3LQLA

Human aldose reductase mutant t113a complexed with idd 594
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lqlA00
4XO6A 3EB3A 2PZNA 3LQGA 1M9HA 4GIEA 1ZUAX 3VXGA 1PWLA 4WGHA 2IQDA 2F38A 4PRTA 1R38A 3R8GA 3CV7A 3M0IA 2HDJA 3NTYA 3UWEA 2PDPA 4L1XA 1XGDA 1QWKA 5HA7A 2PFHA 3RX4A 4IJRA 4I5XA 1VBJA 3CAQA 4OTKA 1Q5MA 1AH4A 4XZLX 4FALA 3LD5A 2PDJA 5AZ0A 4JQ1A 3WG6A 4QR6A 2PD5A 2WZMA 1S1RA 3G1RA 1X96A 1SM9A 2DV0A 4Q7BA 1ADSA 4LB4A 4EXBA 3BCJA 4ASTA 2FZBA 4QX4A 4JTQA 2BGSA 4NKCA 4JQ3A 3GHUA 3V36A 4PMJA 4YVPA 3KRBA 3N2TA 1EXBA 1LQAA 3GUGA 4FA3A 3LBOA 3FX4A 4XZMX 1Z89A 2DUXA 1A80A 1PZ1A 3MC5A 4XZHA 3DN5A 3UZWA 4LAUA 4JIHA 4XAPA 2PDXA 3GHTA 1US0A 2IPFA 2I16A 2I17A 5AZ1A 4H8NA 1X97A 3R6IA 1QRQA 2PDQA 2HE8A 3UP8A 2IQ0A 4WDUA 3GHSA 3EB4A 3O0KA 1YE6A 4GQ0A 1ZQ5A 2PEVA 3R7MA 3WCZA 3WBYA 3Q67A 2PF8A 3N6QA 2IPGA 2PDYA 2BGQA 3P2VA 4WEVX 2HVOA 1OG6A 3H7UA 3F7JA 4DZ5A 1J96A 4LAZA 2ACQA 4WDTA 3CASA 2ACRA 4XO7A 4R9OA 3COTA 3UYIA 4JTDA 3QKZA 4IJCA 3U2CA 5LIXX 2PD9A 2IPWA 1Z3NA 1ZGDA 2INEA 4ZFCA 3WBXA 1RALA 2FZ8A 1MI3A 3Q65A 2A79A 3GHRA 1PWMA 2BP1A 4JQAA 1S2CA 2PDUA 3H4GA 1XF0A 1ZSXA 1PZ0A 3LNMA 4Q3MA 1YNQA 3CV6A 2WZTA 3V0UA 4EXAA 5KETA 1FRBA 3LENA 3RX2A 4YU1A 4QXIA 2PDWA 2ALRA 3LEPA 3ONCA 1YNPA 3BUVA 2IPJA 3LUTA 5LIWX 2PDIA 2PDNA 4WDWA 4PRRA 3UZXA 1MZRA 1S1PA 2ACUA 4XZIA 2PDHA 3V0SA 2F2KA 1AZ1A 3V0TA 1IEIA 3LN3A 3RX3A 4GCAA 4GA8A 5HNTA 5C7HA 5LIUX 4WRHA 1Z8AA 1JEZA 5JH2A 4DBWA 2PDFA 2FGBA 3EAUA 1UR3M 3G5EA 2PDCA 4DBUA 3DOPA 3T42A 1RY8A 2IKIA 5LIKX 3C3UA 4XVDA 3H7RA 1MRQA 4L1WA 4XVEA 2INZA 4F40A 1S2AA 5LIYX 3FJNA 2J8TA 1YE4A 3UZZA 1AH3A 4LBRA 4GACA 5JH1A 3R94A 2R9RA 2IKHA 4XK2A 2HVNA 2IKJA 3ERPA 1EF3A 3R43A 1LWIA 4DBSA 5M2FX 1HW6A 2PDBA 1AH0A 4JQ4A 2ACSA 3D3FA 2C91A 2P5NA 1HQTA 2VDGA 3B3DA 4WDXA 3M4HA 3ONBA 1EL3A 5DANA 1IHIA 4FZIA 5HNUA 3UGRA 3UZYA 4YS1A 3O3RA 3MB9A 2QXWA 1C9WA 2PDLA 4G5DA 1AZ2A 1GVEA 2ISFA 2PDGA 3V35A 4RPQA 2FVLA 4JTCA 1PYFA 3S3GA 4LB3A 4HBKA 3LQLA 2IS7A 4GQGA 4LBSA 1Z9AA 4JIRA 1K8CA 4GABA 4JIIX 2R24A 4HMNA 3BURA 2HE5A 3CMFA 1T40A 4JTRA 1VP5A 4PUWA 4FAMA 3R8HA 2AGTA 4MHBA 4PR4A 3WBWA 1X98A 4XZNX 1EKOA 2NVCA 4YVXA 2DUZA 4QBXA 4JTAA 2IKGA 3LZ5A 1XJBA 2NVDA 4IGSA 4AUBA 4JQ2A 2CLPA 2PDMA 2HV5A 4H7CA 3R58A 1AFSA 2HEJA 2FZDA 3UG8A 2FZ9A 1T41A 3UFYA 3BV7A 4YVVA 4ICCX 3LZ3A 1RY0A 4PUUA 2PDKA 3CAVA 1Q13A 3M64A
chains in the Genus database with same CATH superfamily
4PFHA 3SCRA 1SZRA 1XCFA 2QW5A 3ITCA 5CKSA 1E6QM 1T8XA 2BVYA 2BVDA 2JIEA 1WO2A 3RUBL 3SDOA 4NP7A 4JTKA 1L9WA 1V8EA 3INPA 3OG2A 2QZRA 4O0ZA 3WBEA 3WMSA 2O4MA 1V5XA 3GO2A 4E8DA 4NG3A 1UJPA 4NJGA 1AG1O 5HUOA 1P6BA 3RX4A 3LDVA 3VIHA 5A69A 5HINA 4F0HA 1JGIA 3DEQA 2BOFX 3WDPP 1DP0A 5AKQA 4ZENA 3MBDA 4AYSA 1NSJA 3G1RA 4BI7A 4HSOA 1X8CA 1XBZA 3NM3A 1TUXA 3NL6A 4AMCA 3CS2A 1B2YA 3E0IA 1A49A 1NVMA 2XVGA 3AAMA 1UZDA 3KUMA 4QROA 3MVTA 5EA9A 4ASTA 3C3NA 2QDHA 2FZBA 1B3VA 5GNZA 4QHRA 1UMYA 2XM2A 2NQHA 4TVUA 1ZS2A 3I6RA 1DWAM 4QEEA 5HQMA 5DQPA 5M1TA 1ESWA 3SY5A 3UZWA 2C6QA 1W37A 1OFPA 3L2LA 2VR4A 4UQDA 4OGZA 2Q8ZA 4L64A 3EB4A 5FF4A 2X41A 3ZVHA 4KWVA 3CWHA 1GJPA 4AVNA 4WLCA 1BVNP 3W83A 2DZSA 3GG7A 3L67A 2DZBA 4C65A 5T26A 1THFD 3W1UA 3EA3A 1X7FA 2BGQA 1GJWA 3P2VA 3VAVA 3FAXA 1MUWA 1BEUA 3JUGA 1EUAA 2GWGA 1DEDA 3BANA 1KM5A 3VNIA 3EMZA 4E2BA 3PZTA 3IJIA 1IEWA 1GVYA 1TPFA 3HU7A 4O15A 3NOYA 1V08A 3MANA 2BHYA 4HHLA 1XV8A 2PD9A 5LKYA 1O12A 1LBMA 3K2GA 1RALA 4HNVA 4H6EA 3ZSSA 2CC0A 1DQWA 2BNJA 1FP8A 3LSBA 1WZMA 4YHGA 1ZSXA 4IZGA 3FCPA 3GBEA 3CQ0A 3GBDA 1UD2A 1E1CB 3DG7A 4PSPA 3B04A 3HJZA 1XDLA 1DXEA 4ZO6A 3WF0A 1XIHA 1EJWC 3CLWA 2QUMA 3SQSA 1C93A 3BGAA 1U5HA 3T0AA 3ONCA 3NL2A 4DJEA 2FVMA 3H2OA 3N2MA 3WEZA 1C3FA 5K7JA 4QE1A 3ES7A 5EGRA 1B30A 5HNRA 8TIMA 1QW9A 1A5AA 2EKGA 4Z1CA 3BLFA 3RM9A 4ES4A 3NYDA 4W8BA 1F3TA 2C14A 3ECQA 4X2RA 4MLJA 1UD5A 2H8ZA 2RKXA 1JZ2A 5HMSA 1YW1A 3H26A 2BY0A 4QCFA 2H6RA 1BRLA 2J9YA 4GUHA 2Z1XA 1UR4A 4KCTA 4M6VA 3LB0A 3B0XA 4GVHA 4J3XA 4QS6A 2OSYA 4AC7C 1F9CA 4OFCA 4ENLA 1E70M 2H3BA 1GYMA 4YMZA 3O6YX 3FNDA 5CPOA 5EBAA 1OK6A 4H4IA 4Q6JA 2AMXA 1VLIA 3DX5A 3VMNA 1XRVA 3GDMA 3SUSA 4X22A 2HPIA 3CHEA 4CGTA 3PM6A 4LAKA 3IWPA 3NXLA 1OYCA 5A8PA 2PTZA 3J7HA 1KCZA 3UPWA 3C0LA 1KM3A 1IT0A 2ZA2A 3VD3A 3W7GA 1MWOA 2BSLA 1HKVA 1OT1A 2QJGA 3GLCA 1SW7A 5EMJA 3N6HA 5HWNA 1A5CA 3VZYA 3N25A 4UTWA 1Q8JA 3ZVHB 3U6WA 4O53A 1G4SA 3WJZA 1V7YA 1FWCC 1TFVA 4KGLA 2QLYA 1TUFA 3WF1A 1XYZA 3DECA 2OZ0A 3MI2A 1ISYA 1HGYA 1QMLA 4LBUA 5HWMA 4XAFA 3W2JA 1JZ5A 1VEPA 1REQA 4HBKA 4FNPA 3KTSA 4D6EA 4YTSA 2AAMA 3QN3A 2YBTA 3NQ7A 4Z1YA 4R3UA 5JIPA 4KKXA 5JU6A 3S0CA 3EKGA 4HMNA 3D47A 6ENLA 4XZBA 4RW3A 3EX1A 3EKZA 3RJYA 2EG7A 2ZTKA 1YYAA 4DWSA 3N9RA 3KL5A 3ARWA 1GCYA 4AW7A 4LVBA 4KRUA 4DYEA 2VFGA 3VGEA 3S9IA 3RYSA 2CLPA 1BYDA 4CEUC 2BOGX 3R58A 1FWRA 3S6OA 3H70A 1E4MM 1VFMA 1P6WA 1J9YA 4CVWA 3IS4A 4FOUA 2PODA 2A3EA 4GH1A 4Y9NA 4DJEC 3QYSA 3THAA 2B31A 1T96A 2TMDA 1GZGA 4V28A 4LQ1A 1DHKA 3EB3A 2FFCA 5A8MA 4OBRA 1A5OC 4UB9A 5F2MA 4UTMA 2VDHA 1QNSA 1NQ6A 3P93A 1TJ1A 1B5TA 