3LQEA

X-ray structure of the murine norovirus (mnv)-1 capsid protein protruding (p) domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
313
structure length
313
Chain Sequence
b'RMVDLPVIQPRLCTHARWPAPVYGLLVDPSLPSNPQWQNGRVHVDGTLLGTTPISGSWVSCFAAEAAYEFQSGTGEVATFTLIEQDGSAYVPGDRAAPLGYPDFSGQLEIEVQTETTKTGDKLKVTTFEMILGPTTNADQAPYQGRVFASVTAAASLDLVDGRVRAVPRSIYGFQDTIPEYNDGLLVPLAPPIGPFLPGEVLLRFRTYMRQIDTADAAAEAIDCALPQEFVSWFASNAFTVQSEALLLRYRNTLTGQLLFECKLYNEGYIALSYSGSGPLTFPTDGIFEVVSWVPRLYQLASVGSLATGRMLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
molecule tags Viral protein
source organism Murine norovirus 1
publication title High-resolution x-ray structure and functional analysis of the murine norovirus 1 capsid protein protruding domain.
pubmed doi rcsb
total genus 63
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3lqeA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3lqeA01
5IYPA 4Z4TA 3Q6RA 3LQ6A 3PVDA 3R6JA 2OBRA 4WZEA 3R6KA 4P12A 3V7AA 3PA2A 3PUMA 1IHMA 5E6TA 4Z4RA 4QVJA 5BSXA 4Z4YA 4OP7A 3Q6QA 4QVAA 3RY8A 3ASTA 4WZKA 5J3OA 4ROXA 3PUNA 4P1VA 3SJPA 4OPVA 4X06A 3SKBA 4P25A 4RM0A 4OPSA 3ONYA 5F4MA 4X7CA 4X07A 3LQEA 4X7DA 3PA1A 2ZL5A 3ASQA 3ONUA 4X0CA 3BQJA 3ASRA 4RDJA 3Q3AA 2ZL7A 5J35A 5IYQA 5IYRA 5KW9A 3SEJA 2ZL6A 4RDLA 4OOSA 4OOXA 4OOVA 4Z4VA 2OBTA 4RLZA 5IYWA 3SLDA 3Q38A 4P26A 4X7EA 3SLNA 3BY2A 4WZTA 4X05A 5F4JA 4QUZA 5IYNA 4P2NA 5F4OA 4WZLA 3ASPA 4Z4ZA 4Z4WA 5BSYA 3ASSA 3BY1A 4X7FA 3Q39A 4RPBA 5HZBA 4QV2A 3D26A 4P3IA 4RDKA 2OBSA 4RPDA 4Z4SA 4Z4UA 5HZAA 4OPOA
chains in the Genus database with same CATH superfamily
1JNYA 1KRHA 1NB0A 3I1FA 1U2RA 5B6IA 3VR6A 4RJLA 4P6VF 2C5HA 2NV4A 2VNKA 4AF7A 1QH0A 2FX3A 4XR6A 2EIXA 3OKXA 4RCZA 1KC8D 2BF4A 1T6ZA 2JJ1A 1SKYB 2VYQA 1B2RA 3T56B 2GJRA 3A3BA 3WY9A 4ACBA 4NCNA 3V7AA 3CC4B 3ZPNA 1K9MD 3G05A 1UD3A 3OPOA 1UD6A 5DN6A 5BSXA 1DDIA 4OP7A 3AVWA 4M2LA 1JJ2B 1P4MA 4QVAA 1BMFA 4G7WA 2BM1A 5L46A 3W2EA 2XOKA 1S72B 4B3GA 1E3XA 4N3GA 4XN3A 3WYAA 2PE3A 5J3OA 4ROXA 2E1RA 3PUNA 2DIEA 2VBVA 4K1XA 2V4DA 3W2HA 5H59A 3QFSA 5KNLA 4OPVA 3GSIA 1CQXA 1KK2A 4B3FX 3JU4A 2ZXIA 1M90D 5F4MA 2Q6LA 1R5BA 3VO1A 4ZCIA 1FNBA 4X7DA 