3LQAL

Crystal structure of clade c gp120 in complex with scd4 and 21c fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
213
Chain Sequence
SVLTQPPSVSAAPGQKVTISCSGSSSNIGKNYVSWYQQLPGAAPKLLIFDDTQRPSGIPDRFSGSKSGTSATLAITGLQTGDEADYYCGTWDSSLSTGQLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTMAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD4
publication title Structure of a clade C HIV-1 gp120 bound to CD4 and CD4-induced antibody reveals anti-CD4 polyreactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2010-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqaL01
4HULB 2V2TB 4LEXH 4WWKC 2Z4QA 1WZLA 5TPWL 1NCCH 4MJIB 4S1RL 1NC2D 5CUSL 4MS8C 1HHIB 5JR1L 3GGWB 3RKDC 1C08B 4Y4FD 5ETUA 1V7NL 4HQQL 5C0EA 2ICEA 4FTVA 4CW1A 1OTTC 5JO5B 2HKFL 1NEZG 5CILL 2J8OA 3HS0A 3MACL 1R0AH 4IMLA 3BT2H 4S1SH 5E03A 1YY9C 3QO1A 3ET9F 4N8VG 4RNRA 2OL3A 4YHLL 4H20L 1SBSH 2ARWA 1OAZH 4ZXBC 4H8WC 1FZKA 3TPUB 1XGYL 4WFFD 2GJ6A 2VH5H 5IVZB 4WHCA 1E4KC 5D7SL 1OGAA 2NY4C 3OZ9L 1T2QL 4QXGL 4JFOB 3PDDA 3CH1B 2RB8A 4AENA 3O9WA 1DEEA 2K1MA 3EYQC 1ITCA 3NCJL 2YSSA 1DQLL 1CG9B 1I7UA 2AK1H 5CZVL 3VMNA 4MXQD 2ZSWB 2R69L 3PXJA 1A1OA 4B5EA 3ZE0E 2OXGA 4J8RA 1ZWIB 3OTTA 4KUCF 4R0LA 3FT4A 5K9KB 1I1AC 1KELL 1IGTB 3DVFA 3MGOA 5DJXA 5IB3B 1WBZA 4S1QL 3WE6A 3DOSA 2FO1A 4M3KB 3H3PL 5FUOH 5C0AE 5E94B 3PWNB 3RBSA 5HGDB 4P2YA 5CZXC 4OZFB 1RJCA 2H32B 3KYNB 4JKPH 3KYKH 3RY4A 4OLYL 5JXEA 1ERNA 5T1KA 3WSQL 4ZPTA 4XP9L 1DFBH 2EYRB 1EH9A 1EX0A 1JPGA 4HXAH 1V05A 3TJEL 4NO5A 4M1CC 1N4XL 3J7HA 4BELD 5I9QC 4KZDH 4Y4KB 5JIHA 1EEQA 3GMPB 4K3HA 5BRZE 5DMJB 1DQML 1NSNL 1GC1C 4Q9QH 1CT8B 3OKNA 3TFKD 1HDMA 1Z2KA 5E70A 5GSVB 5C0ND 5BMFL 1RZGA 4LBEB 5IQ9B 2CXGA 4FTVD 5AD0A 3ARUA 1DBAL 5EO9A 4NQCD 4KRPD 4U49A 2Z35B 4FQXC 3AC0A 4JY5L 5EZOL 4OZGB 4PTTA 5FA4A 1BOYA 4WI9A 4R96A 4M6OH 3KGRA 1BVKA 3NFSL 1IGJB 4UIKL 2B1AL 5IW1A 2GJ6D 2QR0B 1T6VN 3HR5A 1WZ1H 1OGAD 3EIFA 3ZKXC 2YPLE 3REVB 5EUOB 4WFFE 1CTNA 4P2OB 2C1OA 5I1LA 5I1CH 1D5IL 1IZJA 3O9WD 2CH8A 4OI9A 5F96H 1KJ3L 3KVQA 2H8PB 3UBXI 1OLZA 2P47B 1ZT1A 1B2WL 2FL5B 3DVGB 1RK1A 2AV1B 5FHBL 4YX2H 1WFNA 2R4RL 4JKMA 2FBOJ 3MUY1 3O3BB 3U6RA 5I0ZA 1FCGA 3TA3C 4ZUSB 5KS9A 1AI1L 2KZWA 4X5XB 1W8NA 1ZAGA 4S11A 3S5LA 2JK5A 2FX7H 2UWEE 2I9LA 2V7NB 5E1HB 3PWUB 4OTXH 5DURB 4HIHA 4CVXA 4LAQH 1T7XA 2QSVA 3RY5A 4XPHH 4Y5XB 2EH8L 1MRCL 3DHMA 5FA3B 4P2QA 5D72H 1HWHB 5KVGH 1H3TA 4GKNB 4XP6L 2VLJB 4OAWA 5JXED 4K7PL 3SDAB 5DTFA 5T1KD 5LGJB 2ATPA 2FGZA 5F71A 3QIWD 4OLZH 4V1DB 3QP3A 5GS0C 4ODBD 3P4MA 1IM9B 5IVOA 1K6QH 3G08B 3VFTA 1Q9KB 1NANH 1N59A 3WMSA 2H26A 3MFFA 4XH2A 4IOFD 1R3HB 1I75A 4ZD3H 1IEHA 1VADA 4M7JL 2E7MA 5F72S 3MJ7B 1UWXK 1AR2A 3MRFB 1OPGH 2DYPB 4M62H 4NO3B 5CEYA 4R3SA 1QPPA 2XA8L 2CMRL 4HKZA 2CGRL 5CBAB 1U8JA 4C83B 1QLEL 2QKIA 4X6BA 2VWEE 4H0GA 2CIIA 3TV3L 4FTVE 1HKFA 5B39G 4IRJB 1N5YL 5E8PA 4UDTB 1GZPA 3PP3K 4EQ3A 5KSBF 2AK4A 3UYRH 1CXLA 5KN5A 1GL4B 1MLCA 4Z7VA 1NL0L 1YDPA 3I6GB 4LSVL 5DUML 2SEBB 1UXWA 3GMOA 1MRDL 3ECBB 4U6TA 4K8RD 1Z9OA 2GJ6E 4OF6A 1MIMH 5CEZL 5MEOA 5FUZL 2X9XA 2DS4A 3K8LA 3QULA 4G9DB 5CUSH 1OGAE 4JLRA 4R6UA 1WBYA 1PZ5A 2HJKB 3LD8B 1NDGA 3OF6A 2ZUVA 1NDMB 4HQQH 1CF8H 4K2UL 4ZSOA 4Y4HC 5GIRB 4I0PC 5ALCH 2HKFH 1AGBB 4N5ED 4GW1A 4PJBB 2BMKA 3HI1B 3VXQB 5TE6L 4YHLH 2BVQB 3H9SB 4UT9L 1U3JA 1RJYB 1YC7A 3G5YA 1J1XL 2WK2A 1D6VL 1JYVA 1V7MH 3OAUH 3O2DA 2UZYB 3RHWF 1NUDA 4P2QD 1T2QH 4ZFOA 1T1ZB 5IB4B 1TVBA 1AGDB 3SE9H 2YPKA 3U79A 5F93C 3REWB 3SQBA 5IMOB 4K3JH 4OJFL 4QY8A 1UM6H 3GJFH 5GGVH 3GJEB 3FFCA 4LSPL 5CZVH 3O3DB 2HTKC 1U3HB 1Z5LB 2R69H 1WUNT 3I3EA 4KQ3L 4MA1C 4RGMB 1YEIL 4RISH 2FX9H 2LE9A 4IS6A 4DK6A 1J9CT 5JLZA 3SDCC 4WHYH 1LEKB 5IVNA 1YPZB 3GSXB 5FCSH 5GGUA 3KWWB 3O2VH 2EYTA 2WZPD 5DDHA 3U36A 5C6WH 2BSSB 1NGPH 3MMEA 2XXMB 4S1QH 2XNAB 3GNML 1H3WM 1UJ3B 1P84J 1FNSH 3K74B 1G9MC 4O2CB 3B9VA 3MLVH 4XMPH 2APTA 5I1HL 1A3QA 4QRTB 1BD2A 2GSIB 4YC2B 5F1NB 3LB6D 3RVVC 5LBSH 2JB5L 5A16A 4DKFL 1D5XA 4J23A 4TNWF 5DK0B 2AK4D 4I4WA 4RIRB 3GSVA 2H2SC 1OM3L 3FT2A 4LSSL 3VFPA 2XG5A 3MV7A 4NHCL 1A21A 4XHQA 5EN2B 3IFNH 3A6CH 3IFOB 2LU4A 3PWPB 3QFJA 4HC1L 1JL8A 2JCCA 3VGDA 4LLWA 4PRHB 1DQMH 3OF6D 1UCTA 1ADQA 3SJVA 1ZLVH 3RVXC 4R90L 5BMFH 1X3DA 1MI5A 1P7QB 2EE2A 5EZOH 3HAEA 1JIBA 3HE7C 4PUBH 1IILE 4N90D 1MWAB 3PWJA 1UB6A 4JDTH 5DD3L 3WFZA 2HG5A 4XAWH 4M48L 4NNPL 1AKJA 4WW2A 3O6MH 4GG6B 2OTWB 4UIKH 5KS9E 2BX5A 4RRPA 2UYLB 2UZXB 2EKSB 3RI5F 4M1DL 1OARL 2EC8A 1G84A 3MRLB 4JRYA 4N8VA 3FO2A 1DQDL 4Q6YA 1FL5A 4G8IA 5GZNC 4P2QE 3DMMB 5T5NF 4ZTOL 3FFCD 4P9MH 3R06A 3X13A 5FK9B 5H37H 4NZUH 5IFHH 2FJFB 1OAUL 1OF2B 4MJ6A 5D71H 3MLTA 3TIDA 2YEZA 3TWCH 2FIKB 2NY5H 1HQ4A 4NKMB 4PJIA 1AI1H 3MUHL 3A67L 3VWKA 1NAMH 4K7PX 3TF7C 4RMVA 4EUPH 4PJXA 4WO4B 3INUH 4AEHL 4Z7NF 4PFEA 3O0RL 3F12B 4PR5B 4ZFZA 1T89A 5DD1L 1CD1B 3BOVA 3WFBH 3TN0A 1MRCH 5FO7B 2C7UB 2VITB 4XP6H 2IBZX 4J7RA 1G9EA 3KPLA 1BD2D 1FYTA 2HT3C 1NCUA 4XNZB 5F7HA 2X5PA 5H8DA 2DLFH 1UEYA 5KOMC 3O6FA 1T66D 4ZPVA 1UENA 5D7JA 3NIFE 1EFXD 2G75B 2HLFD 1XGTB 3UAJC 2GFBA 5I8EB 1VA9A 5IB5B 2AK4E 2AGJL 3S36L 3BGFB 3QEUB 