3LQLA

Human aldose reductase mutant t113a complexed with idd 594
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lqlA00
4DBWA 3WG6A 4RPQA 2CLPA 3Q65A 4PRTA 4XK2A 3V0UA 1EL3A 4YS1A 3M0IA 4HMNA 4IJRA 4EXAA 3CV7A 4GA8A 1Z9AA 4FAMA 1ZUAX 3MC5A 2PDYA 3WBYA 1K8CA 1ADSA 3CAQA 1US0A 2ALRA 3H7UA 3UZYA 1PZ1A 2DUXA 2FZBA 3V0SA 1UR3M 3O3RA 4XVDA 1YNPA 3CV6A 5LIYX 3LZ3A 3UYIA 1RALA 3FJNA 2HV5A 1GVEA 4JQAA 5HA7A 1YNQA 3GHRA 1JEZA 1HQTA 3RX3A 5M2FX 3H4GA 2F38A 1ZGDA 1Q13A 3V36A 3LZ5A 1R38A 3S3GA 4ASTA 2IQDA 2PDHA 3UZXA 1X98A 1YE4A 3RX2A 4PUUA 4PRRA 3WBWA 2INEA 3CAVA 3R8HA 3M64A 3LD5A 4JIHA 1AZ1A 3G5EA 3GHUA 5AZ0A 4FA3A 2PDMA 5DANA 3LQLA 2WZMA 3UFYA 3UP8A 4FZIA 2BGSA 4GACA 4GIEA 1AZ2A 4GQGA 4H7CA 4DBSA 3LNMA 2NVDA 1SM9A 3GUGA 2PFHA 3R8GA 4WDWA 3O0KA 4HBKA 4QX4A 3G1RA 2NVCA 4Q7BA 2I16A 3LN3A 4OTKA 4WDUA 2IS7A 2PDIA 2ACSA 1FRBA 3U2CA 1S1PA 3LUTA 1Q5MA 4ZFCA 3UGRA 1IHIA 1S1RA 4XO7A 2PF8A 4PUWA 3D3FA 4WDTA 3EB4A 3CASA 1S2CA 5HNUA 2FZ9A 2ACQA 3LQGA 2PD5A 2PDCA 2IKIA 3BCJA 1MZRA 2AGTA 2FVLA 5LIXX 3UWEA 1AH3A 2IKHA 2PEVA 3H7RA 2VDGA 4XZLX 2PDBA 3F7JA 2PDLA 3UG8A 2PZNA 4R9OA 4JQ3A 3WCZA 4PR4A 1T41A 4XZNX 2PDWA 2R24A 3GHTA 2IQ0A 3EAUA 4EXBA 4WDXA 2HDJA 2J8TA 1PZ0A 1A80A 4IGSA 4WGHA 1MRQA 3UZZA 3QKZA 5LIWX 3P2VA 5LIUX 1XJBA 3DOPA 2FZ8A 1S2AA 2DV0A 4Q3MA 1AH4A 5JH2A 4LBRA 3NTYA 1Z3NA 4LAZA 4JQ1A 2IPWA 2DUZA 2PDPA 4QR6A 2HE8A 2P5NA 4XZIA 1LWIA 3R94A 4G5DA 1PWMA 1EXBA 2A79A 2INZA 2PD9A 1M9HA 3BURA 3DN5A 4XVEA 1X96A 4WEVX 5C7HA 3R6IA 1RY8A 4JIRA 4GQ0A 1OG6A 1MI3A 2IKGA 2FGBA 3B3DA 2PDXA 1AH0A 2HVOA 3BUVA 5JH1A 3VXGA 1ZSXA 4GCAA 4MHBA 4XAPA 4JIIX 4JQ2A 2PDUA 4JTQA 5LIKX 3LENA 4FALA 1J96A 4JQ4A 3ERPA 3WBXA 3KRBA 3BV7A 3UZWA 2QXWA 3V35A 5AZ1A 1AFSA 4L1WA 2BGQA 4QXIA 3COTA 1QRQA 4IJCA 2WZTA 2PDNA 1X97A 5KETA 4AUBA 2PDGA 2R9RA 3T42A 2ISFA 2IPGA 1Z89A 1VBJA 1T40A 4F40A 4XZHA 4XZMX 2PDFA 4GABA 5HNTA 3EB3A 4JTCA 1C9WA 1PWLA 3ONCA 4DZ5A 2I17A 1ZQ5A 3N2TA 2BP1A 1Z8AA 2FZDA 2IPJA 4LAUA 4YVXA 1LQAA 2ACRA 4YVPA 4XO6A 3R7MA 3RX4A 2HE5A 3FX4A 3R43A 2IPFA 3R58A 3N6QA 3GHSA 4LB3A 1IEIA 4YU1A 2C91A 2PDKA 2HVNA 1YE6A 4JTDA 4DBUA 3C3UA 4JTRA 2PDJA 3LEPA 2ACUA 3Q67A 1XF0A 4H8NA 4YVVA 1HW6A 4L1XA 1EF3A 3CMFA 2IKJA 4NKCA 1VP5A 2HEJA 4LBSA 4WRHA 4PMJA 1PYFA 3MB9A 4QBXA 3M4HA 3V0TA 4I5XA 1XGDA 1EKOA 4LB4A 4ICCX 4JTAA 1RY0A 2F2KA 2PDQA 3ONBA 3LBOA 1QWKA
chains in the Genus database with same CATH superfamily
4K7VA 4DBWA 4CCCA 4FEZA 3WG6A 5BU6A 4GUGA 4K2SA 1S38A 1EL3A 3VPLA 3HU7A 3USZA 3W70A 2GGEA 1O5XA 2F9RA 1R3YA 1R30A 3K1DA 2YKKA 1FCBA 3GB6A 3EWCA 3XIMA 5KITA 2ABBA 3DC8A 5I3DA 7PTDA 1JI1A 2XPKA 1BRLB 1M68A 3RLHA 2Z1WA 4P7NA 5DY2A 1ALDA 5BXTA 1PZ1A 4ZQMA 4E8DA 3U2EA 3VGGA 5TQLA 3ANYA 4B3LA 4MKNA 4DNMA 3RG6A 3UYIA 1G01A 1JYXA 5DO8A 2GDVA 1J8VA 2V81A 1HL9A 3UERA 2ZTJA 4Z0JA 3L4XA 4ZOAA 2V68A 1DJQA 3QF0A 4HQVA 3U9IA 3WQFA 6XIAA 2PURA 4L9XA 4QFUA 2ZKMX 2ZVRA 3GG0A 4HPJA 4FLRA 4P7LA 3UCCA 3RX2A 5HWJA 5A95A 1KBIA 2GJNA 3KUMA 4ZR8A 1UBPC 2VJXA 1BFNA 5DLCA 4W86A 4NJHA 3W7HA 3GNXA 4NYYA 2O55A 4H3DA 4W8AA 3TTOA 3NOYA 2GJPA 1F2JA 3K8MA 3LG3A 4FX8A 2QZRA 4KEUA 1R3VA 2DT0A 2VKZG 1TTJA 1E4NA 4QRNA 4LH8A 1E1CA 1LG1A 3LTYA 1CXFA 3EOEA 3MHGA 4LQ1A 1R3TA 1H60A 4RDVA 3OIXA 4RJEA 2DJXA 4MWAD 2X0HA 3TR9A 3SFKA 1KC7A 3C2EA 3S9IA 5FSEC 4LS0A 4O1BA 3WL0A 2XJ7A 1W2PA 2V3FA 2F6XA 3UGRA 4MY9A 4Y6GA 4GUFA 4HPHA 1OCJA 2XG9A 4S2CA 2BMBA 4RV8A 3UA3A 1EJWC 3AUOA 3PUEA 4IFRA 2I5QA 1I1WA 2JKPA 2E25A 3SUTA 3L21A 5LIXX 3I65A 1US2A 4L65A 3WD2A 3MZ2A 1AH3A 2D22A 3UWVA 2QDGA 3EA1A 4XZLX 2Y62A 4HHPA 4LY4A 4PA8A 4D8ZA 2DH3A 3CQ0A 5D38A 4NZ5A 1Q63A 2DGAA 4BS0A 2UZ9A 1XLLA 1G4EA 2ISVA 5ABEA 1G5AA 2Y8KA 2WKLA 5REQB 4UUIA 4HU4A 4XKYA 4GRSA 5CAKA 4J3XA 3JU2A 1ECQA 3QKZA 1MW0A 5LIWX 1EGZA 5LIUX 4MJMA 3HMCA 3BQ5A 1VBHA 1TPFA 5T26A 1HJXA 4YYCA 3ZLHA 3V5OA 5LHEA 3NGJA 3CMJA 1R46A 5FF4A 1AUSL 4KESA 4AB4A 1XI3A 4M7SA 3NXLA 1V3HA 2A3EA 3QSTA 2VCAA 1M7XA 2C6QA 4LX4A 1M9HA 2ZZ6A 1W31A 3IJ6A 3HURA 4F79A 2PTYA 4WVXA 3HQOA 3TC3A 5MKGB 2ZDSA 3N4AA 2D1ZA 2QF8A 3T9PA 1MDRA 1NU5A 2RDXA 3GXPA 1RA5A 4FR1A 3AIEA 2OOFA 1G4TA 5AHFA 3DKLA 3FXYA 4UR9A 4FPSA 4INFA 1ISXA 1UIOA 1XCFA 3OG3A 3S5SA 4B92A 3W37A 4Y7EA 1YTDA 4JCLA 3WUGA 3C52A 3VXGA 1KCLA 4ZQCA 4TQTA 4D6EA 3SAZA 4TXEA 4X22A 4MTVA 1L0PA 1RV8A 4GO8A 2I9UA 5ABTA 2A4AA 2J75A 