3LQEA

X-ray structure of the murine norovirus (mnv)-1 capsid protein protruding (p) domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
313
structure length
313
Chain Sequence
RMVDLPVIQPRLCTHARWPAPVYGLLVDPSLPSNPQWQNGRVHVDGTLLGTTPISGSWVSCFAAEAAYEFQSGTGEVATFTLIEQDGSAYVPGDRAAPLGYPDFSGQLEIEVQTETTKTGDKLKVTTFEMILGPTTNADQAPYQGRVFASVTAAASLDLVDGRVRAVPRSIYGFQDTIPEYNDGLLVPLAPPIGPFLPGEVLLRFRTYMRQIDTADAAAEAIDCALPQEFVSWFASNAFTVQSEALLLRYRNTLTGQLLFECKLYNEGYIALSYSGSGPLTFPTDGIFEVVSWVPRLYQLASVGSLATGRMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title High-resolution x-ray structure and functional analysis of the murine norovirus 1 capsid protein protruding domain.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Viral protein
total genus 63
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3lqeA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3lqeA01
4RM0A 4Z4SA 4X7FA 3Q6RA 3Q6QA 5KW9A 2ZL5A 4Z4TA 3RY8A 3SJPA 4X05A 5BSXA 3ONYA 4OPVA 2OBTA 4P1VA 4OPOA 3ASQA 5IYPA 4X7CA 4X7DA 3D26A 4P3IA 3R6KA 4RPBA 4RDLA 4WZLA 2OBRA 4X07A 4QVAA 4OPSA 3SKBA 4X0CA 5E6TA 4OOXA 4RLZA 3SLNA 4X7EA 5IYNA 3SLDA 3R6JA 4OOSA 4P26A 2OBSA 4OOVA 5J35A 4Z4VA 2ZL7A 3PUNA 3LQ6A 4WZEA 3PVDA 5F4JA 4Z4ZA 5J3OA 2ZL6A 3Q39A 3PUMA 4QVJA 3ASSA 4ROXA 3ONUA 3ASRA 5HZAA 5F4MA 4RPDA 4WZKA 1IHMA 5IYWA 4QUZA 4X06A 3BQJA 5IYRA 4Z4UA 4P2NA 4Z4RA 3SEJA 5IYQA 4QV2A 4RDJA 4Z4WA 4Z4YA 3BY2A 4P12A 3Q3AA 3PA2A 4RDKA 3V7AA 5BSYA 3PA1A 4WZTA 4OP7A 3BY1A 3LQEA 3ASPA 4P25A 3ASTA 5HZBA 5F4OA 3Q38A
chains in the Genus database with same CATH superfamily
4RCZA 1V0EA 1E79A 2VNKA 3MHPA 1WOPA 3CP2A 2V7VA 4AVZA 2XGJA 2V7XA 2WJVA 2JJ1A 2ZTNA 1VQ7B 4TMWA 4G5GA 2GPJA 4IW3B 4UZUA 4B44A 3WBJA 1QUFA 4AC9A 1M1KD 2E1BA 2OBTA 3BCFA 4TMVA 1HZEA 2W6IA 1VQ8B 3WBKA 1EFTA 2RC6A 2YWHA 2J7KA 2YWEA 2OK8A 1KK0A 1VHOA 2DCUA 4X07A 1N07A 3QFCA 4B4DA 3OE7A 4NCNA 4X0CA 1WSVA 1VQKB 1P4MA 1EP2B 5E6TA 1V5VA 3G05A 1ELOA 2FX3A 4RLZA 1R5BA 4Z1MA 1GO2A 2F1MA 2VNHA 4LBZA 1YJWB 3OJXA 4PAAA 4OOSA 1VQPB 1GVHA 3LVBA 4LBWA 4R71A 1EWYA 4TN1A 1KD1D 5J35A 2QTLA 4Z4VA 2BSAA 3A3BA 3OZVA 1S0UA 4QFMA 2CF4A 3VMFA 1W2BB 3WXMA 4XMYA 1VLOA 3MCAA 2R6HA 