3LQLA

Human aldose reductase mutant t113a complexed with idd 594
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
b'MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lqlA00
1X97A 3RX3A 2CLPA 2BP1A 3CAVA 4EXBA 4JTCA 3R7MA 4XZLX 1ZSXA 2IQDA 4OTKA 2FZDA 5AZ1A 1ZUAX 4WDWA 1PWMA 2PDMA 3GHSA 3LD5A 2PF8A 5LIKX 3R8GA 2PDUA 3P2VA 2PDNA 1T41A 1X98A 3UWEA 4XO7A 3BV7A 3UP8A 1EF3A 4FALA 5JH1A 1Z9AA 2WZTA 3LQLA 4GABA 4LAUA 3ONCA 1QRQA 2PFHA 3RX4A 2PDWA 3CAQA 1IEIA 1US0A 5LIWX 4WGHA 4PR4A 4XK2A 3R8HA 3NTYA 2HE5A 3V0TA 2HEJA 3WCZA 3WBXA 2ISFA 3LBOA 2BGSA 3O3RA 1PWLA 1AZ1A 2DUXA 5DANA 3R94A 2IPGA 2PD5A 1PYFA 4QXIA 1XJBA 1SM9A 4JQ2A 4JIHA 3GHRA 2R24A 3N6QA 4JIIX 2WZMA 2IKJA 1EKOA 3RX2A 1EL3A 3F7JA 3CV7A 2F2KA 3M64A 3S3GA 2PDFA 4RPQA 2FVLA 1S1RA 1AH0A 1AH4A 2PDBA 4Q3MA 1YE6A 4GIEA 2PDCA 2QXWA 3V35A 3H4GA 4WDTA 2DV0A 3UG8A 2ACQA 4YVVA 4HMNA 4XZHA 3V36A 3UZYA 1K8CA 1S2CA 3WBWA 3UZXA 3C3UA 3EB3A 3CASA 2FZ8A 2IPFA 4WRHA 4YVXA 4G5DA 5M2FX 4XZIA 4PMJA 5C7HA 3QKZA 2F38A 3DN5A 1GVEA 3B3DA 4FZIA 2DUZA 3MB9A 1LWIA 1RY0A 2HE8A 2FGBA 4I5XA 4PRTA 3V0UA 3GHUA 1Z3NA 4MHBA 4ZFCA 2PDLA 3BCJA 1S1PA 4YVPA 2PDPA 4QBXA 1MZRA 1RY8A 1S2AA 3R43A 5KETA 1JEZA 1T40A 3Q65A 1AFSA 2IPWA 4DBUA 4DZ5A 2I17A 2NVCA 4LBRA 5HNTA 4GQGA 1IHIA 2PDYA 1OG6A 3R6IA 1R38A 3R58A 2IKIA 3N2TA 3LUTA 2IQ0A 2PD9A 3VXGA 3U2CA 2HV5A 2C91A 2BGQA 3CMFA 2FZ9A 2NVDA 2ACRA 2J8TA 4IGSA 4PUWA 4EXAA 2IKGA 2PDJA 3MC5A 3LN3A 1PZ1A 4QX4A 4XZMX 3LENA 4L1WA 1XGDA 2I16A 4JTAA 4DBSA 3ERPA 5LIXX 2PZNA 1Q13A 4WDXA 1A80A 3FJNA 4Q7BA 2INZA 4GCAA 4H7CA 1AH3A 1ZQ5A 4R9OA 4PRRA 4ASTA 2PDXA 3G1RA 3H7RA 1J96A 3UGRA 4PUUA 2PDKA 4DBWA 3LEPA 3UZWA 1Z8AA 4WDUA 3EB4A 3CV6A 2IS7A 1QWKA 3M4HA 4LAZA 4IJRA 3UZZA 3UYIA 4JTQA 3Q67A 3BURA 1YE4A 2PDHA 2HVNA 2ALRA 1Z89A 4LB3A 4XVDA 4IJCA 3M0IA 3BUVA 4XAPA 2A79A 4GACA 3G5EA 2ACSA 3LZ3A 4QR6A 2IKHA 3O0KA 2FZBA 1RALA 1YNQA 3FX4A 4JQ3A 4YS1A 3KRBA 1EXBA 4F40A 4WEVX 1C9WA 4ICCX 4YU1A 4H8NA 4LB4A 1ZGDA 2ACUA 2PDIA 3GUGA 3UFYA 4NKCA 4FA3A 1X96A 1VP5A 2PEVA 4JIRA 2HVOA 5AZ0A 1LQAA 4JQ1A 2AGTA 4GA8A 3WBYA 4JTDA 2PDGA 1MRQA 1MI3A 5LIUX 4FAMA 4L1XA 4XO6A 2P5NA 2VDGA 3EAUA 5HA7A 1M9HA 3H7UA 1HW6A 5HNUA 3ONBA 3WG6A 4XVEA 1Q5MA 1XF0A 2IPJA 5JH2A 2INEA 4GQ0A 4JQAA 1YNPA 4AUBA 3D3FA 1VBJA 4XZNX 3COTA 3T42A 3LNMA 3GHTA 1PZ0A 2PDQA 1AZ2A 2HDJA 3LQGA 3LZ5A 3DOPA 1UR3M 3V0SA 2R9RA 4LBSA 1HQTA 4HBKA 4JQ4A 4JTRA 1ADSA 1FRBA 5LIYX
chains in the Genus database with same CATH superfamily
5EMMA 2BLEA 3GG7A 3W1TA 2P76A 4DQWA 1KQZA 3A9BA 2QKFA 3N6JA 1K9DA 3O07A 3BCDA 5FSDC 3W2KA 3VNIA 4OOZA 1R5YA 2OSYA 3MUZ1 4F4RA 2NQHA 1FH7A 4HK7A 1DXIA 2YFOA 4AF0B 2E6DA 2RUSA 4K2SA 2FPYA 1KM1A 3SRDA 3I6TA 2VURA 3UWEA 3BV7A 1EWDA 5FJRA 2J4GA 4FX8A 1QNVA 2G97A 3WF4A 1Z9AA 4XAZA 3WLQA 4LAUA 2RH9A 2DQXA 2WHLA 2QV4A 2OGYA 4F2TA 3I4KA 4PTXA 3P93A 3I10A 3HN3A 4AB4A 2R1NA 1C7SA 4PBEA 3LG3A 1OX6A 1CGXA 3WBXA 5BOEA 5HAOA 7CGTA 4MG4A 2VZTA 4DUWA 3B4UA 5G1MA 4NZ5A 3HURA 3QV6A 5A6BD 4TMBA 4D6FA 3DCPA 3F5KA 1EO5A 1UD2A 2B7NA 3VX0A 5F1UA 3QW3A 5BXTA 1XQLA 3W7OA 1TQJA 1I4NA 3B8VA 4Z1BA 3V16A 4MOZA 4X2RA 1H7NA 5DLCA 3O6YX 4JTHA 1RZMA 5CBJA 1MW2A 3IARA 1S1RA 6TIMA 3AIEA 3G3DA 3GS6A 4GHRA 2G5WA 5C7VA 5BNKA 5CZKA 3CL8A 2YPIA 4M0XA 4WOQA 3GB6A 1P1MA 3A4AA 2V5DA 3QBUA 2DV0A 3N04A 3N19B 1L9WA 2EQDA 4GVFA 1FUYA 4QIUA 1DJYA 3SSJA 3FEQA 2D23A 5HXMA 1XH1A 2X16A 4UNLA 9CGTA 1D2KA 5HPCA 1JI2A 3SY5A 4MJMA 1FHDA 2AL2A 4JKKA 4B4HA 3R10A 1J0KA 4B91A 2OLAA 4UTJA 4DO7A 4WX2A 4YL2A 4LJ3A 3L21A 4GBUA 1VPYA 2QZRA 1H5YA 4M81A 3GC5A 1F73A 4HD5A 3ZJ6A 2DIKA 2I14A 5REQB 2FFIA 1CGUA 5CGTA 4HNNA 4LXFA 2X1SA 3H2MA 4O10A 4MZ1A 1V7AA 2ZKMX 3VABA 3QGKC 2B7QA 4FR1A 4C7GA 4QQ3A 2I17A 1GQJA 2DORA 1SW7A 4JHZA 4UNIA 3NGJA 6ALDA 4HU3A 3LXCA 1OG6A 1B30A 5HQLA 1ZS2A 3LXBA 2ZYFA 3SRFA 4ZO6A 3C52A 4MWAA 4UZSA 2FTWA 4J1OA 2ACRA 3VDCA 3NQVA 3QOKA 3M43A 3W7EA 3N2BA 1S2TA 4M29A 4E2DA 3I7RA 4I9MA 4JCLA 4GIAA 5CKSA 3QYSA 2X1RA 1WP6A 3PTKA 2VRJA 3AOFA 3VKDA 1V3HA 2DZUA 3WUGA 5CJNA 4KETA 3NG3A 1FWWA 4UMBA 1I0BA 5LIXX 2PZNA 3B9AA 3UNDA 4ASTA 1P48A 2ICSA 2XN2A 1FQ0A 2QCNA 2FDSA 2Q09A 1XYBA 3FS2A 5CPMA 4DHGA 4EP8C 4EPEC 2VR2A 5CC3A 3NEHA 1WUFA 3CQKA 3W6YA 3GY1A 3KBNA 2Y5EA 3PVFA 1EZ2A 4Y2WA 4WY0B 3IGUA 1HKVA 3MMDA 2YBTA 1R3QA 4IXHA 1DXFA 3UD6A 3K5XA 3I7QA 2YX0A 2PS2A 1UROA 3T6CA 4L7ZA 5CGMA 2F84A 4NSBA 3BUVA 4WCJA 3RAOA 2XWDA 1WDWA 2A79A 3H23A 4DPQA 3BLOA 4GY7A 1WKFA 4HNUA 5A8OA 1A5LC 3O0KA 5I00A 3FGCA 4HZ8A 2QJGA 5A6BA 4JS3A 4WOZA 3VM7A 3C4UA 3K8MA 4C1KA 4B5SA 3GE7A 4MFDA 5C71A 1AQMA 4AVOA 4HK6A 4L4LA 1M04A 5EYWA 3EPOA 3VM5A 3W81A 3O7UA 4XAGA 1LF1A 5ABEA 3TW9A 1QW8A 4E8DA 4GA8A 3NQMA 2PDGA 4FAMA 3E5BA 5HR7A 3GTIA 1RVKA 3NEVA 2VI0A 3HOJA 1XM3A 3EAUA 1NEYA 3H7UA 2GJRA 2GWNA 1V02A 2DZPA 5HNUA 1HKIA 4ONVA 3W6LA 3DH7A 3CUGA 3MI2A 5DCEA 3UBPC 2J66A 4JEJA 4GZEA 2J7FA 3E0WA 2F6KA 3L0NA 5AHFA 7REQB 4UFJA 1YPIA 3WH7A 2DP3A 3PANA 3W2MA 4QS6A 3AYVA 2VXNA 1ICPA 2FMOA 1H61A 3MQTA 4H9ZA 3PC0A 2QJMA 3MP4A 1MNSA 2J6VA 2XYLA 4ATDA 3OQEA 3HA1A 4JYFA 3T40A 3N2MA 