3LQ6A

Crystal structure of murine norovirus protruding (p) domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
313
structure length
313
Chain Sequence
RMVDLPVIQPRLCTHARWPAPVYGLLVDPSLPSNPQWQNGRVHVDGTLLGTTPISGSWVSCFAAEAAYEFQSGTGEVATFTLIEQDGSAYVPGDRAAPLGYPDFSGQLEIEVQTETTKTGDKLKVTTFEMILGPTTNADQAPYQGRVFASVTAAASLDLVDGRVRAVPRSIYGFQDTIPEYNDGLLVPLAPPIGPFLPGEVLLRFRTYMRQIDTADAAAEAIDCALPQEFVSWFASNAFTVQSEALLLRYRNTLTGQLLFECKLYNEGYIALSYSGSGPLTFPTDGIFEVVSWVPRLYQLASVGSLATGRMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title High-resolution x-ray structure and functional analysis of the murine norovirus 1 capsid protein protruding domain.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Viral protein
total genus 64
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3lq6A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3lq6A01
5KW9A 4Z4YA 5F4OA 4P26A 3ASSA 4Z4RA 3ONYA 2OBSA 5E6TA 3V7AA 5IYNA 3PA2A 3ONUA 5J3OA 4P25A 3SLNA 3R6KA 5HZAA 5F4JA 3Q6RA 3SLDA 3BQJA 2ZL5A 5F4MA 4Z4SA 5J35A 5BSXA 4QVJA 4Z4TA 4RPDA 5IYQA 3ASQA 4OP7A 3Q39A 4Z4VA 5IYWA 4P2NA 4X06A 4RDKA 4X7CA 5IYPA 4RM0A 4OOVA 3RY8A 4WZKA 2ZL6A 3ASTA 4X07A 5BSYA 3LQEA 4Z4WA 2ZL7A 4Z4UA 4Z4ZA 3D26A 4P12A 4QVAA 4OOXA 4OPVA 3BY2A 4RLZA 3SEJA 3SKBA 1IHMA 4P1VA 4OOSA 4QUZA 4X7FA 5IYRA 3PA1A 4WZLA 4X05A 4QV2A 4X0CA 3ASPA 4RPBA 3PUNA 3LQ6A 3SJPA 3R6JA 4X7EA 3BY1A 4X7DA 4OPSA 4RDJA 4RDLA 4WZEA 3Q6QA 5HZBA 3Q3AA 4P3IA 3Q38A 4ROXA 3ASRA 2OBTA 4OPOA 3PUMA 4WZTA 3PVDA 2OBRA
chains in the Genus database with same CATH superfamily
2BM0A 4KKUA 5IK2A 5FA6A 2E1BA 3ZBTA 4G1BA 1E1RA 4XR6A 3LO8A 2Z6BD 1N8RD 1QFYA 2GREA 2F4NA 4Y9RA 2F1LA 5TY0A 3CPXA 3OJXA 4YHBA 1E62A 3V7AA 1QH0A 4TMXA 1QUEA 4P3YA 1T6ZA 5J3OA 2QTLA 2C4UA 2ZITA 1UMKA 3R6KA 2ZTNA 5HZAA 4YELA 1Q82D 1CQXA 1KTVA 2VJIA 3BQJA 1IJEA 1I18A 3OW7A 4RCZA 2ZL5A 4P6YA 4TMZA 1E3XA 1CNEA 3W5VA 4Z4TA 2V31A 1GO2A 2YWEA 2V7WA 3ASQA 4DNRB 3Q39A 1WDTA 4FK8A 1BPLA 5IYWA 1D1NA 2XZLA 2HCJB 2VNHA 3A8JA 1EP1B 3ZPNA 4B43A 3JQRA 1D8TA 3OP1A 4IW3B 3AVTA 2EIXA 3CCQB 2BGJA 3OW2B 3JU4A 1T6XA 1E64A 2CNDA 5FNZA 3T51B 4M2LA 3AGPA 4UZFA 5LMZA 2BM1A 3A1PA 2VNKA 1WTHD 1SM4A 2I1LA 