3CCUB 4XOTA 3CRZA 5FA6A 3PVDA 1E63A 1E1QA 3BCDA 2C5BA 1VQ9B 3CB4A 4II3A 5F4JA 3GQBA 3CCMB 4Z4ZA 2PIAA 2KVOA 1NB9A 3HAGA 3SJZA 4RD0A 5LMZA 3I55B 1G7CA 3GIRA 3T53B 3CMEB 3WNBA 4PC7A 2VNJA 3QFRA 1F60A 3ONUA 2JN9A 4LBYA 5THXA 1YHQB 2WZPP 3ASRA 3CPXA 4XN3A 1W35A 3FPKA 4XORA 2VBTA 2CW5A 5TRDA 5IYWA 2HDNB 4C43A 1DDIA 1FDRA 2OK7A 2ZZEA 3V76A 5FO1A 3ZC3A 1QFJA 4KKUA 2BGJA 4N3GA 4NBSA 4UAJA 3A35A 4B48A 2VNIA 5CDFA 4PC1A 4FXUA 5TR9A 1EFUA 1FNDA 1UD8A 4UZFA 2C78A 2GK7A 4Z4RA 2WSSA 1VHEA 2C4TA 5IYQA 3WYAA 1G7TA 2QMUA 1E62A 1E3ZA 1OB2A 3BY2A 4YEJA 2XNCA 1A8PA 1NB0A 3GVJA 3Q3AA 3W2EA 1XQBA 1WP6A 1IJFA 5DSZA 1JJ2B 1UD5A 4MYUA 2HCJB 2V4DA 1DDGA 2I1LA 3U6KA 3ZBUA 4P25A 3ASTA 2ZZQA 3OZWA 5F4OA 1KK1A 1QUEA 2XZLA 1UD6A 4FK8A 4DQKA 2QDXA 5HXBA 3A8JA 4PC2A 4RM0A 2E1RA 4Z4SA 1K9MD 1XFOA 3AGPA 3Q6QA 2ZL5A 2JDIA 2YWFA 5TY0A 1I8DA 1G7SA 3W2HA 1OHHA 2JIZA 4AF6A 4P1VA 4L8JA 1B23P 3AVTA 2Q6IA 1K28D 2V7TA 3A8KA 1RQRA 2OYNA 5KSWB 5IYPA 5H59A 2GJKA 2M5SA 4RPBA 1VQNB 2WJYA 4Y7CA 4WZLA 1EP1B 2OBRA 1R5NA 1NBMA 1D1NA 1G7RA 4OPSA 1UMKA 3KL9A 2ZITA 3ZPNA 3AVVA 1BMFA 3U2QA 2WZNA 1FNBA 2ZZFA 4ZGNB 1YITB 1IJEA 4XLEA 3OW7A 4XLFA 5TV2A 3VO1A 4ACAA 4P26A 3BNWA 2WYRA 1QVFB 4PC3A 2OBSA 3OOCA 2F43A 4ACBA 4ZCMA 3CCRB 1KTVA 3W5HA 3QE2A 3OKXA 3CC2B 3OJWA 2GREA 3LQ6A 3QFSA 1PJ6A 1S4MA 1OGJA 2AHOA 3VO2A 2XNJA 2Q6KA 2X8KA 3ZBTA 4BPRA 1J9ZA 4XKWA 1N06A 1OGIA 1W9XA 3FJOA 4XLCA 4ZCIA 4P22A 4M53A 2NV4A 2P3MA 2BVNA 1GJRA 2EIXA 3T51B 3ZZUA 2LZJA 2BM0A 4G1BA 2V7UA 4QVJA 1TUIA 2PMDA 2VBVA 2VJJA 2X53S 2GQFA 3AVXA 5HZAA 4WWVA 5F4MA 3CCVB 1ZM2A 4ZV4A 4RPDA 3CMMA 2DETA 4DNTB 4WZKA 3OEEA 1XB2A 4GQNA 4YHBA 3OZUA 4QUZA 3T56B 2OTJB 2ZTGA 1BX0A 3BQJA 5IYRA 2EFGA 2W6JA 4XONA 3WY9A 1HVXA 1K73D 1TTTA 1COWA 3FPPA 3MMPA 3H9NA 1SM4A 1Y0RA 3NE5B 1EXMA 4G7WA 3SEJA 3CPWB 1NJID 4QV2A 1OB5A 5JBQA 1HA3A 1IB0A 5GV7A 1CNEA 2QN6A 2QTZA 4C0SA 3G4SB 1Q86D 4G7XA 1YI2B 1YJ9B 3PA2A 1AIPA 4RDKA 2DEUA 1N0VC 2B7CA 2VBSA 2VZLA 2F1LA 2X85A 4UZEA 3BY1A 3JQRA 4XR6A 4B3FX 2CNDA 1Q9SA 2DY1A 2PLFA 4G6IA 4YAUA 1YLOA 2WR8A 3I56B 1JA0A 3WNDA 3OPOA 4P6YA 3P27A 1FX0A 1W34A 3E20A 3B78A 3LO8A 1B2RA 4M4SA 3Q6RA 4X7FA 1N8RD 2QA4B 1W87A 3CP8A 1YJNB 4FN5A 