4M7SA 3IIZA 4WGHA 4DUXA 2G8ZA 2PTYA 4X2PA 3OBEA 4GZJA 4W88A 3DUGA 1E55A 4GVGA 1OADA 4JKKA 2VOTA 3SADA 3K46A 1TVPA 6REQB 7CGTA 1W3HA 4LV4A 3SCQA 1XYLA 3WFLA 4GLEA 1Q5MA 4XZLX 4I7WA 2V82A 2VOMA 2BXYA 2I5QA 2D2HA 3BAWA 4Y9OA 1BRLB 2VFIA 4JHMA 3TFXA 1K03A 1TJ2A 1BKHA 3GDKA 4RNFA 1CGWA 3QVQA 1DQXA 3H53A 1RBOB 1OBAA 3UW6A 2OT0A 2J24A 4GXWA 1ZAJA 5C0QA 1V0KA 3AMDA 1UG6A 4RV8A 1RD6A 2OQLA 2VDIA 3MUIA 2ATMA 1XXXA 4F79A 4ATLA 5E0FA 4D1JA 3NQ6A 2YZ5A 1M1BA 3UCCA 1NF7A 1PV8A 1CXHA 1A80A 4FEZA 3QGAC 4U2ZA 3AIRA 2WHMA 5BOOA 1E6NA 3DN5A 4TU1A 4LAUA 3AZRA 5HJLA 2XSXA 3VI2A 4FO4A 2J62A 3NO1A 1E0WA 4RZ4A 3W2UA 1SO6A 3TOYA 4HHMA 3JZUA 3O16A 1IEQA 3SCUA 4PMQA 5G1MA 3M1ZA 2X09A 3BE7A 5I3GA 3FYYA 3W73A 2OO6A 4P7OA 1A53A 1G94A 3CMGA 3GXIA 3G1AA 2IQ0A 4JD4A 4N6EA 2WNNA 3MJMA 1PTAA 4UFLA 4GQ0A 3V7PA 2Q3RA 3H6OA 4HNUA 1IWPA 1ZJAA 4CNOA 4AD4A 1WP6A 5D8WA 4O50A 3QXBA 1H3GA 5BRQA 2FDMA 2A3HA 3NQGA 1REQB 3QHMA 1H0IA 1VENA 3CJPA 5CJNA 3WO8A 4WY0F 2TYSA 2ZFAA 1C7SA 2F61A 3P67A 3UNDA 3A5VA 1AA1B 2VWTA 5CBJA 1EGZA 2ZVRA 2ASHA 3OB8A 3MI6A 2EPLX 3K4WA 2HROA 3E1F1 4MNKA 5LIXX 3VIMA 5D9MA 3VDGA 2I14A 1I4NA 4DWSB 4ZFCA 2WKJA 3WBXA 4LCSA 2R6OA 1E4IA 1EJSC 4A21A 3N15A 3NDYA 1KM6A 2Q6ZA 1XGEA 1M7XA 3BJFA 1NH6A 4JCMA 1FDYA 3NO3A 3LNMA 3Q37A 3AHZA 3NNTA 1ADDA 2ZXAA 3LCFA 1TZZA 1W3JA 5MHBA 5CPTA 3HMJG 1XQLA 3GZ3A 3GYEA 4DO7A 2DT2A 2YCJA 4MZ1A 2JK2A 3CK5A 3DDMA 3SY1A 4DUOA 3WH7A 3OZMA 2C1HA 2GOKA 3DYMA 1MZHA 3QZEA 2BS9A 3B97A 3LN3A 4K36A 3VIPA 1UW9A 1EA9C 1UUMA 3RPMA 1O66A 3CQKA 4BR1A 1X6UA 3W7CA 5LIUX 3K4DA 1BXCA 2R91A 3FW6A 3MUCA 3SRFA 3W7LA 2J6VA 1PX8A 1OEPA 4FXJA 2FGBA 2XFRA 3TW6A 2PE4A 2VEGA 1EEXA 3GK0A 4FOKA 3QM3A 1RQHA 2JKAA 4Q4SA 4JFTA 5D2YA 3LY0A 3KRZA 2RJHA 4V15A 3UWVA 1CDGA 3OLIA 3H2EA 3T6CA 3C2FA 3BMWA 2QIWA 4W7UA 4QEHA 3WQPA 5LNUA 4UQ9A 3BAKA 1TPUA 2RDTA 3R94A 7ODCA 4K3ZA 3VOGA 3CT7A 4C91A 1F8MA 4ZTYA 4AIUA 1F6PA 3VTRA 1S2WA 4Y9AA 2PF0A 1AH0A 1J5TA 1DV7A 1PCKA 3GDTA 1A5BA 4E8CA 3N29A 3VNJA 1Q7MA 1XGZA 1HO1A 3HFTA 4NYUA 3SI9A 4J3TA 1J0HA 1IHIA 3WL0A 4WJ8A 3B0YA 1JPMA 3N4EA 4G7FA 5F1VA 1AMKA 1J11A 4C6KA 1GPWA 2ZUSA 1C9WA 3G1SA 1DJNA 1J01A 2NT1A 3W7OA 3GVGA 2Y6ZA 3PG8A 2VR2A 4G5DA 3HGRA 4JX4A 2G3JA 4KEZA 2V6AA 1F8IA 4B3LA 4CQ9A 4RPQA 3M07A 1W9PA 3OIHA 3S3GA 1D2KA 2OOGA 4LB3A 4ATWA 3LTYA 2A7NA 2GK1A 1UZ1A 4MB1A 5HANA 1BSLA 3IK4A 1JZ3A 2WWDA 1SMAA 3C6CA 2QGYA 2OTDA 2QVNA 1M53A 3LLFA 1ONRA 3WBWA 5K9XA 2YL9A 1GQNA 5C5YA 5C6MA 1J4EA 1TA3A 3GW3A 3S47A 4NAFA 4JTAA 3EOSA 2VFEA 2WWCA 1OC6A 2J79A 1XJBA 1OJXA 2C19A 1XH2A 2E9MA 3MTWA 2NXHA 2PUZA 4U5KA 1TPWA 4PGLA 4XB3A 3DGBA 1OK4A 1QBBA 3BCFA 1SMDA 4I3GA 4L4MA 3GNRA 2DJXA 3SEPA 4S2BA 3W86A 5FSEC 5FAJA 2WZEA 3TSDA 5D9OA 2CIPA 2ZXBA 1F5ZA 5AHIA 1W5OA 3DHFA 3OVPA 4F2UA 2EG6A 4GY1A 1PX4A 4IXHA 1IGSA 5HULA 2J7HA 1XIJA 1UWUA 1NELA 4AH7A 1QW7A 2IQDA 1KBKA 1W1A1 4QJ3B 4QFUA 3FLUA 3CQIA 2O0TA 1G7VA 1UBSA 2X16A 3R5EA 2OQYA 4GPNA 3PJUA 3WH5A 2V3GA 2Y24A 2E6AA 6PTDA 1R7AA 3PBWA 2QPUA 1HX0A 1V6TA 2VCBA 4KF1A 1VBJA 3CAQA 4P2VA 1POJA 1DJYA 4TQTA 3E0WA 4L4OA 3CHDA 3PS7A 3LPOA 3S42A 1QHOA 3R2GA 2CZEA 3TCSA 1FFQA 4RNIA 3QR0A 2E28A 4Q7BA 4FX6M 1ZAIA 2PP0A 3BK0A 3IAQA 3SURA 3BSHA 3GTXA 4RLIA 4K8EA 4LNYA 4J1OA 2V5LA 3IUIA 4JDYA 4PMJA 2FMNA 4S3JA 3NQCA 1EXBA 4FA3A 3E6EA 1ODUA 1FWEC 4LS1A 4DBEA 3CNYA 3A4XA 4YYCA 1JD7A 3T8QA 3BLIA 4Z0JA 4PMDA 1UKOA 2V5KA 1VKFA 1KFWA 1UWSA 5I3DA 4AIBA 1UROA 1CB2A 2HE8A 3A47A 3VKKA 5L6UA 3G8RA 4HHHA 1C29A 2VC7A 1LRNA 3LI1A 3CM4A 1UUQA 4PODA 2PI6A 2OFJA 1UA3A 4C6IA 2GLKA 4W7WA 1TTJA 2VX7A 2HVOA 3AYVA 1QI4A 2ZTJA 1WV2A 3QEZA 4H6RA 3N73A 3FFSA 4JBRA 5G2HA 4R7OA 1S5WA 3CL7A 3DAQA 3KL0A 5FSDC 1QNRA 1MQPA 1R3VA 4RNHA 1FDJA 4R9OA 1E3ZA 3N1AA 1V0LA 1O4UA 2UY2A 2A3BA 4PMVA 2G3IA 2O9PA 5D32A 4KCWA 3U2CA 4WR3A 3H7VA 3UJ2A 2QUVA 2AKMA 1QOQA 2NX9A 5LYRA 4MDOA 3HMCA 3PBVA 2Z00A 1TA3B 2ISVA 2C79A 4NAFB 5D8ZA 1HZYA 1OF8A 5DMYA 3VGBA 4CCDA 5DRCA 1Y7VA 1JULA 3V5CA 4NJHA 3WUEA 4L65A 1KM2A 3PBUA 3AZTA 1J8VA 4UTKA 4K8HA 1I60A 3JS3A 3GU9A 3L0GA 1GOKA 2CWXA 3NPXA 1NFPA 3G1YA 3OO2A 4G8TA 2CHOA 3A4AA 3APYA 5HR7A 4PRRA 4G9PA 2D3LA 3HF3A 3E74A 2EJ1A 3RM8A 4I5UA 4Q8PA 3BMXA 4I7VA 5CSRA 3SUVA 2QCCA 3QW3A 2H8XA 1XLDA 4C1KA 3B9DA 3GTIA 3LA4A 4GBDA 4HYRA 1YXYA 1VFOA 1TKKA 1J79A 4M82A 1H1YA 3L4VA 3SN1A 1R3QA 2FQIA 5A8GA 5CPMA 2HVMA 4AG0A 1H7RA 2VGFA 3MCMA 1D9EA 3EEGA 4F4RA 3L0NA 3W4RA 1CGXA 4AZCA 4R5EA 1WZKA 3G3DA 5HNNA 3DG3A 1HKJA 4DXVA 1X1ZA 7A3HA 4ATDA 4H9XA 2GGJA 4D9PA 5CPQA 4PBEA 4MUZA 2CLKA 4S3BA 2WNWA 1FWWA 3MP3A 1N82A 2WYSA 3BV4A 3EBVA 1XSJA 1W1ZA 3QKEA 3GC4A 1B3OA 3RG6A 2X7VA 4MUPA 4LANA 3LRLA 3URBA 1XRTA 3OA5A 4WIWA 3GR7A 2VDGA 2Y7GA 3GU2A 2CEQA 3M0MA 1SJDA 4FZIA 2QMKA 1RH9A 3KBMA 1SR9A 3O3RA 2WB5A 1R7OA 5I00A 3TZFA 3XIMA 3O6AA 5A6MA 1W6TA 4JOMA 4DYJA 4HNNA 1WUFA 7ENLA 1OF6A 3LLDA 3PBGA 4GE8A 1AZ2A 1G4EA 2Z1BA 2WW5A 4YJ5A 4URIA 1DWGM 1MXSA 2O56A 1YDYA 1XRFA 3LQLA 3W81A 1MFVA 1W0MA 3LHZA 4NZFA 5AC4A 4XG1A 2OT1A 4Z2HA 3MWCA 1IXPA 4Y8FA 2E8ZA 4G1NA 2IQTA 5A6KA 3OA3A 1QT1A 1CGTA 5HJXA 1KWKA 