3PA1A 2WZPP 3ASQA 5CDFA 5FNZA 4X0CA 3AVVA 4YAOA 4LBWA 4WWVA 2P3MA 2ZL7A 2GJKA 5IYRA 1T6YA 2GJPA 5AN9A 3OP1A 3ZIAA 2QEXB 1WOPA 1XB2A 4XORA 3BC9A 4RDLA 1KMHA 2DCUA 3OW7A 3V76A 3H94A 3QFRA 2XNJA 2ZITA 1WP6A 2HLDA 1E1RA 4XD7A 1VHOA 5TY0A 3CCVB 1BQEA 4ZCMA 2DEUA 3PENA 1EFUA 4PC3A 3CCJB 2F1MA 3WNDA 4XLAA 3SLNA 3BY2A 1QUEA 1D1NA 2BMWA 1QFJA 4PC2A 3WNCA 5F4JA 2QE7A 3MCAA 3OZUA 4YELA 1YJ9B 2X6YA 4XKWA 1VF7A 2JDIA 5F4OA 3ZBUA 4RD0A 3CD6B 4Z4WA 3ZUGA 1GAQA 2CBXA 2WJYA 3CCQB 2R9VA 1BJKA 4HIZA 1KZLA 2M5SA 3ASSA 1H42A 4QFMA 2JJ2A 4AC9A 3U2QA 3A3GA 5HZBA 3OAAA 1V0FA 1WPCA 4B4DA 1UD5A 3D26A 3P26A 4RDKA 1ZM9A 2V7QA 5FL7A 1QUFA 4G1VA 1S4MA 1YJWB 4P3YA 2CF4A 4RPDA 1QVFB 2ZBUA 3J81k 4Z4UA 2VZLA 4TMTA 4DQLA 4OPOA 5HZAA 2PMDA 2V31A 4C0SA 5IYPA 3B8HA 3B78A 4M53A 4TMVA 2XZLA 4MYUA 4XLFA 3PVDA 3GVKA 1G7TA 3CTAA 1D8TA 3CMMA 3R6JA 4ZGNB 1KK3A 5A88A 3FJOA 2W6IA 3T51B 1NJID 1ELOA 1VJSA 1QFYA 2C78A 5THXA 1NB9A 1TVCA 3KEWA 1W34A 3WXMA 3PA2A 3CCLB 3MHPA 3OEEA 1EFRA 4PC7A 2OTLB 4TT3A 2FVGA 2ZZEA 1H85A 1YI2B 4Z4RA 1BX0A 1MRZA 1VQ5B 1GAWA 4XLEA 1VQLB 1IB0A 2GK7A 2WJVA 1Q82D 1V0EA 1F60A 2PIAA 3OJXA 3FPKA 3OZWA 4WQMA 3ASTA 1JA1A 2XNDA 1R5NA 3NE5B 4II2A 4P1VA 1EFCA 1K8AD 4P6YA 1VQMB 3SJPA 1WOSA 4LBYA 4LC0A 4ZCLA 5GV8A 5DS0A 4X06A 3E1YE 3CXCB 4RM0A 2VNIA 3ONYA 2QMUA 3CPWB 4X7CA 4B43A 2OYNA 1PJ6A 1VQ9B 2BGJA 1W9XA 1HZEA 2BM0A 1TLLA 3OW2B 3BNWA 3JQPA 3OFNA 4Z1MA 1EP2B 2Q6IA 5A89A 1CNEA 3Q3AA 1QFZA 1KQSB 1KK1A 2B7CA 2BVNA 3JQRA 5KW9A 1PJ5A 4GQNA 1QG0A 1WU8A 3CC2B 2ZZQA 4ACAA 3CMAB 5FA6A 5A8AA 2CRVA 4F7DA 1KTVA 4AVZA 1YIJB 3GVLA 4B47A 2DY1A 5HXBA 2GQFA 2X85A 1ZM3A 2HCJB 2R6HA 4FXUA 4JMQA 2YWFA 5TV2A 1OGJA 4H9GA 3W5UA 4XONA 4P26A 4YAUA 3U6KA 2BN4A 4U9UA 1EWYA 1YX2A 4FWTA 4UZEA 2XNCA 3QFTA 4TKOB 4WZTA 1WOOA 2GK6A 1OHHA 4B48A 3WNBA 4QUZA 2V7XA 3OJWA 4P2NA 4PGOA 4TMXA 3A8IA 1I7PA 4B44A 4C43A 2YWEA 5H5JA 4XL9A 1F20A 2VBTA 3G71B 3AGPA 1W87A 1BPLA 3SJZA 3Q39A 3AVUA 4Y9UA 4YAWA 3VNVA 1Q7YD 4G7XA 3GQBA 2WR8A 4P3IA 3W5HA 2Q6KA 4DQKA 3CPXA 5TR9A 1DDGA 4XN0A 3CRZA 2V7VA 2VJIA 2C2WA 4TSFA 2QA4B 1VQNB 4KKTA 4Z4TA 1FNMA 3QSYA 1RQPA 4XOTA 2VBUA 1WDTA 3ZZTA 1UD2A 4UAJA 4EH1A 3LQ6A 1FDRA 2V7UA 2D9RA 3CCSB 1XQBA 