4Z7VE 4J3TA 4PG9B 1XF5A 4OIIL 3SJVD 4MNHA 1A02N 5DYOA 3WLWC 4M7JH 1MI5D 3CMOH 1N5AB 3D18B 1DBKH 4MX7B 4XCNA 1QLEH 3U30B 1NFDF 1AIFB 3LKSA 2XIDA 4ZSOE 3WKNA 1J86A 2K3TA 1AKJD 1J10A 2XZAL 4UTAL 1T1YB 3IB4A 4NO0D 5J1AA 1S7RB 4EI5B 4N90E 4ZOAA 3S37H 3O11A 3FN0H 3O8XB 1LK2B 4Y5VA 2R9HC 1CYGA 1ZVHA 5JOFA 4PIRF 3WN5B 5K9OA 1JPSH 2P5EB 4HGKC 2OSLA 4I1NB 4D9LL 5FUZH 1DLHA 4JRYD 4KVCL 3TZVB 1IE5A 1VHPA 1FE8L 2APFA 2DWEB 1BLNB 1VFBA 3VD7A 1ZS8A 2Q8BL 5T1MB 4RMQA 4UOW1 3TVMA 1INDH 1CL7L 3WD5H 4GW5B 3RL1A 5GPRA 3L3OB 3S35L 5FHAL 4IMKC 3I3BA 3VWKD 3FFCE 1S9XB 1MCDA 2CDFB 2GT9A 3CJJA 5E2WL 1AHWC 4PJFA 5HGHB 1S78D 3FQNB 3GUTA 5HYQA 5BQ7B 1G6RB 1B6DA 3CUPB 4XCYA 1J18A 4ETQA 2ZP0T 3TN0D 3IDGA 3NACL 1U8IB 4HWZB 4JPKL 3RDTA 1R24A 3Q3GA 2ZUXA 3AB0B 3DV6A 1S7XA 1NBZB 4G7VL 5E4EB 4OF8A 1FYTD 1CK0L 3QPQD 5D7IF 4Z7OF 4NRXA 5ADOL 2WBKA 4U7KA 4XCFL 2VXQL 3GI8L 3STBA 2J6EL 4LSPH 2XA3A 2A74A 1IGYA 3GSUB 1BD2E 2LAGB 5D7JD 2LVEA 5CJ8A 1SHMA 4ODSH 1FLRH 3HFMH 1MPAH 1X5HA 1CICC 3AXLA 5FYJL 3GSRA 2H3NA 2BOBA 4M03A 4HS6B 3TYFA 4R2GB 1RSFA 4JFQA 3IETA 1MELA 4J3XA 1X44A 1A6UL 4WJ5A 1PSKL 5C0GA 3L3IB 3MRGB 2Z8RA 5H2BB 1KXTB 3HPLB 5C0AB 4WV1C 1U8QA 1H3PL 2YK1H 4L8DB 1DN0A 4TULL 4XRCB 1KLUB 3QFJE 3I6KB 2ATKB 2JCCE 4KMTL 2XFXB 4LCCB 4X98A 2ZUSA 5FV1L 1B0RA 5LGHH 2VDPH 2WQRA 1MNUL 3SJVE 4FS0A 1BZ9A 5FF6B 3VRJA 3RVUD 1MI5E 4E42B 2V5SA 4ZO6A 3K1KC 3PDOA 3WXWL 5DF0A 3DURA 3UEZA 3BFOA 1B4JH 1XGQA 3MBXL 1MF2L 2Z0BA 4JRXB 4N68A 2YA0A 5BRZB 1KJ2H 3ARGB 5JW4N 2CKNA 2ADJB 1SJVA 4HC1H 2X4NB 5B39A 2O61A 2NY1C 2FCBA 4FFZL 4GQPH 4YDIL 4R90H 4N0YL 4NIKB 4FQHB 4Y4FB 1RZIB 3TVMD 4JRYE 1T0PB 5DUPL 2UZIL 2EYSB 2QADC 4HK0B 4KAQL 2WWKO 1IC7H 2FR4B 4AEEA 4NRYB 4HG4K 2PO6B 3QWOA 5J6GB 1HZHH 3CU1A 4MA8L 3PHOB 1INEL 3M07A 3PV6B 1Q0XL 2GITB 3LRSA 4PJIE 4UBDD 2YPLB 4LVHB 4M7ZC 4OZHF 5CWSA 2AJ3A 3RDTD 4UMGA 4PJXE 1OWRM 4MDJB 43C9A 4M1DH 5J12B 1KEGH 1MAJA 3EZJB 3GMMB 5C9KA 1PAMA 1S5IL 2EIEA 1QFUL 1D5BB 3BSZL 3IJYB 1DQDH 4JFDA 4Q0XL 3U0PA 1URLA 3RBGA 2HKHH 2FGWH 1CVSC 1FYTE 1I3GH 3N85H 3GSQB 1ZANL 4NRZB 1CFSB 5C0RH 1A9EA 4Q2ZA 1IAOA 2UWEB 4KJPD 4DCQA 4NHUB 5MP6H 1TTUA 5M7QA 4C59B 1EGJL 1OB1B 5BO1L 1JZ5A 1EO8L 1H3UA 3DO3A 3UCRA 3O0RH 2OQJA 1P7KA 3QCTL 1VFUA 3IDJB 5A2LH 4OUUB 4GLRI 5DD1H 4XWOC 4Y2DC 1HCFX 2W0KA 1LDSA 3ULUD 2IQAA 3RIFK 3VFRA 4G8FB 4DW2H 1QFHA 1EEZB 3L5XH 5L0QB 3S36X 5DJZB 5I18H 1CE6B 4X5WB 2CJUL 2X4PA 3T4AB 1FL3B 1KXVC 3CPLB 3G6AB 4ZS7L 3EOAA 4N1CA 1A3LH 1NJ9A 1KJMA 1G7QA 2W9DH 3L1OL 3RWJA 4PYGA 1G7JA 1RHHA 4LIQH 4M43H 4QXUL 2VC2H 2XQYK 3S36H 2ICCA 3IAQA 3T0XA 2Z4QB 3ZHKA 5EU7E 3DX7A 2DQGH 1YQVL 3F6LA 1II4E 2R23A 1OHQA 1MY5A 5ETUB 5C0EB 2ICEB 4FTVB 4FP8H 4CW1B 3Q5OA 2H1PH 3HS0B 4PP1D 2BVUA 5DUBB 3OPZL 4IMLB 2XZAH 3QO1B 1H8SA 1KLGA 3HMXL 3HUJF 4GRMA 3NCYS 4RNRB 2OL3B 4XP5H 4GW4A 1VGKA 3MJ9L 2YZ1A 4Z78A 2I5YH 1OSZA 1FZKB 3QNZA 4UU9A 1QRND 4KDTA 3WO3B 2GJ6B 2F5AH 3BDBA 4PJFE 3AM8C 2X2YA 1OGAB 3KAAA 4QGYA 1NFIA 4KVCH 2YWYA 1F4YH 4JFDD 4ODTH 4AMKL 4AENB 4JB9H 4EKXA 3O9WB 4JFFA 1DEEB 4MB4A 3CVHH 5SV4A 4GXUN 5F3BB 2MFNA 2YSSB 1I7ZA 1I7UB 1N7MH 1EV2E 1L6ZA 3KS0H 1EMTL 5SX5H 1BZ7A 1A1OB 2HFEB 3BI9X 4LSRL 4APQA 2R2HA 4J8RB 3C2SA 2HYMA 2FBJL 3SO3B 4GJTB 1FH5L 5T33H 2VR9A 3FT4B 5JMRA 3RRQA 1IKFL 5F9JA 1KENH 2GK0A 3NACH 3ZL4L 4KUCD 3MGOB 2I60H 4TQEH 5DJXB 1WBZB 3F7VA 4K3DL 1JNHA 4YGAB 4G9FA 3WNNA 4JGJA 1B88A 4BZYA 2VN4A 1K4DA 1YNKL 1P2CA 5ADOH 3D3VA 3ULUE 3DHJA 4XCFH 4MNGA 3D85A 3GI8H 3SKJL 5T1KB 4XVJL 3KS0J 4DKDC 3KNBA 1EXUA 1N0XL 1Z0MA 2UUDH 2VERN 4ZPTB 1DBML 3LAFA 5DFVC 2GJZA 2PXYA 3D1MC 1UKTA 2KUTA 2C3VA 2Z31C 1JPGB 5I2IA 2OM5A 5INCA 4LSUH 1KB5L 1OAKH 1PSKH 1KCRL 3OKNB 1HDMB 1RZGB 4JM2D 5AD0B 2JLLA 3QIBD 1MCQA 5EO9B 2YKLL 4YBHA 3UTPD 4UV4L 4KHTL 1A6ZA 2DTSA 5CLWA 4NZTL 4PTTB 5D1XC 5FA4B 1FGVL 4PJCF 4R96B 3CC5A 1TNMA 2JJWA 3DETD 4WU7A 3T3MF 1BVKB 3U7AA 4UUJA 2EC9T 5IB1A 3MBXH 5IW1B 1MF2H 1NGZA 1EERB 3HR5B 4LRIA 5IFAH 3O4OC 4RGOL 3LH2L 2R0KL 5KSBA 1UT9A 1QRNE 1S8DA 5C0BA 3ZYJA 1UCBL 3ZKQD 3FZUC 4JJ5A 4JY6B 2C1OB 5I1LB 3EFDL 3L3JA 4XHJD 2NXZD 4JFFD 1PG7L 5HHQB 1IQWH 2RAMA 1VB9A 1ZT1B 2DDQL 4LVNC 1RK1B 2UZIH 1KN2L 1OD9A 4JFDE 5FYKU 5IESL 2PUQT 4CGTA 2R15A 1JTTA 1DL7H 3U6RB 1HYSD 3B6SA 3ESVF 5CLTA 1U95A 2I26N 2BDNL 1YEFL 4NOFA 5KS9B 5GZOC 3ILPA 1MUJA 3S5LB 4PLKC 4ZFGH 2I9LB 2CUMA 2DM7A 1CXEA 4NGHH 3F7PC 4HIHB 4GKZA 4CVXB 1TXKA 3VG9B 1K2DB 5CAYB 1S5IH 4YPGA 2IG2H 3D3VD 4OAWB 5CD3B 5D8JL 1JFQH 2ZUWA 5DTFB 3BDXA 2IH3A 3NN8A 1UACL 2ATPB 3U4AA 4X6FA 5A3ID 2PYEA 4BUHA 4F9LA 2PXYD 4DEPB 1DSFH 5HY9A 4U1SB 1DLFL 3P4MB 3T0BA 5KW9H 2CKBA 3VFTB 3MC0A 1EGJH 3FN3A 5EBGA 4GRLA 1N59B 2H26B 3X17A 2V17H 1YNLL 1ZKAA 3MFFB 1OAXH 2MHAA 2NMSA 4XH2B 3DSFL 5FEBA 1NBYA 1EJOL 2C5DC 3V7MA 2AJYL 1VADB 4HK3J 1DR9A 4B53A 2Y06L 5CEYB 3B9KA 4R3SB 1G9NH 1JUFA 1OQOA 4HKZB 1U8JB 2BVYA 2P44B 2CJUH 3MOBH 3N9GH 3NVQA 2QKIB 4X6BB 2AJXL 5IHZA 3UTPE 1C8PA 4LK4A 5E8PB 4PREA 1GZPB 1XGRA 3ALXA 4R4FH 2AK4B 1JF1A 5KN5B 4CAGA 3MCKA 3FQXA 4Z7VB 1YDPB 1TTGA 3QUYD 1MHHA 2OTUB 4XNXH 5DJAB 1UXWB 3GMOB 3U0WH 1LVEA 5C0BD 4PGZA 3VXUA 4TUKL 4KZEL 4ZNCD 3QULB 