3LQAL

Crystal structure of clade c gp120 in complex with scd4 and 21c fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
213
Chain Sequence
b'SVLTQPPSVSAAPGQKVTISCSGSSSNIGKNYVSWYQQLPGAAPKLLIFDDTQRPSGIPDRFSGSKSGTSATLAITGLQTGDEADYYCGTWDSSLSTGQLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTMAHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD4
publication title Structure of a clade C HIV-1 gp120 bound to CD4 and CD4-induced antibody reveals anti-CD4 polyreactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2010-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqaL01
5L2KB 3ELAT 3TO4D 1LO2H 1UB5A 5E08H 1SY6H 3B4NA 1EHLH 1MWAH 3RVXD 2P8MB 3FO2A 1WZLA 3F12B 2R1WB 5IROC 3ZYOA 4EXPX 3PNWA 4OZGB 5GGRA 1MHPH 1GZPB 3VGGA 4X7DC 1T2QH 4S2SB 4LSVL 4PJ9B 5FCUL 1BZQK 1GGBH 1SEQL 1J7VR 2R0ZL 3BGMB 4HJGA 2H6PA 4HXAL 4G6JH 4R26H 4I77L 4KQ4L 3FQRA 4EDXA 1NEZG 2D7OA 1FYTE 4YHLL 1T89A 4JFXA 5HBBA 4CU6A 1FPTL 5MEQA 4HF5L 4A6YL 3H7BB 4X5WB 4KRNA 1K3IA 4LSTH 1J86A 3S98A 4G8EB 3MLWL 4YX2L 1YY9D 2YD9A 3DROA 3S34H 1N6VA 3WE6A 5ALBL 5GGVL 5T1KA 4Z7WE 1KJ2L 3GBMH 1U8PA 4X7SL 3MMEA 4G8IB 1WUNT 4GW5A 5J6HA 4JN2B 1RMFL 5C1MB 2F54A 4UV4L 4ORGB 1NEUA 2GI7A 4P9HC 3OGCA 3FOMA 3QFJB 1CGSH 1AGBA 3IJYA 2DQDL 4FRWA 4ODWB 1DBJH 3NGBB 4OZ4A 3SKOA 5IFAL 3RUGB 4RAUB 2J5LB 3FRPG 4HW6A 2VLME 1EZVY 4R97B 5ISZA 1KTRL 1TTGA 1OP5H 5EBWA 1F90L 1HINL 4K8RH 3V4VH 5JMOC 4Z76B 5GGQH 5DSCB 1K2DB 5HYEA 3IS0X 3UTTA 1RFDH 4PUBL 4HMEA 1X5LA 3M8OH 5GJTL 2CGRL 3LKPA 4M93B 5KSBB 2QQKL 4JVWA 4U6TA 4XWGL 4HUMB 3T2NL 3IAPA 4LSRH 1A7PH 1EJOH 2KQMA 2ATKA 3ULVE 3MUGA 2BCKA 3BYTA 3O4OC 3S9DB 5KS9F 2ZOLA 2BOBB 5KSAA 1MUJB 5CILL 1H15B 2XZQH 1XCQA 3QPQC 3LKOA 3VFGL 1OGAB 3CFIC 3OB0K 2DWEA 4PJXA 5FA4B 3WFEH 4BH7A 3S6CA 3RHWF 3KPPA 4CVZB 3MA9L 2FEDD 2PXYD 2DM7A 5EBMA 1ZTXH 4PRIE 3AS1A 4XP5L 2NXZC 5C08D 4UNTA 4DTGL 2EKJA 5D5MA 1UJ3C 1D6EA 1KFAH 3ZT6A 2Q76A 4O2CA 1UWXH 5DHVH 4BZ2H 2Y5EA 1LE5A 4NRZA 4M61A 4OKVB 3PQYD 1DANT 2DIBA 1I8IA 4M1CC 4PJEE 3C60A 3VG0H 2NPLX 5CSZA 1G1YA 3EBAA 4CW1B 2P45B 3DV6A 4ZFFB 3FZUC 3BPCA 2HJFA 4M7KL 3W9EA 4R6UA 2QQLH 3GM8A 2Y1VA 2BP3A 2ZSVA 2VZTA 2LV4A 5EO1B 5L2JB 3MRRB 2Q3AA 4JDVA 1NC2A 4Y4KD 4GH7B 3UBXA 5GS3A 3IFNL 5EU4A 3AB0C 5E5MA 4JKMA 3A6OA 1U2HA 4TPRL 4PBVC 3U1SH 3ZHDA 4AEIL 3FQNA 1ZVSB 3UMTA 5D72H 4MXVF 4PTTA 2GITA 5CINL 4HWEH 1NCNA 1CLZL 2B1AL 5FA3A 5INCA 43C9B 3QIWC 3KYOA 2W59A 3SDYL 2NY2C 2BY0A 4ZSOB 1LD9B 1DLHB 4GRMB 4X6DB 1GSMA 3VMOA 3VMNA 3U2SB 4RQQB 4PY7B 4S1RH 2R0WL 4UT9L 3BKYH 2H41A 2ATPB 4G7YH 2BSSB 2AXGB 1YEHH 1FZMB 3BFOA 2BNQE 4TSBL 2AVGA 2P46B 2BJML 4TVPL 5EULV 3TIDA 4Z7VF 3OJDB 4YQXL 1I7RA 5DC9B 1YYMH 1XF4A 2ORBL 1L6XA 4XP4L 4L8SB 4Z7UB 2Q87A 5HVFB 4I0CC 1A4KA 3U36A 1MOEA 3TNMB 2WV3A 1I9RL 4EI6A 3PF2A 3O3AA 4MAYC 4G80B 5CSBA 4U3CA 1IGYA 4K8RC 4XXCA 3VFRA 4N68A 4X4ZA 1I1AC 1MAMH 2Y06L 2LAGB 4X5LA 3SQOH 4XT1C 4UV7H 4PY8J 2ZPKH 1HQ4B 3UTSB 2CK0H 3RVWC 4IHOA 2Z91A 3NN8B 5FHBL 5AG8A 4M5YH 1HXYA 2V5YA 3QXVA 3VDBA 2FGWL 1O7VA 3RU8H 4EZMA 5K9KB 5J9PA 3VFPA 2J88H 5JNYB 4RISL 3SE9L 3LV3A 4JFQA 5D70H 5GISL 1U42A 4L3ED 2IMNA 4NZUH 1JHLL 1YECL 4Y8AA 4KH2A 1A64A 3TN0B 5IFHH 1IBGL 2J8UF 2F5AL 4TUOA 4KY1H 2Y7QA 1M7XA 2ZCKH 4QRRB 5D7LB 3IKCB 3AM8A 5C07D 1FG2B 2IAMC 4YHZL 2QR0A 2ED9A 4OUOA 8FABA 1NDMA 1D5ZB 3RY4A 2ADGA 3EHBD 1A4JB 3D39B 1FSKC 2F54E 3O6MH 3NCJL 4PS4L 1ADQH 4LRNH 3C5ZA 3QDGA 2CDFB 4HS6B 3GHEL 2QQQA 2OL3B 4QWWC 3TO4A 4J4PD 3ZDYE 3N9GH 5HHMD 4WEBH 1EO8H 3IDUA 2XFXB 1E4XH 1JHTA 4MS8D 2CLVA 2FNBA 4DJMA 3E8UH 1PG7X 4JM4H 2RFXA 2ZG1A 5ALCH 4ZG1A 3BH8A 4I18B 3MJ6A 3U0TB 3CJJA 3H7LA 4KK6C 4O9HH 3JWDC 2V5SA 2VXTH 3UJIL 4WY7H 3O3BA 3DX8B 3GSUB 4XP6H 2WIIB 3QI9D 1T0NA 2VH5L 3D0VB 1J0ZA 3U46B 4E9LA 3RNKB 4NM4H 2Q8AL 4BQ6A 4R4FH 4P2RA 2VLKB 1A5FH 5BS0D 5C09D 2V9QA 4WO4C 2AXFA 1PQZB 2BHUA 3GRWL 3VG9C 1P4LB 3TO2A 1O7SA 3MLVH 3ARXA 1IC4H 1CICD 2VWEE 2Y6SC 2B2XH 4MSWA 3CSPA 4W81A 3QUYD 3HG1B 3PV7A 4Q9BA 5GZNC 3L1OH 4PJXE 5DFVC 1EH9A 1HIMH 1S7SB 4KWUA 1DFBL 1RHHB 5JOPE 1U93A 3ARGC 3TYFA 3WKML 4UMGA 1MY7A 1MHHA 3X3FL 2Q7NA 1EFXB 1WCQA 1JNNL 4PJCA 1MLBA 5CD3A 3ARFB 4DFHA 5JHLH 2BVUA 1U8QB 2BY1A 5HGGS 1UT9A 4U1GB 3EO1B 3OAUL 4EKXA 5D5ME 5I1HL 1GGUA 2YUZA 1NCDL 5CIPH 2BMKA 3GIZH 4I2XB 3RWDB 3RWFA 3O4LD 1N6QL 3MV8B 5D1QA 1NBQA 5JW5B 3CDYA 1FGVH 3T1FB 2CDEA 4RIRA 3BN3B 1G7QB 2NY4B 1NUFA 4QOKB 1BFVL 1KLFA 4PR5A 2MCG1 3C6LC 4NWTL 1ZT1A 3I3EA 4WVRA 3MJ8B 4LHQB 4CNIB 1MCBA 4IRJB 3BE1L 5T33L 4P4KD 1KTDB 1YEGL 1VADB 3UTZA 1HCVA 1UM6L 2E7MA 1IEAB 1AHWB 2OJZH 2XZAL 3CVHH 3QO0B 3RBSA 4ZPVB 5T3XL 1QR1A 1FNGA 1BLNB 4NFCA 4F2MB 5BZWA 1V05A 1I3UA 3T3PF 3WBDA 4A6YB 4ELKB 4U6VH 4GG6B 4YGVB 2D0FA 2FSEA 2F74A 4P46A 2N7BA 1QBBA 1JF1A 3QNXB 3AXLA 2PXYA 2CLZB 3GSNL 2ESVB 3HPJA 5HYSB 1KJ2B 4YO0A 2VITA 1IAIL 5ICXB 4NJAH 4BQCA 2G60H 3U9PL 1P84K 2XV6B 5FECA 1JGDB 4JHAH 2CKBH 5L0QC 3LN4A 1FORL 2APFA 4ZUVA 3I6LD 4HKXB 4OFPA 1XGPA 4X0KA 5FGCE 3P9MA 4GSDL 1CFNA 4P2OB 3PQYA 4ZFOA 3T2PA 3WFDH 2AJ3A 4MJ6A 1LDPH 1YMMD 3MR9B 3VFSA 1SM3H 3MJ7B 3T4AA 3O6KL 4HS8L 3ZL4H 1JNHA 1HSAA 2MQCA 4H20H 5I8EA 