3LQEA

X-ray structure of the murine norovirus (mnv)-1 capsid protein protruding (p) domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
313
structure length
313
Chain Sequence
RMVDLPVIQPRLCTHARWPAPVYGLLVDPSLPSNPQWQNGRVHVDGTLLGTTPISGSWVSCFAAEAAYEFQSGTGEVATFTLIEQDGSAYVPGDRAAPLGYPDFSGQLEIEVQTETTKTGDKLKVTTFEMILGPTTNADQAPYQGRVFASVTAAASLDLVDGRVRAVPRSIYGFQDTIPEYNDGLLVPLAPPIGPFLPGEVLLRFRTYMRQIDTADAAAEAIDCALPQEFVSWFASNAFTVQSEALLLRYRNTLTGQLLFECKLYNEGYIALSYSGSGPLTFPTDGIFEVVSWVPRLYQLASVGSLATGRMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution x-ray structure and functional analysis of the murine norovirus 1 capsid protein protruding domain.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Viral protein
molecule keywords Capsid protein
total genus 63
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3lqeA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3lqeA01
3PVDA 3SLNA 4WZLA 5BSXA 4Z4SA 3BY1A 5BSYA 4OOSA 5IYPA 4X7DA 5HZBA 4Z4RA 4X7EA 4RDJA 4WZKA 4Z4YA 3BQJA 5J3OA 3LQEA 3V7AA 3Q3AA 2ZL7A 3Q6RA 1IHMA 5F4MA 4OPOA 5F4JA 3ASTA 5IYNA 2OBTA 3BY2A 4QV2A 5IYQA 3SEJA 4P1VA 4X06A 4RLZA 2OBSA 3Q39A 4X7FA 4Z4WA 4P25A 3SKBA 3D26A 4X0CA 3ASSA 4Z4ZA 2ZL5A 3R6JA 3ASQA 5HZAA 3R6KA 3RY8A 4Z4TA 3Q6QA 4P26A 5E6TA 4P3IA 4X7CA 3PUNA 4RPBA 3PA1A 4RDKA 3PA2A 4OPVA 4P2NA 4OP7A 5IYWA 3SJPA 3ONYA 2OBRA 4ROXA 4QUZA 4Z4VA 3LQ6A 4RDLA 3ASPA 4QVAA 4WZEA 4RM0A 4Z4UA 3SLDA 4X05A 5J35A 4OOVA 5IYRA 4OPSA 4QVJA 5F4OA 4WZTA 3PUMA 4P12A 3ASRA 4X07A 3ONUA 4RPDA 2ZL6A 5KW9A 4OOXA 3Q38A
chains in the Genus database with same CATH superfamily
4P6VF 4B44A 3OP1A 3AVXA 1KK3A 3JU4A 1MRZA 3OJXA 4BPRA 1E64A 2F43A 1PKVA 1NJID 3BY1A 2OYNA 1VQOB 3BC9A 3W2HA 4OOSA 1DARA 4X7DA 3U2QA 1KC8D 1VQNB 3OZVA 3CPWB 4G5GA 4CQJA 4X7EA 1K8AD 2PMDA 3CP2A 4RDJA 1RQPA 1BJKA 1BPLA 2ZTGA 1COWA 2GK7A 3BQJA 1QFZA 2FX3A 2F4NA 4PGOA 4YAFA 5GV7A 2QA4B 4G1BA 2BVNA 3CC7B 1YITB 4XKWA 4RD0A 2Q6OA 2ZL7A 1IHMA 4QHYA 5F4MA 1AIPA 3CCSB 4OPOA 4XQFA 2W6IA 1W87A 2DETA 1WOOA 3CC4B 1ZUNB 2XNCA 4II3A 1ELOA 2CNDA 3FJOA 3W2GA 3ZIAA 4G7WA 4RD3A 2ZITA 2AHOA 1E79A 1YLOA 1J9ZA 4UZEA 5FO1A 4Q7JB 3U6BA 3T56B 3I1FA 4QV2A 4NNJA 5IYQA 