4OT1L 4JLRB 1WBYB 4KROC 4LKXB 1PZ5B 1NDGB 5IG7A 4ODVL 2OS7A 2YMXL 4ZSOB 2BVEA 4GMTL 3RWIA 4JFFE 4H1LH 4GW1B 1RIHH 2BMKB 3EJZC 5B38G 1G0YR 3BMVA 4YHKL 2WMPA 2NY0B 1R3LB 3RVTC 4NKIH 5E5RB 3G5YB 5AZEH 1MRFL 4NQEA 1AQKL 2GK2A 1X5JA 3MLUH 5J7CC 4FQPA 4JJHA 1OP3H 4ZFOB 3UTQB 1TVBB 3LDBB 4YK4B 3MROA 2YPKB 3DLQR 3ULVH 5AWNL 4QY8B 2PYED 3QCVH 3FFCB 2ESVA 1NMAH 4OD3L 5B3NA 3D3VE 3PNWA 3ARFB 4MNGE 5EA0L 2F5BL 4LSRH 5F7DA 4GRLD 3JWDC 1I8LA 1NLBH 4IS6B 4XB7A 5JLZB 4OSUL 2ICWJ 2WIMA 4ELMF 2PTTA 5GGUB 1IKFH 3ZL4H 2EYTB 5DDHB 3U36B 3MMEB 2VZ3A 4MZ2A 1FO0L 2AABL 3QBTB 1A7OH 8CGTA 3B9KD 1YNKH 1Q8MA 5FM8A 5FO9B 1BD2B 3FFDA 3GZKA 5A16B 1D5XB 5D70L 4RBPH 4XMLL 4I4WB 1PBYA 2IBBA 3GSVB 4P5TA 5DWUH 1Q9LA 2X89A 5E08H 3FT2B 4P5MA 3VFPB 3MV7B 4HUNB 3CK0H 2QHRH 5CS7A 3DRQB 3GKWL 5FKPA 3VXUD 3QFJB 5D6CA 4LLWB 1ETZA 2YN5A 3QUXC 4KK6D 1HHKA 2L0DA 1N8ZA 5EOQL 3F5WA 5KSBE 3MREA 3SJVB 5C0BE 3V95A 1JNJA 1WQVT 3E0GA 3U48A 3HAEB 4J3UA 3C87A 5L7XH 3PWJB 1FGVH 1UB6B 5HHPA 2HG5B 3MOAL 3OG6B 4HKBA 1PG7X 2NXYC 1AKJB 1MFBL 2MQCA 4WW2B 1QSVA 5JPMA 2F53A 3GKZA 1NFDA 4NC2B 5I1IH 5J11B 1HN1A 4NPYA 4NQED 5ESQA 3ULVF 1DQJA 2XY2A 5D2NB 3T4YA 5HHOA 4HBQA 4RGOH 2GUOB 1FFRA 4KK8D 2R0KH 2PR4L 3V6FB 2C4FU 3DV4A 4JRYB 4N8VB 3FO2B 3IDYB 1PG7H 2F19L 4G8IB 5JW4Q 2ESVD 1KT2A 3R06B 3X13B 4PD4J 3LN4A 2BNQA 1KN2H 3HZVB 1DZBA 4MJ6B 4HXBH 5A2JH 1NAMA 2OR8A 3TIDB 2YEZB 5E4IA 5I1KH 1JNNL 1HQ4B 2PYEE 4FQCH 4PJIB 2ZNXA 3VWKB 3SE8H 2ZUQC 3WHE1 1TMCB 3T04D 2CRIA 4PJXB 3D69A 1J1OL 3NPSB 4QXWA 4ZFZB 5KANG 4BSVB 1CCZA 1NCNA 2DQEL 5E8DH 3TN0B 1DVFA 4LCUA 4L4VA 3C8KA 3SE4C 5F9WB 1WT5A 2ZPKL 1V8HA 4ENEC 5D8JH 1FYTB 3EJJX 3PG2A 5F3HA 2FWOA 1T5WA 3WEXA 1IGML 2B7DT 4I3RL 3BZEB 3KYOA 4HS8L 5D7IA 4D2NA 4P5TD 5L2JA 1RZFL 3O6FB 4ZPVB 4BFIA 4HAFA 4NYLA 5D7JB 2QQNL 5C3TA 4D3CL 2GFBB 2JJSA 1QSZA 5FAAA 3MFGB 3P40A 1XZ0A 2DI9A 5C09A 4UV7H 1CD0A 1I9IL 1XF5B 4NN7C 2F58H 2E5EA 2EEDA 1KPRA 2VDQL 3FT3A 4MNHB 5DYOB 1UM4H 3VXUE 2EH7L 5ADPL 5GGTH 4TPRL 4P4KA 4NM8H 4JVWA 5TF1L 4XCNB 4F58H 5IOPA 1CI5A 1CDCA 2H9GA 3LKSB 1KB9K 3Q6FA 4FNLL 3KLDA 3V52H 2F53D 5J1AB 2D7MA 3L7FB 4L9LA 4OGYL 3VMPA 1NC4D 5HHOD 4Y5VB 3K7UA 1MCNA 4BFGA 5EC2A 3C5ZC 4YQXL 2VIRA 3O45A 1QG3A 3CH8A 5K9OB 5IT2H 4CL7A 5DHXB 4NQEE 5SWQB 1W0WA 1XH3A 4LQ1A 1DLHB 1G7HB 5D1ZD 3EDFA 4U1KB 4OT1H 4JPWH 2A6JA 1JJUA 3EO9H 3VXMD 1VFBB 2VDNL 1ZS8B 1BQHG 2BNQD 3IDIA 1G7IA 3ARBC 3TVMB 3W9EA 3RL1B 3MLYL 1MFCH 1UWEL 5FGSA 1LO2H 4H25A 3O3AA 1E4XI 2ESVE 2NCMA 5FGRA 3C09C 2XKNA 4K23L 4NJAL 2GT9B 2EIDA 4PJFB 1KCVH 1RD6A 2NY2C 2OK0L 1U8HB 3GUTB 2EIBA 8FABA 5HYQB 3JTTA 1I7TA 4XCYB 4Y19A 4ETQB 1AQKH 1DVFD 3IDGB 4XWGH 4MXWL 1JRHI 3RDTB 3RZWA 1R24B 3Q3GB 2HAZA 2YUVA 3DV6B 3VFMA 3FHAA 2Y36L 1S7XB 4OZHA 1CGXA 3BP5A 4UT6L 2VKXA 5BJTB 1UWGL 2Y1VA 2Q87A 2X4UA 5EBMA 1XF2A 5DRZA 4O2EA 3NTCL 4FFYH 2A74B 1A7NH 4HV8A 1IGYB 1NKOA 1FVCA 3WUZA 3IVKA 1PVHA 3TH2T 3I75A 4OLUL 5DQDL 1RZKL 2XXCB 4O00A 3AXLB 4UNVA 1NUFA 3GSRB 2H3NB 2BOBB 4WEBL 1AH1A 1NCBH 3GEWB 3TYFB 5C09D 3RVWC 3IETB 3K2UL 4NDMA 4WJ5B 4MQ7A 5C0GB 4KJWC 4OCRH 1Z9SA 3BPOB 3Q0HA 1U8QB 1P4IL 3Q48A 1DN0B 3EHBD 4G6AD 4M4RA 3M8OH 1A7RH 3V9FA 2FH8A 4X98B 1TQCB 1B0RB 4BM7A 1C5DA 4HJGA 3ELAT 4U6YA 2PYFA 3VRJB 4ODHL 4P3CH 4N9OB 1UM5L 5BZDA 3PDOB 4MAYC 1CIUA 3DURB 3IU4H 5EU3B 3F65A 1XGQB 3HC3L 4TVPL 1KJ2A 1SEQL 4LOUD 4KI5C 5KSAA 1L7IL 3B2VH 1RZ8A 3O6LL 2F53E 1NFDE 5CP3H 2F8OA 3WIHA 2R0ZL 4WI6A 4X6DF 1D7FA 5HHOE 5B39B 1GXEA 3RX8A 2O61B 4GKOA 4U6HA 3ARVA 3B5TA 3OAZH 4QGTA 3OSKA 3RUGE 4NN5B 3X11A 1OP9A 1JWUA 3GHEH 1PKOA 4PRAA 3V6OA 1EHXA 2M26A 4ISVA 2BNQE 4ZUVA 2B5IB 1P84K 1MFBH 3QWOB 4ZOBA 1JPST 4UILL 4XPTH 4XGZA 3LRSB 3GJFK 2D7NA 3BIBX 3KPSA 3LPGA 2D7TL 1G7MA 4IRSC 5CWSB 2AJ3B 3KG5A 3HUJA 4G7YL 2OJEB 3EJYD 43C9B 1RPQA 2PR4H 4U05A 3LQAL 3QHTC 3VGEA 4M6AA 1X7QA 5B38A 2EDWA 1YYML 1CBVL 2ZOLA 4OIAA 4JFDB 4ZFFA 2WBJA 3U0PB 2WV3A 4NO2A 3LRHA 3IDXH 3AUVA 2CLRA 5E56A 1CLYL 3BZ4A 3MCLL 1Q38A 3WS6A 4YDVA 1A9EB 4Q2ZB 1JNNH 1IAOB 4DCQB 1BF8A 3VD4A 5D7IE 4Z7OE 1N6UA 4N8CL 1JMZA 2DM4A 1S9YA 1P7KB 2AJSL 2OQJB 4I2XE 5C09E 5CKAA 4UIMA 4XC3L 1ODAA 4KU1A 3QI9C 2IQAB 3VFRB 4CU8A 4L29B 4HWBH 3NA4A 3JV6A 1TVHA 5DJDA 2A38A 3G5XA 3MGTA 4QHMA 2X4PB 4KQ4H 2VXSH 3IJSA 4CDGC 5EBLA 5KVMC 3EOAB 3I9GH 1KYOJ 2HT4C 1NJ9B 1KJMB 1ZLVK 3P0VH 5DVOA 1G7QB 4GAGL 1RMFL 4MQSB 2QQNH 3RWJB 3IU3A 1G7JB 1RHHB 2YPVH 3MRNA 5GJSL 3GSNH 5JQ6H 3DIFA 4MNQA 3DX7B 4PJEF 4HJJL 2GHWB 3ZKND 3CXDH 2R23B 3WJLC 2ORBH 2VDOH 3OKKA 5TFSH 1P5UA 1GPOH 3WO4B 3O4LA 5D2LF 5TF1H 3LEYH 4DZ8B 3WLBA 5D7LA 1PFCA 1XAUA 4PJDF 5SWSA 5AAWA 4FNLH 3ZLQC 1KLGB 2D0FA 4GRMB 5INDA 4GW4B 2A9NL 3FRPG 4Z78B 2VAAA 3KPSD 3QNZB 2A77H 4WEMB 4PJCA 4LPYA 2EXWD 3NCFB 4JFEA 2DM2A 2NZ9C 4K3EH 1NGQL 1NFIB 1BIHA 1QFWI 4QWWD 3BAEH 5HJ3B 5HXMA 3CVHA 1P53A 2WBJD 4NQTA 4OCXL 3BISA 5D96B 4JFFB 1X5LA 4OZHE 2Z93A 4NBXB 3JVGA 1I7ZB 5JORB 3QWQB 1C5BL 3MLYH 3GM0A 5J3HC 4P23A 3HE6C 3VGAC 1BZ7B 3MODH 4APQB 4I5BB 2R2HB 3WNPA 4LLUA 4KTYA 4LRNH 4WWKA 5SX4H 5D93C 4PJ8C 5TJWK 1WWBX 4WUKL 5KJRL 1XCTA 4UTBL 5E6YA 4X9FA 2OZ4A 2R1XA 5F9JB 1EK3A 5F7UA 2OR9H 4M02A 