1IVLA 1A2YA 1FL3B 2B5IB 4POYA 4DAGH 1NCTA 1R3KA 2VRAA 2GFBA 3PL6B 5I9QB 3S4SG 1BD2A 3GI8H 4Y4KA 1JPTL 1UA6H 3FOLB 3EOBA 1RVFH 1BX2A 1TLKA 3FO0H 3MRGA 5E4EB 3EYQC 4K94H 4CU8A 3CVIL 1A14L 3VWKA 1EIBA 4ODTL 3MODL 1PVHA 2NY6C 5FOJA 4TN9A 4NP4L 1UC6A 3OB0H 3CFCL 4NQEB 5E95B 4F37F 1UEMA 2IH1B 2H3NB 2R2CA 3IU3B 5DWUH 3RWEB 4NBXB 4HHAB 3V6ZB 5C6WH 4HQQH 2Z93A 4EDWH 4HWUA 1QFWM 4RFOH 4PIRF 5DQ9B 3CMOL 3S7GA 1IQDB 4BELD 3MRMB 3U4BH 5BW7A 2VISB 4Q9CA 5DC0A 3MPCA 3CDGB 2PW1A 4KK5C 3QDGE 3E6FA 3MXWH 5FIEA 5IOPA 1H3UA 5E7BA 4MB3A 3H9ZA 4X6CA 4G6ML 1DBAL 3INUL 1EGJL 4KKCC 2OXGA 2DYPD 5MEND 3G6DL 3CUPB 2NZIA 4XNUL 3O6LL 5IMMA 5D1XC 1BIIB 2Y23A 1YEFH 2M2DA 2Q8BH 5DHXB 2H9GB 2KQNA 5F89A 3HB3C 3MLUL 1W8OA 3STLB 4HIXH 4NGHH 1CU4H 3FN9A 4P2RE 1UWEL 1LO5B 5I73C 1JYWA 1VA9A 5ADOH 1S9WA 4L3EA 3AAZA 5I1EH 3TCXA 1IC7L 2FYYB 1M1SA 5A2JH 2X7LB 3O11B 1Q9OA 3H42L 1MFAH 1Q72L 3ARBC 4POZD 5EIIA 4LFHG 4AEHH 2BVEA 1IL1A 4XVSH 2X9YA 1HOCB 4PJCE 2NXYD 5L88L 1R3IH 1C08A 4HCRA 1JYNA 5K59F 1P4IL 3LH2H 2DAVA 4PG2C 2VUYA 5SX5K 3IB4A 3WXVH 4BSVB 3BWAB 2PF6A 4ZD3L 4AIZB 1RK1A 1I8LC 4H5SB 4TSCH 4L4TD 4Y5YC 2ITDA 3BN9C 1KPRB 4WWKA 1CS6A 4PGZA 1J8KA 1H5BA 4JQIH 4TTDC 1T4KB 2ERJB 3F7VA 1J1OL 4UTBL 3QEGL 3VFMA 4J23A 3VGAC 3T0EB 5IMOB 2YPKB 3H0TB 3TM6A 1CK0L 4UT7L 3MRLB 3UBXI 5I1JH 5JW4Q 2FDBP 3IGAB 4DVRL 3GK8L 3QJFA 2EE6A 2WUBH 4CJ0A 1WGOA 1T21A 4D9QE 4RFEB 2BVPB 1RJLB 1MAKA 2N1KA 5LWYH 4V1DB 3CZFA 5EUKA 5BS0A 4LHJB 2F53D 4U3XA 3NACH 2VXUL 4KHXH 3WN5B 1DBBH 3BZEA 2PCPA 1TENA 4K94C 3RWGB 4RWHA 1ZGLP 5CJXA 3K8KA 3WFBL 4WFFD 5DJ6B 3HLAA 3SDXF 4DQOH 3RY6C 3HZYA 1SEBB 4H26B 2YK1H 3QPQD 4I3SH 2W07A 1OY3B 3GMRA 1INQA 3HC0B 2P5WD 2YA2A 5F8RC 2F58H 1RSFA 3RWCA 1OLZA 1BGXH 1MJ8L 2E9IA 1FLTX 2ZNWA 1WBXB 2HLAA 4BH8A 4HUKB 3T0BA 2P7TB 4KVCL 5FO8B 2NXZD 1A6WH 1MRDH 3QZWB 5H2BA 3O4LA 1KT2B 1GC1L 1Y6NR 1R24A 3DVNB 3RL1A 3PQYE 5DS8B 3SDCA 3TVMD 3O2VL 5C0GA 1J1XL 3NAAL 3DSFL 1BEYL 1FZKB 2EE9A 4BFBD 3BOVA 3DGCR 3CSGA 5IG7A 2C3VA 1KSRA 4M1CD 1IEBA 4RGMC 1SMAA 2PTTB 4MJ2A 4BKLA 2X70B 5D7KD 3V4UH 1U8LB 2AEQH 3FZUD 4LCCB 1KNOA 4P4KA 1AFVH 1TDQA 1TJHH 3TH2T 4O2EA 1YN6B 1IM3A 1BD2E 2YC1B 1N2RB 3MRBA 1QLEL 2HWZH 4P23D 4X98A 3KPMA 5BV7L 4AEEA 1ZV5A 1JFQL 3NZ8A 1A6AB 4Q6IA 4U7SA 5TF0A 5JQHC 4OUUA 2HJLA 2EEDA 3ZDZF 4U05A 2DM4A 4L5FH 3M17A 4I0KA 4Z0XB 2J2ZA 1HEZB 3H3PH 5JQ6H 4HEME 2WBJB 2P44B 4P9MH 1QYGL 4RGNB 5INDB 1TJGH 1J0KA 3FT3B 4L8CA 5DTFB 1UKTA 2ADFH 2VDOL 5KW9H 4NWUH 4KKLC 4EI5B 1C5BH 2YRPA 5DK3A 3NPZB 4FZEH 1Q9KA 3I2CL 1PG7W 1VEOA 2CLRA 3QAZC 5F9AC 4ERSH 1E27B 2FIKB 4U1JA 2CRMA 4OLYL 4X6CE 1ZANH 1UWGL 2OP4L 3LB6C 4ZQKB 3KLAA 5E8PA 4JAMA 2E27H 4RAHA 4KFZC 1AY1L 1YMMA 4LLWB 4XMLL 4M02A 4YHOL 1RAMA 4ZOAA 1UVQB 3BISA 4GG8A 1SBBA 5HDQH 4X9BA 4DZBB 4NZTH 4HBQA 3VCLA 3O9WA 3ULVL 1RUAL 3DBXB 4K8RD 4ZO6A 1CL7I 3O0RL 1QP1A 2CUMA 3GMOA 4TRPH 3RA7H 1R5VA 4IIQC 2RCSL 3GUTA 1A6VH 5DFWH 5DRWA 4L3EE 3KPSB 2XICA 4ZAKD 5IB5B 5IJKA 4DW2L 4YDLB 4U1IB 1K8DA 2D7TH 12E8H 3NBNA 4G43B 1N64L 1T0MA 5F3HB 4KZDL 5GGUB 5IEHB 2PYEB 1EMTL 3TBYB 3HS0A 2X4NB 1OLLA 3GJFA 1NGXA 3QDAA 4D3CL 3VGFA 1MHEB 4F7TB 4LVNC 3ZSTA 3O3EB 5F1IA 3G5ZB 1HI6B 4YPJA 3OMZA 5DD3H 5FUOH 1XR9A 3GSNB 1TPXB 1E6OL 1UACL 1RULH 2FX9L 3MYZA 1HHKB 1KN4L 1T20A 3OX8B 4PGEA 3DI3B 3WIHL 1AI1L 2C4FT 1E28B 3OWEA 3JVGA 4QXGL 2X4TB 1KN2L 3DJ9A 2NTFA 2VLRA 3TZVB 5J3HC 1K4DB 4JFOA 4NO3B 5HI4C 4QWWD 1KB5B 2I9TB 3KXFD 4XRCB 5JORB 2KZ1B 4Z7VA 4LVEA 5FYKU 3EOAB 3OKLA 4HH9B 2CDGB 3RWHA 1MREL 2KDGA 3MLZH 1I1FB 2BRRL 5E6ZA 3MCKB 1P1ZA 3RIAK 4XVJH 5CBEA 4OQTH 3WHE0 3QRGL 1L0XA 3MRIA 4GRWH 4I4WA 5C09E 5BS0E 4AZ8A 3GMNA 4XC1L 1ED3A 1RZFL 5CD5C 1BQHA 5TE7H 4OD2B 4YXKL 4HZLB 5F7FA 4WO4D 3QDMB 2HLFC 4HKJB 4LK4A 3ULUL 4U2YA 1BBJA 3OR7A 1N4XL 5F9WB 4Z8FL 5F7WC 1JGUL 4KKAD 1KEGH 4YBLB 2MNUA 3BVNA 5A16B 3G04A 4Y4FB 5GZND 2GTWA 1LE9B 2L7UA 4YIQB 3OG4B 1NAML 5DFVD 5C6TH 5I8KL 1ZGLB 4XP9L 1Z2KA 4Z6AT 2DQIL 2IPTL 2XT1B 3LN9A 2VR9A 4HKZA 3UJJL 2EXYD 2JIXD 2R4SH 4XMKL 4GKSB 4L4TA 1MRFL 3O4LE 1XGTB 1BM3H 1JTOA 1EAPB 1INEL 3SDAB 2GJZA 4M3KB 4G7VH 3RVVC 1T5WB 4ZNCD 5JOFA 3MV7B 4W6WB 1TQCC 3RTQC 5CZKA 4NSKA 5EU6B 2C5DC 2SEBA 1KGCE 4JM2B 4E41D 1GGIL 3CXDH 4JN1L 3BMVA 2XQYK 5BZDA 4BFEA 4ZYKA 3RGVC 4NO2B 5IHLB 1FNSH 3KPOB 3C6LD 1KBGH 5L7XL 4H8WC 1DE4A 3VGDA 3LKRA 4C58B 3VRJB 3QT2A 2BSTB 3NZHH 5DR5H 3OL2A 3H9SD 5I18H 5LVEA 3GHBH 3S5LB 4MA7L 1CIUA 4U31A 2EC9T 2X4OB 1CD1A 4ZUUA 2F5BL 1QLRA 1EEZA 3KPRB 5IBTL 4IS6A 4XGZA 2DLFH 1TZIB 4FQHA 5DJAB 5CZXC 1N7ML 1JVKA 5IQ7L 3REWB 4RMQA 3AREB 5ECJE 1OM3L 1MRCL 4IOIB 3MRPB 4M6OH 2OZ4L 5EO9A 2VDML 4G42A 5IW1B 2J1KA 4QO1A 2LVCA 2ZCHL 5D2LB 5IHUH 3I9GH 2D7MA 3U30B 3TC9A 5SX5H 4OZFA 4IRZL 2Z0BA 5IKCB 3CGTA 5HI5C 1I1YA 3I6LE 2ARJB 2UWEB 4JQVC 3RKDD 1UZ6F 3QXDA 1JI1A 4JZJC 3VXUD 2QEJA 3SJVB 4EUPH 3QUXD 2EYTB 3TVMA 4Z0BL 1FN4A 1YMME 5E2WH 3FRUB 3OAYK 1VGEL 4KDWA 5D7IB 5C8JA 4ZODA 5ERWB 5E6ID 2ZJSH 5IB4A 3DIFB 1T3FB 4JREB 5GRUH 4RWYL 1OCWH 4M7ZC 3ZHLA 1BJ8A 3LKNA 1LILA 4WGWB 1CE1H 2JJSC 4FQCL 3CCHB 4EN3B 4G9FB 4C56B 3MACL 4XNQB 2D4DA 1FFPA 4HPOH 1C1EL 4X80H 5I76A 5DVNA 