1ZBCA 3KP0A 4TVCA 1ECQA 2DDXA 2J47A 1GOOA 4XKMA 1AL7A 1TWIA 3Q45A 2QUMA 3NQ2A 5IDIA 4DJDD 4JFUA 2OWCA 3P67A 5AZ1A 3U48A 3ZS4A 3L12A 3KHDA 4GFIA 1DYSA 1G4PA 2V9DA 4DPPA 4GUGA 3WMBA 1TE1A 1BXNA 1GVFA 2BV9A 1S5MA 2C79A 3PJWA 2H8XA 3TWAA 3H6OA 3L68A 3LMZA 5FAJA 2OSWA 1H49A 3LHTA 5EPDA 5DY2A 3WJZA 5IFTA 3S4TA 2JFEX 3GNNA 2NZLA 5AVHA 1UZ4A 2PDWA 2XM1A 3HGSA 3TLQA 4K36A 1UKPA 3HTWA 4W8BA 1XSJA 1EYEA 3NTYA 3W7KA 5DEZA 4XD6A 3WDJA 3VIIA 1AQ0A 3AUJA 2QV5A 3STEA 4NG3A 3W37A 1GHSA 2A3CA 3F4DA 4X0NA 1B90A 4FNPA 4EPBC 2PTYA 4C5YA 4FEZA 3W2LA 5E6ZA 3IIXA 2IUZA 5FD0A 3LGDA 3UZ5A 3AFBA 2XIIA 4LX4A 3OW1A 3A3WA 1WXYA 3RU8X 5F4SA 4E4FA 3L4VA 1V4YA 3IUIA 3MYOA 4JYEA 4DJEC 4REQA 1NDVA 3LERA 1YE6A 5AC6A 1JUEA 3UCCA 2OR2A 4H04A 1OF8A 3GYEA 4AMCA 3AQUA 1H51A 3WBWA 2NT1A 1G7UA 1E56A 2YBVA 4MJ4A 1Q8AA 2CWXA 1RJPA 3HFTA 3DYOA 4KEZA 2X30A 1GJUA 3LTPA 1J5TA 4ADUA 3NO1A 4ERGA 4PYSA 1NAL1 5JBDA 4H00A 1RQBA 2BVYA 3CBWA 3CIVA 3SECA 4GYJA 3V0UA 1Q2SA 4TX9A 1W3HA 2QIIA 4JD4A 1SVDA 1VEPA 3KLKA 4NX5A 1LQ0A 4GOAA 1Q6LA 3M41A 4M6PA 3FAXA 4MLRA 3TMLA 4DWSB 4ZOAA 1EHNA 3CB3A 2PE4A 1EOKA 1D8CA 4K1GA 2YXXA 2ZE3A 1K7EA 3PNUA 3W26A 5HQEA 1V3LA 1F74A 1FWJC 1UMYA 3CPRA 3V18A 3WK3A 1JYWA 1B3VA 4J7RA 2ZRUA 4PMUA 5D37A 1V6UA 3T2QA 4LF2A 1R3RA 3LUTA 2RJGA 4JX4A 3U2CA 1DXEA 4LALA 3QC3A 3WLJA 4HYWA 5I03A 4IM4A 3WDPP 1IEWA 4BJHA 3OHMB 3VIKA 4NX0A 4QG6A 3A64A 3SB0A 4AZHA 1FWNA 5MKGB 3LENA 3UT0A 1V02E 4MNLA 2R1LA 5G2WA 2OCZA 3O63A 1J10A 4EAYA 3GDBA 4GC3A 2J7BA 2WC4A 3F1QA 3MUY1 4JFWA 4RZ5A 1UC4A 1VHNA 2A4AA 1EUNA 4DJDA 5K4XA 1RJQA 1LLWA 2HVMA 5I09A 1ZENA 4W5UA 3GK0A 4JFTA 3VGBA 2ZZ2A 1XI3A 3UPWA 3VAVA 1QHPA 1E0UA 2BOEX 2DZSA 1SO6A 1XIMA 2DT2A 4FLSA 4J3UA 2NSXA 5A6AA 5ABGA 1O5KA 3M5YA 3BSMA 5GQBA 4P8XA 2INFA 5CC7A 1K6AA 2WBKA 3GNDA 1VPXA 3EOUA 1SZGA 3BMWA 4ZOBA 3E6EA 3GG8A 3BDKA 3VZZA 4F79A 3S6TA 3U2OA 4AD0A 2OXNA 4HCLA 4QS5A 1QBBA 1UIOA 5IHRA 2VP8A 3UYCA 1XS2A 4HU8A 2NV1A 4IF2A 1E6ZA 2EG6A 2W66A 3TR9A 3GXNA 4DBDA 2W4XA 1X1ZA 3N2CA 3W1AA 3CL7A 3NOEA 2VD9A 1R85A 4U3CA 3MWCA 4A2SA 5I3GA 1EA0A 2E9LA 4ICCX 2Q3OA 5K9CA 4V1XA 2QGYA 1WUEA 3AXHA 3SQSA 2YL8A 1JZ5A 2ACUA 1EDTA 3HO8A 2AL1A 2REQA 1JAKA 4UUIA 4CUCA 1LT8A 2C14A 2OYLA 1E1FA 1I6NA 5EFDA 1BVWA 1UWSA 1QWGA 2JKEA 3P84A 1BXBA 3TJLA 2VFIA 2YDAA 1B3ZA 1TWDA 1W1IE 2GJLA 2G3FA 4RE3A 4N02A 3CV1A 1QNOA 1NDYA 2TMDA 1LZOA 3VDBA 3FNDA 1R3YA 4BEUA 2CBVA 1ZAJA 2Y6ZA 4ZQCA 3AXXA 4WHBA 1PS9A 3P61A 3L4WA 1QTWA 3BOFA 1UD4A 2J7DA 3NXFA 4NAFA 3T09A 2W5FA 2ZZ1A 3B9EA 1Y0EA 2PZ0A 3C8NA 3SCQA 1T6MA 2OZ8A 1WV2A 4ROQA 5LXXA 1UH4A 4XD3A 3WL1A 5F2MA 3CIXA 4YTUA 4NJKA 3LNPA 1WAUA 1GW9A 1F61A 3V0SA 1QI4A 4MPQA 4LBSA 5GVJA 1CCWB 1RPKA 3KL3A 1QVBA 2XFRA 4K8EA 1HNYA 3BO9A 1E72M 2O55A 1ODZA 2HRWA 2YDRA 3RX3A 3VOIA 4IL0A 2OB3A 2Z7GA 4GZIA 1M53A 1RHCA 4US6A 4RXGA 2WM1A 4GJIA 5KITA 1Z44A 4AF0A 3GHSA 5LHEA 4A29A 1YQ2A 4OV9A 2ISWA 4PGLA 3QXBA 4RPPA 1E1CA 3AXKA 1F8MA 2GK1A 5AVNA 2B81A 4MF4A 5GNZA 5CSRA 4A8LA 2WC7A 4IMFA 1OSEA 1NWRA 3M9YA 3PK7A 4QITA 2OQLA 3URQA 1PHQA 2V3FA 4C1NA 2V69A 1S5VA 4UMCA 4BWLC 2WMKA 4KWUA 3I65A 2JBMA 1P0BA 3ONCA 3PUEA 3KOFA 4KIEA 1U5VA 2ZUTA 2PTWA 4JN7A 4KWOA 2OOFA 3FOKA 1H2JA 2WNQA 1TSIA 1I2PA 4E4UA 4QJ1A 4YMZA 1JCMP 4MWAC 4AY8A 3LRMA 1TJ2A 1NFBA 2P8BA 4R7JA 3ZO9A 5D2WA 2A2IA 4PSPA 1EC9A 4D6JA 1DJWA 1PWLA 1PKYA 2YW3A 2VUYA 3AROA 2C1GA 1G4SA 3OIHA 4JQ2A 4LEFA 5JBFA 3UR8A 1GQLA 4OWGA 5D33A 5HK4A 4O4VA 1OZMA 4EF9A 2G50A 2IKJA 2OX4A 3PR2A 3UJFA 4ZXOA 3B03A 3A5FA 1QDSA 2DJXA 4BA0A 3B8IA 3HV8A 2OGJA 3C3NA 4MY1A 3W28A 1EP3A 1Z69A 3IJIA 1JFXA 2DEPA 3WQ6A 3VCRA 2QXWA 3RLGA 4IGMA 3WLPA 3IJ7A 1O4UA 2O7QA 3BK0A 3WLMA 4B5TA 2CBJA 3N73A 4C6OA 1EP1A 3G0XA 4GGHA 2BVTA 4JL2A 3CTLA 4E3VA 2FZ8A 2IPFA 2J13A 5H8MA 3NYDA 4O0ZA 2WJDA 3DENA 2CNCA 3B40A 1PZ2A 5FI8A 3QH2A 4Z0JA 3DEQA 1GYNA 4W85A 4GINA 4TTUA 4A05A 1KCZA 5REQA 3QY6A 4NASA 2Y24A 5E93A 2W61A 4ZE4A 1JDFA 4D1IA 4G8TA 4X9YA 2C6QA 2CKRA 3WNKA 1MEHA 4KWWA 4EACA 3TWBA 2VZOA 1PTAA 4BI6A 1WOBA 5BWFA 5HJLA 1KV5A 5A2BA 3BTNA 3L2IA 1YIXA 3OO2A 4PUMA 3KOZA 6TAAA 2ZZ7A 4F0LA 4I8DA 4XAYA 3UU0A 1VBRA 2PAJA 3P8IA 4C5ZA 3SGZA 4L6DA 3VD7A 4M5PA 1CIUA 5I78A 5DN1A 2GLKA 5BXPA 1ONEA 4NJIA 1UH2A 1OQFA 4Z08A 1HGYA 1KRMA 1BVZA 2OZTA 3II1A 1GZGA 3CM4A 4DBSA 1XKJA 3M44A 2EHHA 3SCVA 2OLSA 1Q6RA 4YCPA 2NVAA 5BRBA 1G01A 3NOYA 3QTGA 5HMEA 3WQVA 2GGGA 1VAHA 4H7CA 2CLMA 3HG3A 1H11A 3UXIA 3MVTA 1OY0A 4FOUA 2J8GA 7ENLA 2DQWA 4JBRA 2J8FA 2VKZG 2W6RA 3MHFA 4C6CA 3QR0A 2WXDM 4DRSA 4L6OA 3WQGA 2DT3A 3HGOA 2Y7FA 4WY0A 3THQA 1KW1A 2CYGA 3VGHA 2ZX5A 1MXDA 5LA0A 2Z6JA 2E25A 3P6LA 3DC0A 5BROA 1TA3A 1K8YA 1RA0A 3GO2A 1W32A 4C6BA 4NZ4A 3E1F1 4JIQA 2WVUA 3WJSA 1IIHA 1G1YA 2YA2A 4OIFA 3HU7A 3H54A 1SZRA 1XH0A 4IPLA 1PCWA 3L4TA 3JW7A 2QIWA 3A47A 5DMYA 4IUGA 3WDHA 3Q4DA 4GZ7A 1W9BM 1AMYA 5LXEA 2V38A 3O06A 2AAAA 2ACSA 1SMAA 3KVKA 3S2MA 1Q6GA 3AYSA 3I68A 4LEQA 3TFXA 5IHSA 4L4PA 1EWEA 4ZMGA 3V5OA 3TAKA 1NP2A 4O1AA 1A5KC 4UTUA 2BHUA 2D3LA 4NL1A 2DPEA 3BLEA 1K9EA 5CPTA 4FB7A 1UQYA 3IRSA 3GXFA 3T2PA 4AX6A 1JPIA 4Q8UA 