2GK0B 3BQUA 1FAIH 2R0WL 3F7VB 2ADGA 1JNHB 1F6FB 4G9FB 5T1DH 3MUGA 4F57L 5AAMA 5EOCH 2C26A 4OFIA 5C7XH 4UT6H 1P2CB 3ZE2E 1MFEH 2YZ8A 3D3VB 4Q74A 2PCPA 5HTSA 4MNGB 3D85B 3QIUC 2ZJSH 3KNBB 1EXUB 4WDIA 1I9RL 4OV6F 2GJZB 5FYJU 2PXYB 1AO7D 4HH9A 2MMXA 4MDIA 2C3VB 3C8DA 4POZC 1E4KA 1G6RL 5TQ0L 5I2IB 3BDYL 4ZUUA 5INCB 4HX1A 4XBGB 2HT2C 4KXZI 1CU4H 4LF3A 4X4MA 3P77A 1AC0A 5F9AC 1Y6KR 5EOCJ 1S9VA 3O4LD 5D7LD 1VPOH 1JHKH 3MV01 1AQDA 3U7WH 2ILLA 5SWSD 5I16A 1E4JA 2NQCA 5BVJA 2CO6B 4X4ZA 3CC5B 1JV5A 2CD0A 4JPVH 4NKQB 4WU7B 3V6OE 3N0PB 4X99A 4UUJB 5IB1B 2Q3ZA 3ZZ1A 2P8LB 3HC3H 4DQOL 5TF0A 1NGZB 2HH0L 4JFED 5HGAA 1UH2A 1L7IH 3QQNA 4FQ2L 1RK0A 5JXAL 1OOAA 1NMBL 4AQ1B 2NR6C 4YE4L 5KSBB 3KPSE 3N1MC 1S8DB 2DBLL 5C0BB 3HUJE 2E9JA 4JJ5B 4H26A 3QHZL 3L3JB 2ZCLL 2YD9A 4UT7L 4F80A 1MHEB 2XPGA 1HNGA 4PBWD 1FDLL 2EDXA 3RNQA 1DANU 1UVQA 2AQ3A 1F02I 4PY8J 3V4PH 4U6VH 3N1QC 2B39A 2XZQH 5DMKA 2JIXA 4P23D 4LARH 3B6SB 5FCUL 2HA1A 1ZVSA 3GMRA 5C0JA 1T1WA 1C1EL 3FQWA 4WWKD 4YXKH 3M45A 4J1UA 1AP2A 3ILPB 1MUJB 1NKRA 2VXTL 2DN7A 3L9RA 1BQHA 5BW7C 4AEFA 5L6YL 5IR1A 3BQUD 1Q94A 3FQRA 4GKZB 4G7YH 1CDJA 2VDRH 3ZT5A 3UZVB 4BZ2L 2PW1B 2CSPA 4YPGB 5JTWA 3ETBF 1MWAH 2IH3B 5E00A 2DWDA 2IFFL 4Y4KC 3NN8B 3EOBA 2PYEB 5CIPA 4FXGA 4B50A 4QRPB 5HY9B 5I1AA 4QEGA 2J4WL 5ITBH 2NY4D 3JTSA 3MBEB 3D48R 4IEFB 3V0AC 2I24N 1UFUA 2OX5A 3KLHD 2CKBB 4LPWA 4N0UA 4GRLB 1HI6A 2YRZA 4W81A 1AO7E 1U58A 2MHAB 3GBML 1EBAA 2AJSH 1NBYB 4HCRL 1ITBB 3RWHB 4JGMA 5DQJA 2XTJE 4YEEA 5EC1B 3LIZL 1WIPA 4OFYA 3QEQA 4QCIA 4KKLD 4ELMA 2ADFL 3B9KB 2VLMD 4L8SA 3U9PH 5LJYH 1JUFB 1RV6X 4IBLT 1I3UA 3TA3A 2JTDA 4NZRH 2F8VA 4M5YL 5IHZB 3RWCA 4P2OC 3O4LE 1XR9A 4NQUA 5D7LE 1QO3B 1LO0L 5F89A 4JANA 4PREB 3TESA 1XGRB 5DA0B 4WWID 3NA9L 5SWSE 1J1PH 4HWNA 5CGTA 1JF1B 3MCKB 3FQXB 3RTQC 1IBGH 5GISH 3F8UB 1MHHB 5GJSH 4PJCE 4X7SL 2LU3A 3VXUB 4JFEE 4HJJH 1NCTA 3T3ME 2WLYA 5IG7B 3C9NA 3VCLA 4JQXC 5E9DD 3CFJA 4UINH 1JHTA 4H1LA 4XI5C 2N7AA 3RWIB 2QQLL 3D87B 4ONFL 4HFWA 3QUML 1PY4A 4JQVA 5IHUH 2HTLD 1FC1A 4KI1A 5IB2A 3AREC 2A9NH 3KLSA 4GG8A 4LHUG 3SDAC 5DEGA 2BY3A 1HKLH 2ICWA 3RJQB 5TQ2H 3H9HA 2Y4SA 3MTRA 3MLZL 4NQEB 1P9MC 4FMFA 4GS7C 4MVBC 4RFOL 3BKJH 4JY4A 3L95A 1OLLA 4OD1H 3ME0A 4XBEL 5GGQL 4LVEA 4NBZB 2QQKL 4JHWH 4F7MA 3MROB 1A64A 5HI4C 4NNYB 2LVCA 2YUXA 3P3YA 2E7HA 3S8WA 2IBGA 4TNVF 1QRKA 2ESVB 3PNWB 2D7OA 1S9KC 1J87A 3NFPA 1E4WH 4FQJH 3N06B 3W2DL 5F7DB 2B8OT 4FABL 3EOYG 1UZ6F 2MSPA 5L8KB 5EZIL 3GSWA 4WUKH 3NAAL 3WJJC 2EZ0D 1I8IA 1P4BH 2H6PA 3FO0L 2PTTB 3NGBC 4IRJC 5E7FA 3MRJA 4OFYD 3QEQD 4Y4HA 4I0PA 4X4ME 5H35A 4PJ9A 1SM3L 3SGJC 5J13B 3CLEH 3TA3D 3S98A 3FFDB 2DQCL 1GOFA 3E8UL 2DICA 2ZG1A 2VLME 4XXCA 2F54A 4X0KA 2YBRA 4P5TB 1Q9LB 4WW1A 5DMGC 4P5MB 1MJJB 4LPXA 5TQ0H 3VGGA 2DLEA 3BDYH 4MJ5A 2VXVH 5FKPB 1ND0A 1KG0A 1K4CA 3CSYA 3TIEA 2VQUA 2X4OA 5D6CB 3A6BL 1ETZB 2V2WA 1HHKB 1YY8A 1N8ZB 1RZKC 3MREB 5GGRY 4U3HA 4YHYC 5AG9A 1QSFA 5HHPB 4FQIL 5E9DE 1YEGH 3MLSL 3ZYZA 4HKBB 3H0TB 4HUKB 3SY0A 4M1GL 5JPMB 3OB0H 3B2UD 4M5ZL 2F53B 3BKYH 1NFDB 4DZBA 4ZO9A 2CO7B 4NPYB 4G42A 4YXHL 2HH0H 5ESQB 1DQJB 2BVPA 3JBG7 4FQ2H 4GBXD 3T4YB 1R3IH 4O58L 5HHOB 1QBLL 4B41A 1ZLUH 5I73B 3BN9D 1L7TL 5SX5K 2R29L 3HNTH 2VRAA 3ULVD 2DBLH 3DV4B 3Q1SL 4C57C 4UT7H 1YNTA 2ZCLH 4ZUTA 3FRPA 1FFPA 1CDUA 4Z7WE 2A83A 1XT5A 1KT2B 1JI2A 1U92A 2BNQB 3LN4B 5IMKA 3QUZD 4K71B 4RAVA 1NAMB 4DGIL 4JAMA 4D0CA 4H88L 3ZMRA 2AXGB 4M6NH 3DO7A 1A6VL 4J12A 1NEUA 1A4JA 5C0CA 3D69B 2RFXA 4XT1C 1EAPA 5EG6C 4N0UE 1R5WA 5ICZA 4PG2C 2XYCA 4K8RL 5LQBH 1DEDA 3OR6A 1OSPL 4Y4HD 1DVFB 4LCUB 4FN0A 4PJ9D 4BZ2H 4L4VB 3C8KB 4FFWD 2ID5A 5FM5O 3IAGC 2CUIA 4OGAC 3IJHA 4NQSA 2NY3D 5F8QC 1UKQA 5F3HB 2FWOB 4YBQC 1T5WB 3QEQE 3WEXB 4ELME 1K8IB 3PWLA 4HMDA 5GS1B 1UKSA 2F54D 3LQAC 5D7IB 4MJ4A 5L2JB 3VWJB 4BFIB 4NYLB 4NP4L 4P3DA 3ZDZF 1U8KA 2FHBA 1FNHA 1QQDA 1XZ0B 4NWTH 3ZO0A 3HNVH 3EYFB 5SWZA 4HWEH 3SCMC 3VG0H 5E8OA 1KPRB 3IAPA 3FT3B 3MLRL 5GGTA 3PL6D 4OKVA 4W68A 5FOJA 3SQOL 3LVEA 5DHYA 2HTKD 1F5WA 1G6VK 4QLRA 3TT1L 4P4KB 1QSFD 5IOPB 1UH4A 2P48B 2A0LC 2H9GB 4ZTPL 1BIIA 4LMQE 3PV7A 1Z9LA 4XAKD 3BE1H 3TEUA 4K9EL 4P9HH 3DMMC 3IYLW 4MSWA 4L9LB 2FEDC 2N1KA 4XPBL 3EO1B 1NMCB 5HDQL 2VIRB 1KIQA 1QLRA 1MJ7H 3JV4A 4X7SH 3WUWG 4LNVA 5F7NC 1W0WB 1XH3B 1RUKH 3S3SA 2VN7A 1C16A 3MRHA 3KPOA 4WO4C 2ZCHH 4G6JL 3IDIB 4X6DA 1TENA 5FGBC 1X4ZA 3AMLA 3ULVE 1G7IB 4LCIH 2L7UA 1RZ7L 2GSGA 3C5JA 3JWOL 3W9EB 1WAAF 5B4MD 4H25B 3O3AB 3F7QA 4X80H 2XKNB 2B2XH 2W59A 1K3ZA 5C0CD 1J11A 4XNZC 4YDKL 1BHGA 5HSFA 3RP1A 2P8PB 5BV7H 3JTTB 8FABB 3UO1L 1I7TB 1Q72H 3RVXD 4Y19B 4KMQA 3TC9A 1GGYA 5CHNA 3NH7L 1MJUL 3L5HA 3VFMB 5TDPA 1JGLH 4OZHB 5IEKA 3BP5B 3LSOA 3PDGA 4ZQKA 2ERJC 1FSKC 2X4UB 3BGFC 1XF2B 2VDKL 1AR1D 5IF0A 5DRZB 1YEKH 4O2EB 1CGSL 4HV8B 1HINL 4RZCA 3IVKB 1KN4L 3TPUA 4WFED 5ESAA 2OL3H 4PS4L 3I75B 4TSBL 2CR3A 2XKUA 3W2DH 5HD8C 1GGUA 4FABH 2F54E 3MX0A 5F7MC 3THML 5HI3C 3O2DL 1SY6H 1UZ8A 4NDMB 4KTEL 5SWZD 4M7LL 4NN6B 2OR7A 3CH1A 4MQ7B 4HT1L 3VGHA 4EI5C 2DKUA 3B5GA 5IBUG 3BXNA 4AG4L 4C56A 1C5DB 1AE6L 4IMKA 3PGDA 4HJGB 3CVIH 1JWMA 4U6YB 2DQCH 5EU6A 1ZGLA 2MTPA 