5IW6A 4P23A 2N4IA 4PRPD 25C8L 5I1DA 4LAQH 2O26U 4YDJA 2G75B 4LLUA 1F3DJ 5EPMA 2PNDA 5GRVL 1JGLL 2Z31C 4JO4L 3PABB 3EYQD 3LS4H 3TBTB 1Z0NA 4MJIA 3SGKA 1DQML 3TBWA 1SBSL 3DYMA 3HKFA 3HAEB 5D7JA 5ENWA 4HUXB 1MNUL 4NQVA 4UU9A 3WXWH 2GKIA 5AD0A 1JTPA 5HHXH 4X6FB 4E5XB 1MVUB 3O2WL 4H25B 4L1DA 1KJMA 4MXVE 4WI8A 4XCFL 3JTTB 3V5DB 1AXIB 5E8NA 4JPKL 2BOCB 4H1LB 4U1KA 1N8ZA 4XVTH 4XBGB 2VLRE 1DQQB 1YDPB 5FB8A 5A40E 4KK5D 5AUMB 1AH1A 1OQOA 5MENE 4F9LA 2IF7A 1QQDB 2R56L 4XNXL 3FT2B 2BHYA 2YZ1A 3EO0B 1U3YA 1KJ3L 3HNVH 4HT1L 2YXMA 3P30H 4KKCD 1W72H 5DD1L 3HCVA 4OIBA 5GGTL 4BYHA 4LCYA 4Z7VE 4NPYA 5H94B 4BUHA 2X42A 4Q0XL 4IRSA 1D5MA 4MNQD 5CP7A 3JSSA 5D1XD 2B0SL 3QXAA 5IB3A 1CYGA 4GXVL 2EXWD 5AAMA 4L3CA 1T1YB 3KYNA 2A6IB 1JN6A 3VMPA 5TDNB 2EDXA 2X4UA 3HB3D 3KNBB 3X13A 1QRNA 5CGTA 4J3SA 5E94B 1HZHL 4ZAKA 4X6EA 1AO7D 1IGCL 3FB8A 5BV7B 4ELMF 5JUEH 1RK0B 2VXQH 4HXBL 2HT3C 3DRQB 1A7NH 2R0LH 3EO9L 4FFVC 3ZE2F 1CXFA 4P3CH 2OMBA 2NY5H 4WNQA 4G5ZL 3EDFA 4Z95L 2XRAL 3NFSH 1U92A 1EXUB 4FQIL 3QNYB 1KG0A 4M9PA 1RIVH 2DIJA 5DEFB 1HSBA 3L3GA 5DJCB 4R7DA 1MFCH 3ARYA 3GM0A 3UAJD 1AE6L 3TNNA 4CMHC 1BZ7B 2NMSA 3TT3L 5CJQH 4L4TE 3VWJC 2EH8H 4JB9H 3BXNB 4R4NC 5T3ZH 5TDPA 1P5VA 1ZWIB 3O4OB 3K8LA 4ZTOL 5DZOA 2MJWA 5FO9B 5LJYH 4YUEL 3KXFA 3SGDI 1QO3B 3DMMD 3R1GL 3VJ6B 3BN9D 1QEWA 4QRTB 4G6FB 1NGQL 5TPWH 4FTVD 4QY8B 3LPGA 4OM1L 4TTDD 4HIHA 3MBED 4O4YH 2QADD 3PWVA 1I9EA 1S7TA 3IDXL 3MRJB 4PYGA 1XGUB 1ZLSL 4NYLA 4ONGH 1T1XA 5IB2B 1LEIA 3SGJA 3W39B 3IXTA 3QCTL 1UH2A 1NFIA 4EOWL 1BWWA 1CVRA 1UJ3B 5DMKB 2OI9C 2OSLA 4PFEA 4NN7C 1BF8A 2DLHA 3EGSA 5TE4H 4WFFE 4DZ8B 3PE9A 4OLXH 4AL8H 3L95B 1ZVHA 1PZUB 1DUYB 4LFHD 3UX9B 4K7PL 1M05B 3BP7B 3PGDA 1FVDB 1FO0H 2IADB 4NQTA 4AMKL 4BFGA 5J0BA 4XC3L 5C0CB 2F8VA 2P5WE 4I13B 4LEXL 4LSPL 2BXZA 3QQ9D 5DVOA 5TF1L 1VFBA 2H8PA 4CN6A 1B3JA 4PRHD 4RNRA 1TVHA 3I6KB 5BQ7B 2JIXA 4XBPA 3HUJB 2IG2L 1QBAA 4LVOC 3T2OA 5T1LD 4ODXB 3VH8A 2FJHB 2I07A 4MGXA 1L7TH 3UTPD 3WIIH 4ZXBC 4ZFGL 4JZOA 3D85A 3VXNA 1V3KA 4OIIH 2C3XA 3CFDA 3ME0A 5E1AB 4NUJB 2DBJA 3C8KB 1R5IB 3C08H 1CFSB 4PJAB 1HHJB 5DZLA 1WVZA 4LNVA 5DUBB 3VDAA 5IB1B 1MAJA 4X4YB 3VXMB 2WQ8A 4XCEA 4QTHB 3QIWB 4QHMA 1U91A 2NY2B 3U7AA 4AQ1B 4L29B 4NKDA 5D7KE 3ARPA 4K2UH 3RZWA 2RIKA 3C6LA 2NZ9C 2DTML 4GRWF 3OJ2C 2APTA 3IAGC 5K93A 4GAJL 1NUGA 4ALAH 1UB6B 5D6CA 1CL7L 4B41A 5IFJB 1CE6A 1NGZA 4MNHA 3BRDA 3DO7B 1NCCH 4N0CC 5F72S 3BSZH 4WUKL 4TUJA 1Q9LB 2C9AA 1HQRB 2P47B 1MJJB 4JGUA 5GRJL 5I0DA 4K3DL 4KJYA 5EBLA 1HCFX 3WDHA 2PW2B 4MAYB 4MJIE 4FNLL 3D5OF 3D87B 3Q3GB 2YKLL 4W4OA 2RGSA 2MMXA 3F5WB 4UUJA 1I1AB 4NZRL 4PLJC 4ZFZA 5GRZA 4HG4J 1GZQB 1UENA 4RZCA 2N7AA 1F58H 1XF3B 4JVUA 5D71H 5EDXA 1TJIH 1MIEH 2CSPA 5GS1C 4KKLD 5HYJD 2XZCL 5JW4R 3PNWB 1F6AB 3OSKA 1XF5B 5C0AA 3KPLA 3QUXA 5GGRB 4C4KT 3MA7A 1G9MC 1V7NL 1DUZA 1FIGL 3B2UC 5LCVL 1HKFA 5SWZB 5E6IA 4GAYB 4M7JL 3LB6D 2H6PB 4UI2A 2IAMB 4EDXB 4FABH 4GMSH 1NBVH 4ONHA 1YEDA 2DQEH 4PJIF 5K9JH 4BA8A 1ACYL 4XNMA 2K7PA 4QHLA 1FSKB 1UFUA 3BKJL 1BVLA 4FQ1L 5C0DA 1QR4A 2PTVA 3QEQD 2R8SH 4Y16C 4OD3L 5FYJL 1D9KA 2JB6B 1AR1C 5E8DL 2DI8A 2HTLC 4R9HA 5FYKE 4UTAH 3DROB 4KJWC 3IRZA 5LQBL 4Y5VC 3LOWA 5D6DA 3PGFL 3GO1L 3IKKA 2VXSH 3ESUF 3NFNA 3WS6C 3K46A 4OLWH 4JQXA 3GB7A 4GW5B 4HZAA 4AH2A 3DXAB 1BAFH 4JY4B 1VFMA 2F54B 4YXHL 4HPYL 3OGCB 3FOMB 1IGJB 1AGBB 1T7VA 1BREA 3L3HA 3P40A 4CDGC 2VC2L 3K4AA 3NA9L 4OZ4B 4F57H 3EZJB 4LGPB 4ZFOL 5IGXH 5ISZB 2AJUH 4AK1A 2CUIA 3B9DA 5J6GA 2BX5A 2VZOA 1T1ZA 3VG9B 1D5XA 4LPXA 5JPMB 3UTTB 1MCOL 2I24N 5DD6A 3KXFE 3OAYH 5CIPA 4WDIA 4MA8L 4BQ8A 1B4JH 4YHMH 5CCKL 3QG7L 1FZOA 1DR9A 5F7DB 1KTLA 3BPLC 3ARGB 3A6BL 3P2TA 3MUGB 1QNZH 4HJJL 5DUPH 5FGBA 1CT8A 2BCKB 1Y18A 3DTXB 5EZOL 3X14A 1JGVH 2ZUQC 5KSAB 3V79C 1CGVA 3F7QA 4DGVL 4L4VD 3B9AA 1AQKH 2DICA 1XCQB 1AO7A 5H35B 2XQYG 5T5FL 2VDLL 1IT9L 2ZOKA 1TTFA 1CLOH 1B0WA 2DRUA 1SHMA 4M3JA 2IPKA 3L3IA 3CVHA 2ZKHL 2WWKO 4FQXA 4BZYA 3VXSB 5JZ7C 1LO4L 1MCNA 5BRZD 1OW0A 5IF0A 5IMLB 1ZK9A 1EVUA 2PKDA 1KIPB 5BMFL 5J1SC 3LKQB 3ZE0F 1IAKB 3IETA 1RV6X 1OARL 3V52H 3EYVA 4MNGA 2JELL 3U4EA 4NRZB 2VDQH 4M61B 5EU5A 1SJEA 3DECA 3QHZL 1EHAA 1I8IB 2LE9A 3C60B 5EZJA 2EICA 4NC1C 3N85H 3RDTD 5ITFB 4M9OA 5ACLA 1AD0B 5K59E 5MEOA 4M03A 3DV6B 2CKBA 5C3TA 3DMMA 2QQNL 3X3GL 4JFFA 3I50L 3TCLB 2QTEA 4GQ9L 4LLMB 3MBEA 3DGGA 2NY1B 2WINA 4ODHL 3THML 1NC2B 1U8NB 2DMCA 3UBXB 2A9ML 4YDKL 3AS0A 2V17L 1A3RL 5J89A 3HR5A 3D3VD 1DP0A 1NDGA 5C6PB 4UNUA 2Q6WA 1NCWH 2A73A 2VDNH 3RGVD 2QSQA 3GSQB 3B43A 4KROC 4UOJA 2HTKD 5D7SL 3R4DA 4PTTB 3BQUD 2VDKL 4NRYB 1FNFA 2ZUSA 4HIEA 2YBRA 3KLHC 3DURA 2P43B 1A6ZB 4O5LL 5FK9B 1RHFA 3K1KC 4HCRL 1P7HL 1KCKA 2ED7A 1IJ9A 5LAXA 5CZXD 1F4YH 1KEML 2LFGA 4MVBC 1JMZA 5IWLA 3SO5A 5IHZB 4NCDA 3MLSH 3WLWC 4PRHA 3TIDB 1U3JA 2R1XA 1S8DA 5FGCB 2VN4A 3D48R 5F7YC 1FNLA 3DRTA 2FO1A 3HZKA 1YUHB 2Q1EA 3VFTA 1FGNL 1LQSR 3V5KA 4EI6B 3IDNA 1S7UA 1S9YB 4IJ3B 5HHVL 1QSEB 5CKAA 4HS3A 3KVQA 4BSWA 5HI5D 2XN9A 3W0WB 5IHBA 1L7IL 3MCLL 4PJ7B 5HGBA 3RPIA 2NY6B 2YSSA 4PJBF 3FFCD 1NBZA 3B9EA 2O61A 1HXYB 2FB4H 5DDHA 4DGIH 3Q2CA 3FB7A 3VW3L 3LV3B 3F7YA 4XVUC 1HH6A 