3NM1A 3C2OA 1WDDA 1TWSA 4RE4A 3VCNA 3WH8A 1PHWA 1OGBA 5H8MA 2WM0A 5SWUA 3RIKA 1C8VA 4I6KA 4Y7EA 3KP0A 1DORA 3T4WA 7PTDA 2ADAA 2W61A 2Q71A 3EZ4A 3FIGA 3I7RA 3HQNA 5IBXA 4IIGA 1E9YB 4LUYA 2ZX9A 3RK8A 1BLIA 1UD3A 1WX0A 4KWWA 3W1AA 5ABGA 2W4XA 3HTWA 1KXHA 4ICCX 3RLUA 3AUOA 4KWOA 2NWRA 3W7DA 3LPGA 2F2HA 1M3UA 3C2EA 4PUUA 2GWNA 2V81A 4S39A 3PNZA 4JY8A 3UPMA 4RDYA 3F4VA 4PMRA 3PFRA 1ISWA 3MMWA 4Y90A 2XH4A 1ZUAX 1R9ZA 1VGAA 3B8IA 2BHZA 2D2GA 4O8AA 4O1CA 1XI3A 2JE8A 5HXMA 2Z1KA 3LG3A 4G2DA 4QJ4B 5JBFA 1BG4A 4AX6A 2PDPA 1LQ0A 3M0YA 4MMWA 4V33A 1FBAA 1FWJC 2D1ZA 4HMEA 3PUOA 4IJRA 4I5XA 4PSRA 3ZWTA 3PJWA 2R1LA 2OEJA 4RW5A 5HJYA 1IE7C 3MKCA 2VD8A 4BCEA 3FA5A 4C6OA 4JQ1A 4DQWA 1LRQA 1UIOA 1C9DA 5D37A 2UBPC 3M0LA 2WMHA 1QHZA 3L5AA 3OZOA 3L68A 2QVHA 2DY3A 1XSIA 4AZCB 3FAWA 1JZ8A 1Q85A 1PIGA 3L66A 2OWXA 3XISA 4IUGA 4L7ZA 1Y65A 1B57A 3BG5A 1EHNA 3WEMA 1S5TA 4PCSA 1W31A 2Q3OA 3NQ2A 1UR1A 1QK0A 3WQ6A 1L8NA 1SZGA 4ZXLA 9CGTA 1PDYA 4H7ZA 3M16A 2WNQA 1XQKA 2QEZA 2J8FA 4O16A 4UNIA 2EPKX 4DXKA 1FCQA 2PDXA 1JFXA 1P48A 3W6YA 2F6XA 4EF9A 3CEUA 1FWHC 1NF0A 3R6IA 4DM1A 3CT2A 1F4HA 3WK3A 4LUSB 4GRSA 2CETA 3S6TA 4AZ7A 3W82A 5U4NA 3M0JA 1ZQ5A 4REQA 2ZADA 3VK5A 4MWAD 3SUWA 2QKFA 1JVNA 1UQZA 2ABBA 4CNSA 3KWSA 1ZP3A 3S1XA 3A3WA 2ZXDA 1J2BA 1KA9F 3TYAA 4MNLA 3E5BA 3NO5A 2OEKA 1XG4A 3CASA 1K3UA 2FVKA 1H41A 4LYKA 3FXGA 4K7VA 1ISXA 4IFKA 3WQOA 2X0YA 2P0OA 3EOEA 4RX0A 4FLSA 4NL1A 2GGEA 3NYZA 4IP4A 3SGZA 2XZ9A 4MJMA 1R85A 2PB1A 3HFYA 2UWFA 3SRDA 4JS3A 3HIJA 3QZ6A 1LTDA 4MKVA 1IWAA 3DC0A 1O6IA 4DLFA 1RBAA 1DJHA 3IGSA 3ZR6A 3F1QA 4X61A 2PCQA 4N02A 4N9EA 3FEMA 1YNQA 2YPIA 1GQKA 4CD8A 3E0LA 1OYBA 1W5PA 3CB8A 1GORA 1DYSA 4PA8A 3WNMA 2OGJA 4HPNA 2Y5EA 1YNPA 1NARA 3C8FA 1ONEA 2PURA 5LIWX 5D9PA 3M7SA 4BI5A 3C0QA 4JTSA 3UCDA 3KHJA 1GOXA 4GO9A 4BQ4A 4MIMA 2AQVA 3ITLA 4AD5A 4YYFA 2ICSA 1WKYA 3VGGA 1C90A 2C16A 1UOZA 5C7HA 3IANA 3TFCA 2EPHA 4H9TA 1JUBA 1ME9A 1E72M 3TTYA 1JAKA 4FP1A 1N8FA 1JCTA 3TN5A 1TE1A 5I23A 3EAUA 4O1AA 3CV1A 1EJTC 1FH7A 4JEJA 4GUIA 2WKLA 3W75A 3WJWA 1Y5WA 1MRQA 3EMCA 2DW7A 1EJ7L 3GFXA 1KGWA 1CYGA 3HO8A 1XM3A 3MU7A 1HUVA 4NAEA 3EEZA 1ISVA 4QP0A 1CLVA 3CUIA 3FJNA 2WKGA 3ATYA 1SZEA 2IW0A 4AIEA 4HQVA 4ECLA 1V3IA 2PWUA 5BWAA 2YDRA 3AC0A 2QPXA 3ARVA 4YHEA 3KTXA 4PUDA 5D02A 1KW1A 3ZFHA 3PVFA 3U57A 1UKTA 1G01A 4WDXA 3EOOA 4AD0A 1FA2A 2YFNA 4ZBCA 3GDBA 3LV6A 1WOAA 1XBYA 2XN2A 2YCEA 3UJSA 4IG2B 1D3CA 1X6NA 2RGLA 1IEXA 2NV2A 1V3LA 3AALA 5J8LA 3GG8A 3KW3A 1Y8BA 4REQB 4QLLA 3WLKX 3L23A 3H2CA 1V0MA 2FVLA 3UGVA 2NQJA 4O4VA 1XIIA 4DUWA 1PYFA 4HD5A 2CESA 3A21A 4KGJA 2FB3A 3EYPA 5JUVA 3EWWA 3N3TA 1ADOA 3K1GA 1QNPA 1RZMA 5DFAA 4Y8EA 6CGTA 1ZBVA 3VA8A 2Z29A 1PCWA 2DSUA 2OVLA 5FEPA 3EB2A 1DPMA 3G24A 4IFKB 4XIAA 1MW3A 3PPCA 4QCEA 2G0WA 4AY1A 3TDFA 2C3ZA 3T81A 1NAL1 3V1PA 3IIOA 2NVCA 3WNNA 2A1YA 2CLOA 1FWDC 3VM7A 1YDVA 1TTIA 5FL1A 3SQMA 1RCOB 1S46A 3KDNA 1KLZA 3RAOA 3N2OA 3WNPA 2EBNA 4CQAA 2FZDA 5CQ1A 4AMAA 1BKSA 3R12A 3ZS4A 4EANA 1I0DA 4L80A 2Z6JA 3TE9A 3LZ3A 4O0KA 3S5YA 1KV8A 2TODA 2DSKA 3E12A 3IEBA 3VIFA 3NJ3A 3TQVA 4XO6A 1M9HA 1K70A 4GFIA 3S2CA 1BXBA 4J4KA 2FGLA 3AIUA 1KTCA 1UPPA 3FVDA 3I6EA 3EDEA 3IGHX 2UZ9A 1M7OA 1UR2A 4JFVA 1NM9A 4YL2A 5LNSA 5CZJA 4PCTA 1BFNA 4YLWA 3VVGA 1RVKA 3E0VA 1WA3A 3TKFA 1JJKA 2Z7KA 2V5JA 1KXQA 3HGSA 2PDJA 4NT0A 1GYNA 4O57A 3PR2A 3QHNA 1A3WA 4TVDA 2XZ7A 3WG6A 1MEIA 3QQ0A 2GQ3A 2O7SA 2BWGA 5AYZA 2QF8A 3H55A 3UR8A 1GTHA 4Q22A 3S6DA 4ZOCA 2J25A 5JIWA 3HQ1A 4NAEB 1KB3A 3GIYA 3GAYA 3WLTA 2ZRVA 3HBLA 4G7EA 1KRAC 1SJAA 3VX0A 3N2TA 2PTWA 3AIEA 4XZMX 3SIMA 5A8OA 2C7FA 4O0QA 3W7JA 1BG9A 1M6JA 1JFHA 1MYRA 1F76A 3U0HA 1UD8A 4XIMA 3QLDA 2VR5A 2D24A 4JTLA 1M65A 2E68A 4DIAA 4FLRA 1OFRA 3PPFA 3GFZA 4J3UA 1GOMA 2R1NA 4GX8A 3ZLFA 2P0IA 2ISWA 5DF0A 1R5YA 1ME8A 3STEA 4B5SA 2BG5A 1XD0A 1F3WA 5IOBA 4MB3A 4GIYA 1YE6A 1H51A 4UTHA 3R10A 3VDHA 4FNUA 3H24A 2F9RA 4HU4A 4GC3A 1OCQA 1NDYA 4TX9A 3ZOAA 3E5PA 4TTGA 4C1NA 2EKCA 2ZKMX 3WBYA 2VX6A 2B7NA 3P8IA 3WELA 2DZPA 4XD5A 3U48A 1R3WA 3DFQA 4B4FA 3H7UA 4K1WA 4JYDA 5I3KA 4YTRA 1O1HA 1XICA 4J28A 1JUKA 3TYZA 2ACQA 1PO9A 3G0SA 3KHDA 2EHHA 1WKEA 1FX6A 1TR1A 4H7VA 1GNXA 3K4AA 4OZOA 1VF8A 2AL1A 3VM5A 4D72A 1W1TA 3CYJA 4JTDA 3W07A 3GVVA 3QKZA 4ZODA 3FA4A 2CW6A 2ZOXA 3GNXA 1OX6A 4WD0A 1ZBKA 4WUIA 3W1QA 1LUCB 1JI1A 1O5RA 3P0WA 1WUEA 1GKPA 3SCSA 3TLLA 3K30A 2E1DA 3I65A 1W32A 3VPLA 4OKDA 3B8DA 2V69A 3RO8A 4LFYA 1Q4WA 1PZ0A 3TTEA 4IIDA 2QNEA 3WF2A 3U7BA 4IMCA 1XRSA 1IT7A 1W3LA 3N9KA 1J18A 2YCLA 4TO8A 4UQCA 4WJEA 4QXIA 2CZFA 4QNWA 3PUDA 2FKPA 2ZZ5A 3KP1A 4JR5A 3TROA 3TYCA 3DI1A 3BUVA 3GZAA 4GCXA 3P62A 3LUTA 4WVXA 2V2CA 3SFWA 3VILA 5DN1A 2JF7A 3EX4A 3UY7A 3KZSA 4JFWA 3PZMA 2D0GA 3W7IA 3CYVA 3LSCA 3UR5A 2BV9A 1QOPA 5D33A 2XIMA 4AFYA 3O06A 1YTEA 3ITXA 2J7EA 4HSNA 1R3RA 3QPZA 4HNCA 1G9HA 2BGNE 3WYZA 4I8DA 2OKTA 4CNUA 3UWZA 4AD1A 1IIHA 1ZJBA 3KL3A 1G7UA 5K4ZA 4UNLA 1S5NA 1ICSA 4XVDA 3T07A 3W38A 3VOCA 2I9UA 3K8MA 2ZZ7A 5B7ZA 2XVPA 3M6DA 3OHMB 3NL5A 4B2DA 1ZJHA 3P84A 1YE4A 3RO6A 3IJDA 1PZ2A 2R9RA 4G7EB 