4ASUA 2YWHA 3W2FA 4XQFA 1AIPA 2BPOA 2OK7A 4LBZA 3QE2A 1VHEA 1SM4A 1IHMA 1G7CA 3LVBA 1D2EA 1HA3A 4P9SA 1VQ6B 2I1LA 1NRKA 4XKVA 4ZV4A 1Q9SA 4E0FA 4QVJA 3BCDA 4Z4YA 1BLIA 3H9NA 3Q6QA 3ZZUA 1FRNA 4TMWA 2WSSA 1NBMA 1H8HA 4PAAA 3RY8A 1N05A 1TUIA 1EP3B 2BV3A 4DK0A 1KK0A 1WTHD 1N08A 5TRDA 1XFOA 4ZGQB 1B23P 1RQRA 3E20A 1QX4A 2WZNA 2X0KA 3HAGA 4X8IA 1KJZA 4P25A 3A35A 4R71A 1VQ4B 4G6IA 4DNTB 1UMKA 1G7SA 1QGZA 2X53S 3LQEA 4QHYA 2OTJB 2X6WA 4II3A 1KD1D 2ZL5A 1QVGB 2GREA 1VLYA 1I18A 2X8KA 2F1LA 1V5VA 3ASRA 4XLCA 2XZPA 4IW3B 5J35A 5IYQA 5JBQA 3VMFA 3OE7A 1PKVA 1AMOA 1W0KA 4XMYA 4DK1A 2ZL6A 4YALA 2ZXHA 3BH4A 1PJ7A 1GJRA 1QGAA 5LMZA 3G4SB 5KSWB 3FKSA 4HE5A 4OOSA 5FIUA 2B7BA 4OOXA 1IJEA 2BGIA 2QN6A 4OOVA 2LZJA 3CESA 1GR1A 2WPDA 3FPPA 4M4SA 2F4NA 3CCEB 2OBTA 1K28D 2B5OA 2DOGA 1M1KD 1UD8A 3GVJA 4TMZA 3SLDA 3Q38A 2GPJA 2D3NA 1IJFA 1FNCA 1H8EA 4X7EA 3ZBTA 2VJJA 3CCUB 2D74A 4LBVA 4B3XA 4DNRB 1UD4A 1GO2A 4CQJA 4X05A 4Y9RA 3ZZ0A 4KKSA 1T5EA 5HKKA 1VQPB 4UZUA 3WQZA 5IYNA 4TN1A 1QGYA 4PABA 3ASPA 3CCMB 4RD3A 3T53B 4AF6A 1I8DA 3VO2A 5EMNA 1K73D 3OEHA 3AVTA 1YLOA 4XOPA 1NDHA 2NPFA 2Q6OA 4L8JA 3ES9A 2W6JA 4XNFA 4PC6A 4N3NA 1E1QA 4XLHA 4HE6A 1G7RA 4RPBA 1N8RD 1VLOA 1VQ7B 2QTLA 2ZTNA 2KVOA 5IK2A 1Q86D 3CCRB 3P27A 5FO1A 2ZZGA 4RD2A 4Z4SA 3CMEB 1J9ZA 1SKQA 3A8JA 1YJNB 1OB2A 1A8PA 3A8KA 3ISXA 4G1BA 3AVYA 2JIZA 3Q6RA 2QGGA 1R5OA 2HDNB 1TTTA 1ZUNB 4NNJA 3W2IA 2OBRA 2EFGA 4BPRA 4WZEA 3R6KA 2ZZFA 4P12A 3ZC3A 4FK8A 4G5GA 2BSAA 1WORA 1E63A 3MMPA 3PUMA 5E6TA 2CNDA 1YITB 4UZFA 1VQKB 2D3LA 1VQ8B 2C4UA 2J7KA 3WBKA 1FNDA 2XGJA 5GV7A 1E64A 2X3UA 4YEJA 1Q81D 1E3ZA 2YWGA 2OK8A 1W2BB 1Y0RA 1N0VC 4WZKA 2X6XA 3BCFA 3I55B 2XEXA 1EXMA 1JA0A 2F43A 2ZTGA 1W0JA 3SKBA 2VBSA 4OPSA 3G6EB 3LNNA 2RC5A 4X07A 3GIRA 1HVXA 1FX0A 3QFCA 1N0UA 3ONUA 4XM3A 4Y7CA 3BQJA 1FRQA 1MABA 1ZM4A 4RD4A 1OB5A 1CNFA 1T6XA 2VNJA 4MYTA 4RDJA 1COWA 3CW2A 2CC2A 1YHQB 1EP1B 4YHBA 1EFTA 2DERA 4FN5A 3DDYA 3SEJA 4NBSA 1OGIA 4RD6A 1S0UA 2AHOA 1Y0YA 3U6BA 3CB4A 3OZVA 1XE1A 2C5BA 4YAFA 1E79A 1VQOB 3VNUA 4M1KA 1N06A 4Z4VA 2CW5A 4RLZA 1BX1A 1GVHA 3A1PA 1WSRA 5IYWA 3AGQA 1ZM2A 2HMAA 3JQQA 5FO0A 3WBJA 2V7TA 1DG1G 4KKUA 1E62A 1WSVA 1N07A 4RD1A 2WYRA 2JN9A 1OB0A 3W2GA 4Q7JB 3B82A 3OOCA 4RCYA 2QTZA 3KL9A 2ZBVA 4WZLA 3AVXA 2VNHA 4Z4ZA 2PLFA 5BSYA 5DSZA 4J0QA 2DETA 1E43A 3I56B 2CK3A 4PC1A 4X7FA 2V7WA 3BY1A 4M0LA 2E1BA 2C77A 3W5VA 4QV2A 3CP2A 3CC7B 2XZOA 4P22A 3CP8A 1JB9A 2DYIA 3LO8A 1W35A 2Z6BD 4YXWA 1DARA 2OBSA 2RC6A 2QDXA 2C4TA