3ZZTA 1KK2A 4XLAA 5KW9A 4Z4TA 3W5UA 3DDYA 3SJPA 3G71B 3QSYA 3U6BA 1H85A 1TVCA 2X0KA 3JU4A 4TT3A 4NNJA 4YAOA 5IK2A 1S72B 4YAFA 1KJZA 2DIEA 3GSIA 4OPOA 4KKSA 2VYQA 4CQJA 4PGOA 2VJIA 3AVYA 4X7CA 4P3IA 3ZIAA 3R6KA 3G6EB 1E64A 1VJSA 1WOSA 2YWGA 4QVAA 4ZGQB 4HIZA 3SKBA 2CRVA 2C5HA 4TMXA 3ES9A 1WSRA 1EFCA 4Y9UA 5A88A 3W5VA 1BPLA 1T6XA 4FWTA 3SLNA 1EFRA 3LNNA 4XNFA 1WPCA 2JJ2A 1YIJB 4WQMA 3SLDA 2C77A 4X8IA 2XEXA 3R6JA 2GK6A 2V7WA 1MABA 2BMWA 2GJRA 1TLLA 1WTHD 4QHYA 1KK3A 2ZL7A 1VQ6B 4XL9A 1F20A 2BM1A 2QE7A 1VQOB 3KEWA 5L46A 1QVGB 1QG0A 1W0JA 3OW2B 2XOKA 2CC2A 3CCJB 4JMQA 4XD7A 2ZL6A 3Q39A 3PUMA 1BJKA 2BGIA 2ZBVA 4B3GA 1CQXA 3JQQA 4KKTA 4RCYA 1Q82D 3B82A 2Z6BD 1BQEA 2C4UA 4DNRB 1WDTA 4U9UA 2D3NA 2F4NA 1K8AD 2HLDA 3A3GA 4TSFA 1ZUNB 4ASUA 1D2EA 2B5OA 1DARA 1I7PA 1NRKA 3CCLB 1FNMA 4MYTA 4M0LA 3CC7B 1KC8D 1VQ4B 3B8HA 2V7QA 1CNFA 4X06A 1JB9A 1FRQA 4YALA 2Q6LA 4P2NA 1Y0YA 1VQMB 2GJPA 3VNVA 3BC9A 1V0FA 1I18A 4Z4WA 3J81k 4TMTA 3VNUA 3OEHA 4XM3A 4Q7JB 1NDHA 1H8EA 1U2RA 5B6IA 4HE6A 4E0FA 5EMNA 2V31A 1ZM4A 3AVWA 3V7AA 1PJ7A 2D9RA 1E1RA 4WZTA 2ZZGA 4OP7A 4F7DA 3I1FA 3CCEB 2ZBUA 1UD3A 3W2GA 5HZBA 4XLHA 2DOGA 5KNLA 1QFYA 3WNCA 1QX4A 1VLYA 3Q38A 4DK0A 3E1YE 4G1VA 1BX1A 5FIUA 4P9SA 2QGGA 3CXCB 1WOOA 1QGAA 1PJ5A 2QEXB 3AVUA 4N3NA 4XKVA 4AF7A 3BH4A 1N0UA 1MRZA 1WORA 1GAQA 1PKVA 3RY8A 4XN0A 5BSXA 1QFZA 4X05A 4DQLA 4Y9RA 3ONYA 2ZXHA 4OPVA 4RD2A 2NPFA 4P3YA 2BV3A 1SKQA 1ZM9A 4PC6A 3ISXA 1T6YA 4RD6A 3ASQA 3CW2A 3QFTA 3CD6B 4X7DA 3D26A 4LC0A 2X6WA 4RDLA 2Q6OA 1KQSB 3A8IA 3CTAA 1KMHA 4P6VF 4ZCLA 1QGYA 1R5OA 2WPDA 4K1XA 4M1KA 2RC5A 2DERA 2C2WA 3CMAB 3AGQA 4H9GA 2X3UA 4OOXA 1SKYB 3VR6A 2X6XA 1AMOA 4J0QA 4X7EA 3ZUGA 5IYNA 4B43A 4RJLA 1UD4A 5FO0A 2HMAA 1GR1A 2ZXIA 3H94A 3W2IA 4OOVA 5A89A 1JNYA 1VQ5B 2XNDA 5DS0A 1EP3B 2D3LA 4II2A 5H5JA 4RD4A 1XE1A 3OFNA 3PUNA 4M2LA 1JA1A 1FNCA 2PE3A 2X6YA 4PABA 4WZEA 5HKKA 5FL7A 3PENA 4YELA 2DYIA 2VBUA 3ZZ0A 1M90D 1E43A 1KZLA 1RQPA 2BPOA 1FRNA 5J3OA 1DG1G 2OTLB 2CBXA 1UD2A 4LBVA 3ASSA 3FKSA 1BLIA 4ROXA 1N05A 1E3XA 1H42A 4TMZA 4B47A 1QH0A 3CC4B 2D74A 1IHMA 3P26A 1VQLB 3JQPA 1QGZA 1Q81D 3CCSB 4YAWA 4DK1A 4HE5A 3WQZA 1VF7A 1OB0A 2XZPA 4Z4UA 4RD1A 5DN6A 2BF4A 1W0KA 1ZM3A 3CESA 3GVKA 4RDJA 4Z4YA 2B7BA 1GAWA 1H8HA 4P12A 1T6ZA 1Q7YD 1D8TA 4XOPA 1N08A 4TKOB 5FNZA 5A8AA 4RD3A 5BSYA 1KRHA 3GVLA 3PA1A 2CK3A 4XQFA 2BN4A 2R9VA 4EH1A 3CCQB 4YXWA 3OP1A 3LQEA 1WU8A 1YX2A 3A1PA 3ASPA 2XZOA 5AN9A 2FVGA 1T5EA 5GV8A 3W2FA 4B3XA 3OAAA