4PC2A 1W0KA 4P1VA 5DS0A 2V7VA 2Q6IA 4X06A 4AVZA 5LMZA 2HMAA 3OOCA 4MYTA 4XLEA 1W34A 3CB4A 4B3GA 1BX0A 1H42A 3JQPA 3W5HA 4EH1A 3AVTA 3D26A 1GVHA 3FPPA 4Z4ZA 1QX4A 3R6JA 3ASQA 4TKOB 2PLFA 2RC6A 3OEEA 4Y9UA 5GV8A 4RD4A 2ZBUA 1GR1A 1UD6A 4YEJA 2XNDA 3KL9A 1E63A 4DQLA 4NCNA 3OAAA 2V7TA 3OFNA 4P6YA 4LBZA 3CMEB 1ZM3A 1KK1A 1OB0A 2X53S 1Y0RA 4JMQA 3JQRA 4RPBA 2C2WA 2QMUA 4R71A 1V0FA 1Q82D 4RCYA 4N3NA 1EFRA 1CNFA 1DG1G 2CK3A 2WR8A 2GREA 4P2NA 3KEWA 4OP7A 1RQRA 4ASUA 3SJPA 1QVFB 1K9MD 1I18A 2OBRA 3ZZTA 3A1PA 3CMMA 4ROXA 1KD1D 2EFGA 2LZJA 4ACBA 1BLIA 4QUZA 4YHBA 4XLHA 3WY9A 3LQ6A 2CBXA 4RDLA 1PJ7A 3ASPA 1VHOA 3CCEB 3OEHA 1OB5A 4K1XA 3BCDA 4Z4UA 4RM0A 2WJVA 5TV2A 3CD6B 3A8IA 4PC1A 4TMVA 1BMFA 2WZNA 3NE5B 2JJ2A 1E3XA 1WOSA 4AC9A 4ZGNB 2C4TA 3QFSA 4OPSA 4UZUA 1JA1A 3AVVA 1G7TA 4QVJA 1V0EA 4RD1A 2WJYA 3HAGA 4PC6A 2YWHA 4P12A 1KK2A 1XE1A 4LC0A 1FNMA 1UD2A 3OZWA 3ZBTA 1KZLA 1VQKB 3GVKA 1E1QA 1W9XA 3PVDA 4RD6A 4WZLA 3H94A 5EMNA 5BSXA 1QUFA 1H85A 4Z4SA 2OTLB 4RCZA 5IYPA 1VQMB 1NDHA 3VMFA 3QE2A 4KKTA 4AF6A 2QGGA 2QEXB 2BM1A 2X0KA 4DK0A 5J3OA 1KMHA 3LQEA 3GVLA 1D8TA 1QFYA 2GJRA 3E20A 4C0SA 2C77A 3V76A 3FPKA 1E3ZA 1N07A 1WSVA 2C4UA 2EIXA 1EP1B 4B47A 1WOPA 3ES9A 2I1LA 1VQ6B 3W2EA 5IYNA 2X6WA 4RD2A 2YWFA 3BY2A 2RC5A 3G05A 1OHHA 5FIUA 2VNHA 3SEJA 3WNDA 2DYIA 1XB2A 2CF4A 4KKSA 3VR6A 3OE7A 1WDTA 1N05A 4TMXA 4H9GA 3OW2B 4YAOA 1YI2B 4X0CA 2DY1A 2ZL5A 4XORA 1TTTA 1AMOA 5HZAA 1Q81D 2PIAA 2DIEA 5A88A 3R6KA 2B7CA 2OTJB 1OGJA 1R5BA 1FNBA 2VJJA 3RY8A 4P3YA 2QDXA 1WSRA 2YWEA 2BN4A 2VNJA 2Q6KA 3OKXA 2BM0A 4P26A 5E6TA 5HKKA 2BGIA 4AF7A 4P3IA 1WORA 4DQKA 1VLYA 1YIJB 1R5NA 3CRZA 4DNTB 1ZM2A 1UD5A 4RDKA 3I56B 5FA6A 2DOGA 1WU8A 2VBSA 2XEXA 2HLDA 2V7XA 2CW5A 3BCFA 1NB0A 2X3UA 1GAQA 4YXWA 1KJZA 3B78A 3W5VA 1Y0YA 1HZEA 4XR6A 1YJNB 4M1KA 1WPCA 2OK8A 1G7RA 1PJ5A 1B23P 3WBJA 3I55B 1GAWA 1FX0A 3G4SB 1BX1A 5DSZA 1W2BB 2V7UA 3W2FA 5H59A 3ZZ0A 3G71B 5H5JA 4M2LA 2BF4A 4XD7A 2JDIA 1MABA 3WNBA 3CCLB 2GJKA 2GK6A 2OK7A 4G7XA 3B82A 4OOVA 3CCUB 3CCJB 2KVOA 4E0FA 2WYRA 4M4SA 3A8JA 5F4OA 3PUMA 1XFOA 1QH0A 1KRHA 3CCMB 3ONUA 1FNDA 2ZL6A 4L8JA 4TT3A 1IB0A 3AGPA 4YELA 1VJSA 1HA3A 2QTLA 3QFCA 1FNCA 3SLNA 1YJ9B 