2C1GA 1LLWA 4PMDA 4WSKA 2D20A 3G0SA 3CBWA 4NILA 2R1PA 4GMEA 3BARA 4JN7A 1OD8A 1J2WA 3UWZA 2A7PA 4PUJA 5FEPA 4GJJA 4Y9OA 3CHDA 2BVTA 3PZIA 1K02A 1FY6A 1A5AA 1U1JA 2ONEA 3TKFA 4V1YA 2CETA 3EB3A 3CNYA 3VINA 3W1QA 2EGZA 3WQ4A 2X7WA 3WF1A 4NVTA 2X0YA 2E8YA 3CV1A 3PZUA 3M6DA 4V28A 2BXZA 3TJLA 1QNQA 3DXIA 2X09A 1UIPA 4MIMA 3ZM8A 3VOHA 1PDZA 3BH4A 4ZBCA 1U33A 4L5ZA 3K30A 4WKHA 2C16A 2DZBA 4AW7A 3KS6A 4NSBA 2WQPA 4JHOA 4YVXA 3KS5A 4XO6A 4AMAA 3IJIA 1TZ9A 3WH5A 1UOKA 4FI4A 4C7DA 3GFYA 2CC0A 3OHIA 2EPLX 2AOSA 2A1YA 2D2JA 1WNOA 2OOGA 4DM2A 2PLJA 1KBKA 3IK4A 4GK8A 1XF0A 5CJNA 3BG9A 4EIVA 4WIWA 2RJGA 1FFQA 3NQEA 1J0ZA 4O11A 4PB4A 3AWOA 1TELA 2CBVA 3OGVA 4MZ1A 3W2LA 1CLXA 2HEJA 1GOOA 1ZP3A 3L12A 4PB5A 3TA9A 2QCDA 3VKDA 1H1NA 5CH9A 3BTNA 2OYLA 2F2KA 3O8AA 4LYPA 4LUSB 4XSMA 3WJSA 1TG7A 2VT0A 5A8QA 3RITA 1JRCA 1YIXA 4N6FA 1J93A 5HNRA 2CLPA 3RIKA 3Q65A 1ZU8A 1E1EA 5AN7A 2TYSA 2XH7A 2IQTA 1FCVA 2YDQA 1QI3A 3WX7A 1Z9AA 2NSOA 3E0WA 4Y9PA 2E5DA 1IE7C 1PTAA 3P5YA 1JDDA 3N4EA 1W5OA 4O16A 2I7GA 1GT8A 2FFIA 4GY1A 3R5EA 4Q8PA 1W3HA 1BKSA 2HRWA 4OHQA 2VC7A 3CH9A 3A5FA 3O2LA 4UFIA 5BU9A 3HMJG 1IXOA 2PGWA 3VI2A 1B3OA 3I3EA 1YNQA 3PHAA 5C54A 2REQB 3VGEA 3VUPA 5J5DA 4LT9A 1FWRA 3PB2A 2D2HA 1RHCA 3H4GA 4DO6A 2VEGA 4KEMA 2G96A 1WKYA 3GIPA 2ZZ4A 1X7FA 1OFPA 4ASTA 4YTRA 1WAWA 2YL6A 2Y2WA 4JNMA 3RUBL 4TMCA 3G8EA 4B5WA 1TV4A 4MB5A 1XP3A 2P50A 3WK3A 3KRUA 2ZQ0A 1DJZA 3GUWA 4Q8NA 4GI6A 4O18A 2Z1SA 1QI0A 3U2OA 1HKKA 3MV01 1SJCA 1OEPA 2E5BA 2ATMA 3PBUA 1K7XA 2NUWA 4M5PA 2VGBA 3VNJA 2WZMA 4UFKA 3VKBA 4JNZA 5D2WA 2Q02A 2XM1A 3D0CA 3OLGA 3AS1A 4NZ3A 1SM9A 2FIQA 3DFOA 2O4MA 3A12A 2NX3A 1O7AA 3SRHA 4RL3A 5U4NA 3B4UA 3O06A 1KFLA 2IS7A 4FR6A 2VEKA 3FLUA 4EAYA 5F7UA 4IGMA 4H19A 4TR9A 1MWOA 3L67A 3G2GA 3N73A 2FZ9A 3VIFA 1VFHA 2HTMA 4XZWA 2P88A 3TH6A 4M6UA 1Q6QA 3W22A 4DN1A 1JYWA 5HJLA 1QO2A 2PEVA 1A0CA 4GQQA 3CPRA 2EHHA 1IEVA 2E1WA 1XYMA 3PTKA 5XINA 3NQ2A 3WCZA 1GVYA 3GXIA 5HINA 1AL8A 3N04A 1ZHAA 2HDJA 4LYRA 1GHRA 3BICA 3OTRA 4W89A 1EUNA 1GVOA 3N9KA 1L6GA 1UZHA 3VX0A 4QCEA 4QROA 4N42A 3QV7A 3CUFA 1QHOA 4IGHA 5H8PA 2EG8A 2OXNA 4NX5A 3M0LA 2DV0A 3P14A 1V0NA 1TZ7A 3OIHA 1H51A 3HGJA 5CQ1A 4FOUA 3STEA 4PB3A 4XD3A 3ZJ6A 1UWIA 1XBZA 4NP7A 1W1YA 4RV3A 1IXPA 4HOXA 3IJDA 3WH7A 4AIOA 1EC8A 3SZ8A 4C6DA 2H9AA 1KLYA 1GG0A 2R94A 2X7VA 2O9RA 3WDJA 1I0BA 3GDLA 3LMZA 3IVUA 4CVWA 5AC5A 4AF0B 2QLYA 3KM8A 4CCEA 3P6LA 4PN2A 1UD5A 1FP9A 2BGNE 3ORWA 1BG4A 2NQJA 1XRSA 1VJZA 1D3GA 3TCSA 4E3TA 4IIEA 1FWJC 5D8ZA 5IFTA 4LAKA 1UP2A 1MW1A 3SW6A 4Y9NA 2Z6IA 1H3GA 2ZRYA 5D9NA 2Y89A 2WVTA 2CLIA 2VX6A 4L4LA 4A05A 1WOAA 2J7HA 3UT0A 5H1WA 2OSWA 3W02A 1I2QA 3KXQA 3VIIA 2Q8LA 2VVNA 1E6QM 2ZUUA 2QUTA 3MMWA 4PMNA 5C71A 1VFSA 3KRBA 3VNZA 3UZWA 2QCCA 5AZ1A 3JZEA 5HXMA 1PIIA 3HQ1A 2R1KA 2G3MA 3JR2A 4DRSA 2WZTA 4PMQA 3QZAA 5BRQA 1X97A 4G1NA 4R7JA 2PDGA 1QAPA 2VDIA 2VXNA 3TSBA 4QTGA 1A5BA 4GE8A 1YXYA 4JNYA 4RE0A 4F0LA 4QNEA 3GVRA 5FEXA 2J24A 5LXXA 3P7YA 3H12A 1UA7A 4DO5A 4M29A 2WC7A 4WJ8A 4AD3A 4HVXA 3AFBA 2DVTA 1DJIA 4NRSA 4O50A 1HP5A 1UR1A 2WWCA 4S1FA 3IGHX 1XX1A 2D3LA 3PZQA 1T7LA 3GSMA 1Y0EA 5LNUA 1LRQA 3S6TA 1TPUA 3GR4A 3IV8A 1RJQA 4XAYA 2TPSA 4WX2A 2QPXA 3IRSA 3GHSA 1UR0A 1OFAA 2O92A 1IEIA 4X61A 1HKVA 4O15A 4Q22A 1JCXA 3DH7A 3H24A 3G8RA 3Q67A 1TMHA 1N55A 4V1XA 5I3HA 2PODA 4EANA 3EMQA 4OQVA 3VCNA 3CMFA 4UQBA 1Q7ZA 1SVDA 4K8HA 5D9PA 2OT1A 1NP0A 2Y63A 5SWUA 3VDBA 3KBNA 2VOTA 3KOWA 1VCFA 3QYSA 2OR2A 1DWFM 2V8ZA 4EXQA 1S2WA 2J27A 3V16A 1UUMA 3MSDA 4YHEA 3ZJ7A 3KDNA 3F4NA 1FDYA 5A8NA 1XIGA 1IXQA 5E9XA 2R1MA 3DAQA 1YEYA 5CZKA 1GQNA 2DSZA 1C3FA 4MJZA 4QGCA 4P5UA 5DRCA 5DEZA 1XLCA 5PTDA 4K7YA 3K5XA 4M80A 4J5NA 3EOSA 2OCZA 4GBUA 1ZCCA 5C9UA 1XQKA 2OZ0A 1P4CA 2GWNA 2VURA 3LLDA 3GU1A 1JPDX 4S3FA 3UNTA 1JUKA 3ARYA 1B31A 3EXTA 3A47A 4C6LA 5E93A 3HPAA 2C3ZA 1JFHA 3R13A 2V69A 5FF3A 2AQOA 1TR1A 3T07A 4NAEA 3BLLA 2CLEA 1Q13A 3H2FA 3W7KA 1UJQA 3CIWA 3HTWA 5H91A 3VIGA 3NSNA 3UZXA 1X98A 4X60A 1OABA 4NXSA 3SJ3A 4DB7A 3SCVA 2OYMA 3TN6A 4NRRA 1GORA 5EMKA 4Q33A 2G41A 1XWYA 3C86A 5H8UA 2BOGX 2REQA 5E09A 2ZE0A 3GHUA 1VEPA 2JKAA 2I56A 4LU0A 3GXTA 4QDMA 4FZIA 1LLOA 3W85A 1TWZA 5JIPA 4QSHA 3S1VA 3VABA 4WY0A 2GOKA 3WYZA 5LHFA 1EZWA 3LS9A 2E0PA 1TX2A 3SJNA 1SFJA 2OO0A 3IVSA 3V3WA 1YLVA 3H23A 4W5ZA 2H90A 2H3BA 2Y0FA 5D30A 4C6BA 1S1RA 3KL0A 