chains in the Genus database with same CATH topology
4RM0A 4Z4SA 4X7FA 3Q6RA 3Q6QA 5KW9A 2ZL5A 4Z4TA 3RY8A 3SJPA 4X05A 5BSXA 3ONYA 4OPVA 2OBTA 4P1VA 4OPOA 3ASQA 5IYPA 4X7CA 4X7DA 3D26A 4P3IA 3R6KA 4RPBA 4RDLA 4WZLA 2OBRA 4X07A 4QVAA 4OPSA 3SKBA 4X0CA 5E6TA 4OOXA 4RLZA 3SLNA 4X7EA 5IYNA 3SLDA 3R6JA 4OOSA 4P26A 2OBSA 4OOVA 5J35A 4Z4VA 2ZL7A 3PUNA 3LQ6A 4WZEA 3PVDA 5F4JA 4Z4ZA 5J3OA 2ZL6A 3Q39A 3PUMA 4QVJA 3ASSA 4ROXA 3ONUA 3ASRA 5HZAA 5F4MA 4RPDA 4WZKA 1IHMA 5IYWA 4QUZA 4X06A 3BQJA 5IYRA 4Z4UA 4P2NA 4Z4RA 3SEJA 5IYQA 4QV2A 4RDJA 4Z4WA 4Z4YA 3BY2A 4P12A 3Q3AA 3PA2A 4RDKA 3V7AA 5BSYA 3PA1A 4WZTA 4OP7A 3BY1A 3LQEA 3ASPA 4P25A 3ASTA 5HZBA 5F4OA 3Q38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RM0 A;  4Z4S A;  4X7F A;  3Q6R A;  3Q6Q A;  5KW9 A;  2ZL5 A;  4Z4T A;  3RY8 A;  3SJP A;  4X05 A;  5BSX A;  3ONY A;  4OPV A;  2OBT A;  4P1V A;  4OPO A;  3ASQ A;  5IYP A;  4X7C A;  4X7D A;  3D26 A;  4P3I A;  3R6K A;  4RPB A;  4RDL A;  4WZL A;  2OBR A;  4X07 A;  4QVA A;  4OPS A;  3SKB A;  4X0C A;  5E6T A;  4OOX A;  4RLZ A;  3SLN A;  4X7E A;  5IYN A;  3SLD A;  3R6J A;  4OOS A;  4P26 A;  2OBS A;  4OOV A;  5J35 A;  4Z4V A;  2ZL7 A;  3PUN A;  3LQ6 A;  4WZE A;  3PVD A;  5F4J A;  4Z4Z A;  5J3O A;  2ZL6 A;  3Q39 A;  3PUM A;  4QVJ A;  3ASS A;  4ROX A;  3ONU A;  3ASR A;  5HZA A;  5F4M A;  4RPD A;  4WZK A;  1IHM A;  5IYW A;  4QUZ A;  4X06 A;  3BQJ A;  5IYR A;  4Z4U A;  4P2N A;  4Z4R A;  3SEJ A;  5IYQ A;  4QV2 A;  4RDJ A;  4Z4W A;  4Z4Y A;  3BY2 A;  4P12 A;  3Q3A A;  3PA2 A;  4RDK A;  3V7A A;  5BSY A;  3PA1 A;  4WZT A;  4OP7 A;  3BY1 A;  3LQE A;  3ASP A;  4P25 A;  3AST A;  5HZB A;  5F4O A;  3Q38 A; 
#chains in the Genus database with same CATH topology