1WP6A 4XONA 4FK8A 2JIZA 4J0QA 2R6HA 4RJLA 1VLOA 1EWYA 2Q6LA 2V7WA 4YAWA 1R5OA 5HZBA 5TRDA 2GQFA 4Y9RA 3CCRB 1IJFA 2ZZGA 3W2IA 1GJRA 2Z6BD 3CCQB 1YHQB 4Z4YA 1JB9A 1VQ5B 2F1LA 4YALA 3W5UA 3AVUA 5JBQA 1EFCA 2YWGA 2VZLA 3V7AA 1EFTA 2BGJA 2BV3A 4N3GA 3GIRA 4KKUA 4P22A 3Q3AA 1V5VA 1IJEA 3Q6RA 5KSWB 4XOPA 1FDRA 2X8KA 4QFMA 2WZPP 3A3BA 1JA0A 1WTHD 5F4JA 3J81k 3E1YE 2BMWA 2VYQA 3ASTA 1EP3B 2NV4A 3CESA 4MYUA 5CDFA 2OBTA 1FRNA 4ZCMA 2CRVA 4ZCIA 4PAAA 1BQEA 5L46A 3A8KA 2X85A 4B3XA 3Q39A 1GO2A 4X7FA 4XN3A 1E1RA 4Z4WA 1EP2B 4P25A 1NRKA 1NBMA 4WWVA 2XZOA 1QG0A 2F1MA 4U9UA 1T6XA 3ZPNA 1K28D 1N8RD 5THXA 4TN1A 2XZPA 2ZXIA 2DCUA 3Q6QA 4XNFA 1K73D 1YX2A 4GQNA 4DK1A 1QGAA 3WNCA 4Y7CA 4Z1MA 3MCAA 1QGZA 4X7CA 1DDIA 3PUNA 1QFJA 1UD3A 2VNKA 1CQXA 1Q7YD 4P9SA 2ZZFA 4TMWA 1QVGB 1VQ8B 1E43A 2X6XA 4B3FX 3CCVB 4TMZA 3G6EB 3GSIA 2VBVA 3LVBA 4LBVA 4NBSA 4UZFA 1KK0A 2WPDA 3U6KA 3CXCB 2R9VA 1I7PA 4XL9A 5HXBA 4IW3B 5B6IA 4QVAA 4WZEA 3ZZUA 2C78A 3SLDA 2XOKA 5J35A 3VNVA 4XOTA 4PC7A 1FRQA 4HIZA 2VBTA 1EFUA 1T6YA 1DDGA 1ZM9A 2BSAA 2DERA 2XGJA 3BNWA 1OGIA 1Q9SA 3ZUGA 2P3MA 3ASRA 1JNYA 1G7CA 4G1VA 4RPDA 4X07A 5KW9A 4DNRB 4TMTA 4F7DA 4OOXA 1W35A 3Q38A 1H8EA 1VF7A 3A35A 2CC2A 5TY0A 3LNNA 2C5BA 2D9RA 3WXMA 3WYAA 2E1RA 2VBUA 4XM3A 3A3GA 4FXUA 2DEUA 5BSYA 1VQ4B 3OW7A 4FWTA 4B4DA 4ZGQB 1N06A 2B5OA 3AVYA 2QN6A 3QFRA 2V4DA 1UD4A 4UAJA 4Z4RA 3ZBUA 4G6IA 1S4MA 3DDYA 3GVJA 4WZKA 5FO0A 1U2RA 2ZXHA 5FNZA 2PE3A 1NB9A 4HE6A 5KNLA 1UD8A 1T5EA 2JN9A 4C43A 2FVGA 1T6ZA 1JJ2B 2ZZQA 1SM4A 3QSYA 1VQ7B 4ACAA 3MMPA 2C5HA 2HCJB 5IK2A 4LBYA 4PC3A 1M1KD 1A8PA 2BPOA 1N0VC 1D1NA 2E1BA 3LO8A 1S0UA 2GPJA 1F60A 2QE7A 1TUIA 4XLFA 2NPFA 3WBKA 4RLZA 2OBSA 1VHEA 2VJIA 1H8HA 2XNJA 4YAUA 1D2EA 2ZTNA 3SKBA 1W0JA 1EXMA 3ASSA 3VO2A 1QUEA 1SKYB 3OZUA 3OJWA 1I8DA 1OB2A 2B7BA 3AVWA 3QFTA 2XZLA 3JQQA 4Z4TA 1PJ6A 3FKSA 4B48A 4ZCLA 2X6YA 1B2RA 5AN9A 2V7QA 3CP8A 5A8AA 3PA1A 1KQSB 1E62A 3CW2A 2WSSA 1KTVA 2M5SA 3PA2A 4OPVA 3H9NA 4XLAA 3OPOA 4B43A 4M0LA 2QTZA 5IYWA 1CNEA 3P26A 3P27A 1TLLA 2D74A 3ONYA 4II2A 4XKVA 5DN6A 4ZV4A 2J7KA 1QGYA 1N08A 3CC2B 1SKQA 1TVCA 1N0UA 2JJ1A 4Z4VA 4PABA 3MHPA 2D3LA 3VNUA 3BH4A 3ZC3A 1VQLB 2HDNB 2V31A 3AGQA 3VO1A 1HVXA 2VNIA 2GJPA 3CTAA 1P4MA 1UMKA 5FL7A 4X05A 1S72B 1Q86D 1M90D 4XMYA 1XQBA 3CPXA 1YJWB 4XLCA 5IYRA 2ZBVA 5A89A 3GQBA 3PENA 4X8IA 4FN5A 1G7SA 3SJZA 1VQPB 2ZZEA 3WQZA 4TSFA 4WZTA 1VQ9B 4LBWA 4HE5A 1ZM4A 3ISXA 3CMAB 3T53B 4XN0A 5TR9A 3T51B 1F20A 4M53A 2W6JA 4WQMA 2D3NA 3B8HA