3SJ3A 1IZCA 1BYCA 1ZALA 2PEVA 4DF0A 3G0SA 4WJ8A 1I1XA 4L5ZA 2HQAA 4DWSD 4HSOA 1D7FA 3RM9A 4ADSA 4CNTA 1VB9A 3H70A 1VKFA 4IFKB 1GW1A 1XLLA 3LSBA 4A8RA 4GMEA 1X7FA 1UJQA 1C8XA 2XVNA 2Y2WA 4DUOA 3E12A 2MNRA 1CW2A 3TTEA 1UHVA 1XFBA 1XL9A 4P8UA 1EEXA 5CPLA 1H7XA 1XF0A 2INEA 4JQAA 4ZZ9A 3RLUA 3QKEA 5KEZA 1JR1A 1NWUA 1Q85A 3AISA 5JBEA 1VHCA 4I9TA 2KZHA 4M6VA 4GYKA 3M1ZA 1AW5A 5F2IA 2VNCA 4OKDA 3HPFA 2A7PA 1IT8A 3LS9A 3CIWA 4CCZA 1HT6A 2YJQA 5FA5A 4KWSA 2W67A 3JU2A 3OBEA 3FYYA 1ZSXA 2IQDA 3BXWA 4PBFA 1CXHA 4Q4RA 5D2YA 1WNOA 1K02A 2W62A 4Q8QA 5I3KA 3V1HA 3TC3A 1JZ8A 4H41A 3N6HA 3N13A 3QPEA 2PDUA 1A5NC 3SFKA 1AA1B 2H9AB 1Q63A 3VD3A 2GUYA 2DIJA 1T41A 2A1YA 2WMJA 3W7DA 5LA2A 5CXPA 1A5SA 1RCOB 5FOOA 1Z32X 2VGBA 3LQLA 3QGVA 2ODOA 4MDPA 4OUIA 2JF7A 4R3UA 3MSGA 2QAPA 2KX9A 3H26A 1C3FA 2DSUA 4L6HA 1WZLA 2NUXA 1JPMA 1IEIA 1V8EA 1CLXA 3MKVA 2OELA 3FV9A 5FEZA 1E5JA 1W1PA 1CLVA 3F4WA 3M5XA 2XFYA 5CQ1A 3SO7A 1UOKA 3W1PA 4QSFA 2VQTA 4LBUA 3CUXA 6REQB 5HNRA 3AC0A 1E9YB 3UPMA 4QFUA 1T0OA 4NU7A 2WB5A 4H7VA 4Y7EA 3LU2A 3KBWA 3GXDA 1AJ0A 1SZNA 1QBAA 3WF3A 2NXGA 1F3XA 3PJXA 3TQVA 3VGGA 2V82A 2NWRA 1YADA 5D2TA 1EYWA 3NQFA 3PZMA 1XDJA 3GVQA 3KEHA 4UCGA 1OD8A 2ZUWA 5D9OA 3TA9A 5M5DA 3W7CA 5L9FA 2YCEA 3T7VA 3HGJA 5AC7A 1OABA 1XIBA 5T8GA 1DE5A 2AOSA 3GIPA 2G96A 2BGNE 2WNZA 3EB3A 1J12A 2ZZ3A 3F4VA 1K9FA 3R11A 2ZCGA 4DJFC 4PULA 2DY3A 3QEZA 2EJ1A 3TLLA 3N4FA 2NQ9A 3PNZA 4FZIA 4DM2A 4C6NA 5LNVA 3KBMA 1A49A 4AC7C 4RE0A 3DC8A 3CAWA 1ECEA 1BSLA 1PIIA 1G7VA 1S1PA 1YLVA 1B57A 5BU9A 1S2WA 1XW8A 3UWQA 1K7XA 1EIBA 1GVSA 5IRPA 1E6PA 2FB3A 3QR3A 4LBRA 3VIMA 2WZIA 1RVGA 3MUIA 2WK2A 4O57A 2GDQA 3TTOA 3VNMA 2QCHA 3SY8A 3ANYA 1F3TA 4KKXA 4QDWA 4RE4A 4V15A 1K1DA 4P7NA 1FHUA 2ZUVA 4A8NA 5SWUA 1JZ6A 3H2EA 1U30A 3W9ZA 3T0DA 4AEFA 1UQZA 3D47A 2H6RA 2IKGA 3RILA 3TONA 1X38A 2X1TA 1H1ZA 3O8AA 4H9UA 5CLWA 4P7OA 5CCZA 1OC5A 1F6PA 1UJPA 3GFYA 4HMDA 1UR0A 3K8LA 4HSHA 4R27A 5G1YA 2JIEA 3JVAA 2GVYA 4WDXA 4CQ9A 4D6DA 2W27A 3C56A 1QMLA 5G4WA 2R1MA 5E9XA 2PDXA 1MDLA 3SZ8A 3GTXA 1AUSL 3SFWA 2ABBA 2VOTA 3IV8A 4NIRA 2HROA 4NXKA 4ZTXA 1JFHA 1EJUC 3ZR5A 2XHYA 1VEOA 1GVYA 4DBWA 4P61A 4MFEA 3G1XA 1Y5WA 3LEPA 4C7DA 1Z8AA 4HPGA 1PX4A 3WQOA 3TYCA 1XRVA 3GAKA 1QWKA 2WZEA 3EWDA 3M4HA 3UYIA 1S5NA 1OC6A 2X40A 2Y88A 2ZQ0A 1YE4A 3W70A 5CPNA 2W9MA 2Z6IA 2DIEA 4ILSA 4D2JA 2HK1A 3LCIA 1H4PA 3T4CA 4IPNB 2A6LA 3CYJA 2DW6A 3R2GA 3QFWA 1QPNA 4B92A 4IZGA 4I7WA 3LCFA 1U1UA 2VC9A 1QI5A 3IJ6A 3OLDA 2Y70A 1TIMA 2EBNA 4J28A 1RALA 3BAXA 2YIHA 1GONA 1XR2A 3FX4A 3N34A 4JQ3A 3FSUA 4HTBA 2W3ZA 1FVPA 4WEVX 3FXYA 3ISIX 1GZJA 2Q3RA 1ZGDA 5CC6A 3APGA 1J8VA 3AIBA 3GDMA 2VCBA 3APTA 4OZOA 2XFFA 3O6AA 3E0IA 2HVOA 5A5WA 2XGIA 2AGTA 1J6OA 1UWUA 3EOOA 3H53A 4O4WA 1T8XA 2Y62A 1JCYA 2P5NA 2VDGA 2F2HA 5AYZA 2DVUA 2QVHA 3EA2A 4MKNA 2FZNA 2ZXDA 3EOEA 1Q65A 2V30A 2D2HA 4JAWA 4AVNA 1R6WA 4ZQOA 1TTJA 2J27A 2XIJA 3VD9A 2VEMA 4MY8A 1OCBA 3D3FA 1E43A 3E3HA 3W23A 3KVJA 4E8GA 3COTA 3OEXA 4W88A 4LVDA 4BHYA 3PBWA 2VVNA 3ITTA 1XLIA 2DVTA 3D3AA 4HMCA 2FZMA 3CMGA 2PBOA 2CLIA 1DJXA 1VLIA 3A13A 3LOTA 3ICJA 4PL1A 2E40A 2I1OA 4B5NA 2OQYA 4TX8A 3ZT5A 4J2MA 2JE8A 2QPXA 3R7MA 2I5QA 1XWYA 3VU2A 3KAOA 5FJOA 1NQ6A 3SR7A 4U5IA 1UD3A 1LOSA 1KBJA 4HPXA 4ZGYA 4GBDA 5HJXA 4U31A 1WB0A 1CZ1A 4HZ6A 4O28A 4E3TA 4ZQRA 1PJ9A 2CLKA 1C8VA 1P0EA 3KZPA 2J79A 2TSYA 3R8GA 3WNLA 1TV3A 4G7FA 1YXYA 3UCQA 3BAIA 1ALDA 4F9JA 1OVDA 1QFEA 1L8PA 1EPVA 2OQHA 5LSMA 4QROA 3CHEA 4FALA 2Y7EA 4PC8A 2GSEA 4IG2B 1A3HA 4CNNA 1HO4A 2XVLA 2CCRA 3NL2A 1RH9A 4QCEA 3HG5A 3WQ5A 2QT3A 2C15A 3T44A 4BFAA 2VFFA 1BSIA 4GH3A 1RR2A 3KTXA 1MMFA 1GQIA 4EIVA 4E2BA 1ADOA 4UBPC 3SW6A 3DG3A 4AQLA 3UERA 1UA3A 1D8WA 2QUTA 4NY2A 5A6MA 3WBEA 3WENA 4NXSA 4CN6A 1R3SA 3GDRA 4U10A 4UFMA 3BCFA 4LYPA 1E9IA 3OJGA 3WEZA 1EKOA 4QJ4B 3CMJA 3B4YA 1VGAA 3AMDA 1EBGA 5JVLA 2ZUUA 1OFPA 4TXEA 2V5LA 3KVMA 1VJSA 1KXQA 3C6CA 1UWTA 1F05A 2GFTA 2WCGA 3W7RA 4O52A 3KOYA 3WF1A 1QPQA 2WVSA 3TJXA 3OBKA 1QR7A 4GYPC 2CETA 3N9KA 3M07A 1P1XA 1XSIA 7XIMA 3ITCA 4NHVA 1ZHAA 1WPCA 3WD1A 1JDAA 3GDKA 4LUIA 1QU4A 1RBLA 1Y7VA 3ZM8A 5ECVA 4IPIA 1LWIA 1RY0A 2EG8A 1A50A 4Z1CA 3N25A 1PDZA 3EGJA 1X6UA 5HINA 3IS4A 2JEPA 5I02A 1JYVA 4ZR8A 5BZAA 3LCHA 5G1TA 2Y85A 3IGHX 1EOMA 4S2BA 2X05A 3WELA 1K70A 3PUGA 3O0FA 3ZVIA 4JTEA 3B0VC 3PZUA 3BG9A 4MB4A 3BLKA 4WUIA 3WY1A 2Y61A 1VFMA 3N2TA 4IHCA 3EPMA 1HJSA 2J7EA 5FL1A 3W85A 1TV2A 3QZAA 3AHTA 2E67A 2WMHA 2X42A 2NVDA 3P62A 1XLFA 1TPH1 2J78A 4EXAA 1SO4A 3LRKA 2HNHA 4P7LA 4XX6A 1BYBA 3ARQA 1RP8A 4F66A 3BW4A 2I16A 2NLIA 2CHOA 2FFCA 3VMOA 3KBSA 4Q4MA 1WZMA 4PCSA 1DJQA 3UXDA 2EPOA 2ZZ5A 1N7KA 2JEQA 4IUOA 4GI8A 2Y5SA 3TIMA 3MUXA 1TIWA 2BTMA 2FLIA 1QAPA 1AQHA 4NYUA 3H7RA 2PWUA 2NUWA 4RLIA 1JI1A 1PKNA 3CLMA 1NVMA 1EJXC 1OYCA 1IE7C 3SN4A 1RK5A 4L65A 1F9CA 2BY1A 4DO5A 3LBCA 2IS7A 1UBPC 1XD0A 5EMKA 2Y8KA 4MPKA 1OGSA 1KM5A 1WDDA 4CVWA 3CEPA 2UY5A 1H1NA 4PA8A 1A0DA 3RPTA 1OM0A 1UWIA 5KZDA 2V6AA 1NM9A 3GZAA 1JG9A 1GNXA 3H8AA 2WOQA 4PCPA 4EKJA 3LPOA 1E55A 2C16A 1R86A 1V3KA 3FCPA 4QDMA 3R5EA 2ZZ4A 1XYCA 