 4RCZ A;  1V0E A;  1E79 A;  2VNK A;  3MHP A;  1WOP A;  3CP2 A;  2V7V A;  4AVZ A;  2XGJ A;  2V7X A;  2WJV A;  2JJ1 A;  2ZTN A;  1VQ7 B;  4TMW A;  4G5G A;  2GPJ A;  4IW3 B;  4UZU A;  4B44 A;  3WBJ A;  1QUF A;  4AC9 A;  1M1K D;  2E1B A;  2OBT A;  3BCF A;  4TMV A;  1HZE A;  2W6I A;  1VQ8 B;  3WBK A;  1EFT A;  2RC6 A;  2YWH A;  2J7K A;  2YWE A;  2OK8 A;  1KK0 A;  1VHO A;  2DCU A;  4X07 A;  1N07 A;  3QFC A;  4B4D A;  3OE7 A;  4NCN A;  4X0C A;  1WSV A;  1VQK B;  1P4M A;  1EP2 B;  5E6T A;  1V5V A;  3G05 A;  1ELO A;  2FX3 A;  4RLZ A;  1R5B A;  4Z1M A;  1GO2 A;  2F1M A;  2VNH A;  4LBZ A;  1YJW B;  3OJX A;  4PAA A;  4OOS A;  1VQP B;  1GVH A;  3LVB A;  4LBW A;  4R71 A;  1EWY A;  4TN1 A;  1KD1 D;  5J35 A;  2QTL A;  4Z4V A;  2BSA A;  3A3B A;  3OZV A;  1S0U A;  4QFM A;  2CF4 A;  3VMF A;  1W2B B;  3WXM A;  4XMY A;  1VLO A;  3MCA A;  2R6H A;  3CCU B;  4XOT A;  3CRZ A;  5FA6 A;  3PVD A;  1E63 A;  1E1Q A;  3BCD A;  2C5B A;  1VQ9 B;  3CB4 A;  4II3 A;  5F4J A;  3GQB A;  3CCM B;  4Z4Z A;  2PIA A;  2KVO A;  1NB9 A;  3HAG A;  3SJZ A;  4RD0 A;  5LMZ A;  3I55 B;  1G7C A;  3GIR A;  3T53 B;  3CME B;  3WNB A;  4PC7 A;  2VNJ A;  3QFR A;  1F60 A;  3ONU A;  2JN9 A;  4LBY A;  5THX A;  1YHQ B;  2WZP P;  3ASR A;  3CPX A;  4XN3 A;  1W35 A;  3FPK A;  4XOR A;  2VBT A;  2CW5 A;  5TRD A;  5IYW A;  2HDN B;  4C43 A;  1DDI A;  1FDR A;  2OK7 A;  2ZZE A;  3V76 A;  5FO1 A;  3ZC3 A;  1QFJ A;  4KKU A;  2BGJ A;  4N3G A;  4NBS A;  4UAJ A;  3A35 A;  4B48 A;  2VNI A;  5CDF A;  4PC1 A;  4FXU A;  5TR9 A;  1EFU A;  1FND A;  1UD8 A;  4UZF A;  2C78 A;  2GK7 A;  4Z4R A;  2WSS A;  1VHE A;  2C4T A;  5IYQ A;  3WYA A;  1G7T A;  2QMU A;  1E62 A;  1E3Z A;  1OB2 A;  3BY2 A;  4YEJ A;  2XNC A;  1A8P A;  1NB0 A;  3GVJ A;  3Q3A A;  3W2E A;  1XQB A;  1WP6 A;  1IJF A;  5DSZ A;  1JJ2 B;  1UD5 A;  4MYU A;  2HCJ B;  2V4D A;  1DDG A;  2I1L A;  3U6K A;  3ZBU A;  4P25 A;  3AST A;  2ZZQ A;  3OZW A;  5F4O A;  1KK1 A;  1QUE A;  2XZL A;  1UD6 A;  4FK8 A;  4DQK A;  2QDX A;  5HXB A;  3A8J A;  4PC2 A;  4RM0 A;  2E1R A;  4Z4S A;  1K9M D;  1XFO A;  3AGP A;  3Q6Q A;  2ZL5 A;  2JDI A;  2YWF A;  5TY0 A;  1I8D A;  1G7S A;  3W2H A;  1OHH A;  2JIZ A;  4AF6 A;  4P1V A;  4L8J A;  1B23 P;  3AVT A;  2Q6I A;  1K28 D;  2V7T A;  3A8K A;  1RQR A;  2OYN A;  5KSW B;  5IYP A;  5H59 A;  2GJK A;  2M5S A;  