chains in the Genus database with same CATH topology
3PVDA 3SLNA 4WZLA 5BSXA 4Z4SA 3BY1A 5BSYA 4OOSA 5IYPA 4X7DA 5HZBA 4Z4RA 4X7EA 4RDJA 4WZKA 4Z4YA 3BQJA 5J3OA 3LQEA 3V7AA 3Q3AA 2ZL7A 3Q6RA 1IHMA 5F4MA 4OPOA 5F4JA 3ASTA 5IYNA 2OBTA 3BY2A 4QV2A 5IYQA 3SEJA 4P1VA 4X06A 4RLZA 2OBSA 3Q39A 4X7FA 4Z4WA 4P25A 3SKBA 3D26A 4X0CA 3ASSA 4Z4ZA 2ZL5A 3R6JA 3ASQA 5HZAA 3R6KA 3RY8A 4Z4TA 3Q6QA 4P26A 5E6TA 4P3IA 4X7CA 3PUNA 4RPBA 3PA1A 4RDKA 3PA2A 4OPVA 4P2NA 4OP7A 5IYWA 3SJPA 3ONYA 2OBRA 4ROXA 4QUZA 4Z4VA 3LQ6A 4RDLA 3ASPA 4QVAA 4WZEA 4RM0A 4Z4UA 3SLDA 4X05A 5J35A 4OOVA 5IYRA 4OPSA 4QVJA 5F4OA 4WZTA 3PUMA 4P12A 3ASRA 4X07A 3ONUA 4RPDA 2ZL6A 5KW9A 4OOXA 3Q38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVD A;  3SLN A;  4WZL A;  5BSX A;  4Z4S A;  3BY1 A;  5BSY A;  4OOS A;  5IYP A;  4X7D A;  5HZB A;  4Z4R A;  4X7E A;  4RDJ A;  4WZK A;  4Z4Y A;  3BQJ A;  5J3O A;  3LQE A;  3V7A A;  3Q3A A;  2ZL7 A;  3Q6R A;  1IHM A;  5F4M A;  4OPO A;  5F4J A;  3AST A;  5IYN A;  2OBT A;  3BY2 A;  4QV2 A;  5IYQ A;  3SEJ A;  4P1V A;  4X06 A;  4RLZ A;  2OBS A;  3Q39 A;  4X7F A;  4Z4W A;  4P25 A;  3SKB A;  3D26 A;  4X0C A;  3ASS A;  4Z4Z A;  2ZL5 A;  3R6J A;  3ASQ A;  5HZA A;  3R6K A;  3RY8 A;  4Z4T A;  3Q6Q A;  4P26 A;  5E6T A;  4P3I A;  4X7C A;  3PUN A;  4RPB A;  3PA1 A;  4RDK A;  3PA2 A;  4OPV A;  4P2N A;  4OP7 A;  5IYW A;  3SJP A;  3ONY A;  2OBR A;  4ROX A;  4QUZ A;  4Z4V A;  3LQ6 A;  4RDL A;  3ASP A;  4QVA A;  4WZE A;  4RM0 A;  4Z4U A;  3SLD A;  4X05 A;  5J35 A;  4OOV A;  5IYR A;  4OPS A;  4QVJ A;  5F4O A;  4WZT A;  3PUM A;  4P12 A;  3ASR A;  4X07 A;  3ONU A;  4RPD A;  2ZL6 A;  5KW9 A;  4OOX A;  3Q38 A; 
#chains in the Genus database with same CATH topology
