3LQ6A

Crystal structure of murine norovirus protruding (p) domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
313
structure length
313
Chain Sequence
RMVDLPVIQPRLCTHARWPAPVYGLLVDPSLPSNPQWQNGRVHVDGTLLGTTPISGSWVSCFAAEAAYEFQSGTGEVATFTLIEQDGSAYVPGDRAAPLGYPDFSGQLEIEVQTETTKTGDKLKVTTFEMILGPTTNADQAPYQGRVFASVTAAASLDLVDGRVRAVPRSIYGFQDTIPEYNDGLLVPLAPPIGPFLPGEVLLRFRTYMRQIDTADAAAEAIDCALPQEFVSWFASNAFTVQSEALLLRYRNTLTGQLLFECKLYNEGYIALSYSGSGPLTFPTDGIFEVVSWVPRLYQLASVGSLATGRMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title High-resolution x-ray structure and functional analysis of the murine norovirus 1 capsid protein protruding domain.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Viral protein
total genus 64
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3lq6A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3lq6A01
4Z4VA 4WZEA 4Z4WA 3PA1A 3ASTA 3ONYA 3LQEA 5BSYA 4RPBA 3PUNA 3ASQA 3SKBA 3RY8A 4QVAA 4X06A 4X7EA 2OBRA 3PVDA 4X7CA 4OPVA 5KW9A 3BQJA 5IYPA 4OPSA 3Q3AA 3V7AA 3ASSA 4OOXA 4RDLA 3R6KA 3PUMA 3Q6QA 4OOVA 5BSXA 4WZTA 3PA2A 4P25A 5IYWA 5HZBA 5J3OA 4OP7A 3ONUA 5IYNA 4RM0A 4OPOA 4ROXA 3Q39A 4Z4TA 3BY2A 4X0CA 4QVJA 4X07A 4P2NA 3ASPA 4X7DA 4OOSA 3D26A 4X7FA 4Z4SA 3LQ6A 5IYQA 5F4MA 4WZKA 3R6JA 4Z4RA 1IHMA 3Q38A 4P3IA 3SLDA 4P26A 5E6TA 4P1VA 5F4JA 4Z4ZA 4RPDA 4P12A 2ZL6A 4RDJA 3SEJA 2ZL7A 4WZLA 5J35A 5F4OA 3SLNA 5HZAA 3BY1A 4QUZA 4Z4YA 3ASRA 2OBSA 3Q6RA 4Z4UA 4RDKA 3SJPA 4QV2A 5IYRA 2ZL5A 4RLZA 4X05A 2OBTA
chains in the Genus database with same CATH superfamily
3CCEB 4WZEA 4PC3A 1XFOA 1E79A 4PGOA 3ASTA 1W2BB 3LQEA 2PLFA 4H9GA 4G6IA 1HVXA 3AVWA 1I7PA 3U2QA 1WSVA 3JQPA 3CMMA 2DCUA 4N3GA 5KSWB 1XQBA 1Y0RA 1KC8D 4HE6A 3I1FA 2VBTA 1VQKB 4XONA 2W6IA 3WNBA 1FNBA 1KJZA 4X7CA 4P6YA 1AMOA 3DDYA 3QSYA 3Q3AA 1KMHA 3BCDA 3ASSA 4Y9UA 3GVKA 4Z1MA 2XNCA 2Q6LA 2M5SA 1G7RA 1ZM2A 1WP6A 4B3GA 4WZTA 3QFCA 1G7SA 1I8DA 1SM4A 4G1BA 1BMFA 2QA4B 4M1KA 3W5VA 1N06A 4DQKA 1EFRA 5FO0A 4DQLA 3LNNA 3VNVA 5GV7A 1QVFB 4XORA 1B23P 3CTAA 4RM0A 1E64A 3G71B 4XKVA 2R9VA 3W2IA 1FRQA 2CK3A 3A8JA 4Z4TA 3CP8A 4X0CA 4RD3A 4M53A 4TSFA 2D3NA 2F1MA 3VNUA 4X07A 1DG1G 2BM1A 2CF4A 