4AAJA 1FWFC 1TV4A 1JPDX 3LHVA 1ZJAA 5TD4A 2TPSA 4YS1A 3LYEA 4F40A 1TWWA 1M1BA 4H8NA 3L9CA 1VZWA 3N9SA 4QNEA 4V2XA 5LA1A 3SIMA 1XLJA 3OZOA 1GZ1A 2PC4A 1QPRA 4KFOA 3ZWTA 3W1XA 4CQ8A 3EXRA 3MJYA 4O1BA 5I79A 5I3JA 4UZUA 3URBA 2V67A 2YXOA 1JDDA 4Q4SA 3RM8A 4GI9A 1ZAHA 1FWEC 1HW6A 3AWNA 3OIXA 2VDHA 1J93A 3IACA 3OZPA 3KW3A 1POJA 3PTDA 5C5YA 4GI6A 2YCJA 3C2RA 4GIYA 2VFEA 3B0PA 2DH3A 2ZXBA 3ITLA 2WSRA 4LUYA 4ZA0A 1FH8A 2D22A 3EWCA 1X39A 4LCRA 2NSOA 2HCVA 8A3HA 3MHGA 4M7SA 4ZSUA 4UTHA 2PDQA 5EMUA 3PG9A 5FESA 2BODX 3OTRA 4Z2GA 3DHPA 1POKA 6XIMA 5A69A 4N4PA 3RMJA 3VMNA 3W27A 5FEXA 1D3CA 5G2IA 4Y8EA 1CT5A 1G4EA 4M7TA 4LW7A 1YXDA 2QJNA 5AOUA 4IH3A 3KWSA 5D03A 1XLDA 5TF0A 3VFCA 3AZRA 2H90A 1L2QA 2H9AA 3BWWA 5I07A 4HB7A 3UJRA 2ANUA 3LHWA 3TYBA 1UG6A 3G1SA 1JCNA 1XRSA 3JRKA 3M7WA 4G1NA 1DJNA 3S2LA 3VKCA 4C6IA 2ISSA 2WQDA 2Z1SA 3N2XA 4QRNA 7PTDA 3I6RA 5AHLA 2E4TA 3E02A 2V8ZA 4JTGA 3N11A 3K1GA 4LWWA 1REQB 3QYQA 3RLHA 2CIPA 4IIFA 5C2XA 1H09A 4DLMA 1RLCL 1K7FA 5F2GA 1EDQA 3P7YA 1GUVA 2GGIA 3SEPA 5HPOA 3TUUA 1C9DA 5LIWX 2PGWA 2QUUA 3ARUA 5K7JA 4JHMA 3TCSA 2EF9A 6REQA 1XUZA 5G4HC 1VEMA 1W2VA 9XIAA 3LBOA 3C2YA 4K8HA 1S2VA 4PCFA 5A6TC 4H83A 4AU0A 2RDUA 5E0FA 2XUCA 1XG4A 3TDFA 3PTMA 4FHAA 1MWOA 2QCFA 1OINA 3W72A 1Q3NA 5E6YA 1B2YA 4MSSA 4DEFA 1VFHA 5GNXA 2Y1HA 3GNPA 4LF1A 5CZSA 1R9ZA 4Y8FA 1EL3A 3VD5A 1JUBA 2ZRVA 1E6NA 2F2KA 1L6SA 3WF0A 3G18A 2PLKA 4GPNA 1RSCA 1TV5A 2UY2A 3QV7A 3GKAA 5CBIA 2FPTA 3PPHA 4YIWA 2PDCA 1E9LA 1CGTA 1MQRA 4C1LA 2CU0A 3CUZA 1KFEA 1GOMA 1GWJA 1XD1A 4PTVA 3BZJA 4PTWA 1UKSA 1MYRA 3MA8A 1A5AA 5IFPA 1VS1A 1B9BA 1YTDA 1DTUA 3H24A 4HN8A 4XZIA 2YCIX 3ZSSA 3DYMA 4V27A 4B2DD 3L4UA 4EAMA 4DX3A 4JTUA 4NILA 1E3XA 4EX4A 4GQBA 3V4BA 3CPGA 3FHAA 3S8HA 4MJ2A 2GQAA 3BMXA 4NAEB 5I3HA 4AYSA 4AXKA 4LCQA 3S5ZA 4ZFCA 4IIDA 1O95A 3UXKA 5RUBA 2WZHA 3SQLA 1YTEA 3WKZA 2OTDA 5B80A 4IQLA 3NZPA 5D4YA 4X22A 3PF3A 4K7VA 1VBGA 3VDHA 3SRKA 1TFVA 4WJEA 1V6VA 1JD7A 1J0HA 4Q7NA 8TIMA 1V5XA 4D6EA 1CWYA 4KEMA 2BHYA 2GOUA 1EXPA 2FTPA 1HIZA 2WJEA 3BGAA 2CZEA 4V33A 1LJYA 1F3WA 4GJJA 2O4MA 2IKIA 1R30A 4XZBA 2VFHA 4XQ6A 2PC8A 2VRQA 2Y7DA 1I45A 2CESA 1WDRA 1GYLA 4V28A 1HJVA 2AAMA 2Z7KA 3MI6A 1M65A 2PDJA 2YBUA 1D7KA 4A3QA 1NP0A 5E0KA 2VZUA 1FTXA 4XZMX 2ZTJA 1W5NA 2BX7A 1M03A 3SCOA 3KZSA 1W5QA 2XSBA 1H5VA 4JTAA 4BQ5A 4ML9A 4CNPA 1V6XA 3O05A 1Q13A 5DCDA 2DZVA 3KRSA 4S3CA 3KL5A 4CN1A 5AYXA 3UW6A 2PLMA 1QNPA 4PMDA 2XIBA 3DKJA 3GNRA 3YPIA 1I9CB 1RXOB 2JQXA 3VIFA 2HK0A 3D6NA 4Q8NA 3CZJA 4PMRA 3L4YA 4JOMA 3DZ1A 3VVGA 4BQ3A 4F0RA 3C2VA 1N8FA 4NZJA 5FCZA 3A21A 3VILA 4M3PA 3EB4A 3CV6A 4HU0A 5A6JA 2IMRA 4ZE5A 2FIQA 4JTLA 4AZ7A 3LHYA 3LCGA 3FVDA 1Z48A 2XIMA 3PZIA 4N0RA 2QDGA 3WQEA 4QJ5B 3VNKA 3W83A 4AHQA 3TE9A 4LB3A 2GJPA 3PN8A 4FOJA 4UTFA 1VPQA 1DJIA 4MNJA 1BGAA 3W22A 3OOQA 1WYIA 1WE5A 1QO5A 2CZFA 5CLTA 1OB0A 4TVUA 2YR1A 2WPGA 1OIMA 1QNRA 1UZ1A 4C6QA 1EP2A 1M7OA 3S1UA 4MUZA 3T05A 3E2QA 3TC7A 4H19A 3FEMA 4LCSA 3PBUA 4JGDA 4YTQA 4J5NA 5CZTA 3GR7A 2BG5A 3KRBA 3BOXA 1C9WA 3DERA 3MSDA 2ZUNA 1UBSA 2OEJA 1DIEA 1OWQA 4IIHA 4KMQA 5JXQA 4KGLA 2YYUA 2RKXA 1W5MA 2R94A 3NO5A 3C8FA 3U7VA 5AZ0A 1RBAA 1IXPA 4C6MA 3ARWA 4CU8A 2J9YA 1MI3A 1S38A 4B5XA 4KEVA 2NV2A 1C29A 2ZXAA 5G4EA 1NWTA 3MMTA 3C2EA 3R89A 4KT2A 3SBFA 1XICA 4C6LA 5FEWA 1E6RA 2PGEA 5EFFA 2A3LA 3VZYA 3VOCA 4A21A 3MMUA 1CB2A 3QMSA 2P1FA 4B2DA 2YDQA 1WDQA 3PAJA 3CWNA 3DKLA 4D6HA 1J0IA 3VIOA 1H7PA 4WLCA 1AJ2A 1AZ2A 3USBA 1PZ3A 1U5JA 3HG2A 2OWXA 1UPPA 3CC1A 4HBKA 3LLFA 4H2HA 1T8QA 3FLUA 4DZAA 1ADSA 3W7QA 3GDLA 1F4HA 1FCVA 4O15A 5ENLA 1UCWA 8XIAA 3S9IA 3BLIA 1XUUA 3ME3A 3CAVA 3OP2A 4UWMA 1B1YA 1TE6A 4OHQA 3QV9A 3VCNA 3LLDA 1V3IA 2D73A 3QQ0A 1BFNA 5D30A 3CQIA 3W4RA 4ZODA 1Q7ZA 3GU2A 3EKZA 1WXZA 3IGSA 4DUVA 3LD5A 3EXSA 5CG7A 1GQNA 3Q37A 4JX6A 4N4QA 1KKRA 3W1RA 1M68A 1E0VA 1DBTA 1LCOA 3K13A 5LNSA 4IT1A 1JQXA 1PHWA 3G6LA 3T0BA 3WX7A 1UUMA 1W9UA 4IG2A 5BWAA 3MZNA 3AIRA 2QGHA 3PJTA 3UP8A 3B05A 3FK4A 1XLEA 3NUKA 2J9ZA 3P5YA 1GOIA 3BW2A 3DYPA 3U7BA 4A8IA 5IBXC 3CAQA 1R7OA 1XG3A 5DXXA 4FXRA 4ZXLA 3R8HA 4EPKA 1YDNA 2YSWA 2YA0A 3V0TA 3TKFA 4HGXA 3K30A 4CN4A 3NSXA 3HB9A 1YBQA 3T78A 4JTIA 3VPLA 2WMGA 1C90A 2CERA 3EMQA 1IQ8A 3NA8A 1R9XA 2PD5A 4ES4A 1LL4A 3GTHA 3CQ0A 4HJFA 4HA0A 5H6HA 1YDVA 1G5AA 4UTLA 2HS6A 3VYLA 2VC5A 3CV7A 4IMGA 3W29A 1CECA 3HFYA 2PGFA 4O50A 3GU9A 1UWRA 1W1VA 1AH0A 2QDHA 4B5WA 3R79A 3M0VA 4P7QA 1FXPA 2BY2A 3B0YA 2QUNA 4FMVA 3H4GA 2D0FA 4GO8A 1HJQA 1A0CA 1LORA 3NVDA 3ZJ7A 5DMMA 2Q8LA 4XSMA 2WBGA 3AHZA 4PUNA 4X60A 4BI5A 4UR8A 2A3EA 3TXVA 3DGRA 1S5WA 2PBGA 2BY3A 3T8QA 5T91A 4DF2A 3S5NA 1OYBA 4AISA 3GVWA 1W1ZA 5ABFB 3MO4A 2DUZA 3O16A 4QG8A 4KGJA 2BXVA 2UBPC 3UCDA 3BC9A 2DGAA 2P53A 4MHBA 1AW1A 4NI3A 5C9RA 4GKLA 1Z6KA 1T40A 4S23A 1EJRC 1ONXA 5CBBA 4FLOA 3KCLA 1VLWA 4AZBA 3G24A 1W56A 1QW7A 4CEXC 4FO4A 1LBFA 3G2GA 3UJSA 4CLMA 3AIUA 4IIGA 1L6YA 1GJPA 3EWZA 3GBEA 3OYXA 1W0MA 3ZXWA 4LH8A 2RJHA 4YPJA 1XPGA 1VIZA 1PIGA 1GVIA 2NQLA 4X63A 2D69A 3RPMA 2DUAA 1HJWA 1UKTA 5A6SA 1ZZMA 3W87A 5AHNA 4FI4A 1J0ZA 1A5CA 