5CMAB 3ESVF 1CVSC 4PRPE 4MJ4A 2V7HA 4OBSA 3GSOA 2YN3A 4PGDA 3WO4C 1IC5L 2BXYA 3CX5J 3D2UB 5TH2B 9CGTA 3KHOA 4JFZH 1DVFA 1S9VA 3U7WH 2OQJB 1QOKA 1T7XA 3GKWH 2MCPL 3QUML 3WNKA 4P2QD 3QCUH 3ZTJH 3RY5A 5F1SA 2Z31D 1RZ7H 1YC7A 1DEEA 2PO6C 2VDRL 3T77A 2VR4A 5I66A 1AJ7H 3ZDZE 2OTUA 5F71A 3WKNA 3TV3H 1TVBA 1CD0A 2FWOA 4XCCL 5DT1H 4WWID 5LGJB 4JY5H 5IJVA 2AJZA 3R0MA 5ACZA 2NY0D 1BP3B 4AQOA 3BP6A 3T3MF 4KKNA 1JNLH 1B0RA 3HC4L 4YZFF 5HYJA 5I17B 1JHTB 4PJ8D 1X5FA 2CLVB 3ARDC 5I73B 4OJFH 4IDJL 1AGEB 4CADA 2HG5A 2RR3A 4F7EA 1UM4H 2CIKA 2CMRH 1B2WH 4KTEL 4OF0A 4QHKI 1A1MA 3ARBB 4HX1A 2WBKA 3WIFA 1MCRA 4U1LB 3RIAF 2BK8A 1T0NB 3MRDA 5E99H 1B90A 1T04A 4P2RB 1S7VA 1RUKH 1S9XB 2B4CH 2AXFB 5FUCC 1QUNA 4DN4H 4NOBA 3DX9A 4R4BA 3QULB 4NT6A 4LASH 3QEQA 2V5TA 3BKCL 4Y2DC 3VE0A 5FGSA 2B1HH 1FFNA 1AO7E 4ZS7H 1MF2H 1FJ1A 3C5SA 1CD8A 4GW1B 4KRMB 1Q94A 3BUTA 1KXVC 3TYGL 5B3JF 2OM5A 1KCRL 2FECI 1U93B 3ZKQD 1S3KL 3WFCH 1MHHB 3FFDA 3HNSL 4OT1L 1MLBB 3VFVA 5CD3B 3MSPA 2HYMA 2C7UA 5D93B 4M43H 1KELL 1S78C 5IBLD 1YN7B 1U8OA 5AZEL 3D69A 3WYRA 3ZTJG 3QB7C 5D1QB 2YR3A 4JKLA 1YEKL 3TBSA 3L3KB 4LPTA 2KUTA 5FV2A 1H3WM 4G8FB 4Q9RL 1IE5A 4R4ND 4GMTH 2R4RL 2NW2A 2JCCF 2XA8L 1ZT1B 4JFFE 1RUMH 4I0PA 1OAZH 3DV4B 4MXQC 2OK0H 3ALPA 1JUFA 3CU1A 1GL4B 5EU3A 3SPVA 4ODVH 1YEIH 3UTZB 2VAAA 3LEYL 1R3JB 1GHFL 4D94A 3NVQA 3OKMA 1RUQL 2VLJB 4RMUA 2QLVB 1W0YT 4CRPA 5BZWB 5EOQL 1QSFD 4L4VA 2UY7A 2R29H 3BGFB 5DMGC 2F74B 4P46B 5C86A 3AXLB 5CUSH 2G5RA 2LU3A 4KPHH 5BRZA 4HJ0D 2L0DA 2E7LC 5E8OB 2AEWA 2UUDK 5HHOD 4ELMA 1ODAA 5KVFH 5FECB 3Q5YA 3LN4B 3DHJA 4PRHE 2W9EH 4MB5A 5IIEA 2GT9B 2P8PA 4X0KB 4O02H 5GGSB 2W0FA 1CFNB 4ZFOB 1CXHA 3FB6A 2YA0A 3UDWC 1GPOH 4MJ6B 4YAQB 1TETH 3RDTA 3UTPE 5KN5A 3VFSB 3AU1A 1OD7A 4F7CA 4NRXA 1CR9H 3T4AB 2XN9E 1JNHB 2E7CA 4YFEA 3WEXB 2IQ9L 2HRPL 1A2YB 3WO3B 1XGYH 1QLFA 3MGAA 2OYPA 4DN3L 4XPBL 3MXVL 5FM4A 4X7TB 5I6XB 4X99A 1R3KB 4MXWL 3P4MA 1S7RA 4C4KO 1HXMA 1BD2B 3DUHA 1DN0A 4KI5C 1Q8MA 4XPTH 5IV2A 2JJWA 4NFBA 3EOBB 4PJ9C 2JJTA 1BX2B 1UH4A 3MRGB 5JDSA 1LNUA 4LEOB 1VB9A 1G9EA 5DJ2B 4FFYH 1UQSB 4GQPH 3FT4A 1T0PB 3OR6A 5C0BB 3VWKB 2BVOA 2NZ9D 4G9DA 3QAZB 4FHBD 1KIRA 1F6FB 2VTFA 3BQUA 5GHWL 5I1GH 1T2JA 3PWJB 4KJPD 4KMTL 1WBZA 1TCMA 3GMMA 1VPOL 5F6HI 4P57A 1CD9B 4BQ9A 4N0CD 5CLTA 5ID0B 1PZ5B 2V7NA 2HFGL 2KKQA 4YXLL 3FL7A 4MCZA 1RZIA 2V6HA 3ILQD 1JL8A 2PW1B 1KENL 1H8SA 5IOPB 2Z9TA 5CWSA 1KLGA 1CFVL 1OF2A 4KK8C 4LL9A 3EUUA 4X6CB 5GIRB 5EOCL 3V7AG 2PYFA 2V2XA 4PLJD 4PRAA 15C8L 5HYJE 3C9NA 3GKZA 1IGTB 4MQ7A 4PJ5A 1KIUA 3SDDC 3B2VH 3NGBC 5JXAL 5BO1L 5F7EH 3ZMRA 5F89B 3FFCA 4DOHB 3T2QA 4R97C 3A6CH 2R2BA 5T3ZD 1HKLH 1UZ6E 2VE6A 1E6JH 3B2UD 3FO9B 3P73B 2OCFD 3QCVH 1DQDL 3NCCB 3QO1B 4R7NA 1EDQA 1BQLL 4M93C 5D8JH 3DARA 4PV9B 1ACZA 2IBZY 3AAZB 3OF6D 3U0PA 3QEQE 1IGFL 3G6JB 5EC1A 4FQLL 5GSRA 4L8BB 3HI6L 3VXOA 1I3RA 3QPXH 4PBXA 2YS4A 2G5BB 4XMPL 3L7EA 3RI5K 2P24A 2D7NA 5EIIB 3QEHB 5I15L 1VGKB 3TT1H 1PKQB 1E4WH 4ZTPL 3X11A 4Q74A 3TFKD 1AR1D 4D9RD 4P2QA 4MD0A 1FAIH 4XPAH 4NNPL 3O3DA 4D9LL 4IMLA 1R0AL 3RZCC 2Z31A 4UNVA 4OGYL 3KYKL 5E9DD 2P5EA 1R5WA 4MCYB 3EYSH 3FN0L 3MX0A 4JO1L 1NBYA 2C1PA 2EDDA 2KPNA 2YMXH 3CLFL 5DVLA 1VSCA 5F6IC 5FKAA 3BZ4A 2I5YL 3O3UN 4WWKB 3KR3L 1H5BB 5KOVC 4PJ8A 3BD5A 4GO6B 4LAJH 3SE8L 5I30H 3IF1B 2A9NL 1FCGA 1OAUH 3VU2A 5I19H 3F7VB 2OL3H 3VFMB 1I8MA 1JGEA 3AMKA 4ZUWB 5FYLL 2BDNH 4HMDA 2YRLA 3W9DA 1MHPL 5JHDD 4S1DC 3QIBD 4ETYA 2XIDA 1T2QL 1OT1A 5DRXB 1GGBL 1F11B 4D0BA 3CZFB 3SCMC 5EUKB 2PR4H 4R26L 2IC2A 5K33A 5EN2B 3QR2A 3BD3A 3BZEB 1UXSB 4L4VE 3Q6FA 4Y4HA 4NQXA 3WJJA 5CZVL 1DCLA 3LS5H 4QRPD 4PJIA 2OMNA 1WZKA 4JRYB 1REIA 2IJ0C 3HZYB 4PG9A 5DD0H 3EOYG 4U6YA 2BY3A 4NCC2 4WEUD 4CVUA 1INQB 2VKXA 1OPGH 3QUMB 3S34L 5BRZE 3BIAX 1P7QB 3GBML 5HYQB 4J8RA 3RTQB 1JPSH 5JDJA 4ELME 2WQRA 5F9OH 2HAZA 1YYLH 3REVA 1QKZH 2HLAB 1G7PA 4BH8B 4OCRL 2OJEA 2VKWA 1CGSL 3ZTNH 3HE6D 1ZT7A 2AS5M 1I1CA 3S35H 3MUJA 1R24B 1DBJL 5E2VL 1RZJH 3SDCB 2FLRT 2X4RA 4DKDC 5HPMB 5DUMH 4F7PB 1UJTA 5IQ9A 4KAQH 5CLWA 3NFPA 2C3VB 2NR6D 4OZGF 4L8SC 5SV3A 2GK2A 3OBAA 1RFDL 4BKLB 2ED8A 1LP9B 5DQDL 4KI5F 4EUPA 3M8OL 3MLRL 2A6DA 1IM3B 5CJ5A 4M6NH 4LSVH 5I1LB 5ACMA 5FYKL 4LSRL 5DLMH 1A3QA 1X5XA 1SEQH 1A7PL 1JRHI 1EJOL 5EO0A 4OUUB 2HJLB 1LVEA 1BECA 4I77H 1EPFA 1FL5B 1SQ2N 4WW2B 3JV0A 4HKBA 2D31B 4YHLH 4YHIB 5JO5B 4JZNA 4JZJB 4EXKA 3UYPA 4R3SB 3PXJA 2IALB 4M4PA 2FATL 4Y19D 2X1XR 4A6YH 3K74B 4NKIH 3TN0C 1NANH 1QFUL 3HRPA 4L8CB 2ITCA 3KLHD 1NGWA 1OTTC 1ZTXL 3MLWH 4LOUD 1BQSA 3EYFB 4JPWL 4YX2H 4U7KA 2W0LA 3FHAA 5ALBH 5GGVH 2XWTA 1KJ2H 4X7SH 3CLEL 3KDMA 1QHPA 2RB8A 3CSYB 1LEGB 1KFAL 1RMFH 1EO5A 3LRSB 4JAMB 5AG9A 3UJTL 4BZ2L 3RUGF 1NMBH 5DRNA 2R69L 3MV9D 2JK5A 4PJ5E 5CBAA 1ES0A 2A38A 4HSQA 3HI5L 4GG8B 4N8VB 1GGTA 3O8XD 3G5VB 2C3HA 3VCLB 3O9WB 3FFCE 4J7RA 1CGTA 1X9QA 3VXRD 3NIGF 1HINH 2DWDB 5KSBF 2DJSA 4OZHB 4PUBH 1R5VB 1W72A 4I18C 3B8SA 2A6JB 5GJTH 2CGRH 4M48H 1X4XA 3S88L 5GRXG 2QQKH 5DRWB 1A9EA 4XWGH 4AY0A 3T2NH 1JK8A 2FJFB 3AC0A 1K8DB 2RBLA 3P77A 1JZ7A 1JI2A 1W0VB 1ZKAA 4ZPTA 4U1MA 2W65A 3UPRB 3GJFB 1NGXB 4GRWE 3LAFA 3B9KD 