chains in the Genus database with same CATH topology
5IYPA 4Z4TA 3Q6RA 3LQ6A 3PVDA 3R6JA 2OBRA 4WZEA 3R6KA 4P12A 3V7AA 3PA2A 3PUMA 1IHMA 5E6TA 4Z4RA 4QVJA 5BSXA 4Z4YA 4OP7A 3Q6QA 4QVAA 3RY8A 3ASTA 4WZKA 5J3OA 4ROXA 3PUNA 4P1VA 3SJPA 4OPVA 4X06A 3SKBA 4P25A 4RM0A 4OPSA 3ONYA 5F4MA 4X7CA 4X07A 3LQEA 4X7DA 3PA1A 2ZL5A 3ASQA 3ONUA 4X0CA 3BQJA 3ASRA 4RDJA 3Q3AA 2ZL7A 5J35A 5IYQA 5IYRA 5KW9A 3SEJA 2ZL6A 4RDLA 4OOSA 4OOXA 4OOVA 4Z4VA 2OBTA 4RLZA 5IYWA 3SLDA 3Q38A 4P26A 4X7EA 3SLNA 3BY2A 4WZTA 4X05A 5F4JA 4QUZA 5IYNA 4P2NA 5F4OA 4WZLA 3ASPA 4Z4ZA 4Z4WA 5BSYA 3ASSA 3BY1A 4X7FA 3Q39A 4RPBA 5HZBA 4QV2A 3D26A 4P3IA 4RDKA 2OBSA 4RPDA 4Z4SA 4Z4UA 5HZAA 4OPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYP A;  4Z4T A;  3Q6R A;  3LQ6 A;  3PVD A;  3R6J A;  2OBR A;  4WZE A;  3R6K A;  4P12 A;  3V7A A;  3PA2 A;  3PUM A;  1IHM A;  5E6T A;  4Z4R A;  4QVJ A;  5BSX A;  4Z4Y A;  4OP7 A;  3Q6Q A;  4QVA A;  3RY8 A;  3AST A;  4WZK A;  5J3O A;  4ROX A;  3PUN A;  4P1V A;  3SJP A;  4OPV A;  4X06 A;  3SKB A;  4P25 A;  4RM0 A;  4OPS A;  3ONY A;  5F4M A;  4X7C A;  4X07 A;  3LQE A;  4X7D A;  3PA1 A;  2ZL5 A;  3ASQ A;  3ONU A;  4X0C A;  3BQJ A;  3ASR A;  4RDJ A;  3Q3A A;  2ZL7 A;  5J35 A;  5IYQ A;  5IYR A;  5KW9 A;  3SEJ A;  2ZL6 A;  4RDL A;  4OOS A;  4OOX A;  4OOV A;  4Z4V A;  2OBT A;  4RLZ A;  5IYW A;  3SLD A;  3Q38 A;  4P26 A;  4X7E A;  3SLN A;  3BY2 A;  4WZT A;  4X05 A;  5F4J A;  4QUZ A;  5IYN A;  4P2N A;  5F4O A;  4WZL A;  3ASP A;  4Z4Z A;  4Z4W A;  5BSY A;  3ASS A;  3BY1 A;  4X7F A;  3Q39 A;  4RPB A;  5HZB A;  4QV2 A;  3D26 A;  4P3I A;  4RDK A;  2OBS A;  4RPD A;  4Z4S A;  4Z4U A;  5HZA A;  4OPO A; 
#chains in the Genus database with same CATH topology