2A3HA 1KM3A 4Q8VA 1RQEA 5HWJA 3TV8A 2ZWZA 4HOXA 2FJUB 2OEMA 3RCNA 1A80A 3KE0A 1V77A 1XLHA 2CLHA 1I8JA 1W8SA 3NXLA 2XU2A 2C19A 1KQYA 4UTTA 3A12A 1RV8A 2NXHA 3CQJA 3GH7A 1ITXA 3IRDA 4WXYA 4UFIA 1SFTA 4ZO8A 3U0HA 1EEPA 1DWAM 3TYDA 1ZRQA 3AYRA 3LV5A 2WSYA 4INFA 1QK0A 2ZX7A 2BOGX 2HS8A 3SCSA 1E6QM 5C2GA 3UETA 3WL0A 2E0PA 1GG1A 3DFPA 4XZWA 3A6OA 3UZZA 1F8IA 3SURA 4YCOA 1W3JA 2UY3A 4AIEA 1CBGA 3LPFA 1SO5A 4A3UA 2C1HA 3ZLFA 1A5BA 1OFOA 4RNFA 2X0SA 1JCJA 4RNIA 1RD5A 1CENA 2V2CA 1NOWA 3OPSA 4P2VA 4XVDA 4I7UA 1CI1A 3F03K 3VE7A 1KBLA 1SFLA 4GQRA 1SJBA 3NQBA 4UQBA 3KWXA 4N9EA 4LYKA 1FHVA 4TU1A 1MW3A 3IUHA 3LZ3A 4IWWA 1BRLA 4OFCA 4AIOA 1FWIC 2IKHA 5FEPA 4O12A 2V2HA 2FZBA 5A2AA 4TX6A 1KR0A 1TZ7A 3ABRA 3B9OA 5D02A 4KRZA 4YU1A 2E77A 4MKSA 1TMLA 3EB2A 3NIYA 3S1XA 4HA1A 1FWTA 3PZOA 2A5HA 4W89A 4PUJA 2QVNA 4JIRA 4J4KA 3UA3A 2QJJA 4H9VA 2QNEA 1JVNA 1TVNA 3W24A 1E4IA 4O8AA 4WY0F 1KLZA 3LBMA 4H1ZA 1FDJA 3B8WA 5EA9A 1V6TA 4UR7A 2CC0A 3W88A 4O11A 4ZBCA 1FBAA 2ZADA 2C7FA 4DF1A 5I3IA 2W63A 1QJWA 3IK4A 4QE4A 4CGTA 3B0UX 4OBSA 4DO4A 4ATLA 2FKPA 4DYJA 1VBJA 2DJLA 1V51A 5FF0A 1N8IA 4R85A 2OWWA 3ZWSA 1LQ2A 3RUBL 2PP3A 3OLEA 3ZYZA 3VKAA 3DBNA 1ISWA 3G1HA 1U22A 4LQ1A 5AYYA 4F2BA 5XIMA 1TR9A 5LIYX 3UXLA 3F4NA 1Z41A 3MANA 1T7LA 1OJXA 1W6TA 4DYEA 2PSNA 1ICQA 3TVAA 4GZJA 5HMDA 2O4QA 2PF8A 4U33A 2Z25A 5DF0A 3NQDA 3GNXA 3UESA 4PRWA 3QHOA 1REQA 3H7VA 2MUCA 2ZE0A 4I9JA 1NU5A 4YWSA 1KWGA 2VFGA 4S3EA 1OK4A 3UVAA 4PTNA 1XLGA 4D6GA 3IGXA 4GABA 3QW4B 2GQ8A 4H6RA 1U5HA 3O15A 3NQAA 1ZBKA 4O0QA 2Y89A 2XGBA 3EA1A 4XUYA 2QULA 3S2NA 4HCHA 4ACYA 1K03A 2TAAA 4UOJA 4H8UA 2QCDB 4J3XA 5FL0A 5TIMA 5ECUA 4XV0A 2VZVA 3BJTA 2W92A 3TSDA 4ZOCA 3M0LA 1BAGA 1JULA 2ONEA 4HCDA 4PB3A 2R14A 3EBVA 3RN6A 3WLOA 1E5NA 4AXNA 4QXIA 2P10A 3KM8A 3QY7A 3CV2A 4WGXA 4UFKA 1VFUA 3ZJ8A 4X0VA 4AFYA 2OZ3A 4GUJA 3FY1A 1QATA 4AZ5A 3GNOA 2YGYA 3LCWA 1XYMA 6ENLA 2BOFX 3MTWA 4WSHA 5GJMA 4KW2A 4D9PA 1HZYA 3DFYA 3ARSA 1AH4A 3S5YA 2C18A 3W7MA 4NJGA 4U28A 2JGYA 3PAOA 5D8WA 4IP4A 2BWGA 1ZLPA 4CNUA 2PWVA 1TUFA 4XZHA 3IVSA 3MBDA 1DIOA 3NR0A 1MQPA 5DRIA 4C6FA 2QR6A 3E2SA 3ABQA 1XCFA 2PRLA 5C7HA 4ACZA 5HMFA 3LLXA 4K38A 4NAEA 4L9ZA 1HKJA 3DXIA 1O5QA 2ZRXA 2ZA2A 3B3DA 1G69A 5HNNA 3WFLA 3MB9A 1UUQA 7ODCA 1QXLA 1OFBA 2A3BA 1CDGA 4Q4OA 3KUMA 5C0QA 3MVIA 2X2YA 3FSTA 2GOKA 3ID7A 5KETA 1W9XA 2ZUMA 3QN3A 3KCJA 2CW6A 2XH0A 3ATZA 1ZTVA 1EQCA 2ZRZA 3JZEA 3MY9A 2XIQA 2QS8A 3CO8A 3SCRA 3OU8A 1FA2A 4H8HA 4LAOA 3UY7A 4MGGA 2YW4A 4RW3A 4G7EA 1ME7A 2PDYA 1OT2A 1MDRA 1R38A 1I0DA 2PD9A 3HG4A 2HV5A 1I2OA 2DSZA 2PGRA 2WLYA 1XLAA 3C86A 1GK8A 3WQWA 5D2XA 1ENUA 5HMSA 1P43A 3W6MA 1IZJA 4PZVA 1WCGA 3C61A 4LS2A 4MNMA 2P0OA 3GH5A 4IGSA 1EH9A 2V63A 3LN3A 4HNTA 3GFXA 4XD4A 4DYKA 4GJ1A 4PUKA 1ISYA 1LROA 1F4AA 1S2UA 2ISVA 1FWAC 2X8RA 3MUAA 3C0LA 1TV8A 3BV4A 2RGMA 1I1WA 2P3ZA 1DQWA 5LGXA 3TQPA 3TTYA 3BICA 5FJUA 1WO2A 1XLCA 1UKOA 3LHZA 3GXIA 3W7IA 3T55A 1RPXA 4C90A 3MJMA 3R4IA 1W5PA 4GYFA 2OU4A 1BXCA 1LLZA 1Q6EA 3FJ4A 3M6YA 1CPUA 3CL6A 2POZA 2X0HA 1EJWC 1NWSA 2VGFA 3WK2A 2A3AA 4AZCA 3HJZA 3M0KA 4RNHA 1YDOA 2UWFA 4AD3A 5J5RA 3BQ5A 1NOFA 1TWSA 1Z89A 4LS0A 3C0SA 5DX7A 3DX5A 2PLJA 4UTWA 1CXIA 1QUMA 5C2CA 3IK2A 3S5OA 5CSYA 4ZFMA 4XAPA 3IVTA 1NELA 2ATMA 2C71A 4XKYA 1NF7A 3S1VA 5XIAA 1E3ZA 4KF1A 5EY5A 1TRIA 3FAWA 2ZTKA 3WLHA 3PJUA 1B3XA 1KM0A 3BMVA 3AMGA 1XHGA 4WK9A 3MPGA 2WLZA 3UWYA 3S1GA 1TTIA 1LUCB 1K77A 3Q94A 4F8XA 3FYOA 3AHYA 4UNKA 3G22A 1VYRA 3GVVA 3HF3A 1ZCOA 3EEGA 5A8PA 5BOFA 4HHHA 2WWDA 3AHXA 2QCMA 4LY8A 4E5TA 3TN4A 3W38A 1IEQA 4MWAB 2WMIB 1B5TA 3NSMA 3WQDA 3SN1A 1RQHA 1XX1A 1V79A 3LXAA 4EOUA 3ARRA 2QYGA 1VRXA 2JKPA 3PM6A 3ZIZA 1MXSA 1FWRA 3RITA 3RXZA 3EWXA 4AD1A 3KS6A 1ZBVA 1EGVA 4O54A 1CEOA 1W1YA 1H7RA 3IV3A 3KX6A 3NPUA 1JRCA 4JNMA 4D6IA 3SRHA 3CJPA 2HDJA 4X2PA 4BF9A 5B7YA 4JPGA 4I6VA 5DRCA 2E5BA 2CZDA 4H6EA 4JNYA 3F2DA 4I90A 4HHPA 3N3MA 3CZGA 3ARZA 1I2NA 1FDYA 3NWRA 2RDTA 4EXBA 4NJHA 5J8LA 1B4EA 1EQPA 1C91A 5HWMA 3CTTA 2GL5A 3TROA 3XINA 1YPXA 2E28A 4U4MA 3V1PA 4NQ1A 4TV5A 2Z0IA 1OX4B 2E6AA 1AL8A 1DL3A 2WYSA 1EBHA 1YTKA 4PTMA 3BLPX 3T08A 2Z29A 3DG7A 1X98A 1KFCA 5HR6A 1FHLA 3L0KA 4XO7A 2NLYA 1ZFJA 4HOWA 4OECA 3NNTA 3BARA 4GWEA 3T0CA 2J7HA 1P7TB 1TVLA 2CKSA 3A4XA 3N12A 5K4ZA 4GKTA 1O94A 2VVSA 1MEIA 6A3HA 5ABTA 1XLKA 1XPYA 4HNCA 4HTYA 3S0CA 1GEHA 4XK2A 2QDEA 2IXVA 3REQA 2HE5A 4CD6A 4JXCA 1V0MA 4GK8A 4DVOA 1VD6A 3GM8A 4M24A 1F7BA 1B3OA 1XJBA 2R91A 1J18A 5AHEA 3GHRA 2R24A 1RCQA 2UZ9A 2HPMA 4R88A 1J11A 4LT9A 3PZVA 1T99A 3A5VA 1KCKA 3KVLA 1X8FA 3IEBA 4B3LA 1XDMA 3RF9A 5DFAA 4KS0A 3U4FA 1V6YA 5GPRA 1MFUA 1XP3A 5BMXA 1TG7A 3RM4A 4KIRA 1KWKA 3VGDA 2LLEA 3R0UA 2VEFA 2HPIA 1W54A 3UJ2A 2CPUA 3RO8A 3G0UA 6XIAA 2V5BA 1ME8A 4C91A 5GJPA 4FOKA 3UZYA 3O6CA 1W37A 2I9UA 1TKKA 4LS1A 3WLTA 3SSZA 1MUCA 4DIAA 5JIWA 2J75A 3WF2A 5A94A 4FF7A 2NV9A 4RXFA 4W8LA 1UOZA 5ABFA 3V5FA 2F38A 4ZENA 3RHGA 4KEUA 1Q6QA 3U9IA 4Y90A 3FXGA 3LB0A 1HXJA 2J62A 1KXVA 4DJED 3M6DA 2PODA 1VFOA 3W71A 2CHRA 2QEZA 4BF7A 2E8ZA 3TYAA 3ORWA 2J24A 1V08A 4JR5A 1D3GA 