1QPXA 3L3JA 3AMLA 3MQIA 5D72L 3QDJD 4P2QE 3RP1A 3BRGC 1YQVL 1XR9B 4JJ5A 5CILH 3T0AA 1ZA3A 1KCSL 4N0RA 2P5EE 2UUDH 1A6TB 1T20B 4J3UA 3L5JA 3PDDA 4PGEB 4J3TA 4S1RL 4R96B 3MA9H 4U1NA 4G7YL 4X8JA 5GS2H 3IDMA 1YEHL 5C92A 2ZUUA 5CEYB 2VLRB 4XP5H 3I6GB 3LCYA 2HMIC 2H2PC 1P2CA 3O41B 4CU7A 3FMGH 5EBGA 1G7LA 3KPNA 3Q1SL 4U1GC 1W0WB 5HYSG 4JHWL 3DSNA 4PRNA 2VLLA 3OKLB 2YZ8A 1MI5D 3ARDD 4P5TD 3RWHB 2NYYC 4MX7A 1JNJA 5HGAA 3U79A 3T04D 1MAML 1CGUA 1PY9A 4PTUB 3SQOL 4UV7L 4KK9D 1F45A 2ZPKL 3Q0HA 3FO1A 1J1PH 4HV8A 1OD9A 3GMNB 5CEXB 2R2EA 2EYRB 1RUPH 4PJBA 1BQHB 3OF6A 4MD5A 2BNUB 5EORL 1A3LL 1K8IA 3U83A 4LNRB 2AK4D 3PHSA 4NZUL 4PJIE 3GIVA 1MLCA 3VWJB 3IFNH 2FO4B 4N0YH 2ZCKL 2DLEA 3G5YA 2ZUTA 43CAA 3SE4A 3BVNB 4UIMA 3G04B 1I1RA 4TPRH 1ZHKA 5T1MA 5E9DA 1Q0XH 4AEIH 2OBGA 5ADPL 4R90L 1FC1A 4X6DF 3LEVL 4DCQA 3S37H 1CLZH 2B1AH 5FOBB 1F42A 3HE7C 4HKZB 4HWZA 4NHCH 3KPQA 4KXZI 1FO0A 1S78D 4NO5B 4LRNL 2R0WH 1EUUA 1I3VA 4TSBH 4MAUL 3OPZL 4Z7UF 1IAIM 3QA3A 2OI9B 4KDVA 1TQBB 1E4XL 2CO6B 4YQXH 4NSKB 4NM8H 4Q2ZB 2H26A 2ORBH 4XP4H 4JM4L 5HJ3A 3JZ7A 1DBKH 4P2OC 3BIKA 5JHDA 3QIBA 4JO2H 4HFWA 4ZYKB 4PJFA 2R1YA 3MV01 4PREA 4O9HL 1DE4B 2DQGH 4PJGB 4XH2B 4HUWA 4WY7L 5I8CB 1UM5H 2Y06H 1VEPA 4YHYB 4N8CH 3RL2A 4NM4L 1PEWA 5HVHC 4R4FL 1A5FL 1QSFE 3TA3C 1CD1B 4HEPG 1EEZB 1IC4L 2FGWH 5I9QC 4QRPA 4KDTC 4LVOB 3QIUA 4RISH 5GISH 4ZXBB 4N90E 5ICYB 5E4EC 5DMGD 3L1OL 1YECH 1CIDA 1A6UL 3JV4A 5EO9B 1IBGH 1J0IA 1IFHH 2F5AH 4PB0H 5HHOE 4GLRH 1M7IB 2ZP0T 2P8LA 3C6SB 3PV6A 4R2GD 4OZFB 1I1YB 3P0YH 1NMAL 3HE6A 1WSST 2EIEA 4GBXA 5FHAH 3MLXL 1FL6B 4QXTA 1AKJD 5F8QC 4GXUN 4YBQC 2E9BA 3NCJH 1WFOA 1T7YA 1A8JH 2UY6A 3ZE0E 1FAKT 5IB4B 1FGVL 3B5GA 3GHEH 2WANA 2XTJD 2ZUXA 5SWSA 2BZDA 1IM9B 4L9LC 4XTRC 4B5EA 3IFPA 4APQC 4P5KA 4OZIA 5D1ZC 5L2KD 5EH1A 3ZKMD 3BW9A 2W38A 3FQXA 3PG2A 3MJ9H 5IW6B 1F3RB 3MOQA 5JMRA 1OB1B 5E0QA 5SX4I 2JCCA 4EBQH 4JHBA 4NOFA 3DO3A 4YDJB 3UJIH 4KRPB 1GGCL 4KI5D 1CLYH 1S7WB 4PJ9D 4RFNB 1KJVB 2Q8AH 5B3NA 3UZEA 3MRFA 4RAVA 4MJIB 3TBVB 3T8XB 3O81A 2CKNA 4U6VL 3V6OA 5D7JB 2ICEA 2J3SA 4NQVB 5AD0B 1YPZA 2HFFA 2DS4A 2VIRA 4JFDB 2EC8A 1LWRA 5I8OH 4NJAL 5TQ0L 2G60L 3WKMH 4O51A 3X3FH 1JNNH 2CKBL 4KK8D 4Y16B 4HMCA 3MV9A 3OAUH 5I1HH 3CFJA 3QEUA 1YNKH 1CXIA 1NCDH 4NPYB 1ZLUK 3QFJD 3O8XA 4P2CG 3UTQB 4Y5VB 1N6QH 4IRSB 2FCBA 4PGCB 2XG5A 3Q5OA 1JJUA 4H20L 2VYRE 2DLGA 3QXAB 3V2AR 1HH9B 3GMLB 4U6HA 3N1QC 2EDOA 2NY3B 1JN6B 2VSDA 4KI1A 3J7HA 1QRNB 4PJBE 2D9QB 3T65B 2FZ3B 1U8KB 4NWTH 1KTKE 4WV1A 3GI8L 4X6EB 2AV7A 2FL5A 1UA6L 1X4ZA 1DDHB 2GSIA 4JGMA 3BE1H 5T33H 4NN6B 1YEGH 2Y25A 1ND0A 1ORQB 1VCAA 1P4BL 1UM6H 3LRGA 2XZAH 4Y5XC 5MHSD 4WEMB 3FONB 4KTYA 3B9KA 1I9JL 4GG6F 4PLKC 3MRQA 3QDJA 5E03A 3RRQA 4D9RE 1B6DA 3GI9L 1BZ9B 1U92B 5HDBF 4M8QA 5E9DE 5DWUL 3EDDA 1CG9A 4HQQL 5B8CA 1N6UA 1FRGL 3MZTA 4R7DB 2P48B 4RFOL 2E7HA 2DDQH 3U9UA 3OQ3B 4YBHA 3TNNB 3GSNH 4LQ1A 1OGAD 5JXEC 3DHMA 2VQTA 2BVYA 1ETZA 3MJGX 1EHNA 1DL7L 4ODSL 4J6RL 2XZZA 3GBLA 3U9PH 5E1HB 2GUOA 1RU9H 1QEWB 1FORH 3VRLE 1G6RL 4L1HA 5F70A 3CIQA 4P5TA 3T3ME 3PWVB 1PKOA 4GSDH 3WUWA 5JHDE 4WUUB 1KB5H 2VB5A 5HSFA 4YZFE 3QUKB 2X89D 1YEFL 1TCRA 4YC2C 4D0CA 4HC1H 1F4XL 4MHHI 3O6KH 4HS8H 2ADIB 3VD3A 3BP4B 4NGHL 2OSLB 4TULH 3QG6A 3F6LA 1HHHB 1OAQL 4JFPA 4ZUTB 4GKOA 5ADOL 3FCTA 1JRHL 1A7QH 3C5JA 1F97A 2HJKA 3GSWA 4K3GA 4QRPE 5I1EL 1JPTH 1X5KA 5E00A 3MO1B 2QBWA 3C87A 3NIFF 2J6EH 3HRZB 5C2BH 3FTGA 5E70A 5J1TC 5I16A 5EZIL 5DEZA 5HGHA 1FVCB 4NP4H 2H8PB 1G7IA 2PN5A 4NZDA 4HK0A 4KTDL 2YD7A 4RNRB 1TVHB 3RAJH 5B3JE 4CAGA 4ONFL 4XBPB 3S35X 2BC4B 1U8MA 1JF6A 1YNLH 5L9DL 4RGNC 3VH8B 3BD4A 4WTZG 3WXVL 3D85B 2RJMA 3SKJL 4JKKA 4GKZA 4EI5C 3V4PL 4HG4K 5F88B 4KROB 4OCLC 1UKQA 4JQIL 5DJDA 1JYXA 4NQSA 5CSGA 4G6MH 4XCEB 2LAAA 3KJ6L 3D25A 4R8WL 1AGDB 4QHMB 2BSRA 3NCYP 3G6DH 4ZO8A 3GSRA 3P9LA 4WHDA 4XNUH 3O6LH 5D9SA 2XKNB 4J3VA 5LWYL 1NGZB 2JCCE 1FV1B 4NHUA 4LIQE 3QWRA 2OR9L 4JRXB 4HLJA 3MLUH 2QKIA 3MZGB 1KLUA 1G9NH 4TUJB 4J2XA 3P0GB 1U8IA 1OTSC 3VGEA 3UTSD 1DBBL 3LRHA 5GXBB 2X2YA 4MA3B 2LU7A 1IAMA 2X5PA 5E5RB 3V6OE 4YDLC 6FABL 1CBVL 4UUJB 3ZZ1A 4DQOL 5ID1A 3H42H 4ZFZB 5DFTA 2YK1L 4I3SL 3TN0D 2E6QA 3E3QC 5I74C 5D7LD 4U33A 2IQAB 4QRRD 5CJ8A 1A1NA 4JPVL 1U3HA 5C0AB 1TPXC 2I60H 1AKJA 3MA7B 1P4IH 2YD8A 4P3DA 1A6WL 2AKRA 3LMJH 3MV9E 1E0OB 3D39D 1FYTA 2CUHA 1DSFH 4ZD3H 5DO2C 2AK1L 4MDJA 3MRKA 5KG9A 5C9JA 1J0JA 1U95B 4C83A 1JZ3A 1PFCA 4N0FA 3DX7B 2L7JA 4XNMB 2VOTA 5BJTB 4OM0L 4UTBH 3UO1L 4QHLB 1CFTA 3OKYA 3S96B 2PO6B 1CK0H 3V4UL 5C0DB 3F12A 1V3JA 4OZGA 1XF2A 4DVRH 1AFVL 4Z7WA 1D9KB 3W2DL 1GZPA 2D4FA 4HULB 4G6AD 4IOSD 1EBAA 5E7FA 2V9RA 5A1AA 3EJZC 3RI5F 3BGMA 3NFNB 4ZUSA 4ZO9A 4L5FL 4HUUB 1CDIA 1C8PA 4AH2B 1SJHA 3QDJE 2VLKD 5FDWB 5JQ6L 3BJ91 5IMKB 1FNEB 1K9TA 5GRVK 3L3HB 1F3DH 3WFBH 4P9ML 2AJYL 4Z78B 3S5LG 3H7BA 1TJGL 3HAEH 4X5WA 3DUSB 4YBLC 2ADFL 5KW9L 3HG1D 1WC7B 1C5BL 2VQ1B 1B0GA 1PGRB 4FQQA 5B4MD 5HD8C 1T1ZB 1D5XB 1CTNA 4PPTA 4DGYH 4G8IA 5EUOB 1MJ8H 5DD6B 3C8HA 1EFXD 5IEKB 4Y2DB 3ARFD 4H1LH 1EERB 2H2PD 4ORGA 2E27L 3QFJA 2AW2A 1XZ0B 2XKSA 1GC1H 2VUOA 1A21A 35C8H 3RPKA 5C0EA 5HDQL 1UKSA 