 1JNY A;  1KRH A;  1NB0 A;  3I1F A;  1U2R A;  5B6I A;  3VR6 A;  4RJL A;  4P6V F;  2C5H A;  2NV4 A;  2VNK A;  4AF7 A;  1QH0 A;  2FX3 A;  4XR6 A;  2EIX A;  3OKX A;  4RCZ A;  1KC8 D;  2BF4 A;  1T6Z A;  2JJ1 A;  1SKY B;  2VYQ A;  1B2R A;  3T56 B;  2GJR A;  3A3B A;  3WY9 A;  4ACB A;  4NCN A;  3V7A A;  3CC4 B;  3ZPN A;  1K9M D;  3G05 A;  1UD3 A;  3OPO A;  1UD6 A;  5DN6 A;  5BSX A;  1DDI A;  4OP7 A;  3AVW A;  4M2L A;  1JJ2 B;  1P4M A;  4QVA A;  1BMF A;  4G7W A;  2BM1 A;  5L46 A;  3W2E A;  2XOK A;  1S72 B;  4B3G A;  1E3X A;  4N3G A;  4XN3 A;  3WYA A;  2PE3 A;  5J3O A;  4ROX A;  2E1R A;  3PUN A;  2DIE A;  2VBV A;  4K1X A;  2V4D A;  3W2H A;  5H59 A;  3QFS A;  5KNL A;  4OPV A;  3GSI A;  1CQX A;  1KK2 A;  4B3F X;  3JU4 A;  2ZXI A;  1M90 D;  5F4M A;  2Q6L A;  1R5B A;  3VO1 A;  4ZCI A;  1FNB A;  4X7D A;  3PA1 A;  2WZP P;  3ASQ A;  5CDF A;  5FNZ A;  4X0C A;  3AVV A;  4YAO A;  4LBW A;  4WWV A;  2P3M A;  2ZL7 A;  2GJK A;  5IYR A;  1T6Y A;  2GJP A;  5AN9 A;  3OP1 A;  3ZIA A;  2QEX B;  1WOP A;  1XB2 A;  4XOR A;  3BC9 A;  4RDL A;  1KMH A;  2DCU A;  3OW7 A;  3V76 A;  3H94 A;  3QFR A;  2XNJ A;  2ZIT A;  1WP6 A;  2HLD A;  1E1R A;  4XD7 A;  1VHO A;  5TY0 A;  3CCV B;  1BQE A;  4ZCM A;  2DEU A;  3PEN A;  1EFU A;  4PC3 A;  3CCJ B;  2F1M A;  3WND A;  4XLA A;  3SLN A;  3BY2 A;  1QUE A;  1D1N A;  2BMW A;  1QFJ A;  4PC2 A;  3WNC A;  5F4J A;  2QE7 A;  3MCA A;  3OZU A;  4YEL A;  1YJ9 B;  2X6Y A;  4XKW A;  1VF7 A;  2JDI A;  5F4O A;  3ZBU A;  4RD0 A;  3CD6 B;  4Z4W A;  3ZUG A;  1GAQ A;  2CBX A;  2WJY A;  3CCQ B;  2R9V A;  1BJK A;  4HIZ A;  1KZL A;  2M5S A;  3ASS A;  1H42 A;  4QFM A;  2JJ2 A;  4AC9 A;  3U2Q A;  3A3G A;  5HZB A;  3OAA A;  1V0F A;  1WPC A;  4B4D A;  1UD5 A;  3D26 A;  3P26 A;  4RDK A;  1ZM9 A;  2V7Q A;  5FL7 A;  1QUF A;  4G1V A;  1S4M A;  1YJW B;  4P3Y A;  2CF4 A;  4RPD A;  1QVF B;  2ZBU A;  3J81 k;  4Z4U A;  2VZL A;  4TMT A;  4DQL A;  4OPO A;  5HZA A;  2PMD A;  2V31 A;  4C0S A;  5IYP A;  3B8H A;  3B78 A;  4M53 A;  4TMV A;  2XZL A;  4MYU A;  4XLF A;  3PVD A;  3GVK A;  1G7T A;  3CTA A;  1D8T A;  3CMM A;  3R6J A;  4ZGN B;  1KK3 A;  5A88 A;  3FJO A;  2W6I A;  3T51 B;  1NJI D;  1ELO A;  1VJS A;  1QFY A;  2C78 A;  5THX A;  1NB9 A;  1TVC A;  3KEW A;  1W34 A;  3WXM A;  3PA2 A;  3CCL B;  3MHP A;  3OEE A;  1EFR A;  4PC7 A;  