  4P3Y A;  1WP6 A;  4TMX A;  3QSY A;  3VNU A;  3OP1 A;  4OOX A;  4XN3 A;  2B7B A;  2ZZE A;  2ZZG A;  3DDY A;  4RD3 A;  3T56 B;  4TMV A;  4X7D A;  4QVJ A;  4WZT A;  4II3 A;  5BSX A;  1JJ2 B;  2YWH A;  4PAA A;  1QFY A;  1YIJ B;  3BC9 A;  1ZM4 A;  4X06 A;  2CRV A;  3CCS B;  2WZN A;  5DS0 A;  3CME B;  2M5S A;  1W2B B;  3CW2 A;  3SEJ A;  3WBK A;  3QFS A;  1G7R A;  1OGJ A;  4XOT A;  3CTA A;  5KNL A;  1FDR A;  1JA1 A;  4RD2 A;  2X85 A;  3ZZ0 A;  3G71 B;  2WR8 A;  2F4N A;  3Q6R A;  4TN1 A;  2I1L A;  1QVF B;  1PJ6 A;  3AGQ A;  2ZL6 A;  4Z4U A;  4B43 A;  1YI2 B;  2CC2 A;  1W0K A;  2GPJ A;  1OGI A;  3OAA A;  5DN6 A;  4Z4T A;  4OP7 A;  2C78 A;  4XQF A;  4KKS A;  5TV2 A;  1AMO A;  2QTZ A;  1R5O A;  2Q6O A;  4Y9R A;  3JU4 A;  4PGO A;  1AIP A;  2ZL5 A;  3VO2 A;  1YLO A;  4QFM A;  3PEN A;  1M90 D;  3QFT A;  3BY1 A;  4HE6 A;  4RM0 A;  1QGZ A;  4UZF A;  3OKX A;  3VR6 A;  2YWG A;  1BJK A;  1OHH A;  1WU8 A;  5KW9 A;  3SLN A;  1EP1 B;  1QGA A;  2BV3 A;  2JJ1 A;  2QE7 A;  2F43 A;  3CES A;  2ZIT A;  4K1X A;  4M53 A;  4ROX A;  1PKV A;  1WSV A;  1ZM3 A;  2PE3 A;  2V7U A;  4M1K A;  3V76 A;  4GQN A;  4XLA A;  1SKQ A;  5IYR A;  3Q39 A;  1VHO A;  5LMZ A;  2OTJ B;  1NB0 A;  1T6Z A;  2VBT A;  2XND A;  3JQQ A;  4DQL A;  4Z4W A;  1VQ6 B;  3AVX A;  2BPO A;  2NV4 A;  2V7V A;  2X3U A;  1Q9S A;  4XD7 A;  2E1R A;  4P9S A;  1VQM B;  1VQP B;  2GK6 A;  1Q86 D;  4P6Y A;  1P4M A;  5A8A A;  1H8E A;  2VBU A;  1T6Y A;  4TT3 A;  2C5B A;  5IYN A;  3I1F A;  2GJP A;  2Q6K A;  3AVV A;  2VBV A;  4ZV4 A;  4PC2 A;  1PJ5 A;  4DQK A;  4KKU A;  4ZCM A;  3WY9 A;  3ZBT A;  2RC6 A;  2WSS A;  5F4J A;  3ONU A;  3HAG A;  3CC7 B;  3Q38 A;  1QFZ A;  4G1V A;  3WND A;  1KC8 D;  1VQK B;  1H85 A;  1S72 B;  2DIE A;  4X8I A;  4WZE A;  2XZL A;  4XON A;  3GSI A;  1ZM2 A;  5A88 A;  3I55 B;  3CMM A;  3W5H A;  4Y9U A;  5GV7 A;  4WWV A;  3WQZ A;  1FNC A;  3ASS A;  3ZZT A;  4R71 A;  1SKY B;  1Y0R A;  5HZA A;  1KD1 D;  3ZUG A;  2X6X A;  3CCJ B;  3ZPN A;  4B3F X;  4Q7J B;  4N3G A;  1ZM9 A;  5FNZ A;  1HVX A;  3CC4 B;  5FA6 A;  4NCN A;  1XQB A;  