3O2VH 3RUGA 1J1XH 4RAUA 2IGFL 4NZTL 4TVSa 3U0WL 1BEYH 3MV8D 5FFLA 1UZ8B 4GAFB 1TFHA 2C26A 5C0RH 3NMEA 2N56A 3RJQB 4Z76A 4QT5B 4TRPL 2YHGA 1G7JA 5DSCA 1N0XL 2ZOKB 3JBG7 2NY4D 5KANI 1A6VL 4QOKD 3ES6A 4C55A 5K9QI 4WI7A 4FQXB 2D7TL 5E56A 12E8L 3PDOB 4IRJD 2IFGA 5BV7H 5DJXB 5IF0B 1VHPA 1WEJL 2Z4QB 1X44A 3MTRA 3IETB 4WI3A 3EYVB 4MNGB 4PJEA 1R3HB 3BHBB 1H15A 1J5OL 1RULL 1OGAA 1QYGH 1SJEB 1SYVA 1IQWL 1NCUA 4P5MA 4YHNA 4WJ5A 2ESVD 3HAEG 3U30C 2WZPD 3IVKB 4JFFB 3B9VA 1NSNH 1ZLUH 1XT5A 2E8YA 1TNNA 4U49A 3DGGB 4LRIC 4W4NA 5EC2B 2OP4H 3PWUB 1XGQB 5GJSH 1AY1H 4LSUH 4XMLH 4H1LG 4DVBB 3ARQA 3LEXB 1V7MH 4P2OD 5DMIL 1P9MA 2A73B 4LHUG 2VL5B 1RUAH 4QRQB 4HIEB 2GY7B 4NQCB 5TE7L 4OF3A 4QRUB 1TZHB 7CGTA 2RCSH 4C54A 5EO1A 3DX6A 5L2JA 3EYOB 1HWGB 3PL6D 5LAXB 3RWJB 3H3KA 1Z9LA 1NC4A 4TSAH 3CX5K 4KZDH 1KEGL 1EMTH 2H45A 4D3CH 3MREA 4X7EC 3STZB 1ZVSA 4FFWD 3TIEB 2Y36L 3OKNB 3VFTB 1SYSA 4NQED 5LBSH 1S7UB 1MELA 4XI5D 1J0YA 1ZAGA 4HD9A 1E6OH 1UACH 4ZSOA 2FX9H 1LD9A 1DLHA 4GRMA 4BSWB 2DQCL 4X6DA 2GJ6B 2XN9B 1KN4H 1PLGL 4M8VA 3U2SA 3WIHH 1YNTA 5GS2D 1BM3L 2YSSB 4J3XA 4PY7A 2ATPA 4X8XA 4Z77A 3MYJB 2AXGA 2XTJE 3PWPB 1IARB 3CFBA 4KJQC 1G6RB 1MCIA 1IKNC 3OJDA 1GC1C 1WT5C 1J05A 4X7CC 4Z7UA 4NIKB 5HY9B 5DXWA 3TNMA 1EK3A 2V7HB 4OZGE 1AD9A 1XFPA 4PGDB 4RSVA 3LY6A 1AQDB 4YPGB 2CXGA 2BRRH 4KI5E 4JCMA 1DVFB 1S9VB 1RJZA 1VACB 3GHBL 1S5IH 3QRGH 5DJZA 3W11C 4AIOA 1HQ4A 2EDJA 5CP3A 2NX5B 1OAYH 4XC1H 5EU7C 1RZFH 2QHRH 1N5YL 3DVIA 4NQDB 3SDDB 5BV7C 5K9KA 4X5XA 2OTUB 4YXKH 5JNYA 3UCRA 5HDOA 1OAXL 1IGMH 1G6VK 4CBPA 1AC6A 2FWOB 1M4KA 3ULUH 4UBDD 5KVEH 5IJVB 2GTZB 4KGLA 3BDYL 5ACZB 3EFDH 4Z8FH 3CZJA 3BP6B 1FFRA 1JGUH 5D7LA 1BWMA 3OAZK 2I9LB 4OGAC 2AXHA 4AM0B 3WJLA 5IHUL 3I9GL 3VD7A 1NGPL 3OG6B 3MBXH 2X9XA 5I8KH 2AV1B 1WFUA 4XNYH 4XP9H 4F7EB 3MUHL 2DQIH 1A9BA 1BOGB 2CIKB 3BH9A 1X5YA 4ENED 1A4JA 3MROA 4HX1B 3WIFB 3SOBL 3QFJE 2X4SA 4UDTB 2ZJSL 1INEH 1T04B 4HS6A 1S7VB 2OL3A 5GRYA 4LDEB 2A74A 3RUGE 4EIGB 3RZCB 4JM2F 2AEPL 4UZGA 3DX9B 1J8HB 1CE1L 4AJ0A 1KCVL 3P11H 3FB5B 3VA6A 2DB8A 4HPOL 3ULSA 3T0ED 1GGIH 3L7FB 5F6IB 4DFIA 4JN1H 3NIGE 1FJ1B 3ULVC 5C0ND 4FS0A 3WHXB 3FFDB 4WW1A 5MHSE 4PJDB 3VFVB 3E0GA 4V1DD 5ELIA 2BNRB 1F4HA 1C12B 4HGMA 4GRLA 5IW3A 1GYAA 5ESQB 1P4LA 4PRBB 3LIZH 5IQ7H 3IS1X 1CGXA 1PYWB 4PLKD 3CFKB 3SKUD 4F33B 1OM3H 5ESAB 1MRCH 3SCMB 5T5NG 1OGAE 3TBSB 3V7AE 5D2LF 3JWDH 2OZ4H 1Z5LB 1ORSA 1S7SA 2XY1A 2VDMH 1RHHA 3PJSB 3BEVA 4Y88A 1JZ6A 1CLCA 5ANMA 5JXED 1EFXA 2F19L 3ARFA 3BPOB 2NW2B 1FFQA 1U8QA 4I0PB 1JWUB 5CHNB 3HNVL 3EO1A 1W72L 4B53A 5D7IF 2DL2A 5EU3B 3SPVB 1EEYB 4Z0BH 4AG4H 3R8QA 4I2XA 1BVKA 1XIWC 4Z7NF 1VGEH 3OKMB 4KZEL 2A83A 3EJJX 3T1FA 4ZDHA 4RWYH 3TJHC 3P4OA 4FOMA 2VXVH 3X12B 3LSOA 3HZVA 3MACH 3NH7H 3F7RA 2DQUL 1C1EH 5F44A 3MJ8A 4RX4A 2DQFA 2X1WL 5JUEL 4IRJA 2DKSA 1RJCA 2VXQL 25C8H 3MNVB 5GS0L 1T22B 1KTDA 3IDJA 1JF5A 4M6AA 1IEAA 1AHWA 3LN5A 2NY5L 4JO4H 1OAKL 3GEWB 1XR8A 4JANA 1J9CT 4XHJC 4F2MA 3ULUC 3NFSL 1DQMH 4A6YA 4ELKA 4YGVA 1RIVL 4PP1C 4OFDA 1MFCL 5KN5B 3QNXA 2WBJD 3WSQH 2CLZA 4ZSOE 3O2WH 3DI2B 1CXLA 4X6DE 2R23B 4XPHH 4RGND 4XCFH 1GOGA 2JJVA 4GW4B 4JPKH 5IT2H 3HZMA 1PJ9A 2VZVA 3HI1A 4EI5D 1JGDA 4X99B 5TPWL 2R56H 4XNXH 4HKXA 4IBLT 2HFTA 5IV2B 1F4AA 2GW5A 4U0RC 1KJ3H 4H0IA 4Z7UE 3SBWC 5DD1H 4CN4A 2EO1A 4ONGL 5GGTH 1YJDL 4OCWH 2NCMA 4P3WA 3OR6B 1B88A 4WHTB 2GK0B 4Q0XH 1ZHBB 4OI9A 1KOAA 2R0KL 1KIRB 3MJ7A 3VDCA 4OCNC 1T89C 2B0SH 1SVZA 3WV0A 1FL3A 2EIZB 2X44D 5TE4L 1LK3L 3CX2A 1HZHH 5KSUA 3PL6A 4QHUB 3CH8A 2DBLH 1UXWB 4BK5A 4Y1AA 2XQBH 1QVOB 1RZIB 1ZA6B 3FOLA 4JDZB 4WI4A 3WHE1 4UIKL 3AGVA 5L8JB 4HXBH 4PRDB 2FLBT 3MRCA 1FO0L 2BVQB 3EO9H 3KPSD 3RJDA 4ISVB 4DKEL 1KLGB 1OF2B 2APBA 4G5ZH 5D7LE 4QRRE 2PYED 4PRAB 4MQXD 3C9NB 1GOHA 4MQ7B 2IH1A 1S7XB 4MMZC 5FUZH 3RWEA 4HHAA 4PJ5B 3KAAA 4FQIH 5E5UB 2RQ8A 2O5ZL 3L3OB 3WIIL 1AE6H 5DQ9A 5TDOB 1IQDA 3MRMA 1IAOA 2R2BB 3M1BA 2VE6B 4WFGD 3SEPA 1Z6JT 3UC0L 4R7NB 2NNAB 5DO2D 4YUEH 3TZVD 5JW4M 1NGQH 3H8NA 8CGTA 1WCBA 1N3NB 3CUPA 3P4NA 5FM5O 5GSRB 3UPCA 3IDXH 4ALAL 3D1MC 1WFTA 3WD5H 2H9GA 5CS7A 3QCTH 1U8JB 2ZSWB 1FC2D 4OLUL 3X11B 3F8UB 4MD0B 4E42B 1NCCL 5KSAC 3W82A 4EOWH 4JR9H 3UBXG 2P5EB 1F8TL 2JLLA 3PGCB 1NBYB 4KVNL 4HDIB 4M1DH 2W60B 5KAQG 4JO3L 5FKAB 1TIUA 5AAWA 2FYYA 3B6SB 3G5XB 5DGQA 2X7LA 3HPLB 3IDGA 3QDMD 4YHKL 1A22B 1FLRL 3HG1E 4ONOA 2CJUL 4XWOC 5F1KC 4J3WA 4LEXH 1BQUA 1D6VH 5TF1H 1JGEB 3HUJF 2VZ3A 1HOCA 3U82B 1JZ4A 2FJGB 4Y4FD 5ANME 5HD8D 5JLZA 1DBMH 2X4PB 4G6KL 3UTOA 3VXQB 3C60C 2Y9RT 4ZFGH 4PJAF 4BSVA 3I02A 3IJSA 2XKUA 4LSSL 4I2XE 4LIQL 4FABL 4F9PA 1KPRA 1NBVL 4GMSL 3SDAD 3ALXA 3DWTA 2DQEL 4GKNA 4XB7A 3O6FD 2BFVH 2GAZA 3Q6FB 1T4KA 3HE7B 4Y4HB 1T5XA 4NQXB 2NY1C 3T0EA 3U7YL 3MV7D 5HYFA 4HUVB 1KUMA 2G2RB 2R8SL 5EU6D 4JM2D 4WTWA 4XAKD 4PG9B 4U6YB 4GAJH 5C08A 1RJLA 2DN7A 1CL7H 5T5NF 4V1DA 1HILB 1QSVA 3RVTC 3D18B 1FQ9C 2VXSL 4U1HA 3ULUF 4ZOBA 1G7PB 1BAFL 3LQZB 3WN5A 5GRJH 5J06A 2QJDA 5IVZB 4QKXB 4MMXC 1FNHA 1INDH 3KPRD 3OAZH 1HHGB 4BQBA 3IDIA 2EE2A 4GG6E 4LPUA 2YKLH 4JEGB 2X4RB 5EFIA 2RHEA 3ARED 3JV6A 5IQ9B 4NZRH 5HVHB 4LMQE 4OFIA 3B3IA 2AJUL 