3W5UA 3WY9A 2VYQA 3ASTA 1U2RA 1QGYA 3E20A 1R5NA 4PC7A 3CPWB 1FRNA 3CXCB 3D26A 4P12A 3WQZA 1G7TA 4PABA 2QMUA 2QN6A 2M5SA 2ZBUA 1PKVA 1EXMA 4DQKA 2V7TA 1H85A 1OGJA 4OPVA 1ZM3A 2BGIA 1R5BA 2X8KA 4PGOA 1ELOA 3OZVA 1FNCA 4X7FA 1YI2B 2HLDA 4J0QA 1P4MA 1Q9SA 4UAJA 3ASPA 4RPBA 5KNLA 3B78A 1ZM4A 1UD2A 4DNTB 3E1YE 2RC6A 4XD7A 5A88A 1KK3A 2R6HA 1V0FA 1Q86D 3VMFA 4LBYA 4NBSA 2OTJB 2Q6KA 2C5HA 1K73D 3MMPA 2OYNA 4RDLA 3Q6QA 1TVCA 3FPKA 4LBZA 4ZCIA 1KC8D 1TLLA 1N07A 4JMQA 1JJ2B 5H5JA 1FRQA 1PJ5A 1XB2A 4ROXA 4DK0A 3NE5B 1OGIA 1VQ5B 1B23P 2VBUA 4TSFA 2CC2A 3BC9A 1UD8A 4ACBA 4KKTA 3WNBA 4ACAA 2YWHA 3W5HA 3HAGA 3CC4B 4G6IA 1TTTA 1WOPA 1JNYA 2XNJA 3AVYA 4P22A 1KMHA 2D74A 3CB4A 1G7RA 3QFSA 4B47A 2X85A 1YJWB 2BMWA 3T53B 4RD2A 4Z4YA 2CK3A 4X8IA 2B7BA 5F4OA 4Z4RA 3BH4A 4Y9UA 1DG1G 4BPRA 5E6TA 2GJPA 4UZUA 1F20A 4MYTA 5DSZA 3CRZA 3PA2A 3CW2A 4PC2A 3FPPA 1PJ6A 2NPFA 1AIPA 3ZZUA 1VQ4B 1N0VC 2QGGA 1S72B 4TN1A 1ZM9A 5F4JA 3SLDA 2Q6OA 2W6JA 3QFCA 1I7PA 5F4MA 4G1VA 1WSRA 2EFGA 2DY1A 3DDYA 4K1XA 4QVJA 1QGZA 1EP3B 1RQPA 1QFJA 2XZPA 2X6WA 3G05A 3OKXA 5IYQA 4OP7A 2DERA 4YAOA 1BJKA 2P3MA 3LVBA 4P2NA 5CDFA 3ISXA 4FXUA 3OZWA 3WXMA 1KJZA 2FX3A 2X6YA 4FN5A 4X7CA 2D3NA 1AMOA 4RD4A 5IYPA 3CC7B 1BMFA 4G5GA 1K28D 1W0KA 2VBVA 4PC6A 4OOVA 3RY8A 1Q81D 4WWVA 3ZUGA 2C77A 3A8IA 4XM3A 1W34A 4RJLA 1W87A 3BCFA 2XNCA 5L46A 2QTZA 1VLOA 2VBSA 3LQEA 2XZOA 2D3LA 4M53A 3CCSB 2C2WA 4G7WA 1M90D 4M1KA 3GIRA 4RD1A 1W35A 3CMMA 5FO1A 4ZV4A 1WSVA 1Q7YD 1CNFA 2E1RA 3CCRB 4L8JA 3BY2A 4RLZA 2NV4A 1NBMA 5KSWB 1H8HA 4P1VA 4QUZA 2QE7A 4B48A 2DYIA 2XEXA 3PA1A 3QSYA 3CTAA 4II2A 3LQ6A 5FO0A 3CCVB 2VBTA 4DK1A 2ZXIA 3BY1A 4Q7JB 1HZEA 1EP2B 5B6IA 1S0UA 1N0UA 1VQMB 2WSSA 1QFZA 4Z1MA 4WZEA 1JA0A 4ZCMA 4B44A 1VQNB 4HE6A 4ZGNB 3B82A 3ASRA 2OBTA 4M4SA 1A8PA 4OPOA 3CCMB 3CP2A 2QA4B 4MYUA 2DEUA 2BF4A 2JIZA 3MHPA 4EH1A 1VQ6B 1G7CA 2RC5A 3PVDA 4N3NA 2X3UA 1VQPB 3OEHA 2XOKA 2OBRA 3OE7A 1IB0A 5HKKA 2GK7A 1E79A 4ZGQB 1VF7A 1NDHA 4II3A 1YJ9B 4ASUA 4XKWA 4ZCLA 1EFCA 2JN9A 2OK7A 3ASSA 5FL7A 3CMAB 4XLAA 3A3GA 4C0SA 1VLYA 2OBSA 3T56B 2WYRA 3ONUA 4XNFA 4YAUA 3CESA 4H9GA 1FX0A 3ES9A 2WZPP 2ZBVA 2V7UA 1DARA 3QFTA 1E1QA 3VNUA 3BNWA 3LNNA 1YITB 