2ZX8A 4XK2A 4M0XA 2C15A 4FF7A 4JTJA 2BX7A 5M3WA 2ZX5A 3VNDA 1EUNA 2A4AA 1FCUA 3GVRA 2HZGA 3FXYA 4NI8A 4QITA 2DIEA 4RXGA 1H61A 1F74A 3CUZA 4JGDA 2XFYA 5F4XA 4BKNA 1KCKA 3DIPA 1FWAC 1OYAA 3VKAA 4I9MA 3W1PA 2Y63A 1SFSA 1XYFA 3GU1A 2QS8A 4A35A 4NRSA 3XINA 1F07A 3ZLGA 4XWUA 3QH2A 3V16A 1NWTA 2ATSA 4UFHA 4QAIA 3VC6A 4D6DA 3SIZA 3PUEA 1JPDX 4F2BA 2J78A 4GUFA 3KEHA 2WSKA 2VT0A 1W8SA 3B8TA 4EIVA 2ZC8A 3EWXA 3FYPA 4E3VA 3W85A 1A5MC 4J35A 1D3HA 3IRDA 1YHTA 3HPZA 1FHUA 1H1NA 3S5ZA 5FF2A 1J0ZA 3CEPA 3CBWA 2VQTA 4ZB0A 4X60A 3M43A 3C4UA 4AZIA 5BXPA 3E96A 4XZNX 4YVXA 4I90A 3F4WA 3BGGA 2WCSA 1GUVA 1XP3A 1VRXA 3QV8A 2ALDA 4IGSA 4FK9A 1EX1A 1JDDA 3AXMA 3VOFA 1VFHA 3AIQA 5REQA 5EKYA 2XISA 1DWHM 2YCLB 4LW7A 3UFYA 2PSNA 1D8CA 3ME3A 3N19B 4MGGA 4LPCA 4W93A 4GH3A 3T0CA 3M64A 2QCEA 2R1MA 3L4UA 4UZUA 1PUDA 1SSDA 3SFKA 4EP8C 4LH8A 1GGOA 4PMYA 3VIIA 5AYXA 5DY2A 3WBAA 5BRPA 1HXJA 4AYGA 1EBGA 1TTPA 3CV7A 3CUFA 3NEVA 2TAAA 2XN0A 1M7PA 5EMUA 2WPBA 5AVHA 1R30A 4UQEA 2PLMA 5FJUA 1QWKA 1M41A 3HG2A 1VCVA 4JTTA 1AL7A 3MKKA 1LBFA 2OG9A 1EQPA 5F4WA 2QUTA 1JDCA 4ROQA 2OYMA 1PEZA 3WEOA 3W76A 4IGNA 2V68A 1E15A 1G0CA 5G4HC 3VKCA 4DI8A 1GOOA 3MPGA 1J5SA 4UFKA 3TW7A 4KCUA 1CENA 3AXIA 3RF9A 3B4UA 3TMQA 1AUSL 1TIMA 3PZVA 4HPHA 1E6RA 1RUSA 1FY6A 9XIAA 4FNRA 3W53A 3VO0A 4DZHA 2FYMA 3O9NA 5C55A 3R8RA 5CJ5A 4GX9A 2GZXA 3A4JA 1FP9A 1W9BM 1KM1A 1LRTA 2YA2A 5CC7A 3ITOA 3QV6A 2VMFA 3E2SA 3AQUA 2FDSA 3B9OA 4LWWA 4JIHA 3O1NA 5I77A 1VBHA 3GVWA 3LV5A 4NU7A 4Q8QA 4DVOA 3AUJA 3MSRA 4UMBA 4MWAA 3BICA 3I3EA 2E77A 1X97A 5IHRA 1MVYA 2BASA 1UD6A 2PDQA 4RV3A 5H1WA 1UKQA 2HCVA 1FHVA 4YWIA 1E9LA 1EO7A 4EWJA 1B1YA 4XTDA 2DZVA 4RNJA 4IQDA 5I7GA 3WK1A 3L12A 3PTMA 2PBGA 2E5BA 4MB4A 2DVXA 1KBBA 4GQRA 4U3AA 3W7RA 1XPYA 3WCZA 4KERA 4M3PA 1KBLA 4I9TA 3CGTA 2V30A 3N3MA 3HV8A 1NDWA 4WEVX 1ZBCA 1A3XA 1Q8AA 1J96A 3FEQA 3KRUA 1ZHAA 4WDTA 4Z2IA 2CITA 3VNZA 3P7YA 3OJGA 1UOKA 1OB0A 4S3FA 2XN1A 4QM1A 3DKJA 4N9DA 2VGGA 4TXEA 3PWAA 2DZTA 4PMXA 1UZHA 4MPQA 4PULA 1JCMP 3QRHA 5LHFA 2ZUVA 4JFUA 4H9MA 4ZVJA 8CGTA 4OU1A 1CNVA 4YCOA 1LF1A 4ZA0A 3ENLA 2AAAA 3KTCA 4F3HA 1X1NA 2OODA 5TAOA 3JU2A 4BF7A 3O2LA 3BLOA 3RM4A 4HCHA 5REQB 2PZ0A 3W6LA 1XCWA 5KETA 4HYWA 1T0OA 4RCXA 2ZE0A 1FRBA 2WLZA 4LYPA 4IMFA 2OXNA 4A8LA 3H21A 2VM8A 2E0PA 5I2UA 4GINA 3LRMA 5ECUA 5EY5A 6ALDA 4XBSA 2W79A 5A6SA 2XU2A 2VWSA 2QF7A 3NIYA 1EB3A 3UA3A 4C7FA 4OWGA 4HTYA 2PDNA 3VMOA 3VYLA 4FX7A 4N2YA 1X8FA 3ARYA 1OX5A 1XIBA 3BH4A 3GNOA 2HBVA 1B9BA 1WDWA 2XIBA 5DCEA 4MJ4A 3WSUA 1OIFA 2D23A 1O68A 2F6UA 3AMCA 1TV3A 3SCNA 4A8RA 3WLMA 2NW0A 3KM8A 1E56A 3EWYA 1Y5XA 3HOJA 2OCZA 2VC9A 1XLGA 4FIQA 3N2CA 2A6LA 3G2GA 3T40A 2BY1A 3AO0A 1DXIA 4Q6XA 3WLHA 3LX9A 3WK2A 3PP7A 1SJCA 3KLKA 5CBIA 4FLQA 4QIUA 4QTGA 1QUMA 2I9EA 3E2QA 3FJ6A 4UQAA 5GJNA 4L6DA 2OJPA 3UG5A 4BWLC 2DORA 3R4IA 3P5ZA 3AXKA 1L2QA 4HK5A 1TPEA 3S2MA 1H7OA 3QHOA 1BPLB 1QBAA 3LCIA 3POCA 5G1YA 3ARUA 4S38A 2ZXQA 1XLIA 4NRRA 1TPH1 1BQCA 1SPQA 5B80A 2Y70A 2WJFA 3CIWA 4WCJA 3VZZA 1KKRA 4RKAA 1PTGA 3CMJA 1A0DA 1YLVA 2A0NA 2Z1WA 3LBMA 4H8UA 1W56A 1A3HA 3TZNA 4NNAA 1Z42A 1ENUA 1EGMA 3O8AA 3KBJA 2GUBA 2IMRA 1Q65A 1CWYA 4A05A 4JFSA 3A24A 4DX3A 3S2LA 5FJPA 4MLRA 4A8IA 3VCCA 1GVIA 3TA9A 3NQAA 1HP4A 2WCGA 2BB0A 2NX3A 4ADSA 4RK8A 4LCQA 1EGVA 2OOFA 2R24A 1HVXA 4DZAA 1EC7A 1JDEA 4ERAA 2WC7A 5CAHA 1RJQA 1JF5A 3ZR5A 1IXNA 4TV5A 3OTRA 4PTNA 1JYWA 1VPQA 1Z6KA 4FIRA 3NR0A 2GVEA 3W1TA 4M51A 3O63A 3ITTA 1EKOA 1C8XA 1P43A 2CU0A 3CUXA 2Z7GA 4UOJA 3LCWA 4JQ2A 2XM1A 5IFPA 3NSMA 3ZVIA 3F03K 1QI3A 1Q7QA 3QFEA 3ANYA 3TH6A 2B7QA 3BAYA 1KCXA 3VD9A 1OFDA 3BV7A 1V0NA 2CKRA 5A2AA 1L8PA 1FTXA 3H54A 4Q33A 4AVFA 1ZP4A 1PVNA 1OZQA 4PCNA 1WE5A 4K1GA 3WQDA 4NZ1A 3TW9A 1AD1A 1V03A 1XIGA 2G5WA 1TX2A 2XIIA 3TN6A 3WLOA 4UCFA 2RDWA 1N8IA 3IGUA 4E4PA 3QGKC 2OX4A 4CN1A 5M03A 1C8QA 3B8VA 5K3VA 2G41A 1L2UA 3TAKA 1JDAA 3AIWA 3KVLA 3W7HA 1OC7A 3GNDA 2C1IA 3SN0A 3QW4B 4GYJA 1OD8A 3HPFA 4TIMA 1H62A 4H9VA 4MOZA 3O05A 4L6HA 4C60A 3VD5A 4GC4A 4UFMA 4F0MA 1ITQA 1VYPX 2QCNA 2ANUA 5BOFA 2DV0A 3WLNA 3NQ8A 1PIFA 1E5NA 4EK7A 3L4WA 1JG9A 2W27A 4L56A 1E9ZB 4DPPA 2ZVIA 5JBEA 3NURA 4ZSUA 4N9CA 2Y0FA 3ITVA 4PB4A 5AYYA 3HM7A 1OSEA 4B5NA 3MC5A 1AQHA 1JCYA 4O18A 4O1FA 2D2OA 3DXIA 4K68A 4NZ4A 2OLSA 1RXOB 2I16A 4EWND 2Y4SA 4AVOA 4HU3A 3NZ1A 3WQ4A 4HYVA 2KX9A 8A3HA 5AC6A 2GVYA 3W23A 4IQJA 1TV2A 2HRWA 3GWQA 2DSVA 3O0KA 3DZ1A 3UY8A 1VBGA 4LUIA 5LNWA 4H3DA 2RDXA 3QR1A 2C71A 4HA1A 4LV9A 1VEOA 3F4DA 1TV7A 5CCZA 2VEKA 3KOWA 3GXDA 3U7VA 4QS5A 3HPSA 5G5IA 3N6QA 2VURA 3O6CA 2Y5JA 5G4EA 1XLEA 3T08A 3WQEA 5I3FA 1Q66A 3VOJA 3F7JA 2XGBA 1U5VA 2QPSA 3BOFA 1VD6A 1WKDA 3GM8A 3UR2A 3U5YA 4U31A 4ZTXA 4MYAA 4O11A 5I78A 4H8VA 1VFTA 4ZOEA 3UYIA 4QQUA 2WSRA 3WZ0E 1S2UA 1RBLA 4S3DA 4D6GA 5HDRA 1OWQA 4ACZB 3T4CA 1QW8A 3MYPA 4OV9A 3ZJ8A 1XH1A 3G1XA 4JTFA 4MPKA 3GX9A 1LBLA 1MRAA 4QDMA 1SO3A 4WKAA 3M44A 3PZIA 1WBJA 4R34A 3RNDA 5FIPA 4U33A 4AQLA 4V1XA 3A3XA 3HGJA 5AVNA 1G5AA 1XLMA 3BAJA 2REQA 4HOZA 3SGUA 3TEVA 4EKJA 1WAWA 5E09A 1EOKA 4PB3A 4XZWA 1YTKA 2YJQA 1RVGA 