4XOP A;  2BGJ A;  4YAO A;  2QGG A;  2XOK A;  4LBY A;  1W87 A;  3A35 A;  4X7E A;  5FO1 A;  4B47 A;  4Z4V A;  3GIR A;  4NNJ A;  1WOO A;  1H42 A;  3PA1 A;  3AVW A;  4MYU A;  4OPO A;  3WYA A;  2F1M A;  2JIZ A;  3AST A;  4HIZ A;  4XM3 A;  2D3N A;  4LBV A;  2HDN B;  4L8J A;  3CCV B;  2BF4 A;  3GVL A;  1VQ9 B;  2WYR A;  2BVN A;  4Z4R A;  3V7A A;  1WPC A;  3FPP A;  3B8H A;  4RDK A;  4P25 A;  5HXB A;  1Y0Y A;  1I8D A;  1IB0 A;  2V7X A;  5TR9 A;  1VQO B;  4XOR A;  1EXM A;  4P2N A;  1NJI D;  1I18 A;  3CC2 B;  4HE5 A;  1V5V A;  3W2I A;  4XLF A;  4QV2 A;  2QN6 A;  2OBR A;  1J9Z A;  2B5O A;  2GK7 A;  1S0U A;  4DK1 A;  2ZXI A;  4Z4S A;  2R9V A;  3OEH A;  2VZL A;  3FKS A;  1IHM A;  2ZZF A;  3G05 A;  3E1Y E;  4YAF A;  3SJP A;  1WOP A;  3CP8 A;  4G7W A;  2PMD A;  3AVT A;  2FX3 A;  4UAJ A;  1CNF A;  4TMT A;  1T6X A;  3MHP A;  4H9G A;  3LQE A;  1T5E A;  1ZUN B;  1WTH D;  2X6Y A;  4B44 A;  1SM4 A;  5FO0 A;  3CP2 A;  5FL7 A;  3QFC A;  2ZTG A;  1G7T A;  4X05 A;  4XMY A;  1W9X A;  2VJJ A;  3ES9 A;  3OW2 B;  1Q82 D;  1E64 A;  2F1L A;  4PC3 A;  3FPK A;  5F4O A;  1NB9 A;  1UD8 A;  3BH4 A;  2XZO A;  3I56 B;  4OPV A;  4E0F A;  3Q6Q A;  2CF4 A;  1MRZ A;  4CQJ A;  2VYQ A;  2X53 S;  1GAQ A;  3B82 A;  3Q3A A;  2LZJ A;  5DSZ A;  4ZGQ B;  3OPO A;  4ZGN B;  4B3X A;  1GAW A;  3VO1 A;  4B4D A;  2VNI A;  2HCJ B;  3WNC A;  4MYT A;  3SJZ A;  3U6K A;  3NE5 B;  4M0L A;  3VMF A;  4G7X A;  3OE7 A;  2Z6B D;  1WDT A;  2P3M A;  1GO2 A;  2CBX A;  1KMH A;  4C43 A;  4ACB A;  2DET A;  1D2E A;  2JDI A;  1R5B A;  4YAL A;  1VQ7 B;  1V0F A;  1YX2 A;  4FWT A;  3QE2 A;  3OW7 A;  3CXC B;  3BY2 A;  3CCM B;  1WOS A;  1B2R A;  3CMA B;  1EFT A;  2D3L A;  2GJK A;  3T51 B;  4X07 A;  1QFJ A;  4ACA A;  2WPD A;  2Q6I A;  4RD6 A;  4AC9 A;  1VHE A;  1S4M A;  1QG0 A;  3D26 A;  5H59 A;  4YAW A;  5FIU A;  2HMA A;  1OB5 A;  1UMK A;  1CQX A;  4RCY A;  4XNF A;  2VNH A;  3GVK A;  5A89 A;  1VQ8 B;  4M2L A;  3AVU A;  1B23 P;  3JQR A;  4J0Q A;  4WZL A;  3BNW A;  3OJX A;  1UD4 A;  5THX A;  5IK2 A;  2DEU A;  1YJ9 B;  1VQ5 B;  1QUF A;  3H9N A;  