2LZJA 5J35A 2QEXB 2PE3A 2VNIA 4P6VF 4GQNA 2BN4A 4RPDA 2JJ1A 3JQQA 2WR8A 3CCLB 1YIJB 1KRHA 3GQBA 1BQEA 1KK1A 5DS0A 1F60A 3OJWA 2PIAA 4N3GA 3GVJA 1VHEA 1QVGB 1OB2A 1FDRA 1N05A 3G4SB 3I55B 1KQSB 1T6YA 4XLEA 4AVZA 1RQRA 1T5EA 3GVKA 2CF4A 1XQBA 4XQFA 1KK2A 1BX1A 1DDGA 3KEWA 1VHOA 1Y0RA 2DIEA 1NB0A 4WZKA 4TT3A 1R5OA 1WU8A 2DCUA 4HIZA 2GJRA 1N08A 1XE1A 2B7CA 2Q6LA 1S4MA 2C5BA 2ZL6A 2ZZEA 2V4DA 4X07A 5BSYA 3MCAA 2ZL7A 4Z4UA 2OTLB 3WNCA 2R9VA 3VO1A 3U6BA 3G6EB 1K9MD 1OB0A 2BSAA 4B3XA 4XLFA 1GAWA 1VQKB 4E0FA 3WBJA 1UD4A 3CCEB 4OOXA 1E43A 1TUIA 4AF7A 1WOSA 2BV3A 3SKBA 4XLHA 3W2IA 4PAAA 1B2RA 1WOOA 3B8HA 4F7DA 1KK0A 4R71A 5IYRA 1WPCA 4B3FX 3CCJB 2C78A 1KD1D 4X0CA 2C4TA 4FWTA 4CQJA 1W2BB 3CC2B 5GV7A 3R6JA 2PLFA 3BCDA 1J9ZA 4PC1A 1HA3A 2D9RA 4XOTA 3U6KA 4XKVA 3W2GA 3CP8A 5AN9A 1VQOB 1UD3A 1YX2A 1GVHA 2W6IA 4OPSA 4XN0A 4TMWA 3CMEB 2GK6A 4AC9A 1SKQA 5HZBA 4P3IA 5HXBA 3Q38A 2VZLA 2B5OA 2ZZFA 4XMYA 1IJFA 2OK8A 3FJOA 5FIUA 1NJID 3CCUB 4NNJA 2WJVA 1NB9A 2DETA 1UD6A 1SKYB 2YWGA 3VO2A 3I56B 4RD3A 4LBVA 4YXWA 4B4DA 3QFRA 2ZZQA 3ZIAA 4PC3A 4QFMA 1JB9A 1V5VA 1QG0A 1FNMA 2V7VA 1QUFA 4YAWA 2CRVA 1OB5A 3J81k 2QDXA 4P9SA 1ZM2A 3OOCA 2XNDA 3VR6A 3H94A 5KW9A 4RD6A 4P26A 2Q6IA 3OEEA 2YWFA 3ONYA 1QX4A 3GVLA 2GQFA 1G7SA 5IYNA 3P26A 1DDIA 4Y7CA 1PJ7A 3SJZA 1YLOA 5JBQA 1VQLB 1H8EA 2WJYA 4P25A 4DQLA 3SLNA 1I8DA 2J7KA 2PMDA 4WQMA 3Q6RA 2ZXHA 1ZUNB 3V76A 1EFTA 1MRZA 2WPDA 4Z4SA 5A8AA 1GAQA 4QHYA 3AVWA 3W2HA 1HVXA 1QVFB 3H9NA 3AGQA 5H59A 5BSXA 3OFNA 5A89A 4G7XA 5TRDA 3WNDA 3WBKA 1WORA 2GPJA 4Z4VA 3ZBUA 1JA1A 2CBXA 3I1FA 3AVVA 4UZEA 3WYAA 5THXA 1VQ9B 3A3BA 4X06A 4LC0A 2ZTGA 2V7QA 4RDKA 4YEJA 4XONA 1GR1A 1QGAA 1V0EA 3W2EA 4RCYA 4RM0A 1E3ZA 1W9XA 2ZZGA 2JDIA 4M0LA 3G71B 3JQPA 3ZZTA 4XL9A 2HDNB 5TV2A 1W0JA 1BLIA 3GSIA 3W2FA 1N06A 4XN3A 3P27A 2HMAA 3QE2A 3ZC3A 3AVUA 1UD5A 2X6XA 1WP6A 4Z4WA 1EFRA 2AHOA 2VJJA 4XORA 2JJ2A 4Z4ZA 2X0KA 1H42A 4AF6A 3VNVA 4LBWA 2DOGA 4QVAA 4TKOB 3OPOA 3CD6B 4C43A 4HE5A 2V7XA 4KKSA 4RD0A 1VJSA 3A35A 1YJNB 4TMVA 3SEJA 2CW5A 5GV8A 1IHMA 4OOSA 5EMNA 4TMTA 1VQ8B 4XLCA 4WZLA 1YHQB 4X05A 4QV2A 1K8AD 3U2QA 3PUNA 4YALA 3SJPA 1BX0A 4XOPA 2BPOA 2GJKA 4X7EA 1KZLA 1XFOA 3AVXA 2KVOA 4X7DA 1VQ7B 1COWA 2XGJA 4RDJA 1M1KD 1E63A 2F43A 1FNBA 1OHHA 2F1MA 4U9UA 3Q3AA 1GJRA 5TR9A 1Y0YA 2WZNA 1EFUA 4B3GA 5DN6A 1D2EA 1FNDA 2BVNA 3A8KA 2FVGA 3KL9A 1EWYA 3PENA 1NRKA 3PUMA 4NCNA 3OZUA 2X53S 4WZTA 3OAAA 1MABA 3ZZ0A 3FKSA 4YAFA 2VNJA