3JU4A 4NNJA 4QHYA 1FRNA 3CCUB 1KK0A 3D26A 3GIRA 4DNTB 2WYRA 1K28D 1F60A 1FNCA 5F4MA 5TY0A 3R6JA 2XNDA 2BGIA 5CDFA 1IHMA 1EP1B 1VQ8B 3WQZA 3Q38A 3QFSA 2X53S 1TVCA 1QGYA 2FX3A 3AVTA 3GVJA 1E43A 2VNKA 2KVOA 4P1VA 4RPDA 4B47A 3CCQB 4RD1A 2ZL6A 2F43A 3V76A 4XM3A 2ZL7A 4G1VA 1UD5A 4UZEA 5J35A 5F4OA 5HZAA 4TMVA 3AVXA 1QUFA 1B2RA 4B3XA 2GJKA 5HKKA 1D2EA 3BY1A 4U9UA 1UD6A 2JDIA 2XEXA 5TR9A 1FNDA 4YAFA 1YJ9B 3ASRA 4XR6A 4M0LA 1EXMA 3WNCA 4II3A 4UZFA 1H8HA 1IB0A 1ELOA 1UD4A 5FL7A 5IK2A 1NRKA 1W34A 4DK0A 3OZWA 5KNLA 1IJEA 1QUEA 3OEHA 3FPPA 3ZBTA 1VQPB 4XLFA 2ZL5A 2VZLA 1R5BA 2XZPA 4TN1A 4UZUA 2BMWA 1WOOA 1GJRA 2CRVA 4RLZA 1VQMB 2OBTA 2OTLB 4Z4VA 3WXMA 4P9SA 1Y0YA 4YEJA 3ONYA 1JB9A 3I56B 1NB9A 2DEUA 4L8JA 3CCLB 2GK7A 3VO1A 1W87A 4RPBA 3ZZ0A 1E3XA 2XGJA 1WPCA 3SKBA 3RY8A 1NJID 2V7XA 4QVAA 4X7EA 3CPXA 3FKSA 4ZV4A 1OGIA 3ZC3A 1G7TA 2OBRA 3OPOA 1I18A 4FN5A 5TV2A 1M1KD 1KTVA 1S4MA 2E1RA 3H9NA 1GO2A 1J9ZA 4FXUA 2Q6KA 3Q6QA 5BSXA 2DETA 3ZZTA 1VQ5B 2V7TA 3OKXA 2C2WA 3CCSB 1A8PA 1FX0A 2VBVA 5DS0A 4P25A 4P22A 2XZLA 3T53B 3A3BA 5IYWA 1NDHA 5JBQA 2Q6IA 5GV8A 1E3ZA 3W2FA 2VJIA 2VBUA 1R5NA 4IW3B 1NBMA 3P27A 4XN0A 1VQOB 2VJJA 2ZTNA 4WQMA 1WSRA 4XKWA 3ONUA 2QGGA 4ASUA 1K9MD 1KZLA 4AVZA 4OPOA 2I1LA 1CNFA 1GAQA 1OB0A 2VYQA 3BY2A 4XLCA 5TRDA 3MMPA 3CRZA 2BF4A 2HCJB 4BPRA 3VR6A 1EWYA 1T6ZA 3FJOA 1KRHA 2AHOA 3W2EA 4P2NA 4WWVA 4B43A 4OOSA 4ZCMA 3CCVB 1D1NA 4E0FA 4Z4SA 2ZXIA 2X6YA 3OW7A 4Z4RA 1YHQB 2B7BA 1KD1D 2WR8A 4XLEA 2CC2A 4P3IA 4YAUA 2BPOA 5FNZA 3QFTA 3CXCB 2C5HA 2BM0A 3P26A 1OB5A 3OEEA 2NV4A 4P12A 1PKVA 4RDJA 2DERA 3SEJA 3QE2A 1VQ6B 4N3NA 4WZLA 3JQRA 2OTJB 2YWFA 3OJWA 1GR1A 3JQQA 1BQEA 1H85A 1H8EA 4FK8A 1JA0A 1WORA 4QUZA 4AF7A 2JIZA 4Z4YA 3CC4B 3G4SB 1S72B 1OGJA 4YHBA 1F20A 2XNJA 2X8KA 1BPLA 3B82A 4XMYA 2NPFA 2C4UA 3ZBUA 1QFZA 3ZZUA 2WZPP 4RDKA 4QV2A 2VBSA 2J7KA 3KL9A 4JMQA 2JN9A 2WZNA 2QTZA 3G6EB 4TMZA 3BC9A 2B7CA 4AF6A 1HZEA 2ZXHA 2ZZGA 3ZPNA 2EFGA 1PJ5A 4Z4WA 2GQFA 1JJ2B 1UD8A 4LBZA 2C5BA 4RD0A 1UD3A 4C0SA 1VLOA 2Q6OA 2BV3A 1TLLA 3CCJB 3ASQA 2RC6A 2V7UA 1FDRA 3PVDA 3CC2B 3OE7A 4XN3A 2BVNA 4PABA 1W0JA 4ZGNB 4OPVA 3AGQA 4XQFA 3BQJA 4UAJA 1R5OA 2Z6BD 4OPSA 4RD6A 4YAWA 