3S3JA 2DD8L 3HB3D 3WFCH 4N5UA 1QSFE 5BZDB 5K9KA 1KEML 1U8NA 3GO1L 3H3KA 4MA7H 1MOEA 3GDBA 1B90A 1KJ2B 5CP3A 5L8LB 1IAIL 3UC0L 1BJMA 5KSAB 4E5XA 1RZ8B 4XAKE 2VLKD 5E94A 1DP0A 3PJSA 1RUMH 1E6OH 2WUCL 4U6HB 1AXTL 1AJ7L 5GQBA 3MRQA 2R2BA 4PJEA 5CSZA 3W39A 3X11B 1CICA 1JWUB 1T7WA 1LD9A 5T1LA 1OP3K 4PRAB 5TE7L 4QTIL 2HJFA 4ISVB 3W11D 2CDEA 4ZUVB 1YJDL 3U9UA 4M1GH 4MJID 5D2LA 3KXFA 4XVUC 5CP7A 3GMPA 1LNUB 4XGZB 1A6WH 2ZCKH 2BSRA 3T3PF 3KPSB 1QBAA 1CT8A 2AKRA 4OBRA 3HUJB 2FDBP 2R2EA 4Y16C 3N50A 5C0CE 2K7QA 1D3CA 2IQ9L 2WINB 4MHHG 2VZVA 1ADQL 4N0RA 1X7QB 5B38B 1E6JH 5DD0L 4U6XA 4O5LL 2ZOLB 1GAFL 2WBJB 4NO2B 2NX5A 5DJCB 2CLRB 4GMSL 5E0QA 1LDPL 4NUGH 4YH6A 4YDVB 2E9BA 4LCCC 1BQSA 1WTLA 1MQKL 3CXHK 1TJGL 4WFEE 4P5KA 2F15A 2R1YA 1BJ8A 1S9YB 4KTDL 5CINH 4RBPK 1B9ZA 4UIMB 2XQBL 2NW2A 1BZQK 4C56D 4HWBA 5SWZE 3DX6A 4RMSA 4LPTA 4OCYH 4FA8A 3JV6B 5DJDB 1TVHB 3ARGC 4JFZL 4JG0L 3G5XB 5EU6D 5J89A 3MGTB 4QHMB 1T83C 3IJSB 5EBLB 4JO4H 2OP4H 2XKSA 4Y4FC 4HFUH 3GSNA 3IU3B 1CLZL 4PD4K 1TFHA 5C0IA 2XTJB 3MRNB 5I1JH 1NCDH 3DIFB 3CSPA 4MNQB 5F9OH 3IKKA 2K9UA 4YHPB 5HYSG 3SQOH 1CFVL 3LEVL 2VLKE 2BC4A 3OKKB 5DC0A 4ZYKA 5IW3A 4OQ1A 5DK2A 1CR9H 3I85A 3O4LB 5T1LD 4Q9BA 4L4TA 5D7LB 3WLBB 4X6DE 4ZTPH 5SWSB 1VDGA 4YHZL 2Y6SD 5FV2A 4HUMB 1KULA 1BOGA 4OLWL 3KXFD 1JVKA 3OJMB 5INDB 4UAOC 1OP5K 1WC7A 2VAAB 3J8F7 1TQBB 4XPBH 1UH3A 2YC1A 4MAUL 4PJCB 3TJHD 1XF1A 2WNGA 4JFEB 4MJIE 5I30H 4DJMA 3P30H 1NGXA 4MXQC 3JUYA 2P46B 1AGCA 4ONGL 3CVHB 4KI5F 2NX5D 3DVIA 3G9AB 2VDLH 3ZTJH 2FECL 2NY7L 4U0RC 2Z93B 1RZ7H 2OCFD 1S5HB 4P23B 1BPVA 3MXVH 2DRUA 4NSKA 4QNPE 4WWKB 4PB9L 3EYOA 1XCTB 1EHAA 4G9DA 3UO1H 1GYAA 2R1XB 3QWRA 4YR6A 2X1PA 1QFWL 5DR5L 3BQUB 3IF1A 1BFVL 1U3ZA 2ADGB 1LK3L 3MUGB 2XWTA 1JZ2A 3MLWH 2IFGA 3WFEL 1TIUA 4OV5A 4Z9KB 2PCPB 3V5KA 3VFGH 4C56E 2VDKH 5GXBB 4DVRH 4WDIB 3QT2A 4ZXBB 1HINH 1SQ2N 1OT1A 1S9WA 4JHZA 3SGKA 5EU6E 3VDBA 2AEPL 2KQMA 2DTML 1A7QL 4HH9B 2HWZH 2VWEC 3AM8A 5C0NC 4MDIB 3MQIA 1ZEAL 2NY4B 1FBIH 3BYYA 3THMH 1N3NA 4KRPC 3DROA 4WU5A 3O2DH 4ZUUB 2R0LL 4HX1B 1RUPH 1WBXA 5FGCB 4HT1H 1T03L 2DIAA 1X5GA 4X7CC 1S7VA 2EDBA 4W6XB 2BRRH 2ADIA 3GJEA 1W72H 1MFAL 1KIPB 3L5WA 1S9VB 2E6JA 3IT8D 5FUCE 4L4TD 1RJZA 1YEHL 3PXHA 1AQDB 3B43A 5I16B 2I27N 5BVJB 2VYRE 4PJEE 1CFTA 3E3QE 1JV5B 5IVXF 3CX2A 1N6QL 1KEMH 4X99B 4HKXA 1I1AB 2XRAL 4G5ZL 3EOTL 1YEJL 1IAIH 5HGAB 5HBBA 4X8JA 5D2LE 3KXFE 1RK0B 1LO5B 2IJ0C 1UJ3A 3P11L 1QPXA 1J5OH 3ULUL 2GSIA 3SOBL 1CS6A 4H26B 2QHLA 2XPGB 5LWYL 1AXTH 1AJ7H 4R0LC 3EYUH 3RNQB 2CLVA 2C4FT 3K2MC 4S10A 4WI7A 1UVQB 5HGGS 5H94A 4N0FA 3ZTNL 1TJIH 4YFEA 5DMKB 2JIXB 2Z31A 2NX5E 3LQZA 1RUAH 1ZVSB 4KMLB 3GMRB 5C0JB 1T1WB 3FQWB 4J1UB 1AP2B 5I9QB 4G6FB 4QO1A 5JXEC 3MRRA 3L9RB 1BQHB 4PRHA 5GS3A 2L7JA 2IAMA 5IR1B 2NLJA 2PF6A 1Q94B 3FQRB 3LKRA 3QIWC 4GAJH 1CDYA 4BJLA 2IQ9H 4HPYL 4MXVF 1KC5H 3R0MA 2A2QT 1ZMYA 1TJHH 5D1XA 2WIIA 4O5LH 3U46A 2QTEA 5FOBA 3TCXA 3LZFL 5E00B 3D9AL 4K7FA 1X5KA 2DWDB 3V4VH 3ZDXF 1F3RB 4GMSH 2OTWA 3EOBB 2Z92A 3F58L 5CIPB 4FXGB 3MV8A 5DJ0B 3VGBA 5I1AB 1PQZA 3GIZL 3JTSB 3ZKXB 1MQKH 3HNSH 4N0UB 3QXUA 1TJGH 1MCRA 1R5IA 1WWAX 4JN1L 1HI6B 4XNUL 1U58B 4OLXL 4PJ7F 5DQJB 1U3HD 3QEQB 4QCIB 2YUZA 4ELMB 1WZMA 4L8SB 3KPQA 4GXVL 4JG0H 4NKMA 3TA3B 1OTUD 1MAKA 3BUYB 4F7EA 3RWCB 4K8RC 2OBGA 2BY1A 3WXVL 1XR9B 4QHKI 4J6RH 4L4TE 5F89B 4JANB 1O7SA 1IGIL 3GBNH 3OAZK 1CLZH 4XPGL 5EO0A 3CLFH 4N5EC 4YWGL 4Q7DA 1NGWA 2DLTA 3LEVH 2AJUL 5B21A 3C9NB 3OX8A 3CFJB 2BJMH 4XTRD 4GKSA 1JHTB 4H1LB 4DK3A 1SYSA 3VI4F 2Z31D 3W81A 4PGCA 2MQ0A 4HFWB 2LTQB 4GAFB 1RU9L 3PWPD 4N0CC 1JZ3A 2AJVH 4LEXL 4K94H 4JHAH 4GG8B 4PRHD 4LSTH 5DEGB 3FONA 4L3AA 2IAMD 2ICWB 3PP4H 3H9HB 4MJ2A 3TM6A 5EIIB 2DQTH 1N6VA 1KGCD 4DEPC 3P0YH 3OB8A 4RFNC 4M7KH 4JY4B 3L95B 4LDLB 5GS2H 3BPCA 5D1XD 4C58B 3LN9A 4K9EC 1AIFA 4NC1E 1R0AL 2AEQH 1CL7I 3BT2L 4S1SL 3EAKA 1T1YA 1RVFH 3UJIH 3CMGA 2GTWA 3MV8D 1F4WH 3AAZA 1OAZL 2IALA 5CSBA 4P59H 5ALBH 1FIGH 1LK2A 1C7TA 5IMMA 2VH5L 1QHPA 3FRUA 3KPNA 4CRPA 3KPTA 2BERA 4A2MA 1CD8A 1EEYA 2P5EA 5JHLH 2AQ2A 3LV3B 3BWUC 1I8IB 4Y1AB 2H6PB 3JWOC 4FFVD 3X3GH 1CGVA 3MRJB 4XCEA 3IDMB 4Y4HB 4I0PB 1T3FA 5H35B 4PJ9B 4BFEA 1M1SA 2AK1L 5JOPE 5C86A 4KJQD 3VXTB 2NY3B 2DLIA 5CJXA 2ZG2A 5HGHA 1Z3GH 3QRFM 1Q0YH 5FB8A 1GOHA 2EIZA 2DTMH 3RAJH 1MCIA 4X0KB 1NUNB 3AGVA 4WW1B 3RY6C 4HEPG 1R5VA 4MJ5B 5FUOL 1ND0B 1K4CB 5GHWL 3CSYB 3TIEB 4JKPL 1XMWA 2X4OB 1F6AA 5IHLB 1YY8B 1PG7W 2VE6B 2VXUH 4C4KT 2J88H 4LSDA 5EORL 3BPNC 5F7EH 4CVUA 3VD5A 2PTVA 1GIGL 1DFBL 4WTZG 1F58H 3BH9A 1QSFB 4MA1B 4HXAL 2JKXA 3KPPA 4HS6A 5HI5D 2P1YA 5C2UB 4O4YH 1KCKA 4TVSa 3SY0B 3ZTJG 5HYSA 4R7NA 5F1KC 4R97B 4YLQT 4KZDL 4DUXA 4DZBB 2J1KA 4G42B 4HPOL 4GT7A 1YEJH 1WFTA 4Q9QL 2BVPB 4RDQG 1VFOA 1MFDH 5GRXG 2J8UF 4QHLA 4PRHE 3UBXG 2A9ML 2D0HA 3DGCR 5FF6A 1A7BA 1TVDA 1YNTB 1CGUA 1KGCE 4ZUTB 5GRUH 4DGYH 1FFPB 2A83B 4M6OL 4HUXA 1U92B 3MNVA 5IMKB 3MSPA 2E6PA 4RAVB 1J0IA 4TTDD 4JAMB 4YXLH 1WZ1L 4D0CB 2NY6C 2IPTH 2P5ED 3MV8E 3TZVD 2J6EA 3DO7B 3SGDI 1WAAA 2LQRA 1U3YA 1VENA 3VDAA 1A4JB 3QUXA 2RFXB 5I1CL 1EAPB 1R5WB 5ICZB 1JNLH 4HEME 5HYEA 5F96L 4BH7A 