2OTL B;  4TT3 A;  2FVG A;  2ZZE A;  1H85 A;  1YI2 B;  4Z4R A;  1BX0 A;  1MRZ A;  1VQ5 B;  1GAW A;  4XLE A;  1VQL B;  1IB0 A;  2GK7 A;  2WJV A;  1Q82 D;  1V0E A;  1F60 A;  2PIA A;  3OJX A;  3FPK A;  3OZW A;  4WQM A;  3AST A;  1JA1 A;  2XND A;  1R5N A;  3NE5 B;  4II2 A;  4P1V A;  1EFC A;  1K8A D;  4P6Y A;  1VQM B;  3SJP A;  1WOS A;  4LBY A;  4LC0 A;  4ZCL A;  5GV8 A;  5DS0 A;  4X06 A;  3E1Y E;  3CXC B;  4RM0 A;  2VNI A;  3ONY A;  2QMU A;  3CPW B;  4X7C A;  4B43 A;  2OYN A;  1PJ6 A;  1VQ9 B;  2BGJ A;  1W9X A;  1HZE A;  2BM0 A;  1TLL A;  3OW2 B;  3BNW A;  3JQP A;  3OFN A;  4Z1M A;  1EP2 B;  2Q6I A;  5A89 A;  1CNE A;  3Q3A A;  1QFZ A;  1KQS B;  1KK1 A;  2B7C A;  2BVN A;  3JQR A;  5KW9 A;  1PJ5 A;  4GQN A;  1QG0 A;  1WU8 A;  3CC2 B;  2ZZQ A;  4ACA A;  3CMA B;  5FA6 A;  5A8A A;  2CRV A;  4F7D A;  1KTV A;  4AVZ A;  1YIJ B;  3GVL A;  4B47 A;  2DY1 A;  5HXB A;  2GQF A;  2X85 A;  1ZM3 A;  2HCJ B;  2R6H A;  4FXU A;  4JMQ A;  2YWF A;  5TV2 A;  1OGJ A;  4H9G A;  3W5U A;  4XON A;  4P26 A;  4YAU A;  3U6K A;  2BN4 A;  4U9U A;  1EWY A;  1YX2 A;  4FWT A;  4UZE A;  2XNC A;  3QFT A;  4TKO B;  4WZT A;  1WOO A;  2GK6 A;  1OHH A;  4B48 A;  3WNB A;  4QUZ A;  2V7X A;  3OJW A;  4P2N A;  4PGO A;  4TMX A;  3A8I A;  1I7P A;  4B44 A;  4C43 A;  2YWE A;  5H5J A;  4XL9 A;  1F20 A;  2VBT A;  3G71 B;  3AGP A;  1W87 A;  1BPL A;  3SJZ A;  3Q39 A;  3AVU A;  4Y9U A;  4YAW A;  3VNV A;  1Q7Y D;  4G7X A;  3GQB A;  2WR8 A;  4P3I A;  3W5H A;  2Q6K A;  4DQK A;  3CPX A;  5TR9 A;  1DDG A;  4XN0 A;  3CRZ A;  2V7V A;  2VJI A;  2C2W A;  4TSF A;  2QA4 B;  1VQN B;  4KKT A;  4Z4T A;  1FNM A;  3QSY A;  1RQP A;  4XOT A;  2VBU A;  1WDT A;  3ZZT A;  1UD2 A;  4UAJ A;  4EH1 A;  3LQ6 A;  1FDR A;  2V7U A;  2D9R A;  3CCS B;  1XQB A;  4ASU A;  2YWH A;  3W2F A;  4XQF A;  1AIP A;  2BPO A;  2OK7 A;  4LBZ A;  3QE2 A;  1VHE A;  1SM4 A;  1IHM A;  1G7C A;  3LVB A;  1D2E A;  1HA3 A;  4P9S A;  1VQ6 B;  2I1L A;  1NRK A;  4XKV A;  4ZV4 A;  1Q9S A;  4E0F A;  4QVJ A;  3BCD A;  4Z4Y A;  1BLI A;  3H9N A;  3Q6Q A;  3ZZU A;  1FRN A;  4TMW A;  2WSS A;  1NBM A;  1H8H A;  4PAA A;  3RY8 A;  1N05 A;  1TUI A;  1EP3 B;  2BV3 A;  4DK0 A;  