5I7GA 2V5BA 2P1FA 3EB4A 4ATDA 3UW6A 1J12A 3LGGA 3JW7A 4D1JA 1KV5A 4ZQRA 4FNPA 2NXIA 1FWEC 2ACQA 1CX9A 3MP3A 2GLKA 1VLWA 3O6AA 4PBEA 3UJFA 1TZZA 2A5HA 1X6LA 4O0QA 2CWXA 4AX6A 4L4PA 3TC6A 4A2SA 1LF1A 2R1LA 3PUGA 3PNZA 3S2CA 2ZVIA 3VGFA 1RCOB 2Y1HA 5KZEA 1XYBA 4DEFA 2CCRA 3W00A 4XZNX 3OLDA 1ZAHA 1UKQA 2PDWA 3DFYA 3ITOA 4PCTA 2W92A 4WDXA 3W87A 3B40A 1W1A1 2WMJA 2QCGA 3TJ4A 4B5TA 1Q6DA 4GYKA 4OE7A 1PHWA 3V7PA 3C0LA 2BVYA 3GTXA 2NVAA 2WZHA 2Y24A 3WZ0E 1CW2A 1KCXA 3DERA 2Y61A 1PYMA 4NT0A 3W7LA 2GPTA 4N9DA 3SUWA 2PDPA 2OQHA 1R3SA 3ZS4A 4KETA 1ENUA 3ZO9A 2PCEA 3CUIA 1LL6A 2QV5A 2WKGA 5GPRA 4KEZA 3DZ1A 4Q8VA 4XUYA 1PAMA 3B9DA 3QYQA 4CU7A 4DF0A 3QC3A 3OB8A 5FF2A 3ES8A 1W56A 4IIDA 1PIFA 1E6PA 4PUNA 4EPKA 2BHYA 1IGWA 4LEQA 3S4TA 3HB9A 2ZRZA 4OV9A 2PWGA 2BHUA 4FNSA 1F61A 1EC7A 1XS2A 3FFSA 1VJSA 3TTYA 3TTEA 2VFFA 1J0JA 3NVTA 4Y9MA 2OMAA 2QPUA 5LIKX 3OBEA 4X0VA 3DFQA 3W25A 4I9TA 2D0HA 4KW2A 2YL5A 6ENLA 4YTTA 3S6DA 3OU8A 2WKJA 3UD6A 3BV7A 4H9MA 2Y70A 1H49A 2WMFA 3ZMRA 2X42A 4HP5A 1R6WA 3ENLA 4HCHA 3M0MA 2J6XA 3QOMA 3VC5A 3AXHA 4MDPA 1LL7A 2IPGA 1FQ0A 4S3AA 3BJTA 4IIHA 1TUFA 4PSRA 2WW5A 1AVAA 4OBSA 5G1TA 2PWUA 5M1TA 4QCFA 1O60A 5C5YA 1GHSA 1W0MA 2WCGA 1FWSA 3WNOA 4LXFA 3KTCA 4O28A 2PRHA 3W7DA 5K9CA 2CWNA 1OCNA 3L68A 1OGBA 2BX7A 1FDZA 4OJYA 3SCUA 1LOQA 1G7UA 3HG4A 3VOGA 1Q6LA 4JX6A 2DSKA 1JD7A 3LXAA 4XSLA 3FYOA 1DWGM 1S3TC 4GUHA 1M6JA 2IPJA 1XPGA 2P0IA 4PUDA 4UR7A 3WQCA 3KLLA 1IT7A 4MB1A 1NM9A 1EB3A 4RE3A 4A3UA 1EOMA 2BWGA 3GW3A 4LVFA 3S2NA 4EP8C 1XDMA 4NAFB 4ZTYA 2WMIB 3LHTA 3QGAC 1RLCL 2BTMA 1EF3A 5RUBA 2D69A 3ARXA 2J6VA 1OIFA 3ABZA 7ODCA 1TWSA 5A6LA 1VP5A 5HANA 2PS2A 3W76A 3B05A 1E6RA 1PYFA 4O0KA 5HPCA 4KCTA 4J3ZA 1UUQA 3GD6A 2QCMA 4PYSA 5CJ5A 1A5LC 1O66A 3EOOA 2VZSA 3THAA 1GJWA 1ZS2A 4HJWA 2VTFA 4PRTA 4PULA 4DY1A 2YA1A 1LBLA 1KXQA 1QT1A 3BAXA 1NAL1 3BOLA 3N14A 5EGRA 1LUCB 4M6QA 3AYSA 4KCWA 3EKZA 1VENA 1VYSX 1W9UA 4A6GA 3GG7A 3NPXA 4C5ZA 1VFTA 1TE1A 3CAQA 3A4AA 2FHCA 5D2VA 5T91A 1UR3M 3WQEA 3O63A 4C91A 5F4XA 3BVJA 3RRAA 1KFCA 1W1TA 1W3TA 1JGIA 2A6LA 4BHYA 4E8CA 3DIPA 1WDSA 4REQA 4B4FA 1R5YA 5F2IA 3UYCA 1S5NA 4BEUA 4RE2A 3R0DA 2YYTA 3UF9A 4GXWA 5K3VA 3THCA 3O6YX 4Z17A 5EY5A 1TB3A 3LXCA 3GHRA 1H7RA 3STPA 1GNXA 3ABSA 4M0XA 5M2FX 1QUMA 1CCWB 1Z41A 1W1PA 3HG2A 3SECA 2ZX6A 4UTUA 4IPJA 3AI0A 2NV9A 4GX9A 4IX0A 3UWWA 3MCOA 1JPMA 4HCLA 1JYNA 2X1TA 4J3TA 3WBWA 3UVAA 1XIHA 2VRQA 4NU7A 4CLMA 2EPNA 2QCHA 4FK9A 4GZJA 3N1AA 3HF3A 3C56A 4ZFMA 3CV2A 1H1YA 3UR8A 3MMTA 3LHYA 2QNEA 1Y65A 2PTWA 1KWKA 1ZJIA 4MPQA 3GC2A 4XAFA 3WL1A 1K9EA 3VIPA 4O17A 1AQ0A 4OT7A 4BI7A 1FH8A 3NYDA 1NOWA 3VFLA 1O12A 2BGSA 1J79A 3I7SA 1JNEA 1AZ2A 1O1HA 1X1OA 4KH2A 1Q6FA 5AVNA 1FTXA 4ZXLA 2FTYA 3NYZA 1UUOA 4HBKA 4LUYA 3OVQA 3I7QA 1JZ6A 4NASA 1B90A 1I8JA 1REQB 4DWSC 1XCWA 3U2CA 4LCSA 5A8OA 3NFUA 1NWSA 4AZCA 2O56A 3KTSA 1DHPA 4A3HA 2QGHA 3S2LA 4UIOA 4HK7A 3E74A 3AAMA 4NZJA 4CQBA 4HNNA 1ZP4A 4UR8A 4ZQNA 4D1IA 1YXDA 3L66A 1IF2A 3DFPA 3WH8A 3DI0A 1FHVA 4B5XA 2FVLA 1Y5WA 3BWWA 3GC5A 3MKCA 4QG9A 4GYFA 2VO5A 3LI0A 1LYXA 2MNRA 5LNVA 3RAOA 1RCQA 4HNLA 1FBAA 2BLEA 3QY6A 1W9VA 1TMQA 5CLWA 2WSRA 3QH2A 4DJDA 2VQTA 4ATWA 3TOYA 3G18A 4R85A 2QUVA 3CTTA 3EX6A 2A7RA 3E0IA 1E3XA 4BY3A 4CNTA 2OB3A 3O6DA 5EBUA 3G1HA 1S3HA 4Z0SA 4EPEC 3ABXA 3P2VA 4IX2A 3CC1A 3DGBA 5G4HC 2VEFA 2RDTA 3H53A 3PTQA 4HKPA 5C9WA 1KFJA 3B04A 1CNVA 1GQKA 2G0WA 4BQ2A 1HN1A 1VEMA 5HR7A 2QAFA 1H61A 1NF0A 3WLTA 4C6KA 2V5DA 1KWGA 4XB3A 3TROA 2GQ9A 1W3IA 3W75A 3WH9A 1Q65A 1U1UA 8A3HA 2Z25A 2B7NA 2XIQA 4TV5A 4JYEA 2H3DA 3UJEA 2ZA3A 5E5CA 2CBJA 2Z6JA 4ADTA 1JQXA 3W01A 2YBUA 3IJ8A 1J0YA 1YRRA 2QJHA 1P0BA 3TAKA 3C2OA 5A6MA 1NQ6A 2GVGA 4J27A 4GVGA 1EIXA 1EHAA 4IF2A 2E9LA 1FKXA 4IFOA 4WOQA 3RM8A 4JGDA 1ZTVA 1I2NA 3OVPA 2PDUA 4RUBA 4AVFA 2PP0A 1UPPA 3RGTA 5DMYA 4GC3A 4LV9A 1F8MA 3LCFA 4ERGA 4LV4A 2AMGA 1VRXA 4PMXA 3W84A 4IP5A 4Q4RA 3WQ6A 2NV2A 2QXWA 4DBDA 2VX5A 4J2PA 4BF9A 4MWAC 1QRQA 3PZGA 4IJCA 4A22A 2ZUVA 1X38A 2BHZA 1PJ9A 3FVDA 2GOUA 3AHXA 4BKNA 5DN1A 1JAKA 3AIQA 3SI9A 1PV8A 2OQYA 1V3LA 3CQKA 3PBGA 2XH4A 3H2AA 1HL8A 1QNOA 2E40A 1A5MC 3XISA 4CD5A 4XWUA 1A53A 3CEPA 2I1OA 4UQDA 2J13A 3A9BA 4K6AA 4FXJA 5GQBA 4E6MA 4HSOA 1EOKA 3NWRA 3PG8A 1I2PA 4FF5A 1E43A 4CN1A 3N2OA 1TKKA 1R7AA 2PCQA 4NNBA 4ZZ9A 5FJPA 4FHAA 4G7EA 1AQFA 1EJXC 2C91A 4ORIA 