2Y7DA 3MP5A 2PDWA 3KVMA 5LNVA 4GD0A 4DNMA 3KWXA 3PTKA 1OGGA 3T2QA 2PDHA 1UUOA 3C61A 4QDWA 4F9DA 5EBUA 2YB4A 4AHPA 1Z44A 1HTIA 3O07A 1X1OA 2XUCA 1L6SA 4JN8A 2G50A 4TVCA 5JH2A 1QASA 3TLQA 3AMKA 1JIBA 1RQEA 1YRRA 3AS1A 3N18A 4GYPA 5BW6A 3CPUA 3MWAA 2DSZA 1E0TA 1K8XA 1R9YA 4YXGA 1DJIA 2QCGA 3AMGA 1RY8A 5KZDA 4M29A 1TWDA 1GK8A 2JKEA 3H7RA 3IPWA 3LXBA 1XYMA 2G37A 1SW3A 3NZGA 1LOSA 1BGGA 4L1WA 1GQLA 5AHLA 3NQDA 3OW1A 1UR9A 5EL1A 1ZTVA 2EGZA 3OVGA 4HHPA 1S2AA 1R87A 2PWFA 4XUYA 5LZLA 4EE9A 3UZZA 4ALDA 3EX2A 2DPEA 2OR2A 5C70A 3ZQ9A 3RJXA 5C54A 1OY0A 2FMOA 2X2YA 4L4PA 4DJFD 1ZY9A 3NDOA 4A3UA 4AWTA 3TN3A 1TPVA 2BTMA 3WFAA 1GVQA 3IVUA 5D09A 2ACSA 2Z4GA 1DJZA 2QUUA 1EH9A 4LC8A 5G4WA 1U1JA 3W1RA 1N7KA 4W86A 2BVWA 1EJUC 3P8JA 3RFAA 4GIRA 4B5TA 2VNCA 4FXFA 1AQ0A 3CU2A 4JN7A 3ZSTA 1FWGC 3UZYA 4IOTA 4MVAA 3SECA 3G77A 3MB9A 1F6YA 4AZHA 1I2OA 3TQKA 4IX2A 1GTEA 3PAJA 1YXCA 2DGAA 2OSXA 2RH9A 4A4AA 1UWTA 1TSIA 2BMBA 2PDGA 4FPSA 1D3GA 2W6RA 4GVFA 3I10A 4JEQA 4QJ1A 4FNTA 3M46A 1VFLA 2NZLA 4A3RA 3VFCA 3UXAA 1P0BA 1RHCA 1M01A 4MTVA 4HVXA 4DI9A 2VJXA 1K7EA 3C2YA 4IP7A 1KO0A 2FPTA 3AI0A 2QMJA 4GY0A 2ZRYA 2NSOA 3NUKA 5C9WA 2EAWA 2EPOA 2WCAA 4MHBA 2QR6A 1A47A 1UP0A 1CI1A 4IQLA 2D69A 3FOKA 3W71A 3P0XA 4JX5A 5KZMA 1XLCA 1GEHA 2NVDA 1KC7A 2OPJA 2J7GA 4U2YA 4AWSA 4K6AA 3AJ7A 3MDUA 5C9ZA 2GVLA 3WH9A 3BG9A 2YW4A 2ON3A 2POZA 2Q8XA 4C5ZA 4LGXA 1EIBA 3UXLA 3FDKA 1KCLA 1IYXA 7REQA 2HXUA 4IFRA 4PMOA 2X1IA 3BL3A 3P81A 2GSEA 3LQGA 2VVNA 1MNZA 1ZZMA 1XDMA 2CLLA 4DO5A 3MCOA 2WOQA 4CCEA 3SCTA 2J9ZA 3N4FA 1EF2A 5ECVA 4CKQA 2CNCA 4IGHA 4O54A 4GYPC 4E2VA 1Z69A 4GQQA 1CIUA 2YL5A 4IHCA 3MKVA 3LD5A 2J88A 4PBFA 2TSYA 2I56A 1GOIA 3IJ6A 4TX6A 1YPFA 3D5HA 1VJIA 5AOUA 4N7QA 3D46A 4OIFA 4OQVA 4IPIA 1RK5A 1DHPA 1EYWA 1IXQA 4DAIA 5C71A 4L61A 3A4WA 3OBKA 3NAVA 3AIVA 3LPFA 2OELA 4HJFA 5I5RA 2DZXA 2BGSA 4C6LA 5LA0A 1JL8A 1Q2SA 3APTA 2OKOA 2A3AA 3EWZA 3F5JA 4I7UA 2CBJA 1W3KA 1Z89A 2DUXA 5I3JA 3ELFA 1FWFC 1MEHA 1XISA 5KZ6A 5F2IA 3SCPA 2H90A 2HS8A 1TX0A 4LUTA 5AZ1A 1TPC1 4H8NA 1J10A 2INFA 3GSMA 4S3CA 1FWSA 3LMZA 4NZCA 3C52A 4MJ2A 3S9ZA 2I1OA 2DQXA 1KXVA 5D2WA 5FA5A 4GUJA 3DFOA 4JAWA 2GFTA 4CUCA 2O55A 3NEHA 3GXFA 1GZJA 4IX0A 1KNWA 1ZNNA 5AHMA 3OLDA 2YA1A 1OHLA 4H2HA 5M17A 3U2OA 3UG3A 4PL1A 1OG6A 2P8BA 1BWKA 1GOQA 3B9AA 3EWDA 3HZ3A 3W24A 5ABHA 3U5UA 3WQ8A 3LHWA 3TQ0A 3G6LA 3MSGA 4FF5A 3LI0A 4WX2A 1QU4A 2Z28A 1ZFJA 3SBFA 1H7PA 2WQDA 3COTA 1EEPA 3I4EA 4E2OA 3E9AA 1I9CB 1I8JA 5D9NA 3MO7A 4IJCA 1MW1A 4CN4A 2YBUA 4ZOAA 2YDAA 1VB9A 1WNOA 2FZ8A 3N11A 1CW2A 4AF0A 5DXXA 2BP1A 2XSAA 3W9ZA 3WKZA 1ZENA 1I2QA 4ZQPA 1XF0A 4B9YA 3WDJA 5CZSA 3OYXA 1EQCA 3QOKA 4V1YA 2QCFA 1XIDA 3CZGA 3NPWA 2C0HA 4X9YA 4W87A 5EMMA 4Z42C 3CL6A 1DJWA 4H00A 4XAYA 1VHCA 2J66A 1S5VA 7REQB 2RGMA 2GGHA 4DJDA 3W26A 1QO2A 1F7BA 4R7WA 3TSMA 2JBMA 1RJPA 4C1LA 5AC8A 4IMGA 2ZA3A 2X8RA 2HK1A 1EZ2A 4LYQA 1JRCA 2WNZA 4KQNA 3M7WA 5F2GA 1JEZA 5I3HA 1V6XA 1G4PA 4P7NA 3R1ZA 3AICA 3EMQA 4ZQRA 2ZDRA 4ZO7A 1R3SA 3K8LA 4NF7A 2NV9A 4HCDA 1K4GA 4XBKA 4X0NA 4M6PA 1GG1A 1R2TA 2XVLA 2HNEA 3JVAA 3TCEA 3T55A 1TZ9A 5AHEA 2C0AA 3QMTA 4I9AA 2OZTA 3A6OA 4DZIA 1AW1A 2YFOA 3SW6A 1Y5VA 2GOUA 3IUDA 5I3IA 3S9YA 2ISSA 4A3HA 2DT0A 1UH3A 2ZYFA 4G6CA 2MANA 3T0DA 3DI0A 2PLJA 2YYTA 4JDBA 4KWSA 4E0CA 3WLJA 5CLTA 2IKJA 1TJRA 1GKRA 4JZ5A 2NXIA 4CNNA 3STGA 3LS9A 5J04A 5K9DA 3BW3A 3IJ8A 1CBGA 4R88A 1NJJA 4J2MA 2P5NA 3TYUA 3TV8A 5FJIA 5DX7A 4R33A 1K7XA 2WMGA 1GVOA 4AZ5A 1KM0A 4LUTB 2HISA 5F4SA 3MUY1 2DIJA 5KITA 5FF3A 4CVUA 2E9LA 4XD4A 4YS1A 5D2TA 1FKWA 3NQVA 5CZ0A 3T0BA 3P6LA 5JBDA 2QGHA 1BD0A 4D8ZA 3TMLA 2E25A 4K2SA 4QLKA 3UJEA 4UMCA 3U4FA 3CZ8A 4GABA 3GKFA 5FKYA 4GNJA 2O9RA 3WUBA 6TIMA 1Q4NX 4HNLA 4HJWA 3CPRA 2I7GA 4JTRA 3DG6A 2G95A 1NU5A 4HU8A 5DO8A 3FGCA 2Y8VA 2WMFA 2CLFA 3BPWA 3EPNA 4PCFA 1BXNA 1C8YA 2YXXA 1E6SM 4B3KA 2QT3A 2O4QA 4KWUA 3WUFA 4BEUA 1EC8A 4Q32A 3GXNA 1DBTA 3IVSA 4N4PA 2YIHA 4WOZA 4UTWC 3VGFA 3ARTA 1B31A 1CEOA 1IXOA 3GH4A 3G6MA 2BHUA 2PDMA 3JW7A 3CL8A 3U2EA 1VYSX 4QLJA 1DE6A 3DH7A 1M7JA 4CN6A 1I2RA 2FZ9A 4NHVA 1T41A 4DJDC 3OPSA 1QK2A 4B5WA 1TREA 4RE2A 2PDKA 4X0VA 3A23A 1UR0A 4JKMA 2VEMA 2VXNA 4IXXA 3EKLA 2GQAA 3CZEA 1YBQA 1EJXC 4HA0A 3GXMA 1VPXA 4ZQCA 4A2SA 5AB3A 5BROA 3U9IA 2NXGA 4HN4A 1IZCA 3ISIX 4HP5A 3B0UX 4DWSC 1UH2A 4H9YA 4BK9A 4TMCA 3W2MA 4MAVA 3UPBA 3EGJA 1TWIA 2CPUA 5HMFA 4LVDA 3KX6A 5AZ0A 1XBXA 3WLPA 4QR6A 4R9XA 4RZ6A 3UWWA 4KBXA 2WZMA 4GGHA 4W89A 3PZQA 3AXHA 2B7OA 2RHGA 1DL3A 1ZPTA 4HNOA 2GJNA 3MZNA 1HF6A 4XQ6A 1LOLA 1KLYA 1ADSA 4LB4A 1KFEA 2YXOA 3IVTA 4US6A 1B90A 1JYXA 4JTQA 5TBOA 1WXJA 4JCLA 2GGGA 3GB6A 1DE5A 4YVPA 3ZT5A 1MUMA 2AL2A 3FSUA 2PWEA 3WQ5A 3CZKA 1EJRC 3QBUA 3WMBA 2NSXA 4GISA 3URAA 1O5XA 2IUZA 1EWDA 3T9PA 1T7LA 3QTGA 1RP8A 4MNJA 3W22A 5G2WA 4WK9A 2WSQA 3L7RA 3RCNA 4WDUA 3GHSA 2V5CA 4XSLA 4JKLA 2VX5A 3RITA 4PUJA 2PU0A 1OCBA 2OO0A 1ALDA 3W2KA 4LF1A 3APGA 3EOUA 4C6DA 3ALFA 1XL9A 3NXFA 4IIEA 2PRMA 1V3HA 1UH4A 5KMYA 2AMGA 3VDBA 1TPB1 3KCJA 1JQXA 1ZBWA 1PDZA 2WJZA 4Q8OA 4JYEA 1E73M 3W7NA 1P7TA 