 4P6V F;  4B44 A;  3OP1 A;  3AVX A;  1KK3 A;  3JU4 A;  1MRZ A;  3OJX A;  4BPR A;  1E64 A;  2F43 A;  1PKV A;  1NJI D;  3BY1 A;  2OYN A;  1VQO B;  3BC9 A;  3W2H A;  4OOS A;  1DAR A;  4X7D A;  3U2Q A;  1KC8 D;  1VQN B;  3OZV A;  3CPW B;  4G5G A;  4CQJ A;  4X7E A;  1K8A D;  2PMD A;  3CP2 A;  4RDJ A;  1RQP A;  1BJK A;  1BPL A;  2ZTG A;  1COW A;  2GK7 A;  3BQJ A;  1QFZ A;  2FX3 A;  2F4N A;  4PGO A;  4YAF A;  5GV7 A;  2QA4 B;  4G1B A;  2BVN A;  3CC7 B;  1YIT B;  4XKW A;  4RD0 A;  2Q6O A;  2ZL7 A;  1IHM A;  4QHY A;  5F4M A;  1AIP A;  3CCS B;  4OPO A;  4XQF A;  2W6I A;  1W87 A;  2DET A;  1WOO A;  3CC4 B;  1ZUN B;  2XNC A;  4II3 A;  1ELO A;  2CND A;  3FJO A;  3W2G A;  3ZIA A;  4G7W A;  4RD3 A;  2ZIT A;  2AHO A;  1E79 A;  1YLO A;  1J9Z A;  4UZE A;  5FO1 A;  4Q7J B;  3U6B A;  3T56 B;  3I1F A;  4QV2 A;  4NNJ A;  5IYQ A;  4PC2 A;  1W0K A;  4P1V A;  5DS0 A;  2V7V A;  2Q6I A;  4X06 A;  4AVZ A;  5LMZ A;  2HMA A;  3OOC A;  4MYT A;  4XLE A;  1W34 A;  3CB4 A;  4B3G A;  1BX0 A;  1H42 A;  3JQP A;  3W5H A;  4EH1 A;  3AVT A;  3D26 A;  1GVH A;  3FPP A;  4Z4Z A;  1QX4 A;  3R6J A;  3ASQ A;  4TKO B;  2PLF A;  2RC6 A;  3OEE A;  4Y9U A;  5GV8 A;  4RD4 A;  2ZBU A;  1GR1 A;  1UD6 A;  4YEJ A;  2XND A;  3KL9 A;  1E63 A;  4DQL A;  4NCN A;  3OAA A;  2V7T A;  3OFN A;  4P6Y A;  4LBZ A;  3CME B;  1ZM3 A;  1KK1 A;  1OB0 A;  2X53 S;  1Y0R A;  4JMQ A;  3JQR A;  4RPB A;  2C2W A;  2QMU A;  4R71 A;  1V0F A;  1Q82 D;  4RCY A;  4N3N A;  1EFR A;  1CNF A;  1DG1 G;  2CK3 A;  2WR8 A;  2GRE A;  4P2N A;  3KEW A;  4OP7 A;  1RQR A;  4ASU A;  3SJP A;  1QVF B;  1K9M D;  1I18 A;  2OBR A;  3ZZT A;  3A1P A;  3CMM A;  4ROX A;  1KD1 D;  2EFG A;  2LZJ A;  4ACB A;  1BLI A;  4QUZ A;  4YHB A;  4XLH A;  3WY9 A;  3LQ6 A;  2CBX A;  4RDL A;  1PJ7 A;  3ASP A;  1VHO A;  3CCE B;  3OEH A;  1OB5 A;  4K1X A;  3BCD A;  4Z4U A;  4RM0 A;  2WJV A;  5TV2 A;  3CD6 B;  3A8I A;  4PC1 A;  4TMV A;  1BMF A;  2WZN A;  3NE5 B;  2JJ2 A;  1E3X A;  1WOS A;  4AC9 A;  4ZGN B;  2C4T A;  3QFS A;  4OPS A;  4UZU A;  1JA1 A;  3AVV A;  1G7T A;  4QVJ A;  1V0E A;  4RD1 A;  2WJY A;  3HAG A;  4PC6 A;  2YWH A;  4P12 A;  1KK2 A;  1XE1 A;  4LC0 A;  1FNM A;  1UD2 A;  3OZW A;  3ZBT A;  1KZL A;  1VQK B;  3GVK A;  1E1Q A;  1W9X A;  3PVD A;  4RD6 A;  4WZL A;  3H94 A;  5EMN A;  5BSX A;  1QUF A;  1H85 A;  4Z4S