3S8HA 3C3UA 3W1RA 3TU9A 4AEFA 2GGIA 2ACUA 5A2BA 3ABOA 1HTIA 2W5FA 1SZEA 4HPNA 1SO6A 1L2UA 1AW2A 4AFYA 2W6RA 2XDFA 3W2JA 2DIEA 3PULA 1M65A 4QQUA 3WLQA 3EEZA 4KIRA 3M4HA 2VEPA 1KRCC 4O8AA 5LNRA 2YB4A 1WCGA 1R9XA 4X0NA 3EDKA 4UTLA 5D04C 2PUZA 3CLMA 2C14A 1E4IA 2FGZA 4Y9AA 4MB4A 4WGXA 3CK5A 4YS1A 2HSAA 1LM1A 3CV7A 2RKXA 1JCYA 5ABFB 1BG9A 3T0BA 1DWAM 5FJJA 3V1PA 1B9ZA 3CZJA 4JIEA 1A3XA 3SRFA 1AODA 4DIAA 3WUEA 1WZMA 4HB7A 2ZX7A 4WKFA 4B15A 3NQFA 3PZVA 4XBJA 1RVKA 1AG1O 1YNPA 3CV6A 3RM4A 3LM7A 4LY8A 5G2HA 3IUIA 1QPQA 5DCDA 1W5NA 2QUMA 4UTHA 1XYAA 1CWYA 1M04A 3AIVA 3IEBA 2ZADA 2ZA2A 2WC4A 1P0EA 3E0FA 2HROA 1J0HA 3BCDA 2POTA 3DHUA 2XISA 1WBJA 2FVKA 3T7VA 4CN4A 3NL3A 4OWGA 3DYOA 4NG3A 4UFLA 3PJTA 5LGXA 3C8NA 3EX1A 6CGTA 2VC5A 3OBKA 3STFA 3QLDA 1F8IA 3GK0A 5FOOA 5KEZA 3LPOA 2E1DA 4L7ZA 3ZSSA 5I3GA 1J5SA 4JKMA 3W1LA 3WJYA 4NI8A 4Y90A 4ZEPA 1TSIA 3B0XA 3FGCB 3NCOA 1RD5A 3PBWA 4UZSA 4AZ5A 2CBUA 4J9JA 2V5JA 4GI8A 2DFAA 5D2XA 2NX1A 3N11A 5AYIA 1I1XA 3WLJA 1E71M 1GQIA 3R8GA 1K9DA 3KTXA 3EWUA 2OQLA 3FKRA 4O1FA 1CT5A 3MUY1 4CKQA 3BSMA 1Q4WA 3PWIA 4WDUA 5E6YA 4MADA 1V02E 2EPMX 2ASHA 3GXNA 4PCNA 3PM6A 2ZA1A 4MFDA 1HVQA 4B2DD 1GWJA 4E38A 4FS9A 2RAGA 2FTWA 3ZXWA 1P7TB 1Z32X 1KGUA 3ECQA 4N7QA 4CU8A 1RAKA 3OHMB 2V82A 3OZPA 4N6EA 1ONEA 4XD4A 3IIVA 1KM0A 2OPJA 1NDZA 3AMLA 1E4MM 1CXKA 2O0TA 5CKSA 4NF7A 1TR9A 4CQ8A 2RFGA 4ZMGA 5KSWA 1T41A 2CERA 2R24A 4PMYA 4JPGA 2GVEA 1OHLA 1GKQA 1H0IA 3ALGA 4H04A 2OO6A 4JTGA 1RXOB 4U5IA 4HU0A 1LROA 4ZQPA 2WQDA 2DY3A 4BR1A 1VFMA 3TJXA 3NSXA 4O57A 5FJTA 5KZDA 4DJEA 5CZTA 4CEXC 3N12A 5A8PA 3VKCA 4Z2GA 1F6YA 3B9OA 3HQNA 4N9CA 4G5DA 5AC7A 3E02A 2E6AA 4H6EA 4X9YA 1TWIA 4L80A 2PD9A 3C0SA 1I2RA 3WQGA 1VAHA 1X96A 5A69A 5IFPA 3EDDA 1W37A 3NQDA 3RFAA 1E6SM 5HATA 3CIVA 4GQ0A 1QW8A 1UJPA 3FXGA 3PZOA 5G2IA 3UETA 4H9VA 5D2YA 1NWRA 4H01A 2J9ZA 4RNFA 3U0HA 3NDYA 2OWCA 3W6LA 1XLBA 3ATYA 1R9ZA 4GZ7A 1C91A 5LKYA 3ICJA 2OFJA 4F2UA 3ITVA 5BOFA 2V5CA 4JY9A 4ROQA 3KAOA 2A0NA 2XYLA 2HWGA 1VCGA 3M0ZA 2YZ5A 1US3A 3VIHA 5HDRA 3SY1A 1DIEA 5AECA 4LGXA 1AFSA 3Q45A 5EPDA 2W9MA 5AHMA 3AIRA 3WQWA 2J74A 4XD5A 4TMBA 1MNZA 4JX4A 3R12A 1UD2A 2R9RA 4PSPA 4AWTA 2ISFA 4EPDC 3L4VA 3BLKA 1QO5A 4IZGA 3MQTA 1S5MA 2O4QA 2Z00A 1PBGA 4BQ3A 3HJEA 3ITCA 4J7RA 1V0KA 5CC7A 1SMAA 3PSWA 4O0ZA 4PMRA 3QW4B 1OG0A 5MF5A 1A4LA 3CUGA 3FS2A 1VFOA 4PCPA 2HZGA 1B30A 4GYPC 2QR6A 5CSRA 2ZZ2A 3LPPA 4GCXA 3DFSA 3MZNA 1KW1A 1MUCA 1E5JA 3OOQA 3MCMA 3IGSA 1L8PA 3VE7A 3I4EA 3N6QA 4F0SA 4AIUA 4O1DA 1B0IA 5BNKA 5E9AA 1QBBA 2DIKA 2FLIA 2WBGA 4URIA 5U7SA 1OC6A 3QC0A 4L56A 3LEPA 3TW9A 1WPCA 3OLEA 4S3CA 1WZKA 2P3EA 3TZNA 5A8GA 3KP0A 4L1XA 2OX1A 4TTUA 2J62A 3W7EA 2QT3A 1QBAA 3WJZA 4QLJA 2R8WA 4HK6A 1OCQA 4E0CA 3E9AA 4IIGA 3MJMA 1T5AA 2FB3A 1F9CA 1EP3A 1XC6A 1GVFA 3LCXA 4LB4A 3CUHA 6PTDA 3ONBA 2XTKA 3CJPA 5AHIA 1OB0A 2EKGA 4H8HA 1JZ8A 5AHNA 1H4PA 3GW0A 2Y8UA 4KWSA 5C2CA 3QBUA 3ABRA 3DFNA 4XUGA 3A4XA 4Y96A 4H1ZA 3UXIA 1BPLB 1LL4A 3CB3A 2EF9A 1K8CA 5HUPA 4HNOA 5GVJA 3UZYA 2ALRA 1H50A 2YLAA 2CHNA 4LF2A 4D8LA 2VFEA 3TWBA 3G1YA 3FAWA 4WKAA 1PIGA 4HSNA 3CL8A 5FCZA 3W24A 1ZBVA 3UWQA 4ADUA 4QLLA 2QJMA 2WLZA 1E0WA 5ABHA 4IOTA 1HQTA 3NM1A 3QHMA 1HKJA 4Q7NA 1TVLA 1SSGA 1RK6A 1XSJA 1B1YA 5I3IA 2V3DA 3U8GA 1NIUA 4HA0A 3T2PA 2YR1A 4K37A 4E2OA 1Y8BA 2XVLA 2CXEA 2J9YA 4GH3A 2EQDA 1DIKA 3M16A 2FVMA 4FA3A 4ZTXA 3LQLA 4KWWA 1UYQA 4M7TA 1RBOB 1XYFA 2WVUA 4GOAA 4DHGA 4RX0A 3F4CA 2QGYA 2YIHA 1M7JA 3O9NA 3I6TA 4A4AA 1HG3A 2IW0A 3DDMA 2CZEA 3GAKA 5IDZA 1DIOA 4KWVA 1B3VA 3L5LA 1O1ZA 2PI6A 3IAQA 4OTKA 3EGJA 3N19B 2WO5A 3B8SA 5I78A 1EEXA 1OX4A 1A5CA 5AHLA 1K77A 2VCBA 1GJPA 4XAZA 1L8NA 3WSUA 1T99A 1VS1A 3QHOA 3QLLA 3O0FA 4F48A 5AVHA 1A5UA 4BQ4A 4TVUA 1C29A 1KNWA 3CZGA 3THQA 1KBJA 4LAMA 3NQ6A 4ZODA 5KZ6A 1EQCA 4LUJA 1H7PA 1W54A 2WOQA 3SGGA 3RJXA 3W2KA 1AMYA 4JQ3A 2OG9A 1MRAA 5D05A 2Q3RA 2QULA 2B31A 1GOIA 1CXLA 3NPVA 3W1TA 3W83A 2H6RA 3B8UA 1HJWA 1MYRA 3P81A 3QY7A 4HTBA 2OZ8A 1CGXA 1JPHA 2WJFA 3UBPC 4EKJA 3W7NA 2OWXA 3JS3A 2BSLA 2ZUNA 4TVCA 4GY0A 4ZO8A 3S1UA 3BMVA 3UPMA 3L2LA 3PFMA 3CUJA 4PTWA 5JH2A 1CZ1A 1OC5A 3W7JA 1UWQA 3ZWSA 4BQ5A 1WKDA 2ALDA 4LNYA 1PWMA 1ZCOA 3N2BA 4I9JA 2AKMA 4IPNB 1D2KA 5A2CA 4AHPA 5K7JA 4YLWA 5HJYA 4XVEA 3REQB 3BAWA 3WH6A 2H8ZA 1TPC1 3TEVA 4AQLA 1F7BA 4KPLA 1XLDA 5TNVA 3UVIA 2DVUA 3NXFA 