chains in the Genus database with same CATH topology
5KW9A 4Z4YA 5F4OA 4P26A 3ASSA 4Z4RA 3ONYA 2OBSA 5E6TA 3V7AA 5IYNA 3PA2A 3ONUA 5J3OA 4P25A 3SLNA 3R6KA 5HZAA 5F4JA 3Q6RA 3SLDA 3BQJA 2ZL5A 5F4MA 4Z4SA 5J35A 5BSXA 4QVJA 4Z4TA 4RPDA 5IYQA 3ASQA 4OP7A 3Q39A 4Z4VA 5IYWA 4P2NA 4X06A 4RDKA 4X7CA 5IYPA 4RM0A 4OOVA 3RY8A 4WZKA 2ZL6A 3ASTA 4X07A 5BSYA 3LQEA 4Z4WA 2ZL7A 4Z4UA 4Z4ZA 3D26A 4P12A 4QVAA 4OOXA 4OPVA 3BY2A 4RLZA 3SEJA 3SKBA 1IHMA 4P1VA 4OOSA 4QUZA 4X7FA 5IYRA 3PA1A 4WZLA 4X05A 4QV2A 4X0CA 3ASPA 4RPBA 3PUNA 3LQ6A 3SJPA 3R6JA 4X7EA 3BY1A 4X7DA 4OPSA 4RDJA 4RDLA 4WZEA 3Q6QA 5HZBA 3Q3AA 4P3IA 3Q38A 4ROXA 3ASRA 2OBTA 4OPOA 3PUMA 4WZTA 3PVDA 2OBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KW9 A;  4Z4Y A;  5F4O A;  4P26 A;  3ASS A;  4Z4R A;  3ONY A;  2OBS A;  5E6T A;  3V7A A;  5IYN A;  3PA2 A;  3ONU A;  5J3O A;  4P25 A;  3SLN A;  3R6K A;  5HZA A;  5F4J A;  3Q6R A;  3SLD A;  3BQJ A;  2ZL5 A;  5F4M A;  4Z4S A;  5J35 A;  5BSX A;  4QVJ A;  4Z4T A;  4RPD A;  5IYQ A;  3ASQ A;  4OP7 A;  3Q39 A;  4Z4V A;  5IYW A;  4P2N A;  4X06 A;  4RDK A;  4X7C A;  5IYP A;  4RM0 A;  4OOV A;  3RY8 A;  4WZK A;  2ZL6 A;  3AST A;  4X07 A;  5BSY A;  3LQE A;  4Z4W A;  2ZL7 A;  4Z4U A;  4Z4Z A;  3D26 A;  4P12 A;  4QVA A;  4OOX A;  4OPV A;  3BY2 A;  4RLZ A;  3SEJ A;  3SKB A;  1IHM A;  4P1V A;  4OOS A;  4QUZ A;  4X7F A;  5IYR A;  3PA1 A;  4WZL A;  4X05 A;  4QV2 A;  4X0C A;  3ASP A;  4RPB A;  3PUN A;  3LQ6 A;  3SJP A;  3R6J A;  4X7E A;  3BY1 A;  4X7D A;  4OPS A;  4RDJ A;  4RDL A;  4WZE A;  3Q6Q A;  5HZB A;  3Q3A A;  4P3I A;  3Q38 A;  4ROX A;  3ASR A;  2OBT A;  4OPO A;  3PUM A;  4WZT A;  3PVD A;  2OBR A; 
#chains in the Genus database with same CATH topology