A;  2OTL B;  4RCZ A;  5IYP A;  1VQM B;  1NDH A;  3VMF A;  3QE2 A;  4KKT A;  4AF6 A;  2QGG A;  2QEX B;  2BM1 A;  2X0K A;  4DK0 A;  5J3O A;  1KMH A;  3LQE A;  3GVL A;  1D8T A;  1QFY A;  2GJR A;  3E20 A;  4C0S A;  2C77 A;  3V76 A;  3FPK A;  1E3Z A;  1N07 A;  1WSV A;  2C4U A;  2EIX A;  1EP1 B;  4B47 A;  1WOP A;  3ES9 A;  2I1L A;  1VQ6 B;  3W2E A;  5IYN A;  2X6W A;  4RD2 A;  2YWF A;  3BY2 A;  2RC5 A;  3G05 A;  1OHH A;  5FIU A;  2VNH A;  3SEJ A;  3WND A;  2DYI A;  1XB2 A;  2CF4 A;  4KKS A;  3VR6 A;  3OE7 A;  1WDT A;  1N05 A;  4TMX A;  4H9G A;  3OW2 B;  4YAO A;  1YI2 B;  4X0C A;  2DY1 A;  2ZL5 A;  4XOR A;  1TTT A;  1AMO A;  5HZA A;  1Q81 D;  2PIA A;  2DIE A;  5A88 A;  3R6K A;  2B7C A;  2OTJ B;  1OGJ A;  1R5B A;  1FNB A;  2VJJ A;  3RY8 A;  4P3Y A;  2QDX A;  1WSR A;  2YWE A;  2BN4 A;  2VNJ A;  2Q6K A;  3OKX A;  2BM0 A;  4P26 A;  5E6T A;  5HKK A;  2BGI A;  4AF7 A;  4P3I A;  1WOR A;  4DQK A;  1VLY A;  1YIJ B;  1R5N A;  3CRZ A;  4DNT B;  1ZM2 A;  1UD5 A;  4RDK A;  3I56 B;  5FA6 A;  2DOG A;  1WU8 A;  2VBS A;  2XEX A;  2HLD A;  2V7X A;  2CW5 A;  3BCF A;  1NB0 A;  2X3U A;  1GAQ A;  4YXW A;  1KJZ A;  3B78 A;  3W5V A;  1Y0Y A;  1HZE A;  4XR6 A;  1YJN B;  4M1K A;  1WPC A;  2OK8 A;  1G7R A;  1PJ5 A;  1B23 P;  3WBJ A;  3I55 B;  1GAW A;  1FX0 A;  3G4S B;  1BX1 A;  5DSZ A;  1W2B B;  2V7U A;  3W2F A;  5H59 A;  3ZZ0 A;  3G71 B;  5H5J A;  4M2L A;  2BF4 A;  4XD7 A;  2JDI A;  1MAB A;  3WNB A;  3CCL B;  2GJK A;  2GK6 A;  2OK7 A;  4G7X A;  3B82 A;  4OOV A;  3CCU B;  3CCJ B;  2KVO A;  4E0F A;  2WYR A;  4M4S A;  3A8J A;  5F4O A;  3PUM A;  1XFO A;  1QH0 A;  1KRH A;  3CCM B;  3ONU A;  1FND A;  2ZL6 A;  4L8J A;  4TT3 A;  1IB0 A;  3AGP A;  4YEL A;  1VJS A;  1HA3 A;  2QTL A;  3QFC A;  1FNC A;  3SLN A;  1YJ9 B;  1WP6 A;  4XON A;  4FK8 A;  2JIZ A;  4J0Q A;  2R6H A;  4RJL A;  1VLO A;  1EWY A;  2Q6L A;  2V7W A;  4YAW A;  1R5O A;  5HZB A;  5TRD A;  2GQF A;  4Y9R A;  3CCR B;  1IJF A;  2ZZG A;  3W2I A;  1GJR A;  2Z6B D;  3CCQ B;  1YHQ B;  4Z4Y A;  1JB9 A;  1VQ5 B;  2F1L A;  4YAL A;  3W5U A;  3AVU A;  5JBQ A;  1EFC A;  2YWG A;  2VZL A;  3V7A A;  1EFT A;  2BGJ A;  2BV3 A;  4N3G A;  3GIR A;  4KKU