3B0VC 4DUXA 4DJDC 1BSIA 3HO8A 4I7WA 3IANA 3MV11 4FNRA 1KLZA 3VZXA 3QR0A 3UEQA 3VAVA 1GPWA 5LGZA 3CGTA 2OJPA 3OODA 5CBIA 4GVFA 3S0CA 3PF3A 1PS9A 4PFHA 3TYBA 3WF2A 3ID7A 1E1FA 4YHGA 3L7RA 2E6YA 1SO3A 3VA8A 2RUSA 1Q6RA 3NUKA 3T40A 1JZ7A 3PBYA 4Y2WA 4O54A 2CLFA 4LW7A 5EMMA 1EJVC 1IEXA 1R9YA 5EMYA 1M5WA 1W5MA 3P8JA 3WFAA 1OYBA 2V9DA 1OY0A 3SUUA 2AL2A 1XGZA 3PAOA 5J04A 3VDHA 2FKPA 2DW6A 3KBMA 3H2CA 1ZJAA 3LX9A 4GXMA 3OVGA 5AOUA 3CL7A 5HBFA 1EGMA 1FDJA 1GCYA 4TX8A 4DJDD 2AL1A 2GVJA 2Z1KA 4O12A 2HQAA 3HBLA 3K1GA 2YA0A 5I3KA 1LQ0A 1PKMA 3OZOA 3SCQA 1I2OA 2WHKA 2V63A 5TD4A 1E70M 1XIJA 3L23A 1DQWA 2P3ZA 4NNCA 1GEHA 4GBDA 4JTCA 7A3HA 4OFCA 5HMEA 4GVHA 3DYMA 3V4BA 3ZWTA 3PY2A 2DORA 2WM0A 4LC6A 1XQLA 3CB8A 4BI5A 3QTPA 3GQYA 2DSVA 1OX5A 4UTWA 1QJWA 3FVMA 3LERA 1XV8A 4Z1BA 3IIOA 4DYEA 2A2IA 5I24A 4HMEA 3BDKA 2X1UA 2CLOA 4OBTA 2E7FA 3PPCA 2D24A 2OSYA 2PGRA 1B3XA 1DHKA 1Q7QA 3F4DA 4WJXA 4ILSA 3GVVA 3DX5A 3W7QA 3CHVA 3W2MA 4HHLA 2NUXA 3GKFA 2WVVB 3OA3A 3C6CA 3QQ0A 3CU2A 2XWDA 1CGVA 1IZJA 3W71A 3SCTA 2CIPA 3K4AA 5ECVA 4KQNA 1O6IA 1OJXA 4MYXA 2ZZ3A 5LA0A 3URBA 5EKYA 2JKEA 3OZMA 3HIJA 2V6AA 2XUCA 3W23A 3CMGA 4XK2A 3N2XA 3TZFA 3M0IA 5AC6A 2YXOA 3QM3A 4MKSA 3M7SA 3EA3A 8RUCA 1XIIA 4JX5A 3B8IA 3L65A 3MC5A 3C4UA 3U2ZA 4W7VA 3SN0A 1FHLA 1RR2A 3EKGA 4W7WA 3KE0A 1V4YA 4DJEC 4W85A 3B8VA 1T0OA 4R3UA 2EPKX 1C8YA 3O3RA 4LS2A 2BDQA 3VOCA 4YYFA 3AICA 1JG9A 1GTHA 3V75A 1NVMA 2PPGA 2PTXA 2E3ZA 2PU0A 3KVKA 4WJEA 3SFWA 5ABFA 1E6XM 3DBPA 4YPJA 2P53A 5E0KA 2BXVA 1SMDA 5M03A 1UW9A 1GJUA 1B4KA 1W1ZA 3MWCA 4DQWA 1DKWA 3C3NA 1V03A 4H83A 4E2VA 4JYDA 1E9LA 3S3GA 2C15A 4YWSA 1O5RA 5HQMA 4DXXA 1CGTA 3PZMA 4MLRA 3PPHA 2DZAA 2ZXDA 1HJVA 3TMQA 1SJDA 2Q01A 2XM2A 4PCSA 3BPWA 4B5UA 1GYLA 1E0TA 1LOLA 4LVGA 5FJOA 3Q94A 3EA2A 2GZXA 4HYVA 1SW0A 1UBSA 2W4XA 3GNOA 4MOZA 4CVUA 2HS8A 1OVDA 3LBCA 4L9ZA 4H9UA 2VGFA 5I79A 3KCLA 3AZTA 1QW7A 3OW1A 4H7CA 4US5D 3PUOA 3L9CA 4DBEA 2OZTA 1KGXA 1YDYA 4OOZA 1CYGA 3S5ZA 1K9TA 2E67A 3NEHA 2NVCA 1AJZA 4K8EA 1FKWA 1ZBKA 1MEHA 4M81A 2ACSA 1C90A 3QJAA 4W8BA 1LUCA 3U7BA 1WAUA 2ZTKA 4QEEA 3EX3A 1UKSA 4D2JA 1VIZA 3B9AA 4PUWA 1UD8A 2OVLA 1QFEA 2JFEX 3G24A 3UJ2A 3KZSA 4P8XA 2GQAA 4MGGA 3S2MA 3P61A 4A21A 1DTUA 4RW3A 2IKIA 1MZRA 3RXZA 1WUEA 2R91A 2DJLA 4QQ3A 3TVAA 5GNYA 3KRSA 1NFGA 4F2BA 4JTHA 1RJRA 3LRMA 3MDWA 3LHWA 5FJUA 2OEMA 4NQ1A 2WMIA 3AALA 3VIJA 1PKLA 3NEVA 2XH2A 1A80A 3KCOA 4CNPA 1EFZA 2CZ5A 3HN3A 3MHUA 1POJA 3AHTA 1XJBA 1HP4A 3AIUA 1CGWA 2I57A 1BF6A 4LRTA 3DOPA 2ZWZA 1BGGA 3VNYA 2YYUA 3HPFA 3FA5A 3BK0A 2OEJA 3PZNA 4PEEA 4Q4QA 1WDQA 3QFWA 4DI8A 1EJRC 1JJKA 4XZIA 4JEJA 3R94A 4W93A 3OQEA 3SCOA 3KDOA 2Z0IA 1UQZA 3V5CA 3ZQ9A 1OT1A 2EPOA 4C1KA 5DXYA 2NW0A 2OX4A 3UQNA 1BAGA 3W73A 3GIQA 3K4DA 3UU0A 2VM8A 3SBFA 3MI6A 3APTA 4IGNA 3GWQA 1T6MA 1HGYA 3PBVA 2JF7A 1OG6A 5CPSA 4E2BA 1TPB1 4XZ9A 4AC1X 2ZX5A 1UWUA 2VL4A 1AH0A 3TTQA 1GPFA 4DM1A 4B5VA 3B8TA 1E73M 3KBSA 3EWYA 3B03A 1VEOA 3T1GA 3VNIA 3BJSA 1EIBA 1TA3B 2YJQA 3CWOX 1V0LA 1V5XA 4H2HA 3T8QA 3C0JA 3GZ3A 5FD0A 2YBVA 5CCZA 3M5YA 4AWUA 2POZA 1RH9A 4G7FA 2RDWA 1XGEA 4H2CA 2F6KA 3U4FA 3UXAA 2IXVA 3UXDA 2O9TA 3G77A 4Q7IA 4F8XA 4D6GA 1XCXA 1CXIA 1VBUA 1SGJA 4U5KA 5EYWA 1Z89A 3MT1A 4N4QA 4GYJA 2Q8ZA 4HOZA 2WWDA 3KZPA 5EFFA 2CLMA 3QRHA 5H6HA 2SFPA 3J7HA 4E4UA 9RUBA 4AZCB 3TUUA 4JIQA 3WLRA 3G6LA 3DBNA 3AROA 4OBRA 3POHA 4DWSB 4QDWA 4C6JA 1E72M 1AJ0A 2YZRA 2DVXA 3GDBA 1E55A 4Q8OA 1REQA 1XKJA 3CWHA 4JFTA 1T8QA 1TJPA 2VGGA 1E4LA 1U5VA 1C92A 2Z2UA 2BP1A 4LAUA 5ENLA 1HUVA 2WSKA 2GQ8A 3A4WA 2WHMA 3LRKA 2IPFA 5C8BB 3VMOA 1XH1A 4AD2A 3ARQA 3LSBA 4Z1AA 4FNUA 5FA5A 3H21A 1BWKA 1NDYA 4YWIA 2WMKA 4JTRA 4H8NA 1XD1A 3KOZA 4IP7A 4RDYA 3P93A 1IZCA 2R82A 4L6OA 1W3JA 5JMUA 3S5OA 4YJ5A 4K68A 1TPDA 1NOFA 3KP1A 2QMKA 4M1RA 1XUZA 3ISIX 1KKOA 1FHDA 3UWUA 1GOXA 3T44A 4H9XA 5F2GA 2BV9A 3SY5A 3H4WA 1EUAA 4M8UA 2EKCA 2R1NA 3KX6A 3OYXA 3BGAA 1GUVA 2J88A 4UOQA 1HKIA 3RM9A 5E1QA 4GA8A 3IIXA 1ONRA 1YPFA 4NAFA 1J5TA 1QVBA 4TVDA 5E70A 4MMWA 4OKDA 2WZIA 3QGKC 1IIGA 4YIWA 3OVRA 3I6EA 3AXKA 3OGRA 1Q2SA 4JFUA 1GOMA 3B0UX 4U2ZA 2YB1A 3G1FA 1CECA 1VLIA 3FJNA 1PTDA 4JN8A 1KV8A 8CGTA 1OFOA 1FXPA 1CBGA 4L61A 3W53A 2CESA 4JQAA 3BSHA 1MFUA 4YXGA 3DYPA 1GKPA 3VIKA 3E96A 1H2JA 1EC9A 2ZIDA 1KRMA 1XDJA 2NT0A 3WEOA 1E40A 4GJIA 1NFPA 2JEQA 1R38A 4GGBA 1PUDA 3SSZA 