2H8ZA 5C6MA 1RY8A 4IXXA 4B16A 1XV8A 4QE5A 1AFSA 2BXYA 1K3UA 1E0WA 5J04A 2ZXQA 3POCA 4JN6A 2DSVA 4WR3A 1WAWA 3QSRA 1X6LA 5BCAA 5HOSA 1IHIA 3S46A 1HVXA 2P50A 3H4WA 3KDNA 1DIKA 5M03A 2IQ0A 1RBOB 5FF7A 3CQHA 1IWAA 1BKHA 4JDBA 1SJCA 3ARXA 5FACA 3AICA 3UR7A 2D24A 1A4LA 1GT8A 4LRSA 1M7JA 1X6NA 4CNSA 2E8YA 4UMAA 4FNUA 4CEUC 1PZ1A 3QZ6A 3G1FA 3UG4A 4L1WA 3TW7A 4XTDA 3AALA 1S3HA 2BSLA 1GOKA 2SFPA 3W73A 4UOZA 3ERPA 5C54A 3CZEA 1GOQA 1E9ZB 5CGQA 1V03A 2FPVA 1GCYA 3DG6A 3DAQA 3WLRA 1YYAA 3LTSA 3FIGA 5A95A 5MF5A 5U4NA 1W2PA 2NW0A 3KLLA 3AJXA 4YWIA 3AIQA 2OFJA 2BBFA 4P7RA 4NYYA 4HNOA 1SYTA 3WEMA 3P14A 1PDYA 1SPQA 2G95A 3A4JA 1YXCA 1JIBA 2WVVB 4LVFA 1S46A 1R46A 2GVGA 4ZB5A 2ALDA 7A3HA 4IX2A 4WDUA 4TOQA 1JQVA 2WSPA 4BZYA 4ERAA 2OT1A 4N9CA 2HVNA 1FFQA 2PCEA 4EXQA 3L23A 3SJNA 3W7GA 4QP0A 1VFTA 2NQ5A 4EANA 2X41A 2QJHA 1LBMA 4IJCA 4US5D 1Q2RA 1TMQA 3VOJA 3GLCA 1ISZA 4QM1A 1TR1A 2PMQA 3EYPA 3STPA 1WBHA 1O66A 5EBUA 3QLLA 3U4AA 1US3A 3H2AA 3NJ3A 2XZ7A 1XIFA 3T9PA 2PWGA 4XBKA 5DBUA 4MLJA 2VR5A 3ZSTA 3SIZA 3L0GA 5AYIA 1QPKA 1JF6A 3VI2A 4M6QA 3AO0A 3GUGA 1EDGA 3L5MA 1K8XA 1TVPA 1YX1A 4PEEA 2B4GA 1X96A 4Y9AA 4YTTA 3NDZA 4IP7A 4I7VA 1P6CA 4CU7A 3ITGA 1TZ9A 3ALGA 4JNZA 4N7QA 2V0TA 4QQUA 5D9PA 3NURA 1OFQA 1PX3A 3VKJA 4B4FA 4C6PA 2OYMA 4AZIA 5H1WA 3AIWA 1YHTA 3S1WA 3NPWA 3GG0A 3A22A 3RG6A 1NTHA 3CYVA 1NFPA 4DO6A 4XVEA 4D71A 3P5ZA 2GGEA 2WV8A 2IPJA 3N29A 4KFNA 1XIIA 4IJBA 2YA1A 2OPJA 1ZJHA 3G3MA 4H2CA 4XZNX 3F4CA 3ZVHB 1R47A 5LKYA 3B8UA 2GPTA 4HHMA 3R13A 4IQJA 4DJEA 1CXEA 1DORA 1GOWA 3LZ5A 2V81A 4ZQPA 1GTHA 3FN9A 4ICMA 5EU9A 1C93A 4HN4A 1LDCA 1B9ZA 2ATSA 4RNJA 1XXXA 1SQ7A 3RLVA 3P60A 1ZJBA 3IIOA 1UH3A 4TR9A 1TJ0A 3HM7A 3GU1A 4XZ9A 1VF8A 2J9XA 4XIMA 1HVQA 1W91A 3TU9A 3GDTA 4MJZA 5HWNA 3ZFHA 4WSKA 4L9YA 3GX9A 4JTKA 2BDQA 2Q71A 3W1MA 1GKPA 4OVXA 2A7NA 5BXSA 2XG9A 3DFSA 4ZTYA 3T07A 1OK6A 4LVBA 1OADA 1FWHC 1JJKA 1BYDA 4C6EA 2ZRWA 2FHCA 1WZAA 2PFHA 1MO0A 1E0TA 2GVJA 1IR1A 4PR4A 2G3MA 4RZ4A 4BI7A 2FHBA 2REQB 4HIBA 3RRAA 4MM1A 3VIHA 3S5SA 2DZWA 2Q01A 1XC6A 3B06A 5KZEA 1AZ1A 3WK0A 4UQ9A 3VOFA 2ON3A 1EO7A 4AD2A 4Z1YA 4BQ4A 3N4EA 4I3GA 4F9DA 4BCEA 1LG1A 1KTCA 3MV01 1JYXA 5EGRA 3F7JA 4O1CA 3LK6A 1NF0A 4FXSA 3VD4A 4NAFB 3KHJA 4W5ZA 4FF5A 4OBRA 3GVRA 3WIJA 4J2PA 5EMLA 1OEPA 2C8NA 3VIPA 1GKRA 1PEZA 5K9XA 4GIEA 4US5A 4PL2A 5HDRA 1IXQA 3THAA 2OX1A 3NZRA 4YVVA 1ONRA 1ITQA 3WH9A 4AC1X 4HOZA 3QJAA 1NDZA 2CWNA 4I5RA 1KBBA 2V68A 4GXPA 1DWFM 3CLWA 4WRHA 2XN1A 3PB0A 4KPLA 4CD8A 3QZEA 5E0CA 4FNRA 2JK2A 2XVKA 4UTWC 4ML4A 3QKZA 4UXDA 3U57A 1W31A 3W2NA 3HMJG 5FJTA 1ZB5A 1FKXA 3HZ3A 1FX6A 3WQPA 5F4WA 4AG0A 4CQAA 1OHLA 2VEKA 4RDWA 3KXQA 3LPGA 3WYZA 3O1NA 1E1CB 4NI8A 4H6QA 2GK1B 4AD5A 1FFRA 3CB8A 3OVRA 2OJPA 3WD3A 1QASA 4HSNA 3MSRA 1GHRA 1S2AA 4MIMA 4BY3A 3TYUA 2D20A 3DFOA 1A5MC 2FMNA 4NRSA 1OF6A 1SFSA 4PB5A 5M1TA 3L66A 4C1NB 1FH9A 4W7WA 1VBHA 4O17A 3T8LA 1MFVA 1RCXB 1AW2A 3MUCA 3TAOA 4D8AA 2ZA1A 3B9NA 2PWDA 1LTDA 3L2LA 1EIXA 2OT0A 2E6FA 1RJRA 2YL9A 2WHKA 7TAAA 4ICNA 3TMQA 3BAJA 5IM51 2WKGA 3DECA 4DZIA 3GRIA 2WMFA 3FYPA 1ICSA 4L9XA 2O7SA 5E09A 3N3TA 4R7WA 4AVFA 3PWAA 3VUSA 1UP2A 5LYRA 3CWHA 4QNWA 1WA3A 7REQA 3NQCA 3OGVA 2OG9A 3I6EA 1BLIA 3HIJA 3LSCA 4Z2IA 4M80A 2QHAA 3DUGA 4RW5A 4PRRA 5DY3A 3S6DA 3ZR6A 3QSTA 3G1RA 3SCNA 4LYQA 1HUVA 3EX6A 1LLOA 4LTSA 4HMEA 2GVLA 4C65A 1UC5A 4CCDA 4Q8MA 2ASHA 2V3GA 3BURA 5FIPA 3N15A 4YYFA 5LNUA 2AKZA 1H63A 5D8ZA 5I7GA 1XIHA 1GVRA 2AMXA 4CD5A 4OGZA 1KA9F 4AY1A 3SY1A 3AI0A 3GWQA 1RD6A 5AKQA 3BGGA 4E4PA 3QLDA 3VC5A 4LPCA 3RU6A 4Y9OA 3I7SA 4MTVA 1HP5A 2VENA 4CCEA 4O19A 1THFD 4UOQA 3UNTA 1LUCA 2VT0A 4BWLA 5I5RA 1ONWA 4E38A 2EPHA 3GXPA 3TNOA 2FTYA 2Z1KA 4LV9A 2C13A 3MP3A 2JALA 2VJXA 3UFYA 4JX5A 2G4FA 4Q22A 2VX5A 2E9MA 3NZ1A 3WLLA 2WMIA 3C5QA 3EDDA 3P0XA 1I60A 3E0FA 1DEDA 2GGJA 2OO6A 2NXIA 4G6CA 4HPNA 4DI8A 3WNPA 3TX9A 2WHMA 1IGSA 3C0JA 1JZ3A 2NX3A 1JCTA 3VIGA 1WXJA 4N2YA 2E1DA 3C0QA 2EEXA 1M5WA 1QK2A 1AJZA 1KFWA 3VFLA 4PMZA 2O9OA 4DJDC 5K3VA 5M3WA 2DZBA 3WMSA 4AUBA 1J2WA 2E6YA 1WDSA 3P0WA 3W7HA 6PTDA 3UY8A 2R1PA 1ZAIA 5CPQA 3JS3A 3PWGA 4ECLA 3LNMA 4GQQA 3KTSA 3QVQA 3S42A 2HISA 4W7VA 4GI4A 1UR3M 4AWTA 2R9RA 4JKMA 1DWGM 5EKYA 3IIZA 1LBLA 1NY1A 4RKAA 3IJLA 1ZU8A 1A4MA 2PUZA 4JDYA 4XAFA 3BW3A 2OEKA 5CEWA 1FWGC 1XISA 3Q2DA 3D46A 2V3EA 3QPYA 1OX4A 3PPCA 3U5YA 3QTPA 2J74A 3LPPA 1TA3B 4S3AA 1H62A 1BG9A 2G41A 2VGIA 1ZUAX 3P82A 2DT0A 3WJXA 3K4AA 5DT7A 5DMLA 4FXJA 2A85A 4TV6A 5KINA 1FWDC 4O1DA 3TK7A 1HO1A 4Z17A 1P7TA 5TBOA 1K6WA 4DWSA 2YL5A 4J3ZA 4BQ2A 4A2RA 1KC7A 1DQXA 3EX4A 4JTJA 3PBGA 3ELFA 3SM0A 1K4GA 3ITYA 3TA6A 1XCWA 3VCCA 3VKKA 3CEUA 4K1WA 3BL3A 1QRQA 3MZ2A 1HKWA 1Q7QA 1VQTA 1XDLA 2Z1XA 3VZXA 5K9DA 4LNYA 4G56A 1R9YA 1L0PA 2TRSA 1Q4WA 3ZJKA 4R53A 4C6KA 4H4IA 3EDJA 1PYFA 4MMWA 5I0DA 5MKGA 4PN2A 1Z7AA 1XGZA 2PA6A 2R6OA 4IQDA 4L61A 1ZP3A 3MCNA 4ZQMA 2GGHA 1PYMA 4PB4A 5H91A 2PTXA 4J27A 2O0TA 1JCXA 4TMCA 3ALFA 2PTZA 2WAGA 2WWCA 3LA4A 5C9ZA 1TRDA 1M3UA 3CNYA 3UG8A 4IQEA 4HMNA 4QEEA 2L5HA 4S3BA 3C3UA 3DU0A 1P6BA 3WNOA 4RV8A 4PUEA 3MO7A 