1EVUA 3OR6B 2BVTA 4GAYA 3MOQA 4RFEA 1DN2A 2VZTA 1YJDC 4YX2L 2HLFC 1A9BA 3IJHB 4NQSB 1U0QA 1UZ6E 2PN5A 4N1EA 4OI7A 2FR4A 4NRYA 3D9AH 3PWLB 2FX7L 5I71B 4OTXL 3T2QA 2AXHA 1ULVA 1U8KB 3DXAA 4LAQL 1PLGH 1LO4H 4XPHL 1ACYH 1QQDB 4LPUA 4LDEB 4AIXA 1IMHC 4Z7UF 5D72L 5KVGL 3GMMA 3C60C 1BWMA 5DHVH 4NZJA 5SWZB 3HCVA 5HVHB 5E8OB 4WW2C 4OKVB 3S34H 5DHYB 2MNUA 4DOHE 1WV7T 4OLZL 1WTGT 1IGFH 3IKCA 4JGUA 4R2GD 1DQTA 1BIIB 4O2FB 1K6QL 1X5XA 3WXVH 3IDYC 2MCPH 2CKBL 3GB7A 5T5FH 2H2PC 4ZD3L 4MSWB 3X14A 3WBDA 5IMLA 1C7SA 3QAZB 5FECA 5HDBF 1KIQB 1OPGL 1QLRB 5HHXL 3JV4B 5JDSA 4QRSA 3VWKC 1ZT7A 1C16B 3MRHB 4FXLA 3KPOB 3B9DA 4X6DB 2J3SA 1S78C 1FNAA 4CDHA 4HKJA 1CZ8H 2CDGA 4JRXD 3DNKA 2GSGB 3C5JB 1KXQE 4JFHD 3FB6A 5I74B 3UYRL 5I66A 2ARJA 1BX2A 5JNYA 1QNZH 4LQFH 43CAA 1MIML 4JM4H 2FZ3A 3LCYA 3W9DA 1WFUA 3B9EA 6FABL 2E7LC 5KOVC 2P5EE 1K8DA 4KKCD 5CHNB 5ERWA 1BQLL 1CF8L 3F7RA 1CVRA 5D7JC 5TDPB 5ALCL 3TBSA 3N1FC 3QQ9C 4NWUH 5IEKB 4UQ2A 5DUBA 1WZKA 3LSOB 3MLXL 2R8SL 4ZQKB 2PO6D 4XP4H 2YD5A 5IF0B 2YPLD 4MLSA 4ORZC 1MAMH 4RZCB 2ARJQ 2AJZA 3I6LD 5ESAB 1I7RA 3PF2A 3U0TA 5IQ7H 3DXAD 1V7ML 3OAUL 4QT5A 1SY6A 4OCSL 1SMAA 1UZ8B 3L5JA 4OZFG 3RVUC 3SE9L 4U33A 4K3JL 3DECA 1GZQA 1UM6L 3T2NH 5F3BA 5GGVL 2IGFH 3ARBA 3ZDZE 1G0DA 3BXNB 4C56B 5EU7C 3VDCA 3BUTA 1QKZH 3PGDB 3GSOA 4GLRH 2HFEA 1JWMB 5EU6B 2YN3A 1ZGLB 1ZV5A 2F9BT 4RISL 2FX9L 5B22A 3LEXA 2X4TB 4PJGF 1U8NB 2DQDL 2WSKA 3DUSA 1I85A 3O2VL 3QR2A 1NGPL 4CJ1A 3TVMC 4I48A 1EDQA 4E5XB 4MA3A 1FNSL 5GHWH 4XMPL 3MJ9A 3MLVL 3PJSB 3WIIH 3X3FH 5F1SA 1JP5A 2C3GA 2DQJL 5DRWA 2IPUK 4OB5L 2FD6H 5EORH 5LBSL 2B4CH 5HYJA 3RPIB 4U2ZA 3MRQB 4UBDC 1GIGH 4DN4L 2R2BB 4PJEB 5CSZB 3W39B 4F37K 1CICB 1FNGB 1Y6MR 1LD9B 5T1LB 2HJFB 5IEHA 1I1RA 3IFNL 1XIWA 2CDEB 3U9UB 3A6CL 1A22B 4JRXE 2APVA 5D2LB 4JFHE 3KXFB 1QR1A 5CP7B 3OXRB 3NZ8A 4HPOH 4WV1B 4PJDB 2BSRB 2AKRB 1ZLSH 4NT6A 2R2EB 2Q20A 2A9MH 4PUBL 4KJPC 4X7TA 4U6XB 4JDTL 3V6BR 2QSTA 2X70A 3K80A 4XAWL 4XPFH 1WVZA 2Y9RT 2NX5B 3O6ML 3HKFA 1D9KC 2NTFA 1LEIA 5HVFB 4RAUA 4LP5A 2X40A 3ULUC 3ZT7A 4PRNA 4KY1H 1TQCC 3VFWA 4KRMB 3ARZA 3I6LE 4P5KB 2R1YB 4OQTH 3DXAE 2NY1B 4JY6A 3BP6A 2OYPA 2RJMA 3BD4A 3OR7A 1L0XA 5HHQA 3ARBD 4HF5H 4P9ML 2NW2B 4LVOB 4Z0BH 2W9LA 3DX6B 3QXTA 1KFAL 1KB5A 4NZUL 5IFHL 4FOMA 3JUZA 4IDJH 5D71L 2LABA 3MJGX 3BH8B 3TWCL 2NY5L 2GYSA 1F11A 3L6FA 4YIQB 3WNLA 1NAML 4GO6B 1LILA 1MCKA 3OL2A 3INUL 5GRYA 5T3XH 2WUBL 3U7YH 3U4BH 3BIKA 5EZJA 3WFBL 3GSNB 4NN5C 4IRZH 4XCCL 5C0IB 1K2DA 4PP1C 2B5IC 5CD3A 4TRPL 4J2XA 2DLFL 2BC4B 1D5MA 4ZYKB 1VKXA 4Q58C 4RGND 5DK2B 2MCG1 1ZGLP 4XB8A 4KGLA 2ZUYA 4U1SA 1ZLUK 1FAKT 4L4TB 4AEIH 1P1ZB 1XIWD 3HTLX 4I9WD 3ZE1F 4O02H 1BOGB 1M71A 1IEAA 2CKBH 2X41A 1NPUA 1WC7B 4U3CA 1BBJA 3QQ4A 1NBQA 1J0ZA 2YC1B 3T0VA 4LCWA 5IVXA 1UEMA 3CMOL 1OW0A 3QI9A 3V8CA 1UWXH 5JW3L 5HHXH 5ACLA 3VGFA 4M00A 1NGXB 3QYCA 1JHLL 1MCHA 1DBKL 3GI9H 2EXYC 1AGCB 4ALAH 4G43A 5DLML 1YA5A 3T3PE 1YEEL 4NOBA 3PP3H 4KI5D 4M6MH 3KR3H 3S37L 3FN0L 1FHGA 3UBXA 2DQFA 2OTUA 1GGBL 5DJAA 4NSKB 1CLOH 1JPSL 2XZZA 1MQ8A 4Z18A 4I3GA 3STLA 2R56H 3EYOB 6FABH 1KBGL 4LKXA 3BHBA 4YR6B 3QZWG 1M7DA 4PGBA 3IF1B 1BQLH 1D5ZA 1A6TA 2DQIH 1INDL 2XWTB 5DO2D 3WD5L 3MLXH 3KYMA 2R8SH 4WTWA 5IBTL 4OV5B 4EOWH 2C3WA 3V5KB 1V5JA 2DMKA 1K85A 1R3LA 1S9WB 2BNRA 3ARWA 1HIMH 1I4FA 1EZVX 4K07A 1IAMA 4OCSH 3MV9A 1QTYT 4JM2C 3QIBC 1N3NB 4WU5B 3DROB 3UTQA 3MNWA 3WCYA 1U93A 1WBXB 2XI9A 1MHPL 1W72A 1JGUL 1S7VB 3DETC 1EVTC 2ADIB 4KDTC 4KKBC 3ARFA 3L5WB 3UPAA 3TBYA 4ODSL 4PJ7A 1FLRL 3HFML 1RJZB 1MPAL 3FL7A 1PDKA 1FCCA 4JN2A 5HYJE 5JMOC 1IZKA 2VB5A 1CFTB 5ENWA 1S7UA 2NNAA 4RGNE 2EE9A 5CJOL 3MV11 4XHJC 4HKXB 2NXZC 2DQDH 5D9SB 4LCWD 4I9WE 2IC2A 2P4AB 2YK1L 3VRLF 3V8OA 5JOEA 4X8JB 4R4ND 4YDLB 5AYQA 2D7PA 5LGHL 2VDPL 1HYSC 2IMMA 2J7LA 5FO9A 2DQJH 2NZIA 3K0WA 4OB5H 4LGPB 3QIUA 3C6SA 2CLVB 3RZCA 1MCPH 4DN4H 5AUMB 5H94B 1B4JL 3RWFA 4N0FB 2Z31B 4YPJA 2DL9A 3WUWB 3LQZB 4P4RA 1KJ2L 3DRQA 3VD9A 4KI5E 4HUVA 1F45A 2R2CA 4U1MB 4EDWH 7FABH 1QR4A 3MRRB 2AXJA 5I8CA 4IJ3C 2IAMB 2NLJB 4JO2L 1AXIB 3LKRB 4O9HH 4WRLA 2PXYC 1RIVH 1T20A 2ENYA 3RNKA 5D1XB 2WIIB 3U46B 1IC7L 1S7WA 5FOBB 1QSEA 2NY0D 4K7FB 4TTGA 1FO0A 4CVZA 1HZHL 5FFLA 4OGZA 2Z92B 2BNRD 3MV8B 4RQQA 5I8KH 4FQLL 3AY4A 1PQZB 4JFYA 5D2NA 2KQNA 3MRPA 2QJDA 3VFOA 1NEZA 1Q9WA 2EDEA 2GUOA 5FO8A 1GVIA 3T77A 1KEGL 3V6FA 1R5IB 2IWGA 2RCSH 5LCVH 4QRRA 2QBWA 3B8YA 2BY2A 3S88H 1RY7B 2HKHL 2FGWL 4LPCA 4LVNB 4ERSL 3ARFD 3HZVA 3PIQA 1I3GL 3N85L 1KFAH 3LS5H 1FP5A 1SVZA 1JF6A 4ORGA 3U1SH 3C2AH 1BEYL 3KPQB 5C0RL 3QUYC 5JIPA 5MP6L 4F7EB 2D03H 3R0NA 1IFHH 4OM0H 3CGTA 3SN6N 3P4OA 2YRLA 2WUBH 4TOYH 5IBUB 5C6TH 4BSVA 1W2KT 1RZJH 5A1AA 4YDJA 4XCCH 3ESUF 3KJ4B 5K59F 5KVEH 1BFSA 5HPOA 4DW2L 4QTHA 3TYGH 5EO0B 3KLAA 3L5XL 4UB0H 2V9QA 4LCWE 4TRPH 5IVXE 2OMBA 2PKDA 5I18L 3QIUD 4DOHB 1NGWB 3ARRA 3BZEA 3RZCD 3OX8B 5JDJA 1A3LL 3BKML 4GKSB 4OZ4A 4XPAH 1SYSB 3CFEA 1YECH 3MV7D 2W9DL 1CTOA 3HLAA 4PGCB 2O93L 4LIQL 4M43L 2HT2D 2VC2L 1BP3B 3CX5J 3QFJD 3RIAK 4HSQA 1IAIM 5JA8B 3FONB 2DQGL 3L7EA 4N9GA 3S37X 2I25N 3PQYA 4F9LC 4NFDA 1S7SA 5ILTH 1A2YB 5JW3H 4FP8L 1JHLH 