3IK2A 1YE4A 3M6YA 4O19A 1ZZMA 4Q4PA 1YBQA 3SRDA 1KFKA 3MSYA 1SJBA 3CS2A 4E2DA 1UD6A 3E3HA 3AJXA 4LALA 1G1YA 1ONXA 1WKEA 5EA9A 2ZICA 4NL1A 2BG5A 2Y7DA 3LNMA 4UMCA 1JF5A 5FF0A 4MNJA 3M0KA 1WX0A 3GUGA 3QMTA 4QG8A 3RR1A 5KMYA 3CQJA 1G69A 3NDZA 4QDPA 2Z4GA 1J6PA 2Y5SA 3HFTA 1XH0A 1MXSA 3BSGA 3WN6A 3E2QA 5LA2A 4XO7A 2QHAA 3VDGA 1K3UA 3TW6A 2X2YA 4LRSA 1VB9A 3H8AA 1B3ZA 1VPXA 3FY1A 4HYWA 2XHYA 1FP8A 2VZVA 3FDGA 3LQGA 2PD5A 5I09A 3BLPX 3IVTA 4JD4A 1Q3NA 5DRIA 1VCVA 2XN2A 2IKHA 3A21A 1I6NA 1UQYA 1W3LA 3ARUA 2Y7FA 4E4FA 3M0VA 4FXRA 5JXQA 2IQ0A 2O9OA 4NJIA 4JFSA 3SR7A 1E6NA 1XUUA 1VFLA 1BWLA 1F3TA 4D6CA 1JD9A 1WKFA 3EXRA 2C71A 2G95A 3UESA 3KLKA 2HPIA 3BCFA 5LXEA 4GH1A 4Q6XA 2YXGA 2V30A 3NM3A 1LWIA 4NZFA 1TVPA 1X1NA 4M82A 5A1AA 3S1WA 4CQDA 1DJXA 3DN5A 3DEQA 4Y8FA 3MTWA 4CD6A 1K7EA 1BYCA 3SQSA 4D9PA 4XIMA 4KKXA 2XVNA 4UXDA 3W88A 1CGUA 4GG9A 1XINA 4JIRA 4QS6A 3WNNA 3RRXA 3WBAA 3BGGA 2J8GA 3BLEA 2Y88A 5FACA 3SN4A 2Q09A 1LWJA 1OK6A 3BUVA 4IPLA 3TWAA 4LFYA 2G4FA 1HO4A 1N8IA 3SQLA 1DL3A 4GCAA 3AMGA 4XAPA 2DU2A 4WY0B 3NA8A 3H2EA 1GW9A 3FCPA 3MA8A 2B7PA 3LENA 4L4MA 4HU3A 2VR2A 4TTGA 3EMCA 3VCRA 2HK1A 4DUOA 2B81A 1UPMB 1C7SA 1SR0A 5BRBA 1G94A 3AUJA 4GIRA 4RE4A 5IXEA 2CW6A 1XIMA 3WFZA 4C6QA 3CUXA 3R25A 1U5JA 3EWBX 3E5BA 3EWZA 4C6CA 4IXHA 3H55A 3MUIA 3SCRA 5KETA 3W1XA 3DHFA 3T42A 4Q32A 4AF0A 1UG6A 1RP8A 1NWUA 1R0MA 1W9DM 5C6MA 4O10A 5D33A 1BD0A 2ZRXA 5GNZA 2IXUA 2FMNA 1E0VA 4FF7A 4P7OA 2VFDA 3DFTA 1EO5A 2PBGA 3VDCA 2ZC8A 3IJQA 1CB2A 1K03A 4S23A 3U7VA 3WLIA 3NQGA 3BE7A 3N2TA 4R7OA 3WQPA 2OLAA 2FZDA 3QHNA 1LTDA 1DJYA 5IRPA 4GNJA 2Q3OA 4B5NA 2R14A 2ZX9A 1L6WA 2ZXQA 1S46A 3GYEA 1FH7A 1RZMA 5CBJA 3R58A 1NSJA 4JCMA 4LB3A 4YU1A 2FZNA 2WVSA 1Q8AA 3LM3A 1YXCA 3QPEA 2DSWA 4FIQA 2FPYA 2DZUA 1EEPA 4KIEA 3S5YA 1JDCA 2OZ3A 2WCSA 4W4QA 4GHRA 4NKCA 1X39A 2EO7A 2IUZA 1RPKA 3CQIA 3RYSA 4WRHA 3M7WA 4QBXA 8XIAA 3V0TA 3GNNA 4I5XA 4KGJA 1E9IA 2X05A 3GDRA 1RY0A 3UA4A 7CGTA 4NAEB 5D09A 1IEWA 4X9SA 2Y5JA 3T0CA 3MI3A 5FAJA 3PC0A 3VZZA 4DZIA 2QS8A 3BL3A 2WZEA 3ME3A 4FX7A 1T96A 3FIGA 2VEIA 4UCGA 3AMCA 1TTQA 1JXKA 4YMZA 5I02A 4BWLC 2FDSA 2EAWA 3AISA 1LP6A 3A23A 4LNCA 2JGQA 3W0KA 4N9EA 3KOXA 5BRPA 4D71A 4O8RA 3PK7A 1YX1A 2WC3A 1EA9C 1VFUA 3DHDA 2HNEA 4CD7A 2OWWA 3WQDA 3RHGA 1HO1A 3UGVA 3QZEA 4GQRA 4UTTA 1M7OA 1UWAA 4IHCA 4RLIA 3M41A 1EX5A 1K8XA 2YCEA 3GS6A 3N9RA 3MMUA 1K4HA 1OBAA 3VNLA 3GTFA 1R2TA 1K8YA 3NO1A 2DP3A 2DUAA 3BW2A 3FHAA 3B06A 3B8WA 3MDUA 3VMNA 4JL1A 4ATLA 3GNDA 4UQAA 1LCOA 4IPIA 4MNMA 4A8IA 4PRRA 1MMFA 1FWDC 5DBUA 2ICSA 3P5ZA 2INEA 3BO9A 3CAVA 3R8HA 3OG2A 1DQXA 1SZFA 2CZFA 1W9BM 2ZRUA 4R27A 2W27A 3ZLGA 3WKZA 1KQYA 2F2HA 2OT0A 3TNOA 1E9ZB 2XSAA 3GR8A 1PVNA 1VYRA 4O53A 2ZRWA 3A3HA 3GVQA 4I6KA 3GNPA 3CAKA 4K3ZA 4UTJA 4EK7A 2FHBA 1XW8A 3MP5A 5E0CA 1VKFA 4DBSA 1KM6A 3PSVA 1JI2A 1ZBWA 1ISWA 2BFGA 1F3WA 1QOQA 2X41A 4G8TA 3WO8A 2J8FA 2IMRA 3DHPA 3QSRA 1TREA 2I16A 3AHYA 3ES7A 3LN3A 3PPFA 1QPNA 2YFNA 1BEUA 2QUNA 1Q5MA 4MJ2A 3VFCA 3BANA 9CGTA 1MUMA 4PMZA 2DZVA 5XIAA 3AHZA 5HUOA 3GM8A 2CEQA 5HR6A 4W87A 5DELA 3GH4A 4XQ6A 4CGTA 4CD8A 4IT1A 1PX3A 4AZBA 4KFOA 4U31A 3VX1A 4PFMA 2O7QA 3BCJA 1LRTA 4OIFA 4JHZA 4PBFA 3GTNA 4TIMA 5FEWA 3T78A 1EJUC 2E9BA 3EB2A 4RNHA 4ACZA 3TOPA 4AIEA 5DX7A 4H6KA 3WLMA 4OV4A 3WNKA 1X1ZA 4NUWA 4JY8A 1PZ0A 3QN3A 3G0UA 4PL1A 4J3UA 3ITXA 1B54A 5A94A 3DESA 3MYOA 1XFCA 4JIPA 3VIMA 4LAZA 4I7UA 4WR3A 6ALDA 2PBOA 3FYYA 3WJXA 4QR6A 2HE8A 4MB3A 2W67A 1UASA 2E09A 2YBTA 2E4TA 4AYGA 3LA4A 4HN8A 4E8GA 4AD5A 4JFVA 4LANA 4MSSA 3FA4A 2VRJA 2A3CA 4S3JA 2F7FA 3MVTA 1HXJA 3MPGA 3LU2A 1H1ZA 3SRKA 1Q6CA 2VUNA 4YN5A 4K1WA 1FWAC 4I90A 3HA1A 3NIYA 4M6VA 3KW3A 2HBVA 4F0RA 3WDQA 1R3RA 1Q8JA 3CM4A 1OFQA 1W9PA 2HVOA 5CPTA 1BYBA 5XIMA 2X8RA 3GBDA 1O5KA 5HPOA 2PLKA 4G9PA 2OKTA 4TX9A 4QSFA 1H0GA 4DJFA 3B4YA 1JPKA 2PGFA 5CPMA 1R85A 3Q2DA 1FWFC 4QS5A 1NELA 4CCDA 4FNTA 3H6OA 3DI1A 3U5YA 1KM2A 3R4IA 1K4GA 1WDRA 3V35A 2JEPA 1EYWA 1Z6KA 2JE8A 5H8MA 1RQBA 1QI2A 3L0KA 3BZJA 3T2OA 2Z26A 4BA0A 4KFPA 2F8QA 2PDNA 4FMVA 3GTIA 5AYYA 3ZOAA 5DQPA 1XDLA 5D03A 3USBA 4NNAA 1BXBA 2XGZA 4HMDA 4XZHA 1GVIA 2BOFX 3E5PA 4GABA 1W2VA 2CZVA 1W5QA 3YPIA 1UH3A 3T0AA 3BV4A 4QE5A 5K9XA 3NQMA 1QPRA 3HFYA 3LPFA 4EOUA 1GK8A 1Z7AA 4P7QA 3ARZA 2GSHA 3R11A 4RZ5A 1LRNA 2HXTA 2VP8A 4ERAA 1A49A 1BSLA 3GXDA 4Q8MA 3MANA 