4KRUA 1AG1O 2EG7A 3GAYA 3G1VA 3DHUA 4XTIA 4F0HA 5F7UA 3RCMA 4MADA 2D2GA 1I2RA 5CZJA 3GFZA 2EPNA 3UWVA 1XQKA 2E5CA 3BJSA 3PG8A 3JR2A 3FA5A 1SZEA 3BCJA 1CYGA 2VL4A 3AJ7A 4YVPA 1PKLA 3VOGA 3UEQA 3B8DA 4XB3A 1FCBA 1OFRA 5FF2A 5LNRA 3OYZA 4DWDA 3OA5A 4KQNA 2YDSA 5T9CE 4GGBA 5E70A 4DJFD 3IJDA 4DZ5A 1Y65A 2NVCA 1TV7A 4S38A 5HNTA 4FPSA 4LGXA 4WJXA 1KRCC 2PP1A 5I06A 3HBLA 3W82A 4ZL1A 2DFAA 3UF9A 1XYZA 1ITCA 4MWAE 1LP6A 2GUUA 1XIGA 3LCXA 1JAEA 4K7YA 5AC8A 1SW3A 4JEQA 1P0NA 3W7LA 3S9ZA 1E6SM 4JTFA 2G0WA 2J8TA 5IOBA 5KMYA 4BK9A 1Q6OA 2F9RA 1E1EA 4NP7A 1EFZA 3K46A 3CK5A 3CUFA 3H2CA 2MANA 3W7NA 1XGDA 3G1DA 1HJXA 1F2JA 4J3TA 4L4MA 2A6NA 2XWEA 3QQWA 1CXKA 1EJVC 5LHFA 2GDUA 3W02A 4FX7A 4ATWA 4UTMA 5I24A 1FWCC 4DI9A 5CPSA 1TO3A 5LNWA 4GNJA 3O2LA 3E2VA 3MI3A 1SGJA 4DLFA 1XYAA 4R9OA 3D5HA 4O14A 2V2DA 4M82A 2WVVA 4YHGA 4KBXA 3KOXA 1DV7A 1W5OA 1AODA 4GH1A 4GX9A 1UKQA 1J96A 3ABOA 3LGEA 4PUUA 3PFRA 3WUFA 1AQFA 2GJXB 2D2JA 4EWJA 4A3YA 1MUWA 1GPWA 2Z1WA 3A24A 4P5UA 4HA4A 2WJFA 4LAZA 5H8UA 1QHOA 1XBVA 1U1HA 2ALRA 4Y9NA 3NDOA 2F6XA 1A53A 4DNHA 2FQIA 1ISXA 2JKAA 2NX1A 1E71M 3GR8A 1LL6A 2HNEA 2AQOA 1O7AA 4GE8A 3AUOA 3J7HA 2IW0A 5HJYA 3T81A 1PCKA 2G3JA 2C0HA 3W76A 3LDVA 4HPHA 2D2OA 3IANA 2F7FA 2AGKA 3WLKX 3T2OA 1JF5A 5D32A 4WKFA 4W86A 4AYGA 1XC4A 3MU7A 2FJKA 1VP5A 1WDPA 1JNDA 4MAVA 3FDKA 1TYGA 3MS8A 3CUIA 4FNQA 4IMEA 4JQ1A 4NZ3A 3D0CA 3R0DA 1KBIA 3C2FA 2CBUA 3OB8A 3HQOA 3VNZA 2YZRA 2GJNA 4D1JA 5DT5A 3QHMA 2Z28A 4AEEA 5AECA 3U2EA 3ONBA 3OGRA 2FB2A 3W1QA 1MUMA 3HQNA 1UPMB 1M7PA 1PE1A 1YNYA 2VRKA 4J3SA 1BYAA 3ZVHA 5JQ9A 5AC5A 2VX4A 1HP4A 4MY9A 2OVLA 4ROPA 3VUPA 4OJYA 1EJTC 3VNLA 1GKQA 1P4CA 1QNQA 4O16A 1SJAA 1WZKA 3DOPA 3L4ZA 3GH4A 4IPJA 3BPWA 2G3NA 3BE7A 2VM8A 4A3RA 2VC6A 2D1ZA 1DPMA 5C9WA 2WANA 2BP1A 3OA3A 1EJ7L 1YEYA 3PUDA 1S5TA 4N42A 3SUSA 1IEXA 4OTKA 3BGJA 4DJFA 2XH7A 4WDWA 4MDOA 2WQPA 1PWMA 3TN3A 3HJEA 3OVQA 2PU1A 3BH4A 4KFPA 1Q6DA 4FLQA 4DAFA 5HUPA 4QG9A 4ZSTA 3PZGA 4QDPA 4JHOA 3ABZA 3WJYA 5D04C 3AIVA 3PFMA 1C7TA 1PTGA 2OMAA 1SFJA 4LV4A 3VE9A 1XLBA 2VHLA 4IICA 1A3WA 3SCTA 5BMWA 3KOWA 3NSNA 4JN8A 3ZOAA 1QI0A 4BEQA 1V3MA 3MCMA 3BAKA 4Z1AA 4DB7A 4W4QA 3GBDA 3EKLA 3R12A 2CBIA 1TX0A 3S9YA 3MKKA 1XIDA 1WBJA 4WSJA 5CG0A 4LVGA 5D9MA 4ZB0A 2BGSA 3DBPA 3WLNA 2HWGA 2DSWA 2DUXA 5I77A 4OU1A 1G94A 3KBJA 4DN1A 3R94A 1QOXA 2IPGA 3MHUA 4AIUA 2RFGA 4QLKA 3EOLA 4JIHA 5HQMA 3TTSA 3F2BA 3OVGA 4H9XA 1RAKA 1KO0A 3SI9A 3FKRA 2JGQA 3DFTA 3NL6A 1ZNNA 2Q8ZA 2YB4A 3ARYA 4HVXA 1G6CA 4RZ6A 3M64A 5D9NA 3LRLA 2EPMX 4KCUA 2ABAA 2CXGA 3IJ8A 2PDBA 4Q3MA 2RDXA 1XIEA 3Q58A 2NT0A 4Q6JA 1K4HA 4IIEA 3BLDA 1HFBA 1K8CA 1S2CA 2J77A 3KRUA 3NVTA 3UZXA 3SAZA 1WX0A 4Q8PA 3CAKA 3VKBA 4QLJA 3GIQA 3PSWA 2CLLA 4B3KA 4GY1A 2EKCA 4HT3A 1QOQA 1ZPTA 3CUJA 2XINA 4X61A 3PWIA 1Y5XA 1VENA 4PMJA 3NGFA 3RR1A 3CZKA 2Z2BA 3FVMA 3BLLA 5C55A 2HE8A 4OQVA 4LAKA 1U83A 1U1JA 1Z3NA 3R8RA 2XH2A 1Y5VA 3VOHA 4IGHA 1L6FA 3K4WA 1OC7A 5HUOA 4TUFA 3W07A 1XRFA 3VX1A 5CC5A 4YTSA 4JY9A 3TJIA 3GG1A 2ZZ6A 1W8GA 2XSAA 1EB3A 2D3NA 4D6CA 2QUVA 3LMYA 3WQCA 1A5OC 4IFRA 3R6IA 1PVNA 2C91A 2PB1A 4QLLA 2FZ9A 3CHCA 1UR4A 4IFKA 3E0LA 4Y9MA 1ITUA 4ZOEA 3BVJA 1QOPA 4UTKA 3QMTA 2D0HA 4MZYA 3W2UA 2Y8UA 3S6OA 4Z42C 4R7OA 2PPGA 4Y96A 2R82A 3MBFA 1E51A 4L64A 4RJEA 5EBAA 3UPBA 4GLEA 4KWVA 1LL7A 1CTNA 4Q7BA 2PI6A 4NZFA 4PCTA 1VFFA 3W7PA 4HZ7A 4IL2A 2F61A 3L5LA 3UGRA 3MP5A 1KFBA 3JUGA 3NZGA 2HBXA 4M51A 1N8WA 3TCEA 3LTYA 4IJRA 1JNEA 4M56A 4LRTA 3WH6A 2PDHA 3UZJA 3QQ1A 1TPFA 3BOLA 3LHUA 4QISA 4N6EA 3EDKA 4L80A 4GVGA 2YLAA 1BWLA 1O5XA 2ZOXA 3M0IA 5DCBA 3GZ3A 4DWSC 1TPB1 2BZNA 4GACA 5FF3A 5A8GA 4UQAA 3G5EA 4FX6M 5I3DA 1DHKA 1PBGA 1WOAA 1XBYA 1ZJIA 2ZRYA 2ZX9A 4JY8A 3CH9A 1B3WA 8RUCA 2HMCA 3MW7A 4O8RA 1OCQA 4GVHA 4QAWA 3NPVA 5EB8A 2ZC8A 4RCXA 3QY8A 4LB4A 4LUSB 5C8BB 2PDIA 4CD4A 3ES7A 2DVXA 2GVEA 4HYRA 4JFSA 3NQGA 3DESA 3W1NA 4Q8WA 3HPZA 3KS5A 1ODUA 3VIJA 1IT7A 3WBYA 4PH6A 1R2RA 1MRQA 4L1XA 3FHQA 1E70M 5FSEC 2CFFA 4P8VA 4S3KA 1TWZA 2VWTA 3USZA 1P5BA 2CHNA 5I23A 1O5RA 1FOBA 4XD5A 3VNYA 3TSBA 4UC5A 4GNVA 4Q7IA 4FNTA 4CVUA 1EPXA 4PMOA 4G9PA 3BAYA 2PU0A 3TH6A 2Y0FA 8XIMA 5DBTA 4HYVA 4X9SA 3GKFA 3N18A 2FDMA 3DFHA 4K39A 4N9DA 3LQGA 1UYQA 1TPDA 1FCQA 3GTFA 1X8CA 4AHPA 6CGTA 4GXMA 1KTNA 1YDYA 3I4EA 1TB3A 2O92A 3CS2A 4RX0A 3TFCA 2HSAA 4AZ6A 2CLPA 3GUWA 4MKVA 4TVDA 1V6WA 2Y4SA 4GYPA 3UG5A 3W1UA 2CZ5A 1IZKA 4ZCWA 3WLIA 2FZDA 1E4LA 3OZMA 1JGMA 3DIPA 4GO9A 1US2A 2OLHA 3CT7A 5FJIA 1TJPA 4IP5A 1C8QA 2PDMA 3ARPA 4Z2LA 4JL1A 2HJPA 2POTA 1JZ4A 3UWZA 2PDNA 4FIRA 1DTNA 1IF2A 4Q4QA 4IFOA 4PTDA 3W3OA 1D9EA 3NQEA 1I75A 1KKOA 2VR4A 3OLGA 4W87A 4H3DA 4LUJA 2YB1A 2CLOA 2GWGA 3MKCA 2J7GA 3SADA 3WD0A 4HHLA 1SSDA 2VEPA 3TYZA 3RX4A 1MQQA 1GOXA 1P0DA 1TPC1 3L7RA 4HKPA 2VTFA 3ARVA 1HKKA 1DOSA 4B9YA 2O9PA 5H2ZA 1KD0A 5CSSA 4B5VA 3WCZA 2QLYA 2J6XA 4Y9PA 2GQ3A 4RV3A 4AIBA 1WKEA 5HANA 4W8AA 3O3RA 2X7WA 3K2GA 1XYFA 4LANA 1PV8A 3M46A 1BG4A 3QR1A 3AZTA 3VDAA 5JIPA 5FF4A 2CZVA 3PUOA 1MRAA 1MXGA 2I5IA 3MMWA 2WZMA 2ZUSA 3STCA 3P3BA 2HTMA 1XINA 2PDFA 4P8WA 