4MF4A 5H91A 1UPMB 4H8HA 5GJPA 3WQVA 3TTSA 4DEFA 5CSSA 2PGRA 3FGCB 4XZ9A 3UEQA 4LALA 4X3ZA 2INEA 2IXVA 2VP8A 1MI3A 1DIDA 1UCWA 1E4NA 2YLLA 5CBBA 3H4GA 2WHKA 4IUOA 1YIXA 1TYGA 3PZUA 4RPPA 3ZMRA 2HXTA 1HJVA 2WZTA 3W02A 1LORA 1EYEA 2W91A 1I6NA 3W2NA 3AYRA 4K7YA 4N42A 2Z2UA 4BZYA 4C6QA 4W9TA 3N13A 5E6ZA 3U3HA 4O19A 3SR7A 1I1WA 2AOSA 1JNDA 3PZOA 1V6WA 3CPGA 1SFJA 3PFMA 5A2CA 3GXPA 4M80A 4GO8A 3LYEA 3GR4A 4PTDA 1DJGA 4PEEA 1WBHA 1RV8A 1A0CA 4E38A 1HO4A 1NP2A 4WRHA 3S1UA 1K6WA 5A5WA 1IR2A 3THUA 2XVNA 2QJHA 2HK0A 3TNBA 1Q6GA 2NX1A 4A6GA 1BQGA 1BF2A 1RR2A 5E0CA 4RDWA 5XIMA 4ZR8A 2FJKA 2ZRUA 3USBA 4JL2A 2YZRA 3RR1A 3TWBA 5BXSA 1SZNA 3KAOA 4ZB2A 1SFLA 2J6XA 3EWUA 4LAMA 2Y7EA 4H1ZA 4DJFA 3QSRA 1KRBC 3E3HA 2E6FA 3TTQA 1F05A 3ES8A 1TV5A 4Y9MA 2Y88A 4GACA 3CHCA 2EJAA 3IJQA 3WY1A 1SR0A 1YMYA 3CLMA 8XIAA 4N6FA 3ERPA 4IQEA 5AC7A 1V4YA 4L9YA 3NQEA 3EDKA 2AL2B 1F4AA 3TX9A 2JIWA 4QSFA 1H60A 2A2IA 3L9CA 5KEZA 1AJ2A 3UG4A 5DANA 2NT0A 1U2YA 3UXKA 2VZVA 3BTNA 3BAXA 5HNUA 3UGRA 3CH9A 3UZ5A 1U1HA 5MKGA 5KTLA 1F2JA 3ZR4A 1JRBA 1GVEA 4GZ7A 5I0DA 1AODA 1ZU8A 2Y1HA 2ISFA 1SUXA 2AKZA 3WMLA 1O5KA 4GGBA 4AY8A 5D38A 1MXDA 1VFSA 1AVAA 3NA8A 4YCPA 3MA8A 1EOMA 2IS7A 4OT7A 1Z9AA 3GDLA 5EFDA 1ME7A 3LGDA 1VIZA 1CCWB 1NTHA 1XCXA 4LS2A 1P7TB 5FL0A 3MHGA 3UWQA 1GQJA 1RCXB 4L4LA 1ELSA 3U2ZA 4FX8A 2YSWA 3GG1A 1MW2A 5TF0A 5IFTA 5EFFA 1XPGA 2WJEA 5CC3A 1N8WA 4Q4KA 4WJXA 1Q6EA 2TRSA 3IACA 4YTQA 1ZCOA 1SGJA 4F0RA 4J3WA 2CKSA 3PNUA 4S3KA 1TMQA 1R2SA 3QPEA 4H7CA 4KT2A 1XLJA 1SSGA 3WLIA 1OVDA 2B4GA 4EPEC 4Z17A 2H3DA 3DU0A 2XH0A 2V38A 4GNVA 2VRJA 4I6VA 4MY9A 3HURA 4PEKA 3OQEA 1KRCC 1LOQA 1PHQA 9RUBA 1XX1A 3R79A 1QR7A 3VXGA 2D22A 4C7GA 4Y96A 4N9BA 2GK1B 5JQ9A 3ZJ6A 3ARZA 3NTYA 3GNNA 3EXSA 3UWEA 3WN6A 3UVAA 3G1DA 2AGKA 3WNOA 1O95A 3QC0A 2VFFA 3VKDA 5HA7A 3W27A 3KOYA 3NL3A 1H1ZA 2XPKA 5IRPA 1H11A 3HPXA 2ZUTA 1ZCCA 2GJPA 2F6KA 2DT3A 3GS6A 1I45A 4DJFC 3BC9A 4KS0A 2J13A 3T05A 1BTMA 2NQLA 4IM4A 1XYBA 3IV8A 3SJNA 3UBPC 1X39A 3BZJA 3UNTA 4OJYA 4HZ8A 4CQBA 3PN8A 2ZCGA 4M81A 1DTNA 2QJIA 4MB5A 2NV1A 3UA4A 1P6CA 2YKKA 3A5FA 5C9RA 4N0RA 2PBOA 2BXVA 2OB3A 5FF7A 1RLCL 4TMBA 1TV8A 1JF6A 4C6BA 1KFKA 1FXPA 5HMEA 1CPUA 2Y8UA 5F2LA 1EWEA 3UYCA 4XZHA 3HG3A 4C5YA 3ZIZA 3BWWA 3PPGA 1XLBA 5DCDA 4DO6A 5A6TC 1C92A 1US0A 2PTDA 2IPFA 3L4TA 4O14A 4LEFA 4B92A 4DO4A 3WQWA 1CXEA 1ZB5A 1E51A 4F0LA 2QUNA 3KZPA 3LPPA 3PPHA 3NZPA 1RJRA 2OMAA 1UWRA 4FHAA 3KE0A 3OZPA 1KTNA 1GKQA 4LOCA 1MMFA 1DKWA 1TJ0A 2R8WA 3UJRA 2J77A 1L6GA 3NQMA 4PTMA 2J7FA 1A5KC 2XFWA 3DESA 3M0VA 3WNKA 4DZ5A 3WENA 1JXKA 3FY1A 3WD0A 2DUAA 3VDAA 4WHBA 4JNYA 3WL1A 4XO7A 3BMVA 3E2VA 3QFWA 1MDLA 3E0FA 1GONA 2PAJA 4JYFA 2VHLA 2DH2A 1V3MA 5E70A 3VZXA 4XAZA 3ABSA 1T99A 4GI6A 4LUJA 3MDWA 5BYWA 3M0ZA 1HKMA 2ZZ1A 4IFOA 4WOQA 3PK7A 1TCDA 4KRTA 4Z2JA 3O15A 4GWEA 4FR1A 4UR7A 1KWGA 2KZHA 3GH5A 4KRZA 2PLKA 1H2JA 3F2DA 2ALRA 1OQFA 2XSBA 5T91A 4F0SA 5C9XA 3ARSA 1HN1A 1GYLA 2E7FA 1W5NA 2Z2AA 3WK0A 3HV9A 3MI3A 4LRSA 1P0KA 4CCCA 4NVTA 4ZXOA 3UZXA 2ACUA 3W84A 3TNOA 5A6JA 2GDVA 1OZMA 1IEIA 2ZX6A 3F4NA 5I02A 1JXJA 3RX3A 3KCLA 5JVLA 1BWVA 4GA8A 5HNTA 5IXEA 4J3VA 3RCYA 4EPBC 4Q8TA 1R9XA 3ZO9A 3OG3A 2E40A 1CT5A 1LDCA 4DWDA 1F3XA 1SW0A 4TR9A 5CGTA 3DHDA 4LXFA 3B05A 2DQWA 4B15A 5D04C 2ZX7A 3T42A 1L6YA 1L0PA 3A13A 2D20A 2Z6IA 5E9AA 1VAHA 2VUNA 1UB3A 4HZ7A 3T2PA 4HIBA 5C2CA 1N55A 3AU6A 4ILSA 5D30A 1Q6CA 1UHVA 3QSTA 1CZ1A 4ZMGA 3AFBA 5C2XA 4PN2A 4B5UA 2EO7A 1I1XA 2QCLA 2W66A 4QQ3A 4P5UA 3ZXWA 3EXTA 1KQYA 3NVDA 3MSDA 2RUSA 3AROA 4HTBA 1GHSA 1Z32X 2VZSA 3BO9A 4CQ8A 3GH7A 3TXVA 2I5IA 1PBGA 3QR3A 1JCNA 1UASA 5A8NA 3S1WA 2JQXA 2XIOA 1HGWA 4AEOA 2HWGA 3LGGA 4UQBA 3Q94A 2PA6A 2ZRXA 4HK7A 2WO5A 1E0VA 1IR1A 3GNPA 4MY1A 4Z2GA 1EHAA 2PWDA 3SN4A 4B90A 4NUWA 3H4WA 3SB0A 3BOXA 1LLOA 1TE6A 3S46A 4DHGA 3D6NA 4JTCA 1DQUA 3L2MA 1VQTA 4GQGA 3CWOX 4CU8A 5C7VA 1XBVA 1WDPA 5I6SA 1KM4A 2W62A 1PIIA 4LJ3A 3AOFA 2XIQA 3QY7A 4OECA 1H5YA 3OEXA 3ZLHA 6REQA 1VRDA 1UQYA 1VP5A 5FACA 4FAMA 2CLMA 2HNHA 2ZZ6A 4Q8NA 1KKOA 3RDKA 2OQHA 2VELA 3LGEA 1KGUA 4HMCA 1OFBA 3UU0A 3AHTA 3LM3A 3PZGA 2BXZA 2P3EA 2P88A 4QBXA 4KEUA 3KOZA 1HL2A 4DYKA 3O0FA 2JALA 1FWIC 1EDQA 3EWCA 4DAFA 3NOEA 1SQ7A 1RAKA 1XYCA 3WF3A 2X0SA 1W9UA 4C6CA 4YIWA 2HV5A 4PL2A 1YXDA 4H04A 1AFSA 2UY5A 1UBPC 2WZHA 5A1AA 1UYQA 2FZNA 3BJTA 2VX4A 1EC9A 2WVTA 4GVIA 1PL9A 3A12A 4JTIA 4ORMA 3D0CA 3NQBA 5CPLA 4JIPA 3UWYA 5G1TA 5DMMA 3TVAA 4UCGA 3ABZA 2AQWA 3H2NA 3SSZA 2JGQA 4WSJA 3GVQA 4XV0A 2Z24A 4DF2A 4HT3A 1LZOA 1HT6A 1O60A 4PRTA 1R38A 1QAPA 5BRBA 3QV7A 1GOWA 4H6KA 1Q3NA 3O6DA 3S5OA 4UZSA 1EDTA 3DHUA 3P5YA 3Q2DA 4US5D 1VBUA 3W1MA 3B8SA 4MJZA 5AHFA 4UR8A 4CLMA 4H41A 1J12A 2X05A 1JUEA 3LRKA 3QY6A 1XLFA 5IBXC 1KFCA 3GTHA 3M5VA 1F3EA 2CHNA 2BY2A 2PD5A 4Q8UA 3CUHA 4FLOA 5D4YA 5DCBA 2R1PA 3CHFA 1K1DA 2B81A 2FTYA 4LY8A 5CGMA 3VGHA 5A3HA 5GNYA 3KDOA 1TWWA 3CO8A 5BXRA 3N2XA 2Q02A 1PJ9A 1V3JA 3M0XA 4JPGA 1E3XA 3WH6A 2NQ5A 3OZYA 3OQ8A 5BCAA 3SUUA 3PSVA 4H9UA 4CU6A 2GJRA 3ZZ1A 2FPVA 2E9BA 1KRMA 4C6PA 1P1XA 1QPKA 1H4PA 2Y5SA 