A;  4P22 A;  3Q3A A;  1V5V A;  1IJE A;  3Q6R A;  5KSW B;  4XOP A;  1FDR A;  2X8K A;  4QFM A;  2WZP P;  3A3B A;  1JA0 A;  1WTH D;  5F4J A;  3J81 k;  3E1Y E;  2BMW A;  2VYQ A;  3AST A;  1EP3 B;  2NV4 A;  3CES A;  4MYU A;  5CDF A;  2OBT A;  1FRN A;  4ZCM A;  2CRV A;  4ZCI A;  4PAA A;  1BQE A;  5L46 A;  3A8K A;  2X85 A;  4B3X A;  3Q39 A;  1GO2 A;  4X7F A;  4XN3 A;  1E1R A;  4Z4W A;  1EP2 B;  4P25 A;  1NRK A;  1NBM A;  4WWV A;  2XZO A;  1QG0 A;  2F1M A;  4U9U A;  1T6X A;  3ZPN A;  1K28 D;  1N8R D;  5THX A;  4TN1 A;  2XZP A;  2ZXI A;  2DCU A;  3Q6Q A;  4XNF A;  1K73 D;  1YX2 A;  4GQN A;  4DK1 A;  1QGA A;  3WNC A;  4Y7C A;  4Z1M A;  3MCA A;  1QGZ A;  4X7C A;  1DDI A;  3PUN A;  1QFJ A;  1UD3 A;  2VNK A;  1CQX A;  1Q7Y D;  4P9S A;  2ZZF A;  4TMW A;  1QVG B;  1VQ8 B;  1E43 A;  2X6X A;  4B3F X;  3CCV B;  4TMZ A;  3G6E B;  3GSI A;  2VBV A;  3LVB A;  4LBV A;  4NBS A;  4UZF A;  1KK0 A;  2WPD A;  3U6K A;  3CXC B;  2R9V A;  1I7P A;  4XL9 A;  5HXB A;  4IW3 B;  5B6I A;  4QVA A;  4WZE A;  3ZZU A;  2C78 A;  3SLD A;  2XOK A;  5J35 A;  3VNV A;  4XOT A;  4PC7 A;  1FRQ A;  4HIZ A;  2VBT A;  1EFU A;  1T6Y A;  1DDG A;  1ZM9 A;  2BSA A;  2DER A;  2XGJ A;  3BNW A;  1OGI A;  1Q9S A;  3ZUG A;  2P3M A;  3ASR A;  1JNY A;  1G7C A;  4G1V A;  4RPD A;  4X07 A;  5KW9 A;  4DNR B;  4TMT A;  4F7D A;  4OOX A;  1W35 A;  3Q38 A;  1H8E A;  1VF7 A;  3A35 A;  2CC2 A;  5TY0 A;  3LNN A;  2C5B A;  2D9R A;  3WXM A;  3WYA A;  2E1R A;  2VBU A;  4XM3 A;  3A3G A;  4FXU A;  2DEU A;  5BSY A;  1VQ4 B;  3OW7 A;  4FWT A;  4B4D A;  4ZGQ B;  1N06 A;  2B5O A;  3AVY A;  2QN6 A;  3QFR A;  2V4D A;  1UD4 A;  4UAJ A;  4Z4R A;  3ZBU A;  4G6I A;  1S4M A;  3DDY A;  3GVJ A;  4WZK A;  5FO0 A;  1U2R A;  2ZXH A;  5FNZ A;  2PE3 A;  1NB9 A;  4HE6 A;  5KNL A;  1UD8 A;  1T5E A;  2JN9 A;  4C43 A;  2FVG A;  1T6Z A;  1JJ2 B;  2ZZQ A;  1SM4 A;  3QSY A;  1VQ7 B;  4ACA A;  3MMP A;  2C5H A;  2HCJ B;  5IK2 A;  4LBY A;  4PC3 A;  1M1K D;  1A8P A;  2BPO A;  1N0V C;  1D1N A;  2E1B A;  3LO8 A;  1S0U A;  2GPJ A;  1F60 A;  2QE7 A;  1TUI A;  4XLF A;  2NPF A;  3WBK A;  4RLZ A;  2OBS A;  1VHE A;  2VJI A;  1H8H A;  2XNJ A;  4YAU A;  1D2E A;  