 2BM0 A;  4KKU A;  5IK2 A;  5FA6 A;  2E1B A;  3ZBT A;  4G1B A;  1E1R A;  4XR6 A;  3LO8 A;  2Z6B D;  1N8R D;  1QFY A;  2GRE A;  2F4N A;  4Y9R A;  2F1L A;  5TY0 A;  3CPX A;  3OJX A;  4YHB A;  1E62 A;  3V7A A;  1QH0 A;  4TMX A;  1QUE A;  4P3Y A;  1T6Z A;  5J3O A;  2QTL A;  2C4U A;  2ZIT A;  1UMK A;  3R6K A;  2ZTN A;  5HZA A;  4YEL A;  1Q82 D;  1CQX A;  1KTV A;  2VJI A;  3BQJ A;  1IJE A;  1I18 A;  3OW7 A;  4RCZ A;  2ZL5 A;  4P6Y A;  4TMZ A;  1E3X A;  1CNE A;  3W5V A;  4Z4T A;  2V31 A;  1GO2 A;  2YWE A;  2V7W A;  3ASQ A;  4DNR B;  3Q39 A;  1WDT A;  4FK8 A;  1BPL A;  5IYW A;  1D1N A;  2XZL A;  2HCJ B;  2VNH A;  3A8J A;  1EP1 B;  3ZPN A;  4B43 A;  3JQR A;  1D8T A;  3OP1 A;  4IW3 B;  3AVT A;  2EIX A;  3CCQ B;  2BGJ A;  3OW2 B;  3JU4 A;  1T6X A;  1E64 A;  2CND A;  5FNZ A;  3T51 B;  4M2L A;  3AGP A;  4UZF A;  5LMZ A;  2BM1 A;  3A1P A;  2VNK A;  1WTH D;  1SM4 A;  2I1L A;  3W5U A;  3WY9 A;  2VYQ A;  3AST A;  1U2R A;  1QGY A;  3E20 A;  1R5N A;  4PC7 A;  3CPW B;  1FRN A;  3CXC B;  3D26 A;  4P12 A;  3WQZ A;  1G7T A;  4PAB A;  2QMU A;  2QN6 A;  2M5S A;  2ZBU A;  1PKV A;  1EXM A;  4DQK A;  2V7T A;  1H85 A;  1OGJ A;  4OPV A;  1ZM3 A;  2BGI A;  1R5B A;  2X8K A;  4PGO A;  1ELO A;  3OZV A;  1FNC A;  4X7F A;  1YI2 B;  2HLD A;  4J0Q A;  1P4M A;  1Q9S A;  4UAJ A;  3ASP A;  4RPB A;  5KNL A;  3B78 A;  1ZM4 A;  1UD2 A;  4DNT B;  3E1Y E;  2RC6 A;  4XD7 A;  5A88 A;  1KK3 A;  2R6H A;  1V0F A;  1Q86 D;  3VMF A;  4LBY A;  4NBS A;  2OTJ B;  2Q6K A;  2C5H A;  1K73 D;  3MMP A;  2OYN A;  4RDL A;  3Q6Q A;  1TVC A;  3FPK A;  4LBZ A;  4ZCI A;  1KC8 D;  1TLL A;  1N07 A;  4JMQ A;  1JJ2 B;  5H5J A;  1FRQ A;  1PJ5 A;  1XB2 A;  4ROX A;  4DK0 A;  3NE5 B;  1OGI A;  1VQ5 B;  1B23 P;  2VBU A;  4TSF A;  2CC2 A;  3BC9 A;  1UD8 A;  4ACB A;  4KKT A;  3WNB A;  4ACA A;  2YWH A;  3W5H A;  3HAG A;  3CC4 B;  4G6I A;  1TTT A;  1WOP A;  1JNY A;  2XNJ A;  3AVY A;  4P22 A;  1KMH A;  2D74 A;  3CB4 A;  1G7R A;  3QFS A;  4B47 A;  2X85 A;  1YJW B;  2BMW A;  3T53 B;  4RD2 A;  4Z4Y A;  2CK3 A;  4X8I A;  2B7B A;  5F4O A;  4Z4R A;  3BH4 A;  4Y9U A;  1DG1 G;  4BPR A;  5E6T A;  2GJP A;  4UZU A;  1F20 A;  4MYT A;  5DSZ A;  3CRZ A;  3PA2 A;  3CW2 A;  4PC2 A;  3FPP A;  1PJ6 A;  2NPF A;  1AIP A;  3ZZU A;  1VQ4 B;  1N0V C;  2QGG A;  1S72 B;  4TN1 A;  1ZM9 A;  5F4J A;  3SLD A;  2Q6O A;  2W6J