4RPB A;  1VQN B;  2WJY A;  4Y7C A;  4WZL A;  1EP1 B;  2OBR A;  1R5N A;  1NBM A;  1D1N A;  1G7R A;  4OPS A;  1UMK A;  3KL9 A;  2ZIT A;  3ZPN A;  3AVV A;  1BMF A;  3U2Q A;  2WZN A;  1FNB A;  2ZZF A;  4ZGN B;  1YIT B;  1IJE A;  4XLE A;  3OW7 A;  4XLF A;  5TV2 A;  3VO1 A;  4ACA A;  4P26 A;  3BNW A;  2WYR A;  1QVF B;  4PC3 A;  2OBS A;  3OOC A;  2F43 A;  4ACB A;  4ZCM A;  3CCR B;  1KTV A;  3W5H A;  3QE2 A;  3OKX A;  3CC2 B;  3OJW A;  2GRE A;  3LQ6 A;  3QFS A;  1PJ6 A;  1S4M A;  1OGJ A;  2AHO A;  3VO2 A;  2XNJ A;  2Q6K A;  2X8K A;  3ZBT A;  4BPR A;  1J9Z A;  4XKW A;  1N06 A;  1OGI A;  1W9X A;  3FJO A;  4XLC A;  4ZCI A;  4P22 A;  4M53 A;  2NV4 A;  2P3M A;  2BVN A;  1GJR A;  2EIX A;  3T51 B;  3ZZU A;  2LZJ A;  2BM0 A;  4G1B A;  2V7U A;  4QVJ A;  1TUI A;  2PMD A;  2VBV A;  2VJJ A;  2X53 S;  2GQF A;  3AVX A;  5HZA A;  4WWV A;  5F4M A;  3CCV B;  1ZM2 A;  4ZV4 A;  4RPD A;  3CMM A;  2DET A;  4DNT B;  4WZK A;  3OEE A;  1XB2 A;  4GQN A;  4YHB A;  3OZU A;  4QUZ A;  3T56 B;  2OTJ B;  2ZTG A;  1BX0 A;  3BQJ A;  5IYR A;  2EFG A;  2W6J A;  4XON A;  3WY9 A;  1HVX A;  1K73 D;  1TTT A;  1COW A;  3FPP A;  3MMP A;  3H9N A;  1SM4 A;  1Y0R A;  3NE5 B;  1EXM A;  4G7W A;  3SEJ A;  3CPW B;  1NJI D;  4QV2 A;  1OB5 A;  5JBQ A;  1HA3 A;  1IB0 A;  5GV7 A;  1CNE A;  2QN6 A;  2QTZ A;  4C0S A;  3G4S B;  1Q86 D;  4G7X A;  1YI2 B;  1YJ9 B;  3PA2 A;  1AIP A;  4RDK A;  2DEU A;  1N0V C;  2B7C A;  2VBS A;  2VZL A;  2F1L A;  2X85 A;  4UZE A;  3BY1 A;  3JQR A;  4XR6 A;  4B3F X;  2CND A;  1Q9S A;  2DY1 A;  2PLF A;  4G6I A;  4YAU A;  1YLO A;  2WR8 A;  3I56 B;  1JA0 A;  3WND A;  3OPO A;  4P6Y A;  3P27 A;  1FX0 A;  1W34 A;  3E20 A;  3B78 A;  3LO8 A;  1B2R A;  4M4S A;  3Q6R A;  4X7F A;  1N8R D;  2QA4 B;  1W87 A;  3CP8 A;  1YJN B;  4FN5 A;  3ZZT A;  1KK2 A;  4XLA A;  5KW9 A;  4Z4T A;  3W5U A;  3DDY A;  3SJP A;  3G71 B;  3QSY A;  3U6B A;  1H85 A;  1TVC A;  2X0K A;  3JU4 A;  4TT3 A;  4NNJ A;  4YAO A;  5IK2 A;  1S72 B;  4YAF A;  1KJZ A;  2DIE A;  3GSI A;  4OPO A;  4KKS A;  2VYQ A;  4CQJ A;  4PGO A;  2VJI A;  3AVY A;  4X7C A;  4P3I A;  3ZIA A;  3R6K A;  3G6E B;  1E64 A;  1VJS A;  1WOS A;  2YWG A;  4QVA