2ZTN A;  3SKB A;  1W0J A;  1EXM A;  3ASS A;  3VO2 A;  1QUE A;  1SKY B;  3OZU A;  3OJW A;  1I8D A;  1OB2 A;  2B7B A;  3AVW A;  3QFT A;  2XZL A;  3JQQ A;  4Z4T A;  1PJ6 A;  3FKS A;  4B48 A;  4ZCL A;  2X6Y A;  1B2R A;  5AN9 A;  2V7Q A;  3CP8 A;  5A8A A;  3PA1 A;  1KQS B;  1E62 A;  3CW2 A;  2WSS A;  1KTV A;  2M5S A;  3PA2 A;  4OPV A;  3H9N A;  4XLA A;  3OPO A;  4B43 A;  4M0L A;  2QTZ A;  5IYW A;  1CNE A;  3P26 A;  3P27 A;  1TLL A;  2D74 A;  3ONY A;  4II2 A;  4XKV A;  5DN6 A;  4ZV4 A;  2J7K A;  1QGY A;  1N08 A;  3CC2 B;  1SKQ A;  1TVC A;  1N0U A;  2JJ1 A;  4Z4V A;  4PAB A;  3MHP A;  2D3L A;  3VNU A;  3BH4 A;  3ZC3 A;  1VQL B;  2HDN B;  2V31 A;  3AGQ A;  3VO1 A;  1HVX A;  2VNI A;  2GJP A;  3CTA A;  1P4M A;  1UMK A;  5FL7 A;  4X05 A;  1S72 B;  1Q86 D;  1M90 D;  4XMY A;  1XQB A;  3CPX A;  1YJW B;  4XLC A;  5IYR A;  2ZBV A;  5A89 A;  3GQB A;  3PEN A;  4X8I A;  4FN5 A;  1G7S A;  3SJZ A;  1VQP B;  2ZZE A;  3WQZ A;  4TSF A;  4WZT A;  1VQ9 B;  4LBW A;  4HE5 A;  1ZM4 A;  3ISX A;  3CMA B;  3T53 B;  4XN0 A;  5TR9 A;  3T51 B;  1F20 A;  4M53 A;  2W6J A;  4WQM A;  2D3N A;  3B8H A; 
#chains in the Genus database with same CATH homology
 3PVD A;  3SLN A;  4WZL A;  5BSX A;  4Z4S A;  3BY1 A;  5BSY A;  4OOS A;  5IYP A;  4X7D A;  5HZB A;  4Z4R A;  4X7E A;  4RDJ A;  4WZK A;  4Z4Y A;  3BQJ A;  5J3O A;  3LQE A;  3V7A A;  3Q3A A;  2ZL7 A;  3Q6R A;  1IHM A;  5F4M A;  4OPO A;  5F4J A;  3AST A;  5IYN A;  2OBT A;  3BY2 A;  4QV2 A;  5IYQ A;  3SEJ A;  4P1V A;  4X06 A;  4RLZ A;  2OBS A;  3Q39 A;  4X7F A;  4Z4W A;  4P25 A;  3SKB A;  3D26 A;  4X0C A;  3ASS A;  4Z4Z A;  2ZL5 A;  3R6J A;  3ASQ A;  5HZA A;  3R6K A;  3RY8 A;  4Z4T A;  3Q6Q A;  4P26 A;  5E6T A;  4P3I A;  4X7C A;  3PUN A;  4RPB A;  3PA1 A;  4RDK A;  3PA2 A;  4OPV A;  4P2N A;  4OP7 A;  5IYW A;  3SJP A;  3ONY A;  2OBR A;  4ROX A;  4QUZ A;  4Z4V A;  3LQ6 A;  4RDL A;  3ASP A;  4QVA A;  4WZE A;  4RM0 A;  4Z4U A;  3SLD A;  4X05 A;  5J35 A;  4OOV A;  5IYR A;  4OPS A;  4QVJ A;  5F4O A;  4WZT A;  3PUM A;  4P12 A;  3ASR A;  4X07 A;  3ONU A;  4RPD A;  2ZL6 A;  5KW9 A;  4OOX A;  3Q38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...