1VHEA 3A3GA 3V7AA 4OOXA 3WNDA 4RDLA 4DK1A 3R6KA 4OOVA 1QFYA 2V7WA 4II2A 4XLAA 1QGZA 3CC7B 3NE5B 2LZJA 1WTHD 2X6WA 1P4MA 3CESA 1MABA 5DN6A 3FPKA 1TTTA 1AIPA 4F7DA 3HAGA 5HZBA 3CB4A 1CNEA 2C77A 2VNHA 3BH4A 5J3OA 4RD2A 4DNRB 3MHPA 4PC1A 1EP3B 3BNWA 3OOCA 4GQNA 1RQRA 1RQPA 3ISXA 3B8HA 3VMFA 1K8AD 2ZITA 3W2GA 2GJRA 5IYNA 4M2LA 4ROXA 3OW2B 1ZM9A 1VQ7B 4ACAA 2BGJA 3CP2A 1EFUA 4B4DA 1PJ7A 2CW5A 1VQ4B 2PMDA 4NBSA 4PC7A 4KKSA 1V5VA 2V31A 4RJLA 1VJSA 3OP1A 1Q82D 1W35A 3ASPA 4X7DA 2W6JA 4KKTA 3B78A 2P3MA 4X7FA 4G7XA 3LQ6A 5IYQA 1N05A 1UD2A 2VNJA 4WZKA 1KQSB 2B5OA 2OYNA 1EP2B 1EFCA 3QFRA 2JJ2A 2XZOA 3LO8A 2ZZFA 3PENA 4AC9A 2RC5A 4TT3A 2YWGA 4HIZA 3AVVA 4MYUA 4P26A 1N0UA 2WJYA 2X85A 5F4JA 2BSAA 4Z4ZA 1YIJB 3W5HA 3U6KA 1QGAA 1T5EA 4RCZA 3BCFA 1QG0A 2HDNB 1H42A 2F1LA 2ZBVA 2C4TA 2E1BA 4MYTA 2V7VA 1XB2A 2QTLA 2ZBUA 1BX1A 2GPJA 2OK7A 3SJZA 4ACBA 3OZUA 1Q9SA 1ZUNB 1SKQA 3CCMB 3CPWB 1CQXA 1DDGA 2GREA 3Q6RA 1YLOA 2XOKA 4KKUA 1BJKA 3CCRB 1JNYA 1KK2A 1WU8A 2GK6A 2QMUA 1QH0A 3WY9A 4TMTA 4PC6A 2D9RA 1E62A 2ZZQA 5IYRA 4XLHA 3OJXA 4Y7CA 4YALA 2PE3A 1MRZA 1K73D 4B44A 4X05A 4XOTA 3VO2A 1BX0A 2V7QA 2D3LA 1ZM3A 3PA1A 2VNIA 1GAWA 1QX4A 4G5GA 4QFMA 1COWA 5BSYA 1T6XA 1YITB 1N8RD 2YWEA 3WBKA 3PUNA 2QEXB 4X8IA 4RCYA 4G7WA 3OAAA 4X06A 3T56B 4FWTA 5H5JA 1N07A 2QE7A 2HMAA 1KK1A 1V0FA 4NCNA 4ZCIA 5KW9A 1VLYA 4C43A 1EFTA 5IYPA 2EIXA 2ZTGA 1VF7A 4ZGQB 3W2HA 2X6XA 3PUMA 3WBJA 3A8IA 4Y9RA 1GVHA 3CD6B 3AVYA 3T51B 2D74A 1UMKA 4XNFA 2CNDA 2DIEA 3PA2A 1D8TA 4YAOA 5FIUA 2ZZEA 5FO1A 5A8AA 2DOGA 4XD7A 1E1QA 3ES9A 3E1YE 3H94A 4J0QA 4Q7JB 1Q81D 3MCAA 4YELA 3CW2A 1W0KA 4RD4A 1HA3A 4OP7A 1DARA 1V0EA 2WPDA 4B48A 2CBXA 1M90D 1G7CA 1N08A 3KEWA 1YJNB 3OFNA 1E63A 3ZIAA 1Q86D 3ZUGA 4YXWA 1Q7YD 4LBVA 1NB0A 3Q39A 5L46A 1S0UA 2R6HA 4LBWA 4R71A 2OK8A 2V4DA 1IJFA 5B6IA 5EMNA 1VHOA 1YX2A 2JJ1A 3AVUA 4XL9A 3CMEB 4PC2A 4QVJA 5DSZA 4XOPA 2QDXA 3A35A 4ZCLA 4CQJA 2C78A 1OB2A 3U6BA 2WJVA 4K1XA 1YI2B 4P3YA 2GJPA 1BLIA 1OHHA 2HLDA 1VQNB 3GSIA 4TMWA 4LC0A 3W5UA 1T6YA 1W9XA 5LMZA 2DYIA 1VQLB 1JA1A 1XE1A 1ZM4A 3SLDA 2X3UA 1PJ6A 5E6TA 5A88A 4TMXA 1N0VC 2FVGA 4P6VF 3LVBA 5H59A 4LBYA 5HXBA 4EH1A 4B3FX 5THXA 3J81k 1DDIA 3GQBA 1E1RA 1QVGB 3SLNA 5FA6A 4HE5A 3AGPA 3I55B 1WOSA 5A89A 1KK3A 3WYAA 1U2RA 1TUIA 1VQ9B 4M4SA 2OBSA 3A8KA 5AN9A 1QFJA 1WDTA 3OZVA 4Z4UA 1SKYB 3A1PA 2F4NA 2QN6A 3SJPA 2YWHA 4PAAA 1YJWB 3G05A 1FNMA 4TKOB 2BN4A 1WOPA 3GVLA 3CMAB 2PIAA 2DY1A 2WSSA 3E20A 2X0KA