3U2Q A;  2V7W A;  1YJW B;  3WBJ A;  1K73 D;  2J7K A;  2ZBU A;  4PC7 A;  5J35 A;  1BX0 A;  5BSY A;  4YXW A;  4YAU A;  3A3B A;  1JNY A;  3AGP A;  2HLD A;  4PC6 A;  3LQ6 A;  4DNT B;  4Z4Y A;  1N0V C;  4G6I A;  4ZCL A;  2OK7 A;  3W2F A;  1TTT A;  3OFN A;  1H8H A;  1OB2 A;  2VJI A;  1KK1 A;  1EWY A;  1FX0 A;  2OYN A;  4QVA A;  4RD0 A;  3W2G A;  3SKB A;  4II2 A;  5L46 A;  4LBW A;  2PLF A;  1ELO A;  1NBM A;  1GVH A;  3P26 A;  3VNV A;  4ASU A;  4UZE A;  1WOR A;  1RQP A;  2QMU A;  5GV8 A;  3CPW B;  1E79 A;  2D9R A;  2GRE A;  3R6J A;  2NPF A;  3BCD A;  1RQR A;  4AVZ A;  5TRD A;  2YWF A;  3CRZ A;  1NDH A;  1VQ4 B;  1QH0 A;  3P27 A;  1KK3 A;  1KZL A;  1UD6 A;  3H94 A;  4RDL A;  5E6T A;  5H5J A;  1K8A D;  3W2H A;  2XZP A;  3CCQ B;  2OK8 A;  1EP2 B;  3BQJ A;  3E20 A;  4X7C A;  3ZC3 A;  1E43 A;  1D1N A;  2EFG A;  3A3G A;  4X7F A;  1G7S A;  2YWE A;  4XLC A;  2JJ2 A;  1BPL A;  2CND A;  4XN0 A;  5HKK A;  3W5U A;  2QTL A;  1N08 A;  4XKV A;  2R6H A;  1E1R A;  1GJR A;  2BMW A;  4C0S A;  4XR6 A;  4P12 A;  1QX4 A;  2C4T A;  1E1Q A;  2CK3 A;  2DER A;  5IYQ A;  4JMQ A;  4RCZ A;  4WZK A;  1DDI A;  4DK0 A;  1VLO A;  2ZXH A;  4M4S A;  2X8K A;  4FN5 A;  1EFR A;  5B6I A;  2FVG A;  2X0K A;  4RD1 A;  4YEL A;  1BLI A;  2B7C A;  1PJ7 A;  2BM1 A;  3KL9 A;  2BN4 A;  3PUM A;  4N3N A;  3CCU B;  1DAR A;  3OOC A;  2V7T A;  1EFC A;  1KQS B;  4EH1 A;  3U6B A;  1N07 A;  1XE1 A;  3R6K A;  3A1P A;  2ZTN A;  3ISX A;  1QGY A;  1D8T A;  4Y7C A;  4TSF A;  3CD6 B;  1W35 A;  4RJL A;  5F4M A;  2ZZQ A;  3T53 B;  1KTV A;  3LNN A;  1FRQ A;  1XB2 A;  3PA2 A;  4U9U A;  3W2E A;  1UD5 A;  1IJF A;  4P26 A;  3OZW A;  2KVO A;  1KJZ A;  3FJO A;  1QVG B;  2DOG A;  1MAB A;  1HA3 A;  2DYI A;  2C4U A;  2C77 A;  1WSR A;  4OOV A;  4P6V F;  2BSA A;  1JA0 A;  1NRK A;  3PUN A;  2GJR A;  3ASQ A;  2EIX A;  1CNE A;  5KSW B;  4OPS A;  4B3G A;  3JQP A;  3CCE B;  1QUE A;  3B78 A;  1GR1 A;  3AVY A;  4Z1M A;  2WJY A;  1E3X A;  1BQE A;  3WXM A;  1W34 A;  4XLH A;  3J81 k;  4XKW A;  2OBS A;  2ZBV A;  3OEE A;  1COW A;  2WJV A;  1R5N A;  2VBS A;  4BPR