3BPCB 2ZZUT 3D6GA 1YEDA 4K7PY 2H1PL 1WICA 4GRLC 1QSED 5DLMH 2J8UA 3BIAX 1F97A 3QA3A 3GHBH 5SV3A 1YEEH 2GTWB 4XP5L 1QA9A 3C6LA 3AAZB 2IALB 3L7FA 1HSBA 2I5YL 3OAYK 4FQQA 5E6ZA 1I3RA 4MXVE 5IMMB 2F5AL 3FRUB 3KPNB 4JG1H 1C5CH 1GGBH 2IBZY 1EEYB 2BNRE 5SWQA 5KZCB 1G7HA 1F4YL 4U1KA 3ZDXE 1KBGH 4ODTL 4KROB 4JB9L 3N1PC 2E8YA 3ARTA 4XCEB 3CVHL 1RQ5A 4LFHG 1T3FB 2YUWA 3TBTA 1N7ML 2DKSA 2XV6B 3C08L 5IBTH 1ZHLA 5D4QA 4PRDA 4HLJA 5GGSY 4MD5A 2EDKA 3UJTH 4PJ7E 2FJHA 5IV2A 1U8HA 5T33L 4KK6C 5FB8B 3QHFH 2EIZB 5K9JH 4X6CF 1KENL 1KCUL 2I60L 2M1KA 2OZ4L 4TQEL 2VZUA 4OIBA 1R5VB 4PRPA 4J4PA 15C8L 1ZSDA 2QSQA 5BJTA 1UQSA 1MHPH 1TETH 2VKWA 1JGUH 1F6AB 4JEGB 3HG1A 4LHJB 4Z7UA 5DT1L 2G5BA 5CMAA 3O6FD 4LLQB 3BH9B 1A7PH 4GSDL 3P9LA 3R4DA 4ZS6D 1G7LA 2EEBA 4M9OA 1ZTXH 3KPPB 4KK8C 5CJOH 5B8CA 3HN3A 5HYSB 4LSUL 4ODXA 4R7NB 3MV7E 2AQ1A 4YNYA 1OAKL 2OJZH 4PTUA 1KTKE 1G1YA 1O7VA 3PQYD 5GS2D 4L8BA 5E5MA 3BWAA 2C4XA 4QHLB 3SGJA 4U7MA 1M05A 1W0VA 1YYLH 4XC1L 2HRPL 2EDLA 3KPMA 5I75B 2EDHA 3Q6GH 3C6LD 4HUXB 3Q5TA 1QHOA 3UYOD 3MNVB 5EU3A 3LRGA 5L8JB 2VUOA 5D1QA 3VFNA 1QSEE 5IFAL 5J13C 3ROLB 4XNYH 4DUWA 5D2NE 1ORQA 5A40E 5CJBA 3WIHH 3QUXB 1EUTA 4JO2H 4YFLI 2XY1A 5DD5H 3WIFA 5IP4A 1E4XH 4XI5D 4BH7B 1IQWL 1JYXA 4GAYB 4P5TC 3W5NA 4RFEB 1PY9A 4GQ9L 4QRRE 1A9BB 1JZ6A 1DL7L 1IC5H 1JRHH 2NXYB 1BM3L 1VGEH 3QZWA 1PZUB 4ZFGL 2HP4A 4FQLH 4OI8A 4WIQA 4NGHL 5KG9A 3DXAB 1EFQA 2OJEA 1GC1L 4PRPD 5IROA 5DHVA 3T2PA 4J4PD 1QFWM 1AFVH 4BFBD 5HI4D 2IG2L 3HG1D 3HCVB 1JFQL 4LLYA 2EDYA 2YXMA 3BD5A 4ERSH 1FFNB 4LCYA 3T0WA 5KAQG 1IM3A 3BEVA 3SBWA 5EDXA 3SO5A 1DSFL 1BEYH 4HS3A 5I73C 1OAYH 3IKCB 3SDDA 3U4EA 5EWIH 5KW9L 5ESVA 4JRWA 5D1ZC 2V17L 1KPUA 1OAXL 3GB7B 4NCC2 3X14B 3RWDA 3IXTA 2E7BA 4ODUA 9CGTA 5IMLB 2FSEA 2NY5C 5A2KH 5FECB 5L9DH 4PJGA 3RA7H 5JDSB 4QRSB 4L29A 1G9NL 3PQYE 3K8MA 3MA9H 3MOBL 3N9GL 1ZT7B 2D3VA 4TSCH 3BKMH 4HKJB 3I3DA 5D1QD 2CDGB 4R4FL 2J8UE 1DVFC 3FB6B 4ZODA 5I66B 3TH4T 4DUVA 2ARJB 2B0SH 1BX2B 5JNYB 1WT5C 5EU5A 3VH8G 4XNXL 5BV7B 3U0WL 4W4NA 1QFOA 2VISB 2ZKHL 43CAB 3LMJL 3FO9A 5JUEL 2FZ3B 3BN3B 3W9DB 3MRKA 1WK0A 4JKKA 1MCWW 1K8DB 4UDUA 2WWKT 2AI0H 4RSVA 5ERWB 5ICYA 4F8TA 2VDMH 3TBSB 1SJXA 4DZ8A 4D94A 3MO1A 4DKEH 2F74B 4UQ2B 1RIHL 1MFNA 4ZOCA 2DMCA 3UTZA 1GSMA 4NKIL 2DMBA 4DKAA 5FYLH 2AJZB 3OKOA 3EKCA 5AZEL 1U8PB 1I7RB 3U0TB 4KK5D 3EHBC 4NBYB 4G6AC 4QT5B 3C5ZB 3MUJA 1WIUA 1KUMA 2AW2A 3MLUL 4L3CA 3QPXL 4NJ9H 1XGPA 5HJ3A 1WFOA 1CE1H 3IRPX 1J7VR 4PRPE 3ULVL 5EU4A 1FGNH 1GZQB 1H5BC 1OCWH 4L9LC 1LE5A 3QCVL 2MWCA 3ARBB 4P49A 4GRWH 1NMAL 5JORA 4FQ1H 3HG1E 3G04A 3SDDD 3HA0A 2JJTC 3C08H 3GSOB 5J8OA 3K4ZA 4I5BA 1G1CA 5IJVA 1ONQB 3WL9A 2A1WL 3RIFF 4ZUWA 2NY2B 1NLBL 5J9PB 3NABH 3LEXB 3GBLA 2X10A 2X1XR 1OD7A 1ED3B 3DUSB 2B1HH 3HRPA 3CDGA 1KCUH 2OZ4H 3MRIA 4I48B 4DTGH 4MA3B 4Z8FH 1A7OL 2JCCF 2AAVA 5DZOA 2MQ3A 3DTXA 15C8H 4CJ0A 2E8ZA 2VZSA 1NCAL 2YD3A 5DRWB 1VACA 5DT1H 1NBVH 3ZKMD 1NUGA 5D5MF 5HYJB 1JN6A 4Z95L 2W1NA 3OGOE 5K33A 4P57A 4X7FC 4GSDH 4RGNB 5DWUL 5E08L 4H8WH 1P4LA 3EJYC 4NC0B 4KRNA 5IEHB 3CK0L 1XIWB 4XBGA 2QHRL 2W60A 1PEZA 2UY6A 2VZOA 1RIUH 1QR1B 1S7QB 2BFVH 3NZ8B 1OGTA 3PUCA 2Q7YA 3QG7H 5L88H 4NT6B 1X4YA 2HVKA 4HLZH 4D0DA 1DBBH 3VJ6A 4XC1H 4X7TB 5L7XL 2HRPH 2X70B 4R26H 1SJHA 3TBVA 3V4UL 4NN6C 2PW2A 2VQTA 2X6MA 5GGRA 3OKEA 1ZHNA 2NTFB 1LEIB 2P8LA 5I1IL 4RAUB 3T65A 4XMKH 1MCFA 1KJVA 4PRNB 2HFGH 4EIZC 1N2RA 2YA2A 1FPTH 4OQTA 1QLFA 4ZAKA 4GRWF 3VFWB 2XT1B 3VW3H 2E9IA 3G5ZA 1CFNA 5J57B 2VLLA 5C07B 3E6FA 3BP6B 1MHEA 1F8TL 5E1AA 3OR7B 2RQ8A 4E0RA 1JTOA 3QNXA 2EE3A 4GQ9H 4TVPE 4WI2A 1KB5B 3WYRA 3UPRA 4HXBL 5MI0C 3EO0A 4OM1L 4APQD 1K5NA 2GKIA 5I1KL 1F11B 4FQCL 3L6FB 3BVNA 2HMID 1BM3H 3SE8L 4UNUA 4HIXH 3ZKNC 4PGJA 3I2CH 3BIKB 4YHOL 5EZJB 4IIQC 5E8DL 1GC1H 4G9FD 2DAVA 2PW1A 1MCCA 3V6OC 5I1EH 4QHUA 2GY7B 1H3VA 4OLEA 3SKOA 3D85D 3TNMA 2IADA 3SE3C 2E27H 1D5MB 3CDYA 4QRPA 5FM5M 1VKXB 2DQHH 5CIPH 3MBEA 4LAJH 5EOTA 4YEFA 1NLDH 3V0WH 2FYYA 4QWWC 4PY7A 4W70A 1M71B 4UV7L 5D6DA 1IEAB 4AQOA 2WBJC 4KJYA 3ORJA 4HIJA 3RWHA 2F58L 1BBJB 3QQ4B 1F2XK 2VL5A 2DI8A 5HDLA 4LCWB 1UM4L 5EC1A 5IVXB 4I77H 5GJTL 3QI9B 3WS6C 5GGTL 2YWZA 4NM8L 4QOKA 3B5HA 4F58L 5MEQA 1T83A 1BVLB 1I1YA 1MVFA 4G43B 5BS0A 4JZJA 2BCKA 3V52L 1NC2A 1QO3A 4WNQA 1H0DA 4X4XA 1RI8A 5AYUH 3UBXB 5CJQL 4L5FH 3C5SA 2DQFB 2G5RA 4HUUA 4ZAKD 5BVPH 3S4SG 5IT2L 2ZKHH 5DRNB 3LMJH 5JUEH 3L5IA 3STLB 2RR3A 3TT3L 1PYWA 4R4BA 3AMKA 4JPWL 3BHBB 3EO9L 5J6HA 1M7DB 2NYYD 4OLVL 4P46A 4PGBB 1D5ZB 1A6TB 4KRLB 4PLNC 5FKAA 1MREL 2MKWA 3PWVA 1EHLH 1H8NA 2X7LA 1J8KA 5F8RC 1MFCL 3KYMB 5GS0H 1LO2L 5T3XD 3SDYH 5F44A 1KCVL 5AZ2H 5T3ZD 5CCKH 2ZOKA 2C1PA 4LFHD 4YUEL 4OUOA 2BNRB 2X1WL 2BSTA 1I4FB 4WUUA 4XVSH 2MPAL 4XWGL 3MV9B 1LO3H 3QPXH 3P2TA 4YJZL 3MNWB 4M8QA 4FG6D 2DL2A 1U93B 4EEEA 3VXPA 3EYVA 2KBGA 4NNYA 1W72B 1Y18A 2P45B 4G9FE 5EPMA 1PX4A 4I3SH 4PP2A 4QRPD 4FFYL 1TQBC 1A7NL 3MGAA 3ILQC 2RBLA 3TBWA 1F4XH 3TBYB 1F13A 3MBED 1IGCL 4PJ7B 4JN2B 3VGAB 1NAKH 1N64H 1MJ8H 2A1WH 1NCBL 5ENWB 4W4OA 1S7UB 5D93B 2NNAB 4MLIA 2AP2A 1KTLA 3E1F1 3QDGA 3D2UA 4OCRL 1L6XA 3QUMA 5F7LB 2YD1A 3M8OL 