chains in the Genus database with same CATH topology
4Z4VA 4WZEA 4Z4WA 3PA1A 3ASTA 3ONYA 3LQEA 5BSYA 4RPBA 3PUNA 3ASQA 3SKBA 3RY8A 4QVAA 4X06A 4X7EA 2OBRA 3PVDA 4X7CA 4OPVA 5KW9A 3BQJA 5IYPA 4OPSA 3Q3AA 3V7AA 3ASSA 4OOXA 4RDLA 3R6KA 3PUMA 3Q6QA 4OOVA 5BSXA 4WZTA 3PA2A 4P25A 5IYWA 5HZBA 5J3OA 4OP7A 3ONUA 5IYNA 4RM0A 4OPOA 4ROXA 3Q39A 4Z4TA 3BY2A 4X0CA 4QVJA 4X07A 4P2NA 3ASPA 4X7DA 4OOSA 3D26A 4X7FA 4Z4SA 3LQ6A 5IYQA 5F4MA 4WZKA 3R6JA 4Z4RA 1IHMA 3Q38A 4P3IA 3SLDA 4P26A 5E6TA 4P1VA 5F4JA 4Z4ZA 4RPDA 4P12A 2ZL6A 4RDJA 3SEJA 2ZL7A 4WZLA 5J35A 5F4OA 3SLNA 5HZAA 3BY1A 4QUZA 4Z4YA 3ASRA 2OBSA 3Q6RA 4Z4UA 4RDKA 3SJPA 4QV2A 5IYRA 2ZL5A 4RLZA 4X05A 2OBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4V A;  4WZE A;  4Z4W A;  3PA1 A;  3AST A;  3ONY A;  3LQE A;  5BSY A;  4RPB A;  3PUN A;  3ASQ A;  3SKB A;  3RY8 A;  4QVA A;  4X06 A;  4X7E A;  2OBR A;  3PVD A;  4X7C A;  4OPV A;  5KW9 A;  3BQJ A;  5IYP A;  4OPS A;  3Q3A A;  3V7A A;  3ASS A;  4OOX A;  4RDL A;  3R6K A;  3PUM A;  3Q6Q A;  4OOV A;  5BSX A;  4WZT A;  3PA2 A;  4P25 A;  5IYW A;  5HZB A;  5J3O A;  4OP7 A;  3ONU A;  5IYN A;  4RM0 A;  4OPO A;  4ROX A;  3Q39 A;  4Z4T A;  3BY2 A;  4X0C A;  4QVJ A;  4X07 A;  4P2N A;  3ASP A;  4X7D A;  4OOS A;  3D26 A;  4X7F A;  4Z4S A;  3LQ6 A;  5IYQ A;  5F4M A;  4WZK A;  3R6J A;  4Z4R A;  1IHM A;  3Q38 A;  4P3I A;  3SLD A;  4P26 A;  5E6T A;  4P1V A;  5F4J A;  4Z4Z A;  4RPD A;  4P12 A;  2ZL6 A;  4RDJ A;  3SEJ A;  2ZL7 A;  4WZL A;  5J35 A;  5F4O A;  3SLN A;  5HZA A;  3BY1 A;  4QUZ A;  4Z4Y A;  3ASR A;  2OBS A;  3Q6R A;  4Z4U A;  4RDK A;  3SJP A;  4QV2 A;  5IYR A;  2ZL5 A;  4RLZ A;  4X05 A;  2OBT A; 
#chains in the Genus database with same CATH topology