2ESVE 3TA3B 4UB0L 3EW3B 3U48A 3ZKNC 1AGCA 4NJ9L 4QNPF 4MYWB 2XZCH 4FQ2L 1WBXA 4IJ3C 4G8GB 3JWOL 4DK6A 5KJRH 1B4JL 4XXCC 1V7NH 4YHML 4PBWD 1I85A 3QZWA 1KT2A 2HT4D 3PHOB 3VXTA 5GSVA 2IPUG 3DVNA 3SJVD 5EO0B 3TPKA 1RURL 2F15A 4PY8I 4JFHD 2IANB 5DUPL 4LSQH 1FZKA 4M6ML 2XA3A 3MRNB 4JZNB 3UPAA 3MJ9A 1AQKL 5CAYB 1F6LL 3BKJH 2X70A 4EN3D 1U8LA 4G9FD 3BPNC 4PP2A 4C56D 4LCCA 4OD3H 1E4KA 1QZ1A 5FYJH 4AENB 1YN6A 2ITCB 3GJFK 4Y1AE 2YC1A 5AYUL 1N2RA 3RBGA 3AM8C 4JG0L 2EDNA 2XWTB 3PGFH 4L9LB 1A6AA 2Y5TB 3BDBA 4RMVA 5A2IH 4K3EL 4APQB 3NIFE 5D1ZB 2MHAB 1WBYA 4RBPK 4Z0XA 5A3IC 3V52L 1HEZA 1Q38A 5DRNB 2WBJA 4NKMB 4OFYD 2VDQL 3C5ZC 5GGSY 3MNZB 5CBAB 1ES0B 1OSZB 2VC2H 3NA9H 1NLBL 3FT3A 1EBPA 5BVPH 2DQJL 3DUUA 2B8OT 3RVXC 4N8PA 2YUWA 2FBJL 2XWJB 2DIAA 4F3FA 4O00A 3HMWH 1E27A 1MCCA 2FIKA 1W72B 2AGJL 3ABZA 2CXKA 4KJQD 5FF6A 1T03L 1JK8B 5C07A 3QG7H 2V2TA 1FYHB 4ZPTB 1DLFL 4U1MB 3A6BH 2CRYA 2ICWA 4HJJH 4DZBA 3L3JB 3JUZA 3MFGB 4PLNC 2HH0L 1OT2A 1MEXH 4R0LA 4JJ5B 1QA9B 5T5FH 4CMMA 1IT9H 1C5CL 2R15A 4J4PA 2O93L 1R3LB 4JG1H 3S3SA 3KPSA 1CDJA 1VEMA 2ZKHH 3C2SA 1F4YL 1BMGA 4U1IA 1LO4H 2EKSA 1RD6A 4G43A 4M00A 5F3HA 5IEHA 2YPLB 2PYEA 3ARRA 1P2CB 3TBYA 2X4NA 5D93C 1ZLWK 1MHEA 4F7TA 3L6FA 5F3BB 3G5ZA 1HI6A 4PRNB 4OGAD 1OARH 2VLLB 3SN6N 3QI9A 1D5IL 5D1QC 4L8DB 2AABH 5C09A 3QHZH 4Y5XB 3BRFA 1U58B 5J12B 2JE8A 4RA0C 2VLMD 1ZEAH 4J1UA 1CICA 1F02I 3FO1B 5A2FA 4HV8B 3TZVA 2R2EB 2DLTA 4KKBC 3NCFB 2AJXL 3X3GH 2X41A 1K4DA 2FB4L 3QUYA 3CC5B 3QH3B 1NAKL 4MD5B 1FFOB 2WM0A 3NIDF 1KB5A 4FXLA 5J13C 5JORA 5IM7B 1FDLL 3T0EE 4G6FD 4MDIB 4WI2A 3G9VA 5KAQF 1CGYA 1L0YA 4HH9A 1DQTA 4HC1A 1MLCB 2A9MH 4XPGH 2V17H 1A3RH 5B39A 4M7LL 1MJUH 2Q20A 1M6OB 3G5YB 4KHTL 1I1FA 3MCKA 5C08E 4JFZL 3U7WL 4XBEH 4V1DE 3GKWL 5JW3H 2JKXA 3BGFC 1YEJL 3QCUL 4P46C 2VDKH 3Q6GL 4DCQB 4K3JL 1GGYA 2PXYC 4FZ8L 2J6EA 4O5LH 4YE4L 4HCRH 4YC2B 2IBZX 4KU1A 3V95A 3QDMA 2APWA 2VDPL 3ZKSD 4JY5L 5SWQB 5D2NB 3ARVA 1X6NA 3EIFA 5A16A 1PBYA 4Y4FA 2WMPA 3UYRH 5C0CD 1NFDB 2H26B 4YIQA 1X5JA 5HHQB 1ZGLA 3IFOA 4LLQA 3EFFA 3BIKB 3VRIA 1Z9MA 4B50A 1OL0A 2CMRL 4PJ7F 3RIFK 4PJFB 5HHVH 3ZYIA 4Q9QH 5K9OB 4OV5A 1DJSA 1L6ZA 3MLTA 4HUWB 3F58L 4HFUH 4GKSA 4URTB 1HNGA 1L7IH 3GMPB 1XGTA 4CKVX 3WUZA 3RL2B 3SDAA 2B4CL 3O6FA 5I6XC 1T5WA 1QFWH 3OKOA 4DN4L 3OKDA 2LU4A 5KS9A 3MV7A 4LKCB 1J11A 3K4ZA 3QIUB 1FBIH 3VXMD 4JM2A 3VW3H 5H8DA 2O5XH 1PEZA 4K07A 2B1HL 3QIWD 2NY2D 2WP3T 1MF2L 1BFOA 3VWKC 3JV4B 3LD8C 1IC1A 2CO7B 3QUZB 4NUGH 3QFDA 4WI6A 3VRJA 2P8LB 2BSTA 3K81A 1NGYB 3W5NA 4MD4B 3S5LA 2MCPH 1F2XK 3QUMH 4HIJB 2X4OA 4YGAB 4F58L 3KPRA 4GBXB 3MGTA 1TZIA 2AQ1A 5BW7C 3REWA 1H0DA 4M7LT 3AREA 3ULUD 5L6YH 3L9RB 4MAYD 1Z3GL 4QGTA 3TWCL 1VERA 4XCCH 1M71B 4IOIA 2MKWA 4RGNE 4H8WH 1U8HA 5SWSB 4Z18A 1I1AD 2XPGB 3LHPH 1IKFL 2APVA 5IW1A 3TH4T 4ZNEE 3HC4H 1JPFB 3IFPB 3OB8A 4IMKA 5D2LA 3RVWD 4OZIB 1CZ8L 3JTSA 4QYOB 1K4CA 3M45A 1WWWX 3FQXB 4IDJH 5IKCA 1RUML 1EVTC 1H3PL 1I8KA 3SJVA 1YEIL 4RCAA 3EOTH 2MFNA 1T83C 5C07E 5I71C 3AY4A 3FRUA 3Q5TA 4QGYA 1CDGA 5D7IA 5SWZD 2A77H 5I74B 5KVGH 3DIFA 1T3FA 4RAVB 3G08A 3N50A 2IAMD 3ETBF 3ZLQC 4LCWB 1WTLA 4EN3A 3QJHA 4G9FA 1W8NA 4C56A 4TOYH 4MZ3A 3AROA 3ROOA 1YPZB 3QQ3B 4K55A 2UZIL 3HMXH 1KV3A 3R8BB 2VIRB 5CUSL 2Y4SA 1ZSDA 4KPHL 5AYQA 5JIHA 5HHME 4LCUA 1KCRH 2DYPA 3KPSE 5MENA 1S3KH 4I48A 2DI7A 3MUZ1 5KVFL 4OT1H 3PABA 2YD3A 2PYEE 3TPUB 3O2DA 2W9EL 4WU5B 5IROA 3BT2H 2YEZB 3DXAD 2YN5A 4OLVL 3CFJB 3QEUB 1FVEB 2F54D 4HUXA 4CJ1A 2XYCA 5AZEH 4KK6D 4WWKC 4X6FA 4E5XA 1L0QA 1ZE3C 1CR9L 5DEGA 1H5BC 1YEKH 4MS8C 5DJYB 5TFSH 32C2B 3JTTA 4Z5RB 4CVXB 4WFGE 2Z92B 4U6HB 3OKKB 4PJHB 1WISA 2BOCA 5ISZD 1EX0A 4XBGA 4RGOH 2R4RH 2XA8H 4PYHA 4WV1B 5TQ2L 1QQDA 3WFHA 4LCIH 3FT2A 2FL5B 3UTTD 2IH3A 2K9UA 1VFAB 4XPTL 2Y6SD 2HKHH 3RX8A 4DUWA 3LEYH 1GHFH 4F7MA 2J8UA 1RUQH 3MRQB 3ARGD 5EOQH 5J11B 4M8QB 5CJXC 4XX1E 1T1YA 3GJFH 5B8CB 2A6IA 1N59B 4H88L 3GBNL 1V5JA 3KNBA 5KSAD 5E94A 1LO3L 4K7PX 4NNXB 3U9UB 1LEKB 1G1CA 1HYRC 1X5HA 1H9VA 4RBPH 3DRQA 1ETZB 2IEPA 3QDME 4XP1L 1WWCA 5JOPD 3V6FA 1TMCB 4DKFL 3VXSD 1NJ9A 3RNQB 4L9DA 4QRSB 1WIUA 2GUOB 4S1SL 4HGKC 3IXAB 1NEZA 5MP6L 4YDIL 3MGOB 5KZCB 1GCFA 4E0RA 4BUGA 3WUWB 2GYSA 3QNYA 2CPCA 3SDCC 2F53A 5F7EL 4UOW0 4OSUL 4D0CB 1BZ7A 5C2UB 1A7OL 1HKLL 2O5YL 1E6JL 2ARJQ 1RZ8B 2IQ9H 3BXNA 4FQPA 2WNGA 3C60D 1ZWIA 1NL0L 4M1GH 3VD9A 2HRPH 2EO9A 2AXJA 5AWNH 2IFFL 5FO9A 3QG6B 1A1OB 5IR1A 2EYSB 2VABB 3MXVH 5D8JL 5DI8A 3FCTB 4MXWH 4OCSL 4N8VG 5KS9E 3C5JB 4QRTA 2HJKB 3MV7E 3QQ4B 1P5UA 5ETUA 4QY8A 2P5WA 2ZCLL 3V5HB 1LO0L 2W0KA 4XAKE 1BBDL 3UP1A 5CEZH 4B7LA 1JV5B 3L5IA 2NY1D 5DJ8B 5J1AB 4Q6IC 1RJYB 1NC2D 2YD5A 3K4DA 5I1KH 1JZ8A 3TT1L 4WW2C 2EDLA 4KGJA 4WENB 5IESH 1G7IB 3FRPA 1FAIL 5GHWH 4V2CB 3PWNA 3S36L 4KMTH 1UJ3A 3K8MA 5DMKA 4UT6L 1HE7A 3EYSL 4KV5F 2QHLA 1U8MB 3PP4H 4KC3B 1MCKA 3KPRE 2D7PA 4DZ8A 4UQ3B 2HFGH 4OCXL 4YXLH 5B21A 1SY6A 3QYCA 1DUYA 1ZLWH 4DUXA 4X6CF 1MWAA 1M05A 3BP7A 1FVDA 1WJ3A 1MFDL 2IADA 4NQSB 5C0CA 4MWFB 3ZE1F 5I19L 2EDRA 5GPRA 2BSRB 5D2LE 15C8H 5T1DL 4ETQA 3BESR 3HUJA 2D03L 2HFEA 5JXAH 5CFHA 5CGYC 2ICWI 1MJ7H 2M1KA 2MQ3A 4ODXA 