A;  3QFC A;  1I7P A;  5F4M A;  4G1V A;  1WSR A;  2EFG A;  2DY1 A;  3DDY A;  4K1X A;  4QVJ A;  1QGZ A;  1EP3 B;  1RQP A;  1QFJ A;  2XZP A;  2X6W A;  3G05 A;  3OKX A;  5IYQ A;  4OP7 A;  2DER A;  4YAO A;  1BJK A;  2P3M A;  3LVB A;  4P2N A;  5CDF A;  3ISX A;  4FXU A;  3OZW A;  3WXM A;  1KJZ A;  2FX3 A;  2X6Y A;  4FN5 A;  4X7C A;  2D3N A;  1AMO A;  4RD4 A;  5IYP A;  3CC7 B;  1BMF A;  4G5G A;  1K28 D;  1W0K A;  2VBV A;  4PC6 A;  4OOV A;  3RY8 A;  1Q81 D;  4WWV A;  3ZUG A;  2C77 A;  3A8I A;  4XM3 A;  1W34 A;  4RJL A;  1W87 A;  3BCF A;  2XNC A;  5L46 A;  2QTZ A;  1VLO A;  2VBS A;  3LQE A;  2XZO A;  2D3L A;  4M53 A;  3CCS B;  2C2W A;  4G7W A;  1M90 D;  4M1K A;  3GIR A;  4RD1 A;  1W35 A;  3CMM A;  5FO1 A;  4ZV4 A;  1WSV A;  1Q7Y D;  1CNF A;  2E1R A;  3CCR B;  4L8J A;  3BY2 A;  4RLZ A;  2NV4 A;  1NBM A;  5KSW B;  1H8H A;  4P1V A;  4QUZ A;  2QE7 A;  4B48 A;  2DYI A;  2XEX A;  3PA1 A;  3QSY A;  3CTA A;  4II2 A;  3LQ6 A;  5FO0 A;  3CCV B;  2VBT A;  4DK1 A;  2ZXI A;  3BY1 A;  4Q7J B;  1HZE A;  1EP2 B;  5B6I A;  1S0U A;  1N0U A;  1VQM B;  2WSS A;  1QFZ A;  4Z1M A;  4WZE A;  1JA0 A;  4ZCM A;  4B44 A;  1VQN B;  4HE6 A;  4ZGN B;  3B82 A;  3ASR A;  2OBT A;  4M4S A;  1A8P A;  4OPO A;  3CCM B;  3CP2 A;  2QA4 B;  4MYU A;  2DEU A;  2BF4 A;  2JIZ A;  3MHP A;  4EH1 A;  1VQ6 B;  1G7C A;  2RC5 A;  3PVD A;  4N3N A;  2X3U A;  1VQP B;  3OEH A;  2XOK A;  2OBR A;  3OE7 A;  1IB0 A;  5HKK A;  2GK7 A;  1E79 A;  4ZGQ B;  1VF7 A;  1NDH A;  4II3 A;  1YJ9 B;  4ASU A;  4XKW A;  4ZCL A;  1EFC A;  2JN9 A;  2OK7 A;  3ASS A;  5FL7 A;  3CMA B;  4XLA A;  3A3G A;  4C0S A;  1VLY A;  2OBS A;  3T56 B;  2WYR A;  3ONU A;  4XNF A;  4YAU A;  3CES A;  4H9G A;  1FX0 A;  3ES9 A;  2WZP P;  2ZBV A;  2V7U A;  1DAR A;  3QFT A;  1E1Q A;  3VNU A;  3BNW A;  3LNN A;  1YIT B;  2LZJ A;  5J35 A;  2QEX B;  2PE3 A;  2VNI A;  4P6V F;  4GQN A;  2BN4 A;  4RPD A;  2JJ1 A;  3JQQ A;  2WR8 A;  3CCL B;  1YIJ B;  1KRH A;  3GQB A;  1BQE A;  1KK1 A;  5DS0 A;  1F60 A;  3OJW A;  2PIA A;  4N3G A;  3GVJ A;  1VHE A;  1QVG B;  1OB2 A;  1FDR A;  1N05 A;  3G4S B;  3I55 B;  1KQS B;  1T6Y A;  4XLE A;  4AVZ A;  1RQR A;  1T5E A;  3GVK