 3CCE B;  4WZE A;  4PC3 A;  1XFO A;  1E79 A;  4PGO A;  3AST A;  1W2B B;  3LQE A;  2PLF A;  4H9G A;  4G6I A;  1HVX A;  3AVW A;  1I7P A;  3U2Q A;  1WSV A;  3JQP A;  3CMM A;  2DCU A;  4N3G A;  5KSW B;  1XQB A;  1Y0R A;  1KC8 D;  4HE6 A;  3I1F A;  2VBT A;  1VQK B;  4XON A;  2W6I A;  3WNB A;  1FNB A;  1KJZ A;  4X7C A;  4P6Y A;  1AMO A;  3DDY A;  3QSY A;  3Q3A A;  1KMH A;  3BCD A;  3ASS A;  4Y9U A;  3GVK A;  4Z1M A;  2XNC A;  2Q6L A;  2M5S A;  1G7R A;  1ZM2 A;  1WP6 A;  4B3G A;  4WZT A;  3QFC A;  1G7S A;  1I8D A;  1SM4 A;  4G1B A;  1BMF A;  2QA4 B;  4M1K A;  3W5V A;  1N06 A;  4DQK A;  1EFR A;  5FO0 A;  4DQL A;  3LNN A;  3VNV A;  5GV7 A;  1QVF B;  4XOR A;  1B23 P;  3CTA A;  4RM0 A;  1E64 A;  3G71 B;  4XKV A;  2R9V A;  3W2I A;  1FRQ A;  2CK3 A;  3A8J A;  4Z4T A;  3CP8 A;  4X0C A;  4RD3 A;  4M53 A;  4TSF A;  2D3N A;  2F1M A;  3VNU A;  4X07 A;  1DG1 G;  2BM1 A;  2CF4 A;  3JU4 A;  4NNJ A;  4QHY A;  1FRN A;  3CCU B;  1KK0 A;  3D26 A;  3GIR A;  4DNT B;  2WYR A;  1K28 D;  1F60 A;  1FNC A;  5F4M A;  5TY0 A;  3R6J A;  2XND A;  2BGI A;  5CDF A;  1IHM A;  1EP1 B;  1VQ8 B;  3WQZ A;  3Q38 A;  3QFS A;  2X53 S;  1TVC A;  1QGY A;  2FX3 A;  3AVT A;  3GVJ A;  1E43 A;  2VNK A;  2KVO A;  4P1V A;  4RPD A;  4B47 A;  3CCQ B;  4RD1 A;  2ZL6 A;  2F43 A;  3V76 A;  4XM3 A;  2ZL7 A;  4G1V A;  1UD5 A;  4UZE A;  5J35 A;  5F4O A;  5HZA A;  4TMV A;  3AVX A;  1QUF A;  1B2R A;  4B3X A;  2GJK A;  5HKK A;  1D2E A;  3BY1 A;  4U9U A;  1UD6 A;  2JDI A;  2XEX A;  5TR9 A;  1FND A;  4YAF A;  1YJ9 B;  3ASR A;  4XR6 A;  4M0L A;  1EXM A;  3WNC A;  4II3 A;  4UZF A;  1H8H A;  1IB0 A;  1ELO A;  1UD4 A;  5FL7 A;  5IK2 A;  1NRK A;  1W34 A;  4DK0 A;  3OZW A;  5KNL A;  1IJE A;  1QUE A;  3OEH A;  3FPP A;  3ZBT A;  1VQP B;  4XLF A;  2ZL5 A;  2VZL A;  1R5B A;  2XZP A;  4TN1 A;  4UZU A;  2BMW A;  1WOO A;  1GJR A;  2CRV A;  4RLZ A;  1VQM B;  2OBT A;  2OTL B;  4Z4V A;  3WXM A;  4P9S A;  1Y0Y A;  4YEJ A;  3ONY A;  1JB9 A;  3I56 B;  1NB9 A;  2DEU A;  4L8J A;  3CCL B;  2GK7 A;  3VO1 A;  1W87 A;  4RPB A;  3ZZ0 A;  1E3X A;  2XGJ A;  1WPC A;  3SKB A;  3RY8 A;  1NJI D;  2V7X A;  4QVA A;  4X7E A;  3CPX A;  3FKS A;  4ZV4 A;  1OGI A;  3ZC3 A;  1G7T A;  2OBR A;  3OPO A;  1I18 A;  4FN5 A;  5TV2 A;  1M1K D;  1KTV A;  1S4M A;  2E1R A;  3H9N A;  1GO2 A;  1J9Z A;  4FXU A;  2Q6K A;  3Q6Q A;  5BSX