A;  4ZGQ B;  4HIZ A;  3SKB A;  2CRV A;  2C5H A;  4TMX A;  3ES9 A;  1WSR A;  1EFC A;  4Y9U A;  5A88 A;  3W5V A;  1BPL A;  1T6X A;  4FWT A;  3SLN A;  1EFR A;  3LNN A;  4XNF A;  1WPC A;  2JJ2 A;  1YIJ B;  4WQM A;  3SLD A;  2C77 A;  4X8I A;  2XEX A;  3R6J A;  2GK6 A;  2V7W A;  1MAB A;  2BMW A;  2GJR A;  1TLL A;  1WTH D;  4QHY A;  1KK3 A;  2ZL7 A;  1VQ6 B;  4XL9 A;  1F20 A;  2BM1 A;  2QE7 A;  1VQO B;  3KEW A;  5L46 A;  1QVG B;  1QG0 A;  1W0J A;  3OW2 B;  2XOK A;  2CC2 A;  3CCJ B;  4JMQ A;  4XD7 A;  2ZL6 A;  3Q39 A;  3PUM A;  1BJK A;  2BGI A;  2ZBV A;  4B3G A;  1CQX A;  3JQQ A;  4KKT A;  4RCY A;  1Q82 D;  3B82 A;  2Z6B D;  1BQE A;  2C4U A;  4DNR B;  1WDT A;  4U9U A;  2D3N A;  2F4N A;  1K8A D;  2HLD A;  3A3G A;  4TSF A;  1ZUN B;  4ASU A;  1D2E A;  2B5O A;  1DAR A;  1I7P A;  1NRK A;  3CCL B;  1FNM A;  4MYT A;  4M0L A;  3CC7 B;  1KC8 D;  1VQ4 B;  3B8H A;  2V7Q A;  1CNF A;  4X06 A;  1JB9 A;  1FRQ A;  4YAL A;  2Q6L A;  4P2N A;  1Y0Y A;  1VQM B;  2GJP A;  3VNV A;  3BC9 A;  1V0F A;  1I18 A;  4Z4W A;  3J81 k;  4TMT A;  3VNU A;  3OEH A;  4XM3 A;  4Q7J B;  1NDH A;  1H8E A;  1U2R A;  5B6I A;  4HE6 A;  4E0F A;  5EMN A;  2V31 A;  1ZM4 A;  3AVW A;  3V7A A;  1PJ7 A;  2D9R A;  1E1R A;  4WZT A;  2ZZG A;  4OP7 A;  4F7D A;  3I1F A;  3CCE B;  2ZBU A;  1UD3 A;  3W2G A;  5HZB A;  4XLH A;  2DOG A;  5KNL A;  1QFY A;  3WNC A;  1QX4 A;  1VLY A;  3Q38 A;  4DK0 A;  3E1Y E;  4G1V A;  1BX1 A;  5FIU A;  4P9S A;  2QGG A;  3CXC B;  1WOO A;  1QGA A;  1PJ5 A;  2QEX B;  3AVU A;  4N3N A;  4XKV A;  4AF7 A;  3BH4 A;  1N0U A;  1MRZ A;  1WOR A;  1GAQ A;  1PKV A;  3RY8 A;  4XN0 A;  5BSX A;  1QFZ A;  4X05 A;  4DQL A;  4Y9R A;  3ONY A;  2ZXH A;  4OPV A;  4RD2 A;  2NPF A;  4P3Y A;  2BV3 A;  1SKQ A;  1ZM9 A;  4PC6 A;  3ISX A;  1T6Y A;  4RD6 A;  3ASQ A;  3CW2 A;  3QFT A;  3CD6 B;  4X7D A;  3D26 A;  4LC0 A;  2X6W A;  4RDL A;  2Q6O A;  1KQS B;  3A8I A;  3CTA A;  1KMH A;  4P6V F;  4ZCL A;  1QGY A;  1R5O A;  2WPD A;  4K1X A;  4M1K A;  2RC5 A;  2DER A;  2C2W A;  3CMA B;  3AGQ A;  4H9G A;  2X3U A;  4OOX A;  1SKY B;  3VR6 A;  2X6X A;  1AMO A;  4J0Q A;  4X7E A;  3ZUG A;  5IYN A;  4B43 A;  4RJL A;  1UD4 A;  