1A4MA 1AMKA 5TF0A 2DZPA 3QQ1A 1QPKA 1JXJA 4RNJA 1A5SA 3GG8A 2WHLA 5JBDA 2ZC1A 7REQA 4KRZA 4JDBA 5LYRA 1V6XA 4ROPA 1E9YB 4GJ1A 3LDVA 2W62A 1X6NA 3NO3A 5D2TA 1KO0A 1GQJA 2J77A 2XFWA 1ODZA 3QY8A 3BG5A 3VO0A 2E9MA 2X1IA 1F4HA 1QOPA 5LZLA 1V0MA 3VNMA 3D46A 2CKRA 3WLNA 1KFWA 5CEWA 1I0DA 4I5UA 3U6WA 4EWND 1UR8A 1TRDA 5G4WA 1VD6A 4UTMA 1UH4A 1NDVA 1KTBA 2G8ZA 1QWKA 4ZOCA 1HKWA 3VGDA 5F4WA 1UP0A 3CLWA 4CU6A 5CZ0A 1S5VA 2B0MA 1P5BA 5K4XA 2CYGA 1XC4A 1KRBC 4HMNA 1WB0A 5K4ZA 4GFSA 2HNHA 4DI9A 2WNWA 5A6JA 3GNRA 7ENLA 3NZ1A 1FWBC 3BLIA 2D0GA 3EOLA 5BWAA 3WF0A 4QJ1A 4XBSA 3CT2A 4JDYA 2G3IA 4BF5A 2FZBA 3UNDA 4XVDA 1SQ7A 1Y7VA 1J4EA 1UROA 3KL5A 1E51A 1E1CB 3W3OA 1JCJA 3FOKA 1IQ8A 3VC6A 1U2YA 1QNRA 4ZVJA 1W5PA 2ZOXA 3OPSA 3IV3A 1YYAA 3RLUA 3SSJA 4UQEA 3ITTA 4LPCA 1UKOA 3KBJA 1E5NA 3LZ5A 1XD0A 2PDHA 3PB0A 4H00A 3WF3A 5A6KA 1H7WA 3KVJA 4KS0A 1X6UA 3WQ8A 2P8BA 4GZIA 5A8MA 1JZ5A 5KINA 2P0OA 3I3BA 3O16A 4C6OA 3W1PA 2XIJA 3I4KA 3MWAA 1KR1A 2CKSA 4QITA 3ARRA 1F5ZA 1ZENA 4IICA 2UY5A 4I8YA 1H11A 3W7RA 3MW7A 2HXUA 1QWGA 4E4PA 4GIEA 4N9BA 2RJHA 5CC5A 4B2DA 1EO7A 1V6VA 5DFAA 2WMHA 4AWEA 3APGA 2PFHA 3DU0A 3O6CA 4LEFA 1UWRA 2QKFA 2PLCA 4ZFCA 1IHIA 1QASA 5BMWA 5AKQA 5BCAA 1AQMA 3W74A 2DQWA 4U10A 3CASA 4BWLA 4LCRA 4UWMA 3QXBA 4JTJA 1NARA 4M51A 4PUEA 5MKGA 1XH2A 3OEXA 1K70A 3NNTA 2OGYA 3WY1A 2WNQA 1N82A 3GC4A 1IR2A 3GX9A 3RCYA 4JN6A 4G2DA 1XG4A 3H26A 3MKKA 1LLZA 4QHRA 2PP3A 3F7JA 4CQCA 3UG8A 2GWGA 2NXGA 3AMDA 4CNSA 3S46A 3NSMA 3P0XA 2C1IA 4PR4A 1EBGA 1E0XA 2GGHA 5HQEA 2PWVA 3WENA 2PTZA 2NLYA 1D8WA 3CZEA 5IBXA 3MU7A 2GJXA 4HOWA 1MRQA 3K8KA 1X8CA 1SW7A 5MHBA 5CXPA 5HOSA 3IRDA 1G4SA 1JUEA 3Q4DA 4WUIA 5LNWA 1PTGA 1FCQA 1E0UA 5IBXC 3NTYA 1Z3NA 4NHVA 3W81A 2DUZA 2VZTA 2Z1VA 2INFA 3G1VA 4V33A 2DIJA 2YCKX 4L6DA 3AS3A 3VD4A 5A2AA 4AZGA 4DXKA 4IMDA 3M5XA 3R8RA 1TIMA 4GIAA 3FJ4A 4W88A 1H41A 3CO8A 1KBLA 2WSQA 1JZ3A 3DECA 3UCQA 1H5VA 1R7OA 2OYKA 4ZL1A 1M41A 5DMMA 3CZKA 1H5YA 3UG3A 1MEWA 4UQ9A 4M6PA 1KCZA 3T55A 3K2GA 3HJZA 3QOKA 1ME8A 2V2HA 3NGFA 5JH1A 3LCWA 3W7OA 3EDJA 3PAJA 4XD6A 5CAHA 3B97A 3AJ7A 4EX4A 4P2VA 1HJQA 2C18A 1WO2A 2V67A 6XIMA 6TIMA 4JQ2A 2WLYA 3HPSA 4RDWA 3M9YA 4JQ4A 1EHNA 4LVAA 1B5TA 3UXKA 1NDWA 2ZXAA 1YTKA 6TAAA 2BNJA 1XLFA 4DXVA 3PANA 2QUUA 3F5KA 2VENA 3BZGA 4QXIA 2Z7KA 1JPIA 4RK8A 4PZVA 3W1AA 2YGYA 2WNZA 2AQWA 3V5FA 1NP2A 4AUBA 1JDAA 2UWFA 4EF8A 2DT1A 3AC0A 2QMJA 4AY8A 4GO9A 4WXZA 2I5GA 4XZMX 1QI5A 2QDEA 1ITQA 1PE1A 4A29A 2YXXA 2OODA 2PWFA 1MDLA 3QPZA 2ISWA 1FUYA 3P84A 4QJ3B 6REQA 1CB7B 1ME7A 2CLLA 3LPGA 1IWAA 3URQA 1C9WA 4ZO9A 4LYQA 2VYOA 1V77A 3ONCA 5HAOA 3VD3A 4EF9A 3MYPA 1ICSA 4A8NA 4Z2JA 3TJIA 4GVIA 1XPYA 1F4AA 1LQAA 4YVPA 1YHTA 4BFAA 3R7MA 3TYUA 1I45A 3CYJA 3RK8A 3IJ7A 3LI1A 1DXIA 5FL1A 2HMCA 3N34A 3TQKA 4UFHA 1WXJA 3KCJA 3GVGA 4LJ3A 1DP0A 1QDSA 2PDJA 2XIBA 3SGZA 1CLVA 3TR2A 3ARTA 1TPH1 1R87A 5I3FA 1IYXA 3TXZA 1Q7MA 2TAAA 3M0XA 1ITCA 3ZFHA 3K46A 3AYTA 2WANA 3WD1A 1GYNA 4P7RA 4H9YA 2EJAA 2VOMA 3L5MA 3MB9A 1MO0A 3TFCA 5L6UA 5JQ9A 1EQPA 3CZ8A 1IV8A 3AXXA 4K38A 4JTAA 2VR5A 2C0HA 2ANUA 2PDQA 3LBOA 5GJNA 4PMUA 2J7CA 3PN8A 1V51A 1L6SA 3RJYA 3N6HA 2V3EA 1MZHA 4FLQA 5ECUA 1ZJBA 1FHUA 3GH5A 4ZOBA 3TC7A 2W63A 1MW3A 3L2IA 3MJYA 3L0NA 3H7UA 1EWDA 4REQB 3G1AA 2YSWA 1UZ1A 3EWDA 4MZYA 4J35A 1XKYA 2KAUC 4UFMA 1TV3A 1R47A 3ZJ8A 2Z2AA 5IHSA 4S38A 2YPIA 3N25A 1KTNA 3HGSA 4ENLA 1NJJA 4LCQA 6REQB 3KVLA 3DGRA 3RX3A 4JTIA 1ONWA 1TPWA 2BY2A 1F05A 2QJJA 3FJ6A 4R34A 3FK4A 4HK5A 4RXFA 4HSHA 3B9NA 2XFFA 1BQCA 1ZAIA 4H8VA 3TX9A 4B90A 3RILA 4F2TA 4H6RA 4PUUA 4RKAA 1QATA 2XIIA 1THFD 1XIDA 3MO7A 2WVVA 4ZGYA 1DEDA 3NQCA 4PUKA 1UH2A 3ANVA 2WM1A 2YDRA 5IHRA 4F9DA 1JCNA 1YMYA 5DCBA 3EOUA 4IMCA 4C65A 3I6RA 2XVKA 4ICMA 2YL8A 5EB8A 4WQ6A 4N2YA 4U2YA 2A7NA 2F6UA 3GE7A 7REQB 1QW9A 3G1RA 1EWEA 4O1CA 4B16A 4IXXA 2W3ZA 2AAAA 4AX7A 3CWNA 3A64A 3CXOA 4W7UA 2Q8XA 1GGOA 3K8LA 3MMDA 3WDHA 2RGLA 1E3ZA 3LNPA 1LBMA 4IMGA 1EYEA 3ATZA 4HYRA 4Z2LA 2PLMA 4C6NA 2W0UA 4KF1A 1ISVA 3EX2A 4S3BA 4AC7C 3WK0A 4AZ7A 5FF7A 3MHFA 2XSXA 1QPOA 4IMAA 4TOQA 3O07A 5CLTA 1S2TA 2R6OA 2FB2A 3M0HA 4R53A 1XFBA 1XLAA 2MUCA 3MS8A 2QVHA 3I10A 2V38A 1V6TA 3WNPA 2C7FA 3GAYA 4LOCA 3EMZA 4U28A 2J78A 1XRTA 3ZR4A 3OO2A 5AB3A 1EPVA 4RZ4A 1WXYA 1TWDA 1OCBA 4IGSA 4F0MA 2V3GA 1L6FA 2A3BA 3LBMA 5JU6A 2GJXB 1SZRA 3OLIA 1SFTA 