A;  2DET A;  3ZZT A;  1VQ5 B;  2V7T A;  3OKX A;  2C2W A;  3CCS B;  1A8P A;  1FX0 A;  2VBV A;  5DS0 A;  4P25 A;  4P22 A;  2XZL A;  3T53 B;  3A3B A;  5IYW A;  1NDH A;  5JBQ A;  2Q6I A;  5GV8 A;  1E3Z A;  3W2F A;  2VJI A;  2VBU A;  1R5N A;  4IW3 B;  1NBM A;  3P27 A;  4XN0 A;  1VQO B;  2VJJ A;  2ZTN A;  4WQM A;  1WSR A;  4XKW A;  3ONU A;  2QGG A;  4ASU A;  1K9M D;  1KZL A;  4AVZ A;  4OPO A;  2I1L A;  1CNF A;  1GAQ A;  1OB0 A;  2VYQ A;  3BY2 A;  4XLC A;  5TRD A;  3MMP A;  3CRZ A;  2BF4 A;  2HCJ B;  4BPR A;  3VR6 A;  1EWY A;  1T6Z A;  3FJO A;  1KRH A;  2AHO A;  3W2E A;  4P2N A;  4WWV A;  4B43 A;  4OOS A;  4ZCM A;  3CCV B;  1D1N A;  4E0F A;  4Z4S A;  2ZXI A;  2X6Y A;  3OW7 A;  4Z4R A;  1YHQ B;  2B7B A;  1KD1 D;  2WR8 A;  4XLE A;  2CC2 A;  4P3I A;  4YAU A;  2BPO A;  5FNZ A;  3QFT A;  3CXC B;  2C5H A;  2BM0 A;  3P26 A;  1OB5 A;  3OEE A;  2NV4 A;  4P12 A;  1PKV A;  4RDJ A;  2DER A;  3SEJ A;  3QE2 A;  1VQ6 B;  4N3N A;  4WZL A;  3JQR A;  2OTJ B;  2YWF A;  3OJW A;  1GR1 A;  3JQQ A;  1BQE A;  1H85 A;  1H8E A;  4FK8 A;  1JA0 A;  1WOR A;  4QUZ A;  4AF7 A;  2JIZ A;  4Z4Y A;  3CC4 B;  3G4S B;  1S72 B;  1OGJ A;  4YHB A;  1F20 A;  2XNJ A;  2X8K A;  1BPL A;  3B82 A;  4XMY A;  2NPF A;  2C4U A;  3ZBU A;  1QFZ A;  3ZZU A;  2WZP P;  4RDK A;  4QV2 A;  2VBS A;  2J7K A;  3KL9 A;  4JMQ A;  2JN9 A;  2WZN A;  2QTZ A;  3G6E B;  4TMZ A;  3BC9 A;  2B7C A;  4AF6 A;  1HZE A;  2ZXH A;  2ZZG A;  3ZPN A;  2EFG A;  1PJ5 A;  4Z4W A;  2GQF A;  1JJ2 B;  1UD8 A;  4LBZ A;  2C5B A;  4RD0 A;  1UD3 A;  4C0S A;  1VLO A;  2Q6O A;  2BV3 A;  1TLL A;  3CCJ B;  3ASQ A;  2RC6 A;  2V7U A;  1FDR A;  3PVD A;  3CC2 B;  3OE7 A;  4XN3 A;  2BVN A;  4PAB A;  1W0J A;  4ZGN B;  4OPV A;  3AGQ A;  4XQF A;  3BQJ A;  4UAJ A;  1R5O A;  2Z6B D;  4OPS A;  4RD6 A;  4YAW A;  1VHE A;  3A3G A;  3V7A A;  4OOX A;  3WND A;  4RDL A;  4DK1 A;  3R6K A;  4OOV A;  1QFY A;  2V7W A;  4II2 A;  4XLA A;  1QGZ A;  3CC7 B;  3NE5 B;  2LZJ A;  1WTH D;  2X6W A;  1P4M A;  3CES A;  1MAB A;  5DN6 A;  3FPK A;  1TTT A;  1AIP A;  4F7D A;  3HAG A;  5HZB A;  3CB4 A;  1CNE A;  2C77 A;  2VNH A;  3BH4 A;  5J3O A;  4RD2 A;  4DNR B;  3MHP A;  4PC1 