5FO0 A;  2HMA A;  1GR1 A;  2ZXI A;  3H94 A;  3W2I A;  4OOV A;  5A89 A;  1JNY A;  1VQ5 B;  2XND A;  5DS0 A;  1EP3 B;  2D3L A;  4II2 A;  5H5J A;  4RD4 A;  1XE1 A;  3OFN A;  3PUN A;  4M2L A;  1JA1 A;  1FNC A;  2PE3 A;  2X6Y A;  4PAB A;  4WZE A;  5HKK A;  5FL7 A;  3PEN A;  4YEL A;  2DYI A;  2VBU A;  3ZZ0 A;  1M90 D;  1E43 A;  1KZL A;  1RQP A;  2BPO A;  1FRN A;  5J3O A;  1DG1 G;  2OTL B;  2CBX A;  1UD2 A;  4LBV A;  3ASS A;  3FKS A;  1BLI A;  4ROX A;  1N05 A;  1E3X A;  1H42 A;  4TMZ A;  4B47 A;  1QH0 A;  3CC4 B;  2D74 A;  1IHM A;  3P26 A;  1VQL B;  3JQP A;  1QGZ A;  1Q81 D;  3CCS B;  4YAW A;  4DK1 A;  4HE5 A;  3WQZ A;  1VF7 A;  1OB0 A;  2XZP A;  4Z4U A;  4RD1 A;  5DN6 A;  2BF4 A;  1W0K A;  1ZM3 A;  3CES A;  3GVK A;  4RDJ A;  4Z4Y A;  2B7B A;  1GAW A;  1H8H A;  4P12 A;  1T6Z A;  1Q7Y D;  1D8T A;  4XOP A;  1N08 A;  4TKO B;  5FNZ A;  5A8A A;  4RD3 A;  5BSY A;  1KRH A;  3GVL A;  3PA1 A;  2CK3 A;  4XQF A;  2BN4 A;  2R9V A;  4EH1 A;  3CCQ B;  4YXW A;  3OP1 A;  3LQE A;  1WU8 A;  1YX2 A;  3A1P A;  3ASP A;  2XZO A;  5AN9 A;  2FVG A;  1T5E A;  5GV8 A;  3W2F A;  4B3X A;  3OAA A; 
#chains in the Genus database with same CATH homology
 4RM0 A;  4Z4S A;  4X7F A;  3Q6R A;  3Q6Q A;  5KW9 A;  2ZL5 A;  4Z4T A;  3RY8 A;  3SJP A;  4X05 A;  5BSX A;  3ONY A;  4OPV A;  2OBT A;  4P1V A;  4OPO A;  3ASQ A;  5IYP A;  4X7C A;  4X7D A;  3D26 A;  4P3I A;  3R6K A;  4RPB A;  4RDL A;  4WZL A;  2OBR A;  4X07 A;  4QVA A;  4OPS A;  3SKB A;  4X0C A;  5E6T A;  4OOX A;  4RLZ A;  3SLN A;  4X7E A;  5IYN A;  3SLD A;  3R6J A;  4OOS A;  4P26 A;  2OBS A;  4OOV A;  5J35 A;  4Z4V A;  2ZL7 A;  3PUN A;  3LQ6 A;  4WZE A;  3PVD A;  5F4J A;  4Z4Z A;  5J3O A;  2ZL6 A;  3Q39 A;  3PUM A;  4QVJ A;  3ASS A;  4ROX A;  3ONU A;  3ASR A;  5HZA A;  5F4M A;  4RPD A;  4WZK A;  1IHM A;  5IYW A;  4QUZ A;  4X06 A;  3BQJ A;  5IYR A;  4Z4U A;  4P2N A;  4Z4R A;  3SEJ A;  5IYQ A;  4QV2 A;  4RDJ A;  4Z4W A;  4Z4Y A;  3BY2 A;  4P12 A;  3Q3A A;  3PA2 A;  4RDK A;  3V7A A;  5BSY A;  3PA1 A;  4WZT A;  4OP7 A;  3BY1 A;  3LQE A;  3ASP A;  4P25 A;  3AST A;  5HZB A;  5F4O A;  3Q38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...