A;  2CF4 A;  1XQB A;  4XQF A;  1KK2 A;  1BX1 A;  1DDG A;  3KEW A;  1VHO A;  1Y0R A;  2DIE A;  1NB0 A;  4WZK A;  4TT3 A;  1R5O A;  1WU8 A;  2DCU A;  4HIZ A;  2GJR A;  1N08 A;  1XE1 A;  2B7C A;  2Q6L A;  1S4M A;  2C5B A;  2ZL6 A;  2ZZE A;  2V4D A;  4X07 A;  5BSY A;  3MCA A;  2ZL7 A;  4Z4U A;  2OTL B;  3WNC A;  2R9V A;  3VO1 A;  3U6B A;  3G6E B;  1K9M D;  1OB0 A;  2BSA A;  4B3X A;  4XLF A;  1GAW A;  1VQK B;  4E0F A;  3WBJ A;  1UD4 A;  3CCE B;  4OOX A;  1E43 A;  1TUI A;  4AF7 A;  1WOS A;  2BV3 A;  3SKB A;  4XLH A;  3W2I A;  4PAA A;  1B2R A;  1WOO A;  3B8H A;  4F7D A;  1KK0 A;  4R71 A;  5IYR A;  1WPC A;  4B3F X;  3CCJ B;  2C78 A;  1KD1 D;  4X0C A;  2C4T A;  4FWT A;  4CQJ A;  1W2B B;  3CC2 B;  5GV7 A;  3R6J A;  2PLF A;  3BCD A;  1J9Z A;  4PC1 A;  1HA3 A;  2D9R A;  4XOT A;  3U6K A;  4XKV A;  3W2G A;  3CP8 A;  5AN9 A;  1VQO B;  1UD3 A;  1YX2 A;  1GVH A;  2W6I A;  4OPS A;  4XN0 A;  4TMW A;  3CME B;  2GK6 A;  4AC9 A;  1SKQ A;  5HZB A;  4P3I A;  5HXB A;  3Q38 A;  2VZL A;  2B5O A;  2ZZF A;  4XMY A;  1IJF A;  2OK8 A;  3FJO A;  5FIU A;  1NJI D;  3CCU B;  4NNJ A;  2WJV A;  1NB9 A;  2DET A;  1UD6 A;  1SKY B;  2YWG A;  3VO2 A;  3I56 B;  4RD3 A;  4LBV A;  4YXW A;  4B4D A;  3QFR A;  2ZZQ A;  3ZIA A;  4PC3 A;  4QFM A;  1JB9 A;  1V5V A;  1QG0 A;  1FNM A;  2V7V A;  1QUF A;  4YAW A;  2CRV A;  1OB5 A;  3J81 k;  2QDX A;  4P9S A;  1ZM2 A;  3OOC A;  2XND A;  3VR6 A;  3H94 A;  5KW9 A;  4RD6 A;  4P26 A;  2Q6I A;  3OEE A;  2YWF A;  3ONY A;  1QX4 A;  3GVL A;  2GQF A;  1G7S A;  5IYN A;  3P26 A;  1DDI A;  4Y7C A;  1PJ7 A;  3SJZ A;  1YLO A;  5JBQ A;  1VQL B;  1H8E A;  2WJY A;  4P25 A;  4DQL A;  3SLN A;  1I8D A;  2J7K A;  2PMD A;  4WQM A;  3Q6R A;  2ZXH A;  1ZUN B;  3V76 A;  1EFT A;  1MRZ A;  2WPD A;  4Z4S A;  5A8A A;  1GAQ A;  4QHY A;  3AVW A;  3W2H A;  1HVX A;  1QVF B;  3H9N A;  3AGQ A;  5H59 A;  5BSX A;  3OFN A;  5A89 A;  4G7X A;  5TRD A;  3WND A;  3WBK A;  1WOR A;  2GPJ A;  4Z4V A;  3ZBU A;  1JA1 A;  2CBX A;  3I1F A;  3AVV A;  4UZE A;  3WYA A;  5THX A;  1VQ9 B;  3A3B A;  4X06 A;  4LC0 A;  2ZTG A;  2V7Q A;  4RDK A;  4YEJ A;  4XON A;  1GR1 A;  1QGA A;  1V0E A;  3W2E A;  4RCY