A;  1EP3 B;  3BNW A;  3OOC A;  4GQN A;  1RQR A;  1RQP A;  3ISX A;  3B8H A;  3VMF A;  1K8A D;  2ZIT A;  3W2G A;  2GJR A;  5IYN A;  4M2L A;  4ROX A;  3OW2 B;  1ZM9 A;  1VQ7 B;  4ACA A;  2BGJ A;  3CP2 A;  1EFU A;  4B4D A;  1PJ7 A;  2CW5 A;  1VQ4 B;  2PMD A;  4NBS A;  4PC7 A;  4KKS A;  1V5V A;  2V31 A;  4RJL A;  1VJS A;  3OP1 A;  1Q82 D;  1W35 A;  3ASP A;  4X7D A;  2W6J A;  4KKT A;  3B78 A;  2P3M A;  4X7F A;  4G7X A;  3LQ6 A;  5IYQ A;  1N05 A;  1UD2 A;  2VNJ A;  4WZK A;  1KQS B;  2B5O A;  2OYN A;  1EP2 B;  1EFC A;  3QFR A;  2JJ2 A;  2XZO A;  3LO8 A;  2ZZF A;  3PEN A;  4AC9 A;  2RC5 A;  4TT3 A;  2YWG A;  4HIZ A;  3AVV A;  4MYU A;  4P26 A;  1N0U A;  2WJY A;  2X85 A;  5F4J A;  2BSA A;  4Z4Z A;  1YIJ B;  3W5H A;  3U6K A;  1QGA A;  1T5E A;  4RCZ A;  3BCF A;  1QG0 A;  2HDN B;  1H42 A;  2F1L A;  2ZBV A;  2C4T A;  2E1B A;  4MYT A;  2V7V A;  1XB2 A;  2QTL A;  2ZBU A;  1BX1 A;  2GPJ A;  2OK7 A;  3SJZ A;  4ACB A;  3OZU A;  1Q9S A;  1ZUN B;  1SKQ A;  3CCM B;  3CPW B;  1CQX A;  1DDG A;  2GRE A;  3Q6R A;  1YLO A;  2XOK A;  4KKU A;  1BJK A;  3CCR B;  1JNY A;  1KK2 A;  1WU8 A;  2GK6 A;  2QMU A;  1QH0 A;  3WY9 A;  4TMT A;  4PC6 A;  2D9R A;  1E62 A;  2ZZQ A;  5IYR A;  4XLH A;  3OJX A;  4Y7C A;  4YAL A;  2PE3 A;  1MRZ A;  1K73 D;  4B44 A;  4X05 A;  4XOT A;  3VO2 A;  1BX0 A;  2V7Q A;  2D3L A;  1ZM3 A;  3PA1 A;  2VNI A;  1GAW A;  1QX4 A;  4G5G A;  4QFM A;  1COW A;  5BSY A;  1T6X A;  1YIT B;  1N8R D;  2YWE A;  3WBK A;  3PUN A;  2QEX B;  4X8I A;  4RCY A;  4G7W A;  3OAA A;  4X06 A;  3T56 B;  4FWT A;  5H5J A;  1N07 A;  2QE7 A;  2HMA A;  1KK1 A;  1V0F A;  4NCN A;  4ZCI A;  5KW9 A;  1VLY A;  4C43 A;  1EFT A;  5IYP A;  2EIX A;  2ZTG A;  1VF7 A;  4ZGQ B;  3W2H A;  2X6X A;  3PUM A;  3WBJ A;  3A8I A;  4Y9R A;  1GVH A;  3CD6 B;  3AVY A;  3T51 B;  2D74 A;  1UMK A;  4XNF A;  2CND A;  2DIE A;  3PA2 A;  1D8T A;  4YAO A;  5FIU A;  2ZZE A;  5FO1 A;  5A8A A;  2DOG A;  4XD7 A;  1E1Q A;  3ES9 A;  3E1Y E;  3H94 A;  4J0Q A;  4Q7J B;  1Q81 D;  3MCA A;  4YEL A;  3CW2 A;  1W0K A;  4RD4 A;  1HA3 A;  4OP7 A;  1DAR A;  1V0E A;  2WPD A;  4B48 A;  2CBX A;  1M90 D;  1G7C A;  1N08 A;  3KEW A;  1YJN