1TJ0A 4HZ6A 1OX6A 3GG1A 2X1SA 4JEQA 4IIFA 1C8XA 2GGJA 2MANA 3H54A 4DWSD 3E0VA 2IPWA 5C2GA 4UNKA 1DXFA 3CUZA 1DV7A 2VWSA 3IPWA 1FWGC 4EACA 4QAWA 4XV0A 4EVZA 1XYZA 4M3PA 3WLHA 1TTIA 2QAPA 1EXBA 2FJKA 2FPTA 2ZZ7A 3M47A 1UCWA 4O4VA 5D02A 4YNGA 3BURA 4POCA 1H09A 1MQQA 1GONA 1HGWA 3FSUA 3GBEA 2Y7GA 2WBKA 4MF4A 3PJUA 1PO9A 2H8XA 3LTPA 4PEKA 1TO3A 3LGDA 4X3ZA 3S83A 2JK2A 4N02A 2CFFA 1U83A 3H70A 1ZAJA 1VIWA 3QV9A 1FWIC 3VGBA 3W9ZA 1R3QA 1ZSXA 2VD8A 5B7YA 1H7OA 1QTWA 2EJ1A 3AYRA 3D3AA 1DYSA 3HQPA 2A3HA 1VPYA 2AMXA 4GC4A 4JTQA 2VEMA 2YCJA 4DLFA 3PPGA 2HVMA 2DZSA 4ZE4A 3WBXA 2EBNA 4RW5A 1YDNA 3EDEA 3ANUA 3IUHA 1DBTA 1SZNA 3C8FA 1OGGA 1XIEA 1IZKA 1EGVA 2A6NA 4MAZA 5CSYA 5G1MA 3C61A 1XM3A 4B9ZA 4JBRA 4S3DA 2CPUA 1QNSA 1KB3A 1VHCA 1WZAA 4OZOA 4OU1A 2BY3A 4DO4A 1P43A 1WA3A 3KL3A 2F84A 2WJZA 4BJHA 5DXXA 4MKVA 1VBGA 3L5AA 2YLLA 2GFTA 1YTEA 2C79A 1NH6A 4H8UA 2NX9A 3TXVA 3VUSA 4HTYA 3P8IA 1KCKA 2CHOA 1OINA 1PL9A 3W07A 4FP1A 4DPPA 5LSMA 2ZE3A 1EDGA 4QAIA 1ZQ5A 4PUMA 4BZYA 4XG1A 3VGHA 3LOTA 1PX8A 1QXLA 3W82A 1G4PA 2TODA 4IISA 2D2OA 4D6DA 4C90A 1TPVA 1WP6A 4C6FA 3SIMA 1TE6A 2HK0A 2HVNA 3F1QA 1VHNA 1HNYA 3TTSA 2ZDRA 3HPXA 1HW6A 1ZL1A 4RCXA 5D9OA 5G1YA 4PTVA 3QV6A 3O15A 4WOZA 2E6FA 4QJ4B 4MYAA 4Q8QA 1OGSA 2X30A 3KOFA 1KQZA 4O1AA 3POCA 2WNNA 1XGDA 4AU0A 5HWMA 3R0KA 3N18A 5F4SA 4AHOA 1OF6A 3W6MA 4FXFA 3RPDA 2VRKA 4LC8A 1EJSC 2RHGA 1OD0A 4JICA 3PS7A 1UMYA 1KFBA 1TV8A 3UR2A 2VHLA 2ZX8A 2GL5A 3JVAA 2EG6A 4FOKA 5M17A 1GZJA 4H9TA 3VD5A 1D7FA 4JR5A 2FH8A 5CJMA 5CPQA 1CEOA 4MG4A 3VM5A 4YTUA 3QFEA 4MNLA 3T05A 2PA6A 2WJDA 2NQLA 2DUXA 3H22A 4PCFA 1V7YA 4J40A 3PJWA 1C93A 4JFWA 4YCPA 3PUDA 2AAMA 2J25A 1P6WA 1CDGA 4JTTA 2PGEA 3FA3A 4HD5A 4QG6A 4CEUC 4MPKA 1PSCA 4UOZA 4FSAA 1FCUA 4AYSA 5TBOA 4GI4A 2XINA 1BTCA 4KERA 5CZJA 1VRDA 1B57A 4E3VA 3E49A 2D3NA 1XXXA 3V36A 3NQBA 4Q4MA 5K9DA 1W17A 4Q4OA 3W7PA 4QISA 3SM0A 3SB0A 1HIZA 3B0YA 3L2MA 4WXYA 3NZRA 1WOBA 1E15A 3M43A 3O7UA 3GDMA 3QGVA 4BK9A 2Z27A 4KEVA 1U5HA 3SGUA 4NXKA 1RSCA 1O5QA 3BXWA 3RN6A 1VR6A 2XZ9A 4JIHA 1UR4A 1XR2A 1QMLA 2GYIA 1UZDA 3W26A 5DY3A 1MSSA 4C1NB 4XIAA 4S39A 5JIWA 5C7VA 2PWEA 3NR0A 1KXTA 4XBKA 3LHZA 4Y8EA 4TX6A 4HNUA 4GY7A 3TN3A 2QJNA 4V27A 3KRZA 2O9PA 1XYCA 3F2BA 1WBHA 5B7ZA 2XWEA 1JYVA 2WXDM 4GX8A 3L4TA 4UNLA 4UFJA 4DLMA 1TV5A 2HISA 1UWSA 4H7ZA 8XIMA 4F66A 5HNUA 4WK9A 3WNMA 2YCIX 4ACYA 2Y6ZA 3SCWA 3UJRA 1C7TA 1J0KA 2VFGA 3ZSTA 2QIIA 1IWBA 4A2RA 3QR3A 4P61A 3IGXA 5BMXA 4RZBA 3T2QA 3H7RA 1LG2A 3W28A 4O4WA 1L2QA 3C2VA 2PZ0A 2FDMA 3M5ZA 1CXEA 4HNVA 1GW1A 3UXLA 3WBEA 4DELA 3D47A 3PTDA 3TYAA 2PWDA 3T0TA 3WJWA 4Z1DA 5D32A 5HK4A 2WSPA 2VR4A 4KCVA 1VF8A 3CAWA 1S5WA 2ODOA 2BASA 4P8UA 4Z2HA 3P80A 2WV8A 3ARWA 1A5NC 2ABAA 4C6EA 2YA2A 5F1UA 2CXGA 2QQ6A 5EFDA 1V6WA 3WF4A 3IARA 4K36A 2JIEA 3DUGA 4UBPC 3VOJA 4DF1A 1CTNA 4FO4A 2XFYA 2EXOA 4DJFC 2D0FA 1F6KA 1TWWA 4JQ1A 4DUWA 4B3ZA 2O7SA 2P5NA 3KHJA 3W7MA 2AKZA 4ACZB 2E5CA 1EF2A 3HG3A 5I00A 1W1B1 1A5OC 5C70A 1LQ2A 4U3CA 4DF2A 4WEVX 4GISA 4RXGA 1J10A 1AL7A 4PGLA 4NYUA 4F3HA 5C7HA 4DZAA 3UJSA 1FX6A 3RCNA 3CL6A 1XHGA 1V93A 1MI3A 2IKGA 4QLKA 3L4WA 3DFHA 1V7AA 1OADA 5CSUA 4JKKA 3B3DA 2G4JA 3QW3A 5C55A 3GFZA 3GFXA 1O4UA 3LY0A 5TAOA 4UOJA 3RDKA 5JBEA 5K2ZA 3LV5A 3C2FA 1Y5VA 1XYLA 1JCMP 1G67A 4MHBA 2P8CA 4D6IA 4M24A 3SCNA 4MWAA 1JF6A 1XIBA 1M3UA 1WDWA 1BKHA 1J18A 3OGSA 4XX6A 2TRSA 1JL8A 1SFSA 1JDFA 3CIXA 3VE9A 5BYWA 3WD3A 3ABQA 4UTKA 4A8LA 2XSBA 2J7FA 1V3MA 5AYZA 1RBAA 3BAYA 2V0TA 1ISZA 4Q8TA 3P74A 4PMOA 4IPPA 4UTTC 4DZHA 3RU8X 4M1BA 4P8WA 4AY1A 4ICNA 3AOFA 1TFVA 1OFEA 3BOXA 3FKKA 4GKTA 1Z44A 2YW3A 1JCLA 4A3QA 2GJLA 3IS4A 2PDFA 3LCGA 2J66A 2C19A 1NTHA 4KRTA 3WUBA 2XVGA 2RDUA 1NOUA 4K8GA 4YTSA 3BAIA 4HZMA 1A3WA 3NOEA 4QP0A 3I3DA 3JUGA 1UHVA 1Q66A 1UKPA 2WPGA 5F1VA 4F0KA 2ZBTA 1O94A 3H2NA 4LBUA 4J3VA 3G3DA 2FH6A 2J4GA 3PBMA 4WSJA 2QCFA 2W79A 4EWJA 4I9AA 1GTEA 5DBTA 3T0DA 4ML4A 2PDKA 4GQBA 1V3IA 3II1A 2JGYA 1EP2A 5C9XA 2P76A 3GKAA 4KGLA 4ZENA 4X2RA 3SCPA 3TYZA 3S6OA 4J4KA 3EWWA 1XBYA 4LBSA 1IEQA 3RMEA 1SUXA 5FEZA 1AW1A 2XIOA 2NUYA 5AC4A 2YCLB 1GVSA 3EX4A 4CUCA 3PWAA 3WLLA 1BYAA 1J2BA 1IXNA 4HHHA 4FOJA 4HNCA 5TIMA 2ESCA 1SPQA 3URAA 1VQTA 2ISSA 4NJJA 1VBRA 1C8QA 4RPQA 1R2SA 3THDA 1GQLA 4M56A 3M07A 4B4HA 2DZTA 4HMCA 4IJRA 4UTWC 1ITUA 5AFDA 4LTSA 5DT7A 4UC5A 1KFEA 2B7OA 3HGOA 