1KK0 A;  1WTH D;  1N08 A;  5TRD A;  1XFO A;  4ZGQ B;  1B23 P;  1RQR A;  3E20 A;  1QX4 A;  2WZN A;  2X0K A;  3HAG A;  4X8I A;  1KJZ A;  4P25 A;  3A35 A;  4R71 A;  1VQ4 B;  4G6I A;  4DNT B;  1UMK A;  1G7S A;  1QGZ A;  2X53 S;  3LQE A;  4QHY A;  2OTJ B;  2X6W A;  4II3 A;  1KD1 D;  2ZL5 A;  1QVG B;  2GRE A;  1VLY A;  1I18 A;  2X8K A;  2F1L A;  1V5V A;  3ASR A;  4XLC A;  2XZP A;  4IW3 B;  5J35 A;  5IYQ A;  5JBQ A;  3VMF A;  3OE7 A;  1PKV A;  1AMO A;  1W0K A;  4XMY A;  4DK1 A;  2ZL6 A;  4YAL A;  2ZXH A;  3BH4 A;  1PJ7 A;  1GJR A;  1QGA A;  5LMZ A;  3G4S B;  5KSW B;  3FKS A;  4HE5 A;  4OOS A;  5FIU A;  2B7B A;  4OOX A;  1IJE A;  2BGI A;  2QN6 A;  4OOV A;  2LZJ A;  3CES A;  1GR1 A;  2WPD A;  3FPP A;  4M4S A;  2F4N A;  3CCE B;  2OBT A;  1K28 D;  2B5O A;  2DOG A;  1M1K D;  1UD8 A;  3GVJ A;  4TMZ A;  3SLD A;  3Q38 A;  2GPJ A;  2D3N A;  1IJF A;  1FNC A;  1H8E A;  4X7E A;  3ZBT A;  2VJJ A;  3CCU B;  2D74 A;  4LBV A;  4B3X A;  4DNR B;  1UD4 A;  1GO2 A;  4CQJ A;  4X05 A;  4Y9R A;  3ZZ0 A;  4KKS A;  1T5E A;  5HKK A;  1VQP B;  4UZU A;  3WQZ A;  5IYN A;  4TN1 A;  1QGY A;  4PAB A;  3ASP A;  3CCM B;  4RD3 A;  3T53 B;  4AF6 A;  1I8D A;  3VO2 A;  5EMN A;  1K73 D;  3OEH A;  3AVT A;  1YLO A;  4XOP A;  1NDH A;  2NPF A;  2Q6O A;  4L8J A;  3ES9 A;  2W6J A;  4XNF A;  4PC6 A;  4N3N A;  1E1Q A;  4XLH A;  4HE6 A;  1G7R A;  4RPB A;  1N8R D;  1VLO A;  1VQ7 B;  2QTL A;  2ZTN A;  2KVO A;  5IK2 A;  1Q86 D;  3CCR B;  3P27 A;  5FO1 A;  2ZZG A;  4RD2 A;  4Z4S A;  3CME B;  1J9Z A;  1SKQ A;  3A8J A;  1YJN B;  1OB2 A;  1A8P A;  3A8K A;  3ISX A;  4G1B A;  3AVY A;  2JIZ A;  3Q6R A;  2QGG A;  1R5O A;  2HDN B;  1TTT A;  1ZUN B;  4NNJ A;  3W2I A;  2OBR A;  2EFG A;  4BPR A;  4WZE A;  3R6K A;  2ZZF A;  4P12 A;  3ZC3 A;  4FK8 A;  4G5G A;  2BSA A;  1WOR A;  1E63 A;  3MMP A;  3PUM A;  5E6T A;  2CND A;  1YIT B;  4UZF A;  1VQK B;  2D3L A;  1VQ8 B;  2C4U A;  2J7K A;  3WBK A;  1FND A;  2XGJ A;  5GV7 A;  1E64 A;  2X3U A;  4YEJ A;  1Q81 D;  1E3Z A;  2YWG A;  2OK8 A;  1W2B B;  1Y0R A;  1N0V C;  4WZK A;  2X6X A;  3BCF A;  3I55 B;  2XEX A;  1EXM A;  1JA0 A;  2F43 A;  2ZTG A;  1W0J A;  3SKB A;  2VBS A;  4OPS A;  