B;  3OFN A;  1E63 A;  3ZIA A;  1Q86 D;  3ZUG A;  4YXW A;  1Q7Y D;  4LBV A;  1NB0 A;  3Q39 A;  5L46 A;  1S0U A;  2R6H A;  4LBW A;  4R71 A;  2OK8 A;  2V4D A;  1IJF A;  5B6I A;  5EMN A;  1VHO A;  1YX2 A;  2JJ1 A;  3AVU A;  4XL9 A;  3CME B;  4PC2 A;  4QVJ A;  5DSZ A;  4XOP A;  2QDX A;  3A35 A;  4ZCL A;  4CQJ A;  2C78 A;  1OB2 A;  3U6B A;  2WJV A;  4K1X A;  1YI2 B;  4P3Y A;  2GJP A;  1BLI A;  1OHH A;  2HLD A;  1VQN B;  3GSI A;  4TMW A;  4LC0 A;  3W5U A;  1T6Y A;  1W9X A;  5LMZ A;  2DYI A;  1VQL B;  1JA1 A;  1XE1 A;  1ZM4 A;  3SLD A;  2X3U A;  1PJ6 A;  5E6T A;  5A88 A;  4TMX A;  1N0V C;  2FVG A;  4P6V F;  3LVB A;  5H59 A;  4LBY A;  5HXB A;  4EH1 A;  4B3F X;  5THX A;  3J81 k;  1DDI A;  3GQB A;  1E1R A;  1QVG B;  3SLN A;  5FA6 A;  4HE5 A;  3AGP A;  3I55 B;  1WOS A;  5A89 A;  1KK3 A;  3WYA A;  1U2R A;  1TUI A;  1VQ9 B;  4M4S A;  2OBS A;  3A8K A;  5AN9 A;  1QFJ A;  1WDT A;  3OZV A;  4Z4U A;  1SKY B;  3A1P A;  2F4N A;  2QN6 A;  3SJP A;  2YWH A;  4PAA A;  1YJW B;  3G05 A;  1FNM A;  4TKO B;  2BN4 A;  1WOP A;  3GVL A;  3CMA B;  2PIA A;  2DY1 A;  2WSS A;  3E20 A;  2X0K A; 
#chains in the Genus database with same CATH homology
 4Z4V A;  4WZE A;  4Z4W A;  3PA1 A;  3AST A;  3ONY A;  3LQE A;  5BSY A;  4RPB A;  3PUN A;  3ASQ A;  3SKB A;  3RY8 A;  4QVA A;  4X06 A;  4X7E A;  2OBR A;  3PVD A;  4X7C A;  4OPV A;  5KW9 A;  3BQJ A;  5IYP A;  4OPS A;  3Q3A A;  3V7A A;  3ASS A;  4OOX A;  4RDL A;  3R6K A;  3PUM A;  3Q6Q A;  4OOV A;  5BSX A;  4WZT A;  3PA2 A;  4P25 A;  5IYW A;  5HZB A;  5J3O A;  4OP7 A;  3ONU A;  5IYN A;  4RM0 A;  4OPO A;  4ROX A;  3Q39 A;  4Z4T A;  3BY2 A;  4X0C A;  4QVJ A;  4X07 A;  4P2N A;  3ASP A;  4X7D A;  4OOS A;  3D26 A;  4X7F A;  4Z4S A;  3LQ6 A;  5IYQ A;  5F4M A;  4WZK A;  3R6J A;  4Z4R A;  1IHM A;  3Q38 A;  4P3I A;  3SLD A;  4P26 A;  5E6T A;  4P1V A;  5F4J A;  4Z4Z A;  4RPD A;  4P12 A;  2ZL6 A;  4RDJ A;  3SEJ A;  2ZL7 A;  4WZL A;  5J35 A;  5F4O A;  3SLN A;  5HZA A;  3BY1 A;  4QUZ A;  4Z4Y A;  3ASR A;  2OBS A;  3Q6R A;  4Z4U A;  4RDK A;  3SJP A;  4QV2 A;  5IYR A;  2ZL5 A;  4RLZ A;  4X05 A;  2OBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...