4C6FA 4AHQA 1GHRA 5LSMA 4LEQA 4RDVA 4W85A 1KV5A 2QV5A 3EDJA 1IT8A 3P74A 1VZWA 1Q6FA 5FOOA 4P8VA 3FHAA 5LGZA 3DBNA 2GVGA 1IF2A 2QAPA 4DPQA 3QZAA 4H9ZA 1O7AA 3MCNA 4WKHA 4BHYA 1AJZA 1GEQA 3I7SA 3WIJA 2E8YA 2WXDM 3BW4A 1F73A 3K13A 3KOFA 2CBUA 3ARPA 3PHAA 3KBSA 1GW9A 1EZWA 3W7EA 4UOQA 3TP4A 3OYZA 4DXXA 4PMNA 1DJXA 2J9XA 3TIMA 3V1HA 4O10A 4MAZA 2YDQA 5AYBA 2V3FA 5HK4A 4PUEA 4I5RA 1SJBA 2O9TA 4JNMA 1W1YA 1W5QA 1YDOA 1CXIA 4RZ5A 3ABOA 3WJSA 4IPJA 4CEXC 3OGSA 3NQFA 3W72A 3GHRA 2VQUA 5XINA 2C1GA 1DWFM 4BA0A 3USZA 3BQ5A 4ACYA 2WHJA 1HJUA 1QO5A 5EB8A 4ERGA 2OLHA 4O17A 2XH2A 1AW2A 3PANA 4YN5A 2CYGA 3QF0A 3FDGA 2XYLA 1XG3A 2DSWA 2HBXA 2A21A 1PS9A 1MNSA 1Q6RA 2OGYA 2VZUA 3ZWSA 2OZ3A 3T44A 2Z27A 4WGXA 2VFDA 4NZ3A 3UETA 5DRIA 5GNXA 2Z2BA 2MUCA 1B3ZA 2VI0A 2DZAA 3VE9A 2PDIA 3FYOA 4K37A 4PTVA 3T8LA 1VCFA 3A9IA 2DVUA 3P82A 2R1KA 1X6LA 4K39A 1GVFA 4DUVA 4AISA 3MUZ1 3EXRA 2ZUUA 3MZ2A 1LL7A 1UA7A 3FKKA 2ISDA 3UCQA 1KBIA 2QIIA 4MWAE 4FR6A 4O1EA 3BLPX 5CLWA 3SSJA 2W9MA 2OEMA 3DOPA 1Q6OA 4QAWA 5XIAA 4LY4A 3WMCA 5T8GA 1S3TC 3HG4A 1BAGA 2IKIA 1R0MA 4UC5A 1EBHA 1W2VA 3UT0A 2VGIA 4Z1AA 2I5GA 4GI9A 1K6AA 2ABAA 2X1TA 4M6QA 5CPSA 1RCQA 4Q8MA 1A0EA 3BAIA 1WDRA 3BLKA 1JAEA 4WXYA 3P14A 4IPPA 2J8TA 3PC0A 7TIMA 2WV8A 3TOPA 4LBRA 1ONXA 5JH1A 1TZ7A 3S83A 1T6MA 4HKPA 3QV9A 5FJRA 3VNYA 4PMUA 4D8LA 4NASA 2HSAA 9XIMA 3TJ4A 4DBSA 2E67A 5M2FX 3EA1A 1ZRQA 2VYOA 5FJOA 4KETA 4QE5A 4JXCA 4M8UA 3DFSA 1IV8A 4M24A 4C7DA 5EPDA 2J8GA 4GI8A 4DELA 4A29A 4DN1A 2J47A 3ITYA 3RLHA 1OG0A 3KFTA 2Z26A 5I07A 3H2FA 3DYOA 3RR4A 4KPLA 2SFPA 3PULA 1XKYA 1E0UA 2GJLA 5CG7A 5HUPA 8RUCA 1TIWA 4LBSA 1WPCA 3TYEA 4ZO8A 3GE7A 5HQEA 1LQ2A 2Z0IA 4LT9A 4WQ6A 3BURA 4NNCA 4QG6A 2P53A 4NI3A 1R6WA 4Z1DA 1RPXA 3M5ZA 2IXUA 3TR9A 2CFFA 1HVQA 2V8ZA 4LF2A 4C90A 1SVDA 1UP3A 1XYAA 2X7WA 3DFYA 4JX6A 4AUBA 5E5CA 3W7KA 2PWGA 2EG8A 5LNRA 5HWJA 2VL4A 4RDZA 2Q09A 3S5SA 1HFBA 3WQCA 1P5BA 4YVVA 2WM1A 5LA2A 2A6NA 1U5JA 4F48A 1UR8A 1NP0A 3CIVA 3SCOA 2PWHA 1N2VA 3PBMA 1VLWA 2HQAA 5CAKA 4Q8VA 3P3BA 4A22A 3I4KA 5T9CE 2Y2WA 4GXPA 2E5CA 5FEXA 1K9EA 1V7AA 1A5LC 4XAGA 4D2JA 3TWAA 2A3CA 3C2VA 4AZGA 1FDZA 2JGYA 4YPJA 1TB3A 2PFHA 3MT1A 1QPRA 5FEZA 4IISA 2WVUA 4QISA 3OU8A 1XINA 4DY1A 4AD2A 3EA2A 4AEFA 1DIEA 3DERA 4R53A 4W5UA 1NDZA 2XH7A 1JQVA 2WJDA 4ADTA 4IH3A 1B9ZA 1LYXA 2GQ9A 4QNEA 2ZZ3A 3LCGA 2PGFA 2YX0A 4NXKA 3TUUA 5DXYA 3NGJA 3AHXA 4S3GA 4JQ3A 1E71M 3THCA 1ZAHA 3IGXA 4RJEA 5M5DA 4CCZA 1UC4A 3PY2A 2X0HA 3W88A 3NCOA 1HL8A 1XHGA 5BU6A 2DU2A 4HZ6A 2G3MA 4PH6A 3AISA 3HQPA 3VUSA 1QPQA 4C6JA 1C7TA 1E6PA 1BVZA 1ECQA 3QLLA 4QJ5B 1JD9A 2WBGA 1O1ZA 3BGJA 3VNLA 3S5NA 3UP8A 4Q4OA 4B9ZA 1DXFA 1I0BA 5CC5A 1NFBA 4BJHA 2J7DA 3TXZA 5AFDA 4JTEA 5CSYA 1XW8A 1K7FA 3G1VA 1H09A 3W1XA 3GTFA 4GZIA 4JHOA 4TTUA 2DJLA 3WUGA 1W9XA 3Q58A 1V6UA 3QJAA 4AXKA 2J75A 4EACA 2VC6A 5RUBA 3VNKA 2W5FA 3PJTA 4IWWA 4Q4QA 5DBTA 3MYOA 4J7RA 2VRQA 2JKPA 1BGAA 1W1IE 5AHNA 1A4LA 1HIZA 4GQBA 1P4CA 2Y85A 5AECA 5C9UA 2GL5A 3VIGA 1ZGDA 4TX8A 3N14A 2PP1A 3FN9A 3W37A 2YCIX 1UC5A 2GPTA 2HS6A 2Y7FA 1CGVA 1QNOA 4QGCA 1PKNA 5LGXA 2WC3A 4PMZA 3THQA 2I57A 4GZEA 3N04A 4OE7A 3GW0A 4Z1BA 1XWYA 2V3DA 1E40A 4C1NB 2CCRA 3LHYA 3H12A 4O8RA 1EXPA 3T09A 1W54A 1S1PA 3R13A 1NOUA 5DBUA 3N12A 1B4KA 2W0UA 1JR1A 2V5BA 1WOBA 2R14A 3DYPA 4KFNA 3ZYZA 4HN8A 1H5VA 4Q7NA 4Y2WA 4MM1A 3S2JA 2VVSA 3BLEA 3MO4A 4GCAA 4J9JA 3QMRA 3K8KA 3IIVA 5BOEA 3STPA 2XINA 1MUCA 4AHOA 1JCJA 3RGTA 2FTWA 2WHLA 2WANA 4CQCA 5JXQA 4PTXA 3UR7A 2PDCA 1BVWA 2MNRA 4DBUA 5CXPA 4BQ5A 4ZL1A 1M03A 1IQ8A 4UOZA 3CUGA 4AEEA 2ODOA 4U10A 3NZRA 3L4YA 1HNYA 2DIKA 5A6BD 1E6ZA 4CD5A 1V3KA 2FHFA 3TJXA 3TC6A 1GW1A 4F40A 3URQA 1LG1A 4IIFA 3AWNA 1S38A 1UKSA 4EXQA 2HVNA 5BXTA 2NQ9A 3PSWA 3WLLA 3REQA 1TPDA 4OBSA 2PCEA 1F61A 2X2GA 5KZEA 3PZNA 4JQ4A 5HMDA 3D3FA 3VDCA 3VIJA 1BF6A 4LX4A 2B0MA 4WKFA 3VIKA 3ONBA 4PCPA 1EL3A 4IICA 2G3FA 3NVTA 2VKZG 3ZJ7A 5IDZA 3LHTA 1X38A 4X63A 3T78A 2E09A 2H9AA 2QCMA 5E0KA 3KLLA 4KIEA 4MSSA 1QDSA 3QOMA 4NJIA 2JEQA 1PPIA 1R8LA 2A5HA 2VD9A 3M9YA 4AWEA 3IJ7A 4E4FA 2PU1A 2FZMA 1BYBA 4H19A 2AQOA 3VCRA 1PKLA 1MQRA 2BVTA 3S4TA 4IMEA 2HE5A 3KVJA 1YQ2A 4X9SA 3W2LA 5BU9A 5J5RA 1C91A 5FAGA 3IAPA 1TJPA 4PUWA 4HA4A 4HA3A 1M04A 1ICQA 4XUGA 5FESA 2AGTA 3AJXA 4LU0A 4LVGA 4NJJA 4GK8A 3T2OA 1ECEA 1OFEA 1R47A 2CLIA 4GG9A 1W3NA 2ZRZA 2GDUA 3W7PA 1KR0A 1E6XM 1KFBA 4UR9A 1ZLPA 3DBPA 3W28A 3LCXA 3A64A 1Q13A 2O92A 1OT2A 4US5A 3MSYA 1TCMA 4UTJA 3B9NA 4CNTA 1GJUA 4B2DD 2PMQA 1LWJA 3M0IA 4O13A 3GFYA 2WSPA 2PTXA 3ZT7A 3K1DA 2PGWA 2ZRWA 4GUGA 1LM1A 3TYDA 4LUSA 4IMDA 1JZ7A 1PE1A 1K9DA 3IK2A 1AH4A 4FALA 3FJLA 3LXCA 4M19A 3G3MA 5I09A 2BODX 1J0JA 3UZJA 3VIOA 3Q45A 1S1RA 2R82A 4LTSA 3BLLA 4A8NA 4HNTA 1O94A 1W3TA 1VH7A 4R85A 3WX7A 4L1GA 1JPKA 1KFLA 3L4ZA 2DT1A 1TV4A 3KBNA 1JYNA 3BDKA 3L2IA 4MG4A 3W74A 4UNKA 4EVZA 1R86A 3RRXA 1YKWA 1AK5A 1OC5A 5CH9A 5DEZA 3TK7A 3KRBA 1LQAA 3GUGA 2POTA 2EF9A 3REQB 5FF0A 4O52A 3FS2A 2VEPA 5TNVA 1HKKA 1EP2A 1MEWA 3LCHA 1EJVC 1FVPA 1U22A 4UTIA 5E1QA 1YPIA 1KXTA 4O1BA 3WDIA 4XAPA 1B0IA 4EX4A 