1KLYA 1MVYA 4RPQA 4I9AA 3U8GA 3ANVA 5H8PA 3NCOA 1Q6FA 3CHVA 2XISA 3FW6A 1ML1A 1W17A 2R8WA 2ZBTA 3DHDA 3QFEA 1DJHA 2VOMA 2Y5JA 3I3DA 5TQLA 5BRQA 2A7RA 2ESCA 2A0NA 1W3TA 3PHAA 3BSHA 4CNOA 1OYAA 4YJ5A 3LV6A 5FJJA 4YVXA 4AWSA 2FYMA 1ZCCA 4ZEPA 4U2YA 1I2QA 1K8ZA 3DN5A 3IIVA 2ZWYA 1GVEA 3HQ1A 3TW6A 3CGTA 4I5XA 1HTIA 3VNDA 1H0GA 4DXXA 1JDEA 3SGGA 1V3JA 1CXLA 1MNZA 1CX9A 1BF6A 1MZRA 2X09A 1JEZA 1OFDA 4CCCA 1Q7MA 4NNBA 5AFDA 1QI3A 2DU2A 2NUYA 2VC7A 2VO5A 3TOYA 2Z26A 1QI2A 4EK7A 1HL8A 4LUTB 2HXTA 1FDZA 4PCNA 3GC2A 4B5UA 3FKKA 2FGZA 1FXQA 3EX1A 3VINA 4OOUA 3GD6A 3WQ8A 3CMFA 3ES8A 2TYSA 2XPKA 4XIAA 4JCMA 2PRMA 3LX9A 4QCFA 1NJJA 1PL9A 4Q4KA 1F5ZA 1OFEA 1JXJA 1VFSA 1J6PA 2A21A 1JGIA 5A8QA 3IJQA 1L6GA 4LU0A 5KZMA 1QCWA 4R5EA 2ZVIA 3VGFA 1OX5A 3WD2A 2WCSA 1W9DM 1O12A 2VCCA 1VFLA 3WDIA 2GJXA 1UASA 1G0CA 1X7IA 1B0IA 2NX9A 4Z1DA 4M1BA 4DM1A 4L1GA 1GEQA 3N2OA 4O13A 1UR9A 3AS0A 2Q02A 2P0IA 1UW9A 1EHAA 2IXUA 2FGLA 2VQUA 3ZMRA 3L2MA 1SUXA 1TCMA 2QAFA 4O18A 1BQCA 5D05A 4UQCA 1BD0A 1HL2A 1UA7A 3OHIA 3AU6A 5AHMA 3MDWA 5U7SA 4GCXA 4ADTA 4DUXA 3G6MA 4LY4A 2Z00A 1D3HA 4MB3A 1Q8JA 3WLSA 2EAWA 2VX6A 3H12A 5TAOA 3W84A 5BXRA 1OCNA 2Z27A 5JUVA 1O68A 3NL5A 1YNQA 4WZHA 3QHNA 5EMJA 4XISA 4ORIA 2H3DA 1EXBA 3BZGA 3GVGA 3PTQA 3W25A 1PTDA 1TTQA 5E5CA 3HGRA 1JRBA 4O1FA 4C6DA 5FJPA 3SCUA 4FR6A 1KB3A 1MZHA 4H8VA 2OODA 1JZ7A 4G1KA 3E74A 1EC7A 4WVXA 3GW0A 3TQKA 4H9YA 1TPEA 2PTDA 3LM7A 4JTDA 1OGGA 1U2YA 1YW1A 2B7PA 1SR9A 1M9HA 2YL6A 3TN6A 3W74A 4HU4A 4W7UA 1E15A 3EOSA 1EA9C 4POCA 3VK5A 2V5JA 3RPDA 3BANA 3ZZ1A 4F48A 5E9AA 1S39A 2V3DA 3CHDA 3WDRA 1YNPA 3INPA 4PFMA 4CU6A 3N1AA 4KCTA 2XGZA 3NDYA 3PS7A 5A6LA 1VRDA 3G1YA 3DFQA 3VNJA 3S47A 4E2VA 4D8LA 3E49A 3VA8A 4KH2A 2PF0A 1NARA 3QF0A 2XH4A 3FFSA 1JXKA 1O6IA 3H2FA 4HQVA 3QOMA 1BQGA 3HPAA 2B31A 1PSCA 1R2TA 4LC6A 3M0HA 4D72A 3WUEA 2EJAA 1RLDA 2QCLA 5BU6A 3IUDA 4F2UA 4AZGA 4K3ZA 3V5CA 2CITA 3RCYA 2BVWA 4RDZA 3E5PA 1HJUA 4LVAA 5I3FA 1GG0A 3KRZA 4JFVA 5LIKX 2I5GA 3H4XA 1JDCA 1LOQA 1FY6A 1Q4NX 3EWWA 1TPUA 2XM2A 1W3NA 1KR1A 4M19A 1WKDA 2I57A 5F1VA 1L6WA 1EF3A 1XLMA 4E8CA 5JH1A 1RUSA 2OOGA 3NQ8A 4CKQA 1EGMA 4JIEA 3HV9A 4W9TA 2BHZA 3W00A 1EC8A 4MUPA 1ZY9A 1TREA 4J9JA 3EDFA 1TJRA 3AYTA 4H7ZA 4DY1A 2BVDA 5AC4A 1US0A 2YZ5A 3TJ4A 4TIMA 1F6YA 1KGWA 1DQUA 2HEJA 4CQBA 2ISFA 2QF7A 1VR6A 5K2ZA 3CO4A 4GNKB 3PULA 3EEZA 1ZP4A 2XTKA 2WNWA 2YCKX 4ZO7A 1R87A 4L4OA 3W7JA 3THUA 5FAGA 3RK8A 4PMYA 3WZ0E 1SM9A 1KRAC 4IISA 4B90A 4ENLA 4JIIX 5FKYA 1E0XA 3PP7A 2X2GA 2VUNA 2BNJA 4XUGA 5BW6A 3ZR4A 3U2ZA 2FVLA 2E5DA 4XG1A 3W01A 4XWUA 4W93A 1PKMA 1XRTA 3DI1A 1CNVA 3V75A 5AN7A 1J9YA 2RAGA 3PZNA 3F5JA 5BRPA 4NF7A 4QTGA 2VWSA 2ACQA 3M5VA 1XFCA 3V36A 4Z2HA 4PE8A 3I3BA 2OZ0A 3C2OA 1PXGA 2ZIDA 3W2JA 1BF2A 2VEIA 4GIRA 1SO3A 4G5DA 3WDQA 1VJIA 5A3HA 2QPSA 4A22A 3I3EA 4FIQA 1CLKA 5B7ZA 1AD1A 2O9TA 2Y8VA 3RFAA 3F5LA 2AKMA 3ATYA 1CGYA 4GX8A 4Y6GA 3PB2A 2WKJA 1KFJA 4JICA 5GNYA 1UWAA 3GHUA 2YCLB 4Z2JA 3FA4A 1J79A 3BG3A 2PDLA 1W3KA 2F8QA 4BR1A 1P6WA 1DVJA 2DZXA 3R43A 4PMQA 1NQKA 2CXEA 1OZQA 1EUAA 1O60A 3GTNA 1A3XA 3L67A 5T9BG 3ITVA 4S3JA 4N9BA 2QDDA 4DBUA 3P74A 1O1ZA 4RK8A 1LM1A 1M01A 4L56A 1GVQA 3TTQA 5I6SA 4TQTA 5EMYA 4UCFA 1KCLA 2ZVRA 3N4AA 1Z42A 1OBAA 5DMNA 3N17A 3R58A 1XSKA 1Q45A 1XH2A 4NUWA 3G77A 2QPUA 2WM0A 5L6UA 4GFSA 3SN0A 1YBQB 2VEGA 1W3LA 3RJYA 1ADDA 4H9MA 3OGSA 4AWEA 4R9XA 4IMAA 3ANUA 4H01A 4FNSA 4GVIA 3MV11 4RDVA 2WSQA 3CXOA 1W1A1 1L8NA 3GIYA 3OBAA 2ZFAA 2BB0A 4FXFA 1GGOA 1UD6A 2GSHA 3GW3A 5M17A 4WXZA 1UD8A 4J40A 3FJNA 3KTCA 1EX5A 1G9HA 3GR4A 1H50A 1SSGA 3V7PA 1B3YA 2INZA 1SZFA 1PIFA 4GCAA 3MWAA 1R3WA 3UJEA 4QE1A 1ZQ5A 3NM1A 3KCOA 4DXKA 3N14A 3W1LA 2P3EA 4GXWA 1N55A 1R8LA 1KBKA 3DGBA 5A2CA 5J5DA 1TCDA 1UWQA 1IV8A 2W91A 4A3HA 1MW0A 4LC8A 1DE6A 2QF8A 4LAMA 4Z0SA 2PRHA 1LT7A 4MNKA 2GZXA 1AMKA 1KXHA 4K8GA 4S3FA 2J88A 3MT1A 4PEKA 4Q8TA 3CPUA 1R2SA 2OYKA 2WC3A 5LZLA 2YLLA 4IMDA 3CZLA 3EWUA 3QMRA 4WF7A 2NQZA 5LGZA 4IMCA 3AS3A 1U33A 1UP3A 3WK1A 2BASA 1HF6A 1MEWA 1E4NA 3NM3A 2VMFA 4QR6A 3P80A 1KV8A 2YYTA 2I56A 4UR9A 3UQNA 4HNVA 1WQ5A 2OO0A 1LWHA 1L2UA 3ITXA 4YHEA 1TJ1A 1HL9A 4LUSA 1VCFA 2VGGA 1E73M 5CAKA 3LCLA 4WKHA 4Q32A 4LFYA 3EX2A 2HXUA 3QM3A 4NNCA 3RMEA 5IBXA 3URAA 2WJZA 1H7WA 4FA3A 1TPWA 3WFAA 4MVAA 4CQCA 3AMCA 3TZNA 3K4DA 3DDMA 5PTDA 4A6GA 2GSJA 4B9ZA 2Y7GA 4BF5A 1HN1A 3BG5A 3ZLHA 4LNCA 2VD8A 3WSUA 4J35A 3A3HA 2DW7A 1JL8A 2G4JA 5CJ5A 3GQYA 3XISA 2XN0A 3BJFA 4U3AA 1Q5MA 4K37A 2WO5A 1UP0A 1KFKA 2EGZA 1PB0A 3STGA 2FH8A 3KL0A 1W9PA 2E1WA 3PZTA 3T42A 4O0KA 3GHTA 1DWJM 1PZ0A 4LOCA 2RGLA 5C9UA 3NAVA 4NRRA 3MDUA 4V1YA 3GXMA 1HQTA 3R1ZA 4DELA 4M8UA 3IWPA 1VC4A 3H2NA 2VCAA 4FP1A 2BFGA 1K9TA 1CGVA 4OT7A 4XSLA 3E96A 3VMPA 3CHFA 4HJWA 4WD0A 1F3EA 2E68A 4CQDA 3KFTA 1VBUA 4J3VA 4AD4A 2VZSA 3MSYA 1IWPA 5HBFA 3HMCA 1TQXA 3APYA 4Q6XA 1ME9A 1NH6A 4OE7A 1W3IA 4PFHA 3P2VA 4Q33A 4EWND 3WFZA 4PSRA 3WO8A 1BRLB 1LOLA 2XVPA 3IIPA 3PSVA 1KM4A 4HPJA 4MZ8A 3A3XA 3XIMA 2AQVA 3VGEA 5JMUA 3TN5A 3SGUA 2DH2A 3ABSA 3G8EA 5EL1A 1O1HA 2W79A 1GORA 1RA5A 2GDVA 4AX7A