3G6E B;  3LNN A;  2RC5 A;  4X07 A;  3GIR A;  1HVX A;  1FX0 A;  3QFC A;  1N0U A;  3ONU A;  4XM3 A;  4Y7C A;  3BQJ A;  1FRQ A;  1MAB A;  1ZM4 A;  4RD4 A;  1OB5 A;  1CNF A;  1T6X A;  2VNJ A;  4MYT A;  4RDJ A;  1COW A;  3CW2 A;  2CC2 A;  1YHQ B;  1EP1 B;  4YHB A;  1EFT A;  2DER A;  4FN5 A;  3DDY A;  3SEJ A;  4NBS A;  1OGI A;  4RD6 A;  1S0U A;  2AHO A;  1Y0Y A;  3U6B A;  3CB4 A;  3OZV A;  1XE1 A;  2C5B A;  4YAF A;  1E79 A;  1VQO B;  3VNU A;  4M1K A;  1N06 A;  4Z4V A;  2CW5 A;  4RLZ A;  1BX1 A;  1GVH A;  3A1P A;  1WSR A;  5IYW A;  3AGQ A;  1ZM2 A;  2HMA A;  3JQQ A;  5FO0 A;  3WBJ A;  2V7T A;  1DG1 G;  4KKU A;  1E62 A;  1WSV A;  1N07 A;  4RD1 A;  2WYR A;  2JN9 A;  1OB0 A;  3W2G A;  4Q7J B;  3B82 A;  3OOC A;  4RCY A;  2QTZ A;  3KL9 A;  2ZBV A;  4WZL A;  3AVX A;  2VNH A;  4Z4Z A;  2PLF A;  5BSY A;  5DSZ A;  4J0Q A;  2DET A;  1E43 A;  3I56 B;  2CK3 A;  4PC1 A;  4X7F A;  2V7W A;  3BY1 A;  4M0L A;  2E1B A;  2C77 A;  3W5V A;  4QV2 A;  3CP2 A;  3CC7 B;  2XZO A;  4P22 A;  3CP8 A;  1JB9 A;  2DYI A;  3LO8 A;  1W35 A;  2Z6B D;  4YXW A;  1DAR A;  2OBS A;  2RC6 A;  2QDX A;  2C4T A; 
#chains in the Genus database with same CATH homology
 5IYP A;  4Z4T A;  3Q6R A;  3LQ6 A;  3PVD A;  3R6J A;  2OBR A;  4WZE A;  3R6K A;  4P12 A;  3V7A A;  3PA2 A;  3PUM A;  1IHM A;  5E6T A;  4Z4R A;  4QVJ A;  5BSX A;  4Z4Y A;  4OP7 A;  3Q6Q A;  4QVA A;  3RY8 A;  3AST A;  4WZK A;  5J3O A;  4ROX A;  3PUN A;  4P1V A;  3SJP A;  4OPV A;  4X06 A;  3SKB A;  4P25 A;  4RM0 A;  4OPS A;  3ONY A;  5F4M A;  4X7C A;  4X07 A;  3LQE A;  4X7D A;  3PA1 A;  2ZL5 A;  3ASQ A;  3ONU A;  4X0C A;  3BQJ A;  3ASR A;  4RDJ A;  3Q3A A;  2ZL7 A;  5J35 A;  5IYQ A;  5IYR A;  5KW9 A;  3SEJ A;  2ZL6 A;  4RDL A;  4OOS A;  4OOX A;  4OOV A;  4Z4V A;  2OBT A;  4RLZ A;  5IYW A;  3SLD A;  3Q38 A;  4P26 A;  4X7E A;  3SLN A;  3BY2 A;  4WZT A;  4X05 A;  5F4J A;  4QUZ A;  5IYN A;  4P2N A;  5F4O A;  4WZL A;  3ASP A;  4Z4Z A;  4Z4W A;  5BSY A;  3ASS A;  3BY1 A;  4X7F A;  3Q39 A;  4RPB A;  5HZB A;  4QV2 A;  3D26 A;  4P3I A;  4RDK A;  2OBS A;  4RPD A;  4Z4S A;  4Z4U A;  5HZA A;  4OPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...