3G8EA 1AQFA 3BG3A 4XSMA 2NQZA 1FFRA 2Y89A 4QDPA 5D05A 5U7SA 1DWIM 3PTQA 2H9AB 2NUXA 3MUXA 2A7PA 3OVRA 3EX6A 2E5DA 3T1GA 4UXDA 4E4UA 3FVMA 3AWOA 2A3LA 1XLLA 2ZBTA 2WMJA 3WLQA 1RA0A 3KS5A 3C2RA 3LTSA 2OWCA 4OUEA 1BWLA 1RPKA 3SM0A 3VC5A 3BZGA 3BVJA 1XDJA 3ZJKA 3LHVA 4AD3A 3KCOA 3N4AA 2YBVA 3W70A 4FNQA 3QMSA 3PBYA 3URNA 1RQBA 3H2MA 3IJ9A 2C13A 4W8AA 4LC6A 3EDFA 1Y0EA 2E6DA 3BSMA 1VJZA 3OIXA 4MWAC 1Z3NA 3BLDA 3B0VC 1NOWA 1QNQA 3T0TA 1RD5A 5FJJA 3KBWA 4LAOA 3SAZA 4MKNA 1LCOA 4B4HA 2ZZ2A 4Q4MA 4RZBA 3EOLA 1S2CA 4MWAB 1NFGA 1TRIA 3MQTA 1T8QA 4Q3MA 1Q45A 2FIQA 2ZUNA 3M47A 1FWTA 1W91A 2OU4A 1CLXA 4PE8A 4AXNA 4IL0A 4LVFA 3PB2A 4B5VA 1J0IA 4GMEA 3JRKA 2BOEX 3QC3A 2IPJA 1OABA 1J2WA 3CHVA 3SUTA 4P8XA 3GIPA 3TAOA 3YPIA 4XZIA 2FLIA 5EMYA 2WQPA 3MBFA 1YEYA 4J3SA 1PKMA 1AZ1A 1XUUA 1US2A 3ATZA 1FCBA 1ICPA 3B03A 2PRHA 3OGVA 4J2PA 5K2ZA 3DFPA 3W00A 2XFFA 1L6FA 3W7MA 4EAMA 4IMAA 3RXZA 4MADA 4ZCWA 3TSBA 2VZOA 4UFJA 4EOUA 5F7UA 1Z48A 3ABQA 4HCLA 2CBVA 3DENA 2CZVA 1HJWA 4BEQA 3GKAA 4IG2A 3GR8A 1FH9A 5DLCA 3U8GA 2D73A 2F84A 4XKMA 1LLWA 4M1RA 2QQ6A 1UMLA 3C3UA 2WSYA 3A22A 2GSHA 4B16A 5TIMA 4XKYA 4JNZA 3VGDA 3PTDA 3JR2A 3MS8A 3FA3A 3F2BA 2V63A 4UWMA 1HKIA 2OSWA 4ERIA 2X1UA 3P61A 3RMEA 5KINA 1TELA 5DMLA 3B0PA 1NOFA 1U30A 3VX1A 1E5JA 1LL6A 3R0DA 2OYLA 4WXZA 1VPYA 4YWSA 1DIOA 4F8XA 1YPXA 1SYTA 3LU2A 1MQQA 4QSHA 1LWIA 3C0JA 3AZSA 2PDBA 5H8UA 1R3TA 4LVAA 5H6HA 1V77A 1TO3A 1IIGA 5AC5A 3TR2A 3STFA 3GIQA 3GG0A 2V67A 3B3DA 2YB1A 3TYBA 3LERA 4YTTA 5E6YA 3SJ3A 1T5AA 4POCA 1P1MA 1QHPA 1CLKA 1LP6A 1BHGA 1J6PA 5E9XA 2B7PA 4U4MA 2PDLA 3F4CA 4CU7A 3DCPA 3WF4A 4IPNB 3ANVA 1VEMA 4HK6A 1OGSA 1JZ6A 5EMKA 2X30A 3TJIA 1IEVA 1EDGA 1J6OA 2PGEA 4HPJA 1NEYA 1S39A 1WZAA 5D2XA 3OGRA 4NYYA 1IZJA 4EPDC 4GIAA 1JGMA 3VOHA 4IP5A 1OINA 1GG0A 3MY9A 3CZLA 5B7YA 4ML4A 2BLEA 3E49A 3VNMA 1W1VA 2QJJA 4OHQA 3AU2A 3LZ5A 1AQMA 2EPNA 2Q8LA 3RCMA 2XGIA 2CERA 4F9JA 4RR4A 3EWBX 1P0EA 4PFMA 3SO7A 4ZFMA 2CXEA 2QJNA 1XR2A 4BS0A 2ZQ0A 3BOLA 1RY0A 4ZSTA 1PTDA 6XIMA 2PZNA 2Y61A 1FHDA 4W7VA 1XC6A 2F38A 3AXXA 4HU0A 1JPHA 2W63A 3R11A 3LNPA 2HDJA 2G96A 4JN6A 2V9DA 4D71A 2ZIDA 5CC6A 4S1FA 2ZUWA 1IGWA 4EF8A 1YX1A 4C6MA 1W8GA 1GQIA 3STCA 1US3A 3POHA 3VE7A 3CZJA 4GJJA 4HGXA 2QV4A 1DOSA 2DDXA 1SO4A 5CPNA 2XGZA 1TTQA 3FJ4A 3UERA 1W5MA 2DW6A 3QQ1A 1V6YA 1MSSA 3L21A 1SM9A 4XKYB 2ZA1A 1W9VA 4OBTA 3CUJA 4Z2LA 4HB7A 5DMNA 1QNVA 4W8LA 3TTOA 2FFIA 1K77A 4KMQA 1TQJA 2TPSA 3VINA 1KD0A 2Y62A 1ZALA 1PYMA 4ML9A 1VFFA 1DTUA 1VJSA 2ZC1A 1JDFA 3FX4A 3RPDA 5CZKA 4ZB5A 4ONVA 4GJIA 5BZAA 1P0DA 3M5XA 1LUCA 3BJSA 5J5DA 3RU6A 4AWUA 1PKYA 4JTHA 1Q6LA 3F2CA 2I17A 3AS0A 5GPRA 4HMDA 2PWVA 5ABTA 4PBGA 4RUBA 1B3YA 1NDVA 1OIMA 2G4FA 4WY0A 5G2IA 3UXIA 1XLAA 5DELA 4XD6A 3NSXA 4AU0A 1D8WA 4UMAA 4DLMA 4JIEA 1X7IA 2RDUA 4ZZ9A 1XFBA 3G1FA 2OX1A 1B4EA 3Q67A 4I9JA 1IWBA 2IPGA 1KGXA 3ICJA 3ID7A 3QY8A 1Q6QA 3ABRA 4AZ6A 5F1UA 1K02A 4D6JA 5FI8A 2CWNA 4XISA 3DKLA 2QHAA 3CB3A 3SCWA 3B8UA 3ORWA 5HAOA 2LLEA 2E3ZA 3L5MA 1RSCA 2XVKA 4NX0A 3L5LA 2P50A 3SRHA 1R3YA 3EDDA 3ZT6A 2YW3A 1UP2A 2CXGA 5GQBA 3EPMA 4AIOA 2QCDA 2DVTA 1XSKA 3Q65A 3E2RA 1LT8A 2A79A 2P10A 2NLIA 3VD4A 1OD0A 4KIRA 3ARRA 4NZ5A 2F8QA 1W1B1 1K9FA 3CV6A 4EXAA 3VU2A 4A3YA 1G67A 2ZE3A 4FXSA 1Q2RA 4ICNA 4YU1A 1QATA 1ZJIA 3CWNA 2QULA 1TVLA 3RPTA 4ZE5A 3W29A 3QTPA 5KSWA 3HGOA 4RL3A 3QGVA 4GI4A 1MZRA 3RU8X 2D0HA 3RHGA 1S2VA 1EA0A 2G3NA 2JFEX 3V0SA 4XBJA 3V0TA 5HOSA 2A85A 4Q7IA 4MYXA 4P61A 1JI2A 4L5ZA 3S8HA 3HB9A 4E2DA 1WZLA 5T9BG 2Z1VA 4YTUA 5IDIA 5BMWA 1HKWA 3WLRA 5DT5A 5CEWA 5TD4A 4IL2A 1CB7B 3W01A 1BSIA 4DBWA 4LYRA 2PDFA 3IARA 1UIPA 1VFUA 5A6BA 1AL8A 2VEIA 3RLVA 3BSGA 5MF5A 3OODA 2VCCA 4AC1X 1FUYA 3UD6A 1H49A 4LS0A 4Q4PA 1I75A 2WMKA 3CAWA 1OFOA 2REQB 2OLAA 4NIRA 1XFCA 4KW2A 1QI0A 4V27A 3U4AA 1CGUA 2L5HA 1LT7A 3W3OA 3LK6A 3NSNA 4HPXA 2DFAA 3K5XA 3MVIA 3EPOA 2FHCA 5A6LA 3HG5A 2X1SA 1Z7AA 4U5IA 3OP2A 2IKHA 4UTTA 3C86A 2E6YA 1TRDA 4L9ZA 2P8CA 3DFNA 4CD7A 2FJUB 3CTTA 3WD3A 1ONWA 1VCGA 1POKA 3VUPA 2WK2A 3WFZA 3WDRA 1E1FA 4IGMA 3FKRA 1WCGA 4JTUA 2J7BA 2QCHA 1TMLA 4L9XA 4W4QA 1MXGA 3AYSA 4ROPA 3M4HA 3N9SA 2BZNA 5BMXA 3B40A 1Z41A 3RILA 1W2PA 4WY0B 1V02E 3GDRA 1V51A 2GQ8A 4M6UA 3IIPA 1HL9A 3TU9A 3DFHA 2YA0A 1LWHA 3PF3A 1WYIA 3I3BA 1J0KA 1SFTA 2W67A 3H2AA 4AAJA 4M5PA 3WJXA 4E6MA 3V35A 2HMCA 4GBUA 2XWEA 1VYRA 1A50A 3I7QA 1S3HA 2PLCA 3M0HA 4JICA 3HA1A 4INFA 4KH2A 3W1NA 2VCAA 3V75A 3R25A 3MHFA 3DHPA 1FCVA 3CMFA 4D6FA 2P1FA 5LXXA 2CZ5A 2F7FA 3G1HA 2D3NA 5JMUA 1QWGA 1KFJA 3BARA 4J5NA 4IIHA 3MW7A 1OCJA 1X98A 2QCDB 4PC8A 5LA1A 3GY1A 2DP3A 2C8NA 3WLSA 4E8GA 1M5WA 1UD4A 5A95A 5E93A 4AB4A 5EU9A 1BTCA 4LRTA 3THDA 3T7VA 4H01A 3KXQA 4OOUA 3LLXA 1ITUA 2VUYA 2D2JA 3D3AA 2RJGA 3ABXA 1E43A 2GSJA 3AIBA 1FQ0A 3V18A 1NWSA 1QI2A 5FJTA 4YNGA 2PC8A 1DWJM 3OVQA 4J27A 1E4LA 3M6YA 1PWLA 1XKJA 4W84A 2PC4A 2O7QA 1Q6DA 3MMUA 1TQXA 1K9TA 2ZUMA 4F66A 3W0KA 3I6TA 2HPMA 3AMLA 1PSCA 3R8GA 1J0YA 3C56A 1I2PA 3W6MA 2QDEA 3HPAA 4P7QA 5CGQA 3P80A 4JTGA 4FS9A 4BY3A 1XGDA 4Z0SA 4KFOA 1AW5A 3EX3A 3VMPA