A;  1VQL B;  4ZCI A;  2V4D A;  4TKO B;  1FND A;  1N05 A;  2E1B A;  2PIA A;  2QDX A;  2GQF A;  4X0C A;  1FNM A;  1Q81 D;  2AHO A;  2ZL7 A;  3GQB A;  4NBS A;  3ASP A;  3KEW A;  2XNJ A;  2XGJ A;  2D74 A;  3LVB A;  4YEJ A;  4QHY A;  2XNC A;  5HZB A;  1JB9 A;  1VLY A;  1YJN B;  4IW3 B;  1FRN A;  1G7C A;  1DG1 G;  4G5G A;  1KRH A;  1YHQ B;  1UD3 A;  3A8J A;  1OB0 A;  2X6W A;  1YIT B;  4YHB A;  1FNB A;  2W6I A;  1M1K D;  3CPX A;  1E63 A;  2VNJ A;  2BM0 A;  3GVJ A;  2Q6L A;  4RPB A;  1EP3 B;  3MCA A;  4PC1 A;  5TY0 A;  1W0J A;  3WNB A;  3OJW A;  3BCF A;  1DDG A;  3G6E B;  4FK8 A;  4TMW A;  1VQN B;  4P22 A;  3MMP A;  1N8R D;  2W6J A;  4WQM A;  4RPD A;  3CCL B;  2JN9 A;  4XLE A;  1I7P A;  4Z4Z A;  4UZU A;  3SLD A;  4LBZ A;  1UD2 A;  1BX1 A;  4LC0 A;  2C5H A;  4TMZ A;  4KKT A;  2CW5 A;  4XL9 A;  1U2R A;  2QA4 B;  1F60 A;  3A8I A;  4OOS A;  5EMN A;  4PAB A;  4RLZ A;  2BGI A;  3CCR B;  4RDJ A;  5AN9 A;  4DNR B;  2DCU A;  1TUI A;  1K28 D;  4B48 A;  1TVC A;  1F20 A;  1KK2 A;  2QEX B;  1VF7 A; 
#chains in the Genus database with same CATH homology
 4P1V A;  5F4M A;  5F4J A;  3ONU A;  3PVD A;  3Q38 A;  5J3O A;  3ASR A;  3PA2 A;  4WZE A;  3BY2 A;  4P26 A;  5IYP A;  3ONY A;  4X07 A;  5IYW A;  4QUZ A;  3ASS A;  5HZA A;  4P3I A;  3RY8 A;  4OOV A;  3PUN A;  3D26 A;  3ASQ A;  2OBT A;  4OPS A;  4OOX A;  4WZL A;  2OBS A;  4Z4V A;  4X7E A;  4X7D A;  5J35 A;  4QVJ A;  4WZT A;  5BSY A;  5BSX A;  4X06 A;  3PA1 A;  3LQ6 A;  4OPO A;  3AST A;  4Z4Y A;  4X0C A;  3SEJ A;  2ZL7 A;  4Z4R A;  3ASP A;  3V7A A;  4RDK A;  4P25 A;  3Q6R A;  4QVA A;  3SKB A;  2ZL6 A;  4Z4U A;  4P2N A;  5HZB A;  4Z4T A;  4OP7 A;  4QV2 A;  2OBR A;  3R6J A;  2ZL5 A;  4Z4S A;  1IHM A;  4RDL A;  5E6T A;  3BY1 A;  3SJP A;  4RM0 A;  3BQJ A;  4X7C A;  4RPB A;  4X7F A;  5KW9 A;  3SLN A;  3LQE A;  4P12 A;  4RPD A;  4X05 A;  4ROX A;  4Z4Z A;  3SLD A;  5IYQ A;  5IYR A;  3Q39 A;  4WZK A;  5F4O A;  4OPV A;  4Z4W A;  3Q6Q A;  4OOS A;  4RLZ A;  3Q3A A;  4RDJ A;  3PUM A;  5IYN A;  3R6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...