4B0MM 1A7RL 1U42A 2KL6A 4IDLA 3QXAA 4QOKD 2XQYG 4P23C 3ZE1E 5E2JA 3K1DA 2OXHA 1GGTA 4WEUD 1BFTA 1YQ2A 1A6AA 1NCAH 4GH7B 1MCOH 4HW6A 5BS0D 4P3CL 1MLBA 3QIUB 5BOZG 4Z95H 3C6SB 3RZCB 1ZHKA 4AH2A 5C0FA 5J1TC 2D4DA 3AS2A 3IU4L 3BQUC 3RWFB 4RWYH 1NCWH 3VD3A 2YOCA 5CEXA 1MJJA 5IKCA 2FLBT 1U6AH 4RRPG 4NQCA 4P4RB 4X4YA 3B2VL 3QEGH 1J12A 1RULH 5DQ9A 4HUVB 4X9HA 3HMWL 5I8CB 1JPTH 4P46D 1U91A 3DX9A 5IBLD 5TE4H 3U82B 3R8QA 3GHEL 4OCWH 1T20B 3VH8A 3RNKB 1AY1H 4WCYH 2G9HA 3KLHC 1S7WB 1U41A 3LOWA 4XZUA 3V4UH 3H0TA 1QSEB 2BOCB 5KTEH 1FO0B 4CVZB 3AU1B 4XPTL 4RQQB 4WUUD 3DSNA 1WWCA 4JFYB 5DEFA 3LKQA 3MRPB 5T3XE 3VFOB 1NEZB 1Q9WB 4KKLC 5FO8B 5T3ZE 3T77B 4P0DA 3EZ8A 1GHFH 3UXFA 1BFOA 3H2WA 4I18A 3R1GH 3KJ6H 1G9MH 1TNNA 4EN3A 1F8TH 4QRRB 1WWWX 3IDXL 4TSAL 4LGSB 3L3HA 3PIQB 5IGXH 4ORGB 3MRBA 4OM1H 5KVFH 2J5LC 4QYOA 1OTSC 4XBPA 1V3KA 4QRPE 1U36A 2AXGA 1A3RH 4ODWA 3P4OB 3QDGD 1CQKA 4G8GA 4G6MH 3T8XA 2Y5TA 1FRGH 3D2UD 1MH5A 1A1MA 3QIWA 4YHOH 3BPLB 4DN3H 4YDJB 4X9GA 3P4LA 4QTHB 2ITDA 3KLAB 4X6CA 2APWA 4HWBL 2HTLC 5F6HI 1FORH 3WKML 4KQ4L 2VXSL 1K8IA 4JM2F 3ARDA 5GS1A 2R4SH 4QOKE 3I9GL 5HDOA 4H0HB 3VRLE 1QVOA 3CCHA 4OZ4B 2X89D 3P0VL 3CFEB 4HLZG 3VWJA 2WWMC 5BS0E 1CXFA 5E99H 3HLAB 1X5FA 3MR9A 4JREC 3H3BC 3H42H 4MCZA 3SKMA 3G6DH 1FNEA 2YPVL 3GSNL 3X12A 2WLZA 5JQ6L 3H8NA 3EYFA 1IC4H 3RX7A 3L7EB 4N9GB 1SYVA 2CRMA 3CXDL 5F6IC 2G60L 3MXWL 1DE4A 3PQYB 2ORBL 3SGEI 1S7SB 1ZE3C 2VDOL 4QHNA 5GJTH 5TFSL 2EEAA 4F9PC 1GPOL 5F7WC 3LEYL 4OF7A 1P6FA 1YEDB 4U7SA 3EDJA 1JGDA 2Y72A 4DGVL 5ITFA 2J8UB 1PKQA 3QA3B 1VFAA 2EZ0C 5E6IA 1NFKA 1XR8A 1T0NA 1QA9B 1JGVH 3C6LB 5C1MB 1HSBB 4FQQB 4G80A 2A77L 1I3RB 5LXGH 2HN7B 1G9NC 5CJQH 3RTQB 5C2BH 3EO1A 4K3EL 3FO1A 4PBVC 5FYKH 4L8SC 3KDMA 4WUUE 3BAEL 3TT3H 4P3WA 4EN3D 1XF4B 5HHVH 3GRWH 4OLVH 1WCBA 5CKGA 1YN7A 4F2MA 4OZIF 1DTUA 3IGAA 4OBSA 2DI7A 5JW4M 1MREH 3TH3T 1KB9J 3TBTB 2V5YA 3TO4A 3VMOA 3HC4H 2V5RA 3LKNA 1Q1JH 3PGCA 3MODL 1ZHLB 4PRDB 4MD5B 3AREB 4G8GD 4LRNL 4L1DA 2FJHB 5IV2B 3QDJA 1BAFH 2P8PA 4YUEH 3LKOB 3RHWK 4HUWA 3ALPA 3DGGB 4GS7B 4R8WH 2Q8AH 3SKUD 2MPAH 5LG1A 1CDIA 2OR9L 4L4VD 1FAIL 4LLDA 3FOLA 3GK8H 3QDGE 1T6WA 1YZZA 1A1NA 4PRPB 3DPBA 5T1DL 4JQVC 2LTQC 5JZ7D 1ZSDB 5EOCL 2XWBA 3V7AG 4ELKA 1HHGA 5C7XL 1UQSB 1MFEL 3O3UN 3ARDD 3HG1B 3QRGH 4Z7NE 4Z7UB 2ZJSL 2G5BB 3B2UC 5CMAB 3VWJD 2DF3A 1PJ9A 1IGCH 4GBXC 5K59E 1HHHA 2WW8A 3P9LB 4JO1H 1G7LB 1S7TA 1R6VA 3BN9C 2W9EL 3ULVC 4KK9D 5F70A 4Z76A 1GH7A 1IAII 5B8CB 4ODXB 1A0QH 4YNYB 5JIIA 4PTUB 1CU4L 4NQCE 3NGBB 5E8EA 2QSCH 4AIZA 4L8BB 2ZNWA 4P4KD 5E5MB 3BWAB 4PB0L 4CN4A 4BSWA 3QUZC 1M05B 1VPOL 1JHKL 2X4QA 1W0VB 3U7WL 1L0QA 3H7BA 3BJLA 4Q97A 4TNWK 5TPWH 4S1RH 1GJIA 2V9TA 4CVWA 3EUUA 3KPMB 5E6ID 2X4RA 5JR1H 4JPVL 2W0LA 4R9HA 1V7NH 5D1QB 3VFNB 5I1DA 4Q6IA 3RY6A 4AL8L 4PJ9C 5CILH 4FFWC 3MACH 2MJWA 3QJHB 4KC3B 5FDYA 2PNDA 2NY3C 2EICA 2GCYB 1ORQB 1TZGL 3GMLA 3HMWH 3O3EB 5K9QI 3OHXA 3UDWC 4H20H 4AM0A 3WIFB 3RL2B 1XGYH 3P0GB 4XXCC 1IAKA 4YHYB 5JW4R 1QP1A 3TO4D 3V4PL 5D7SH 3OZ9H 4U0QB 4U6VL 2XZQL 3S4SA 4LARL 4N0CD 4QXGH 3BO8A 4LASL 1RJLA 4LU5L 4YXKL 1T4KA 3QDJD 3QZWB 1LNUA 4HZAA 4Y19D 1B0GB 1TCMA 1KCLA 3NCJH 4A6YA 1DQLH 3PL6C 2GIYA 3RI5K 4U1LA 1U9KA 5KG9B 3UTTA 2EE6A 1XEDA 4G8GE 3NPZB 2VDRL 1CQYA 5DZNA 2WINA 5DHVB 5TDNA 1L4IA 2VQ1A 1Y0LA 4LLYB 4L4VE 1UA6L 4R97C 1MWAL 4TSAH 4WI4A 5DJCA 4X6CE 2BHUA 1JE6A 1KELH 4LCYB 1IM3B 3BEVB 4BUGA 4KKAC 2JJUA 4JR9L 1PGRB 1FFOA 3H3PH 4HS3B 3WS3A 1KNOB 5ITBL 3SDDB 3U4EB 5CD5D 4Y5YA 1BECA 5ESVB 4EBQL 4OLYH 4GXUM 2X42A 1KPUB 3ABZA 3WSQH 1I1CA 5C71A 3RWDB 4XP9H 3IXTB 3WHXA 1LEGB 4ODUB 2V9RA 2FSEB 1H9VA 3BEWA 1EFXA 3HC0A 4PJGB 4AJ0A 3TJEH 2ITCB 3U9PL 4U1JA 1N4XH 5B4MC 4NZRL 3WKMH 2KKQA 4PLJD 4NQXA 5DK3A 4S1DD 1NSNH 4YBLC 1RURL 1FZJA 5M94B 1E0OB 1M6OA 1J1PL 1PKQE 1DBAH 5KSAD 1Z9MA 5D5MA 4JY5H 4PBXA 1IBGL 2X05A 5GISL 1VEPA 4GOSA 5EU5B 3QXVA 1YMHA 2V7HA 4E9LA 3C60A 1LE9A 4CMHB 3FO9B 4LLVA 1BREA 4P2RA 3BW9A 4YHPA 3SCMB 3MRKB 5CGYC 3BJ91 3JZ7A 1HQRA 2G60H 3NFSH 3MXWH 1H3XA 5IWLA 1AR1C 2B1AH 4NO0A 4UDUB 4PPTA 1HYRC 5DJ6A 5I71C 5ICYB 3RGVC 4UINL 2YS4A 1G7PA 2FECI 3MO1B 2XN9B 1JF5A 5IHUL 4DGVH 3TCLB 3RPKA 1D5IH 3UTZB 5HHNA 5HVHC 3D0LA 1KJ3H 1HKLL 3OKOB 1B2WH 5TQ2L 5FHBH 3T0EA 3UTTD 2Q86A 3BKJL 2R4RH 3QDJE 1TCRA 4U3XA 3V5HA 4L3CB 4Y19E 4NKDA 4OD1L 1XGPB 3CD4A 4JHWL 5IW6A 1IC1A 1VCAA 1FZMA 3CX5K 4S0SD 3HB3C 5EU4B 1X5AA 1EO5A 4M7LT 4PV9A 1LE5B 4OFPA 1LQSR 1BJ1H 3U2SB 5C08A 2EH8H 2NY6D 3M17A 3G04B 3QAZC 4PJ5A 5I19L 1S5HA 3TP4A 1FG2A 3T1WA 1E4WL 2GEEA 2A6IA 4FQJL 5IJVB 3WL9B 1F3DH 4K7PH 3O41A 4IOSD 4ZUWB 2E7LA 1P4BL 4J3WA 4HGWA 4KH2A 1XFPA 5ICXA 4OCMC 3CDGB 3MRIB 5I74C 5TH2A 4L9DA 4PGDA 3DTXB 3CLEL 2WP3T 3W11C 2ERJB 3MRCB 1FSKB 1VACB 1UG9A 1BJ1J 4H5SA 2VO5A 4ZXBA 1JN6B 3DJ9A 4F8QA 4P57B 4YAQA 4JZNA 1F3DJ 5I76A 2NW3A 3BZFA 1P4LB 3BP7B 2XA8H 2CMRH 4QRUA 2CGRH 2W9EH 2XTJD 1QEWA 4V2CB 3C60D 1CXHA 2WAHA 5EO1A 2W60B 2VXVL 3TV3H 4MNQD 1NH6A 4P2RD 1J88A 4KVNL 1N5YH 1OGTB 3DYMA 5LGKA 2Q7YB 1IT9L 1T5XA 3PHQA 2HVKB 4PB0H 1KIPA 1NL0H 4HJ0D 3RUGF 4LSVH 4D0DB 4CN6A 3VJ6B 5DUMH 1YN6A 3B83A 3NCBB 1MRDH 2FEEL