A;  4RM0 A;  1E3Z A;  1W9X A;  2ZZG A;  2JDI A;  4M0L A;  3G71 B;  3JQP A;  3ZZT A;  4XL9 A;  2HDN B;  5TV2 A;  1W0J A;  1BLI A;  3GSI A;  3W2F A;  1N06 A;  4XN3 A;  3P27 A;  2HMA A;  3QE2 A;  3ZC3 A;  3AVU A;  1UD5 A;  2X6X A;  1WP6 A;  4Z4W A;  1EFR A;  2AHO A;  2VJJ A;  4XOR A;  2JJ2 A;  4Z4Z A;  2X0K A;  1H42 A;  4AF6 A;  3VNV A;  4LBW A;  2DOG A;  4QVA A;  4TKO B;  3OPO A;  3CD6 B;  4C43 A;  4HE5 A;  2V7X A;  4KKS A;  4RD0 A;  1VJS A;  3A35 A;  1YJN B;  4TMV A;  3SEJ A;  2CW5 A;  5GV8 A;  1IHM A;  4OOS A;  5EMN A;  4TMT A;  1VQ8 B;  4XLC A;  4WZL A;  1YHQ B;  4X05 A;  4QV2 A;  1K8A D;  3U2Q A;  3PUN A;  4YAL A;  3SJP A;  1BX0 A;  4XOP A;  2BPO A;  2GJK A;  4X7E A;  1KZL A;  1XFO A;  3AVX A;  2KVO A;  4X7D A;  1VQ7 B;  1COW A;  2XGJ A;  4RDJ A;  1M1K D;  1E63 A;  2F43 A;  1FNB A;  1OHH A;  2F1M A;  4U9U A;  3Q3A A;  1GJR A;  5TR9 A;  1Y0Y A;  2WZN A;  1EFU A;  4B3G A;  5DN6 A;  1D2E A;  1FND A;  2BVN A;  3A8K A;  2FVG A;  3KL9 A;  1EWY A;  3PEN A;  1NRK A;  3PUM A;  4NCN A;  3OZU A;  2X53 S;  4WZT A;  3OAA A;  1MAB A;  3ZZ0 A;  3FKS A;  4YAF A;  2VNJ A; 
#chains in the Genus database with same CATH homology
 5KW9 A;  4Z4Y A;  5F4O A;  4P26 A;  3ASS A;  4Z4R A;  3ONY A;  2OBS A;  5E6T A;  3V7A A;  5IYN A;  3PA2 A;  3ONU A;  5J3O A;  4P25 A;  3SLN A;  3R6K A;  5HZA A;  5F4J A;  3Q6R A;  3SLD A;  3BQJ A;  2ZL5 A;  5F4M A;  4Z4S A;  5J35 A;  5BSX A;  4QVJ A;  4Z4T A;  4RPD A;  5IYQ A;  3ASQ A;  4OP7 A;  3Q39 A;  4Z4V A;  5IYW A;  4P2N A;  4X06 A;  4RDK A;  4X7C A;  5IYP A;  4RM0 A;  4OOV A;  3RY8 A;  4WZK A;  2ZL6 A;  3AST A;  4X07 A;  5BSY A;  3LQE A;  4Z4W A;  2ZL7 A;  4Z4U A;  4Z4Z A;  3D26 A;  4P12 A;  4QVA A;  4OOX A;  4OPV A;  3BY2 A;  4RLZ A;  3SEJ A;  3SKB A;  1IHM A;  4P1V A;  4OOS A;  4QUZ A;  4X7F A;  5IYR A;  3PA1 A;  4WZL A;  4X05 A;  4QV2 A;  4X0C A;  3ASP A;  4RPB A;  3PUN A;  3LQ6 A;  3SJP A;  3R6J A;  4X7E A;  3BY1 A;  4X7D A;  4OPS A;  4RDJ A;  4RDL A;  4WZE A;  3Q6Q A;  5HZB A;  3Q3A A;  4P3I A;  3Q38 A;  4ROX A;  3ASR A;  2OBT A;  4OPO A;  3PUM A;  4WZT A;  3PVD A;  2OBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...