4Y2OA 1C16B 1QSED 3O9WC 3SJVE 5E1AA 5IVXB 1EO7A 2Q7YB 4NUJA 1MQKL 3W0WD 2XWBB 3C8KA 3QHFL 4JFHE 1R5IA 4N9GA 2NY6D 4PJAA 5D7IE 5DUBA 1DQDH 5HGDB 4BSJA 1JWMA 3L5WA 4H0HB 5IB1A 3ROLB 4X4YA 2ZNXA 3G6JF 1BQLH 4Z7NE 3QIWA 3HHRB 1ZHLA 1GAFH 4EVNB 4GT7A 4EIZC 4L29A 2CRIA 1AP2B 3LS5L 4JY6A 5IJKC 4G9FE 1IGFH 4C56E 4OBRA 4FQLH 5ID1B 3NCMA 4XMPH 1FE8L 1UB6A 5IFJA 1BQHG 5ICZA 1HK6A 5DD5H 1BF2A 3V9FA 4ZTPH 3K1DA 4LHUB 3D2UD 3CPLB 5F9OL 1QKZL 1U3HB 2EZ0C 2GIYA 4D9LH 5AZ2L 4OGYH 1Q9LA 1HQRA 2D9CA 1MJJA 2PETA 1GOFA 4AT6B 4OZFH 3FN0H 4JO1H 2AKRB 2PW2A 4MAYA 3JVGC 4X4XA 1FYTB 1RZJL 4N1HB 4GS7B 1FP5A 1I1AA 3MRKB 1Y0LA 3S3JA 1GZQA 2Q3ZA 1G0DA 4C83B 3U6RB 4N0FB 3C2AH 3FQWA 3LQAL 3SE8H 1XF3A 2A9NH 4FQJL 3OTTA 4QTIH 1CFTB 1NMCC 5B38B 4NFDA 4WRLA 4RMRA 5FYLH 1XF2B 1F6AA 1XF5A 4Z7WB 1QG3A 2YD4A 3GJEA 4M6NL 1KCUL 3SBWA 1RZKL 5DLML 3JUYA 5SWZA 4GAYA 2FX8L 3ARBD 4U1SB 4ZUSB 3D6GA 2IAMA 2HVJB 3PHQB 2EEAA 1G7MB 2J8UE 4NDMB 5C0IA 3BWUC 4P4RA 3VFOB 4D0DB 1SJHB 4P2RD 1S7QB 3EYUL 4LLAA 5EZLB 3V0VB 2M8XA 4JFYB 4QXUL 2X1PA 5CZVH 2QV2A 4POZC 1ZT4B 4NKIL 4YK4B 1G9MH 5EU7E 2JB6A 4MQSB 1B0GB 1I7TA 3FQTA 4FQQB 3TEUA 2NXYC 4OCMC 1ZXQA 4XXDB 5DHVA 5FO7B 5I1CL 1MHCB 4O58L 2Q86B 5FKPB 1LK2B 3BKMH 3ECBA 3PIQB 3DXAA 4JFED 1KPVA 5EIQA 4JY4A 4OCRH 1B9ZA 4TUKL 1IRAY 1QBLH 1IGJA 1NMBL 3O45A 1XH3A 4TQEH 5E2VH 2OZ4A 1X7QA 4OZFG 2F53E 5C0EB 2AJSL 1J12A 2CH8A 3EDEA 1CF8H 1JPST 1NLDH 1MIML 5D1QD 3KWWB 3P4LA 4JKPL 1TQBC 1LP9F 3SQBA 4WO4A 4YLQT 4NNYB 1XCTB 1G7JB 2R2HA 1UCBL 3WNOA 5JPMA 5DQDH 2UYLB 4PRIB 1MFNA 4M48L 3ES6B 3MLRH 4KKBD 5KTEL 3BP5A 1TZGL 4D9QD 5FYKH 3IAQA 4YHYC 2X9WA 5F7DA 4WW2F 4HIIA 1WFNA 3F65A 1ZS8A 3ARGA 1I4FA 5I75C 5DRZA 3DTXA 5IK3B 2VLJD 3KS0J 1BOYA 2H1PL 4OFVA 1VDGA 4PJEB 1WZ1H 1MFEL 1MCHA 1YMHA 5DA0B 2VN7A 4TNVK 5F9JB 1AXSB 5H35A 2FATH 2WP3O 5FYJD 1SYVB 4P46D 1QFUH 1XIWB 4OF7A 4NO0B 4P5MB 5E8EB 4YHNB 4WJ5B 1I3GH 5DHYB 4JPWH 3VFNB 3VXSA 4LLDB 5DK0B 5IMLA 4E41A 2H32B 3CLEH 3FMGL 1KIPA 1OP3K 5C0CE 3CH1B 3MFFB 2UVFA 3LKQA 1HHIA 1IAKA 3TVMC 5HXMA 3MNWA 3UJTH 3H9SA 2R69H 4Y89A 5DURB 2EIDA 3A67L 3HUJE 1XMWA 3HI5H 5ITFA 1AD0A 2AJVL 4OZHF 1G7HA 1J1PL 1EA9C 4I3GA 3CNKA 1RUPL 3SKNA 1VESA 5JPNB 5HYIA 3PDGA 3H9HB 4PJAE 4Z9KB 4BFIB 2J4WL 3TCLA 4JVPA 1EUTA 2BNQB 2H2SC 4LLMA 4K23H 4P23C 5FYJU 3VXME 5GGTA 3S88H 3T3PE 3DX6B 3LQMA 1KULA 3QNZA 3SDXA 4XAWL 1BD2D 1NAMB 4KRPC 1U8NA 4C57C 1NC4B 1I7ZA 5TE6H 5I1AA 4N0YL 1YC8A 5M95B 1UB5B 5E4IA 4RFNC 2ZUVA 4XZUA 5HHPA 3FO2B 2VMFA 5C0BD 3VWKD 3MREB 3GSQA 3SGKC 3VXUA 1Q0XL 5DK2A 3VGHA 3BAEL 5D7JC 1ADQA 1SYSB 2I25N 4U0RB 4NRYA 3S37L 1WIPA 1YQVH 4NHCL 1KCSH 1ZHNA 3HR6A 4HJGB 1A6ZA 5FK9A 4PB9L 3ULUE 3FQRB 1YNTB 3IDYC 2AI0L 3MC0A 1YQ2A 4Z77B 1YEEH 2Z8RA 3CFBB 2DL9A 1MCJA 3NA4A 4JFXB 2MOVA 2YD6A 2QSCL 2GCYA 2FH6A 5GQBA 5IHZA 2B7DT 5MEQB 4LKXA 4F9LC 4NM8L 4PRPA 1J05B 3Q1SH 3GNMH 5C0JA 4JHWH 1DBKL 1YUHA 3QWOA 4JO2L 1S9YA 4OD1H 3WE6B 1QSEA 1AD9B 5T1KB 4IRSC 4GAGH 4QNPE 1TTUA 1U8PB 2DQGL 3MMEB 4WU7A 4HWBH 3W0WA 1UM5L 4PJ7A 3S97C 2X4QA 1RJZB 2MQ0A 5J6HB 5SWZE 4N8CL 5DJZB 2M26A 1XF1A 2A6KA 5F1NA 4WHCA 2NY3C 1C5DA 2BVTA 1QBML 3OZ9L 3IJYB 4MA1C 4ZAKC 5FXCH 3SKOB 4X5XB 5EORH 1CCZA 1A3LH 4NN6C 4PGBA 5CMAA 5LXGH 1U3ZA 3P9WB 2Y07L 5EBWB 2HKFL 1A7RL 1Q1JH 2C1OA 5F96L 1PW3A 4PB0L 1IFHL 2FHBA 5CJOL 3D2UA 4Q58C 5TH2A 3LKPB 5J3HD 2BRQA 2OQJA 1MCPL 2NY7H 3P0YL 4R90H 5ADPH 1A9BB 1JP5A 3BH9B 5HI4D 3LEVH 4EQ2A 1OWRM 4NN5B 5FHAL 3GMQA 3TJEL 3DXAE 4MNQA 3MROB 5D1XA 1RIUL 2ATKB 5E2UH 3S4SA 3HC3H 2X4SB 3QP3A 4QF1A 5LGJA 1JZ5A 1HYSC 2ZOLB 2A74B 4MAUH 1HDMA 3OPZH 4WWKD 3CAFA 3VH8G 3NABH 5ISZE 3LKOB 1CDHA 4YFDB 5I17A 1MPAL 2DWEB 4PJXB 4BH7B 3KPPB 1AGEA 4WCYL 1T7ZA 5CD5D 3ULSB 4PJGF 1P53A 3ARTA 3MJ9L 5EBMB 3UTTE 3LDBC 3SGJC 5EG6C 2XNAA 1GIGL 4EBQL 4JRWA 2HLFD 2W1NA 3ARBA 1CLYL 1FH5H 3ZT5A 4WW1B 4U1LA 5M94B 5D5MB 1D6EB 2G9HA 5D96B 1S9XA 2Q76B 4O2CB 4X6BA 3D9AH 4GRLB 2YWYA 1LE5B 1RIHL 3T4YA 5F7MC 5F7HA 3JXAA 3QULA 5DJ0A 3IT8D 3N1FC 3M07A 2R39A 1MH5A 3ZHKA 4PG2A 5CSZB 4KKAC 5HPOA 1WV7T 4JGJA 4MLSA 1I8LA 4JRYD 5I8OL 1A6UH 4GW1A 3BPCB 4Y5YA 2HJFB 1VKXA 1ORSB 3W9EB 5AEAA 5ITBL 3BEVB 4OGXH 3VFUA 3GSVA 4FTVA 2ZSVB 5ANMB 3VXSE 3RVVD 4JFEA 2EXYC 1P7QD 2MPAL 4PV8A 3J8F7 4E41E 3K2UL 3RTQD 4JDVB 1NMAH 3G6AA 4W6YB 5KSVA 3MLXH 5EU4B 3RIFF 1YNKL 1YN7A 1KC5L 5E5MB 2FEEI 1A7BA 1MCQA 4FP8H 1BVKB 3H9SE 1AC0A 4FMFA 1X4YA 3FQNB 2A83B 2NW3A 1CN4A 3L3KA 3OKEA 3SDCD 4ZDHB 2GITB 2WUCL 5LGHL 3ZYJA 1KF9B 3P4OB 5FA3B 5INCB 4OB5L 3KYOB 5KVDH 5C7XL 3LSOB 5EOTA 3HZVB 4FXKA 2W9DL 4G8FA 1RZGA 3GZKA 1KGCD 1IILE 2DQFB 3MRHA 3DV4A 3CK0L 3RY6A 2HVKA 3IDJB 4LBEA 3SDXE 1U6AH 1GGCH 1R3JA 3LN5B 3NIDE 4OQ1A 2GY5A 1I7RB 1XF4B 2P42B 2VLJA 4JANB 1XR8B 4MJ5A 1A4KB 3U36B 1GJIA 5T1LA 1X5GA 1F3JA 3O3AB 3ZDXF 3VXUE 3L5XH 1IGYB 5EIVA 3VFRB 4MZ2A 4W4OC 1SVCP 2FD6L 2DDQL 3K2MC 4IHOB 3HA0A 2Z91B 4U7MA 1V3MA 1BFSA 1BFTA 3QHTC 4XCNA 5E8OA 5TQ0H 5FM5M 4L3AA 2DQHL 3HZMB 2XY2A 3RKDC 5J9PB 3VFPB 3HI1B 4DEPB 1JBJA 3MLYL 5I1IH 4JFQB 2W9LA 1BPVA 4BZ1H 1RU9L 3QUXC 4FFZH 4NC2B 4LQFH 1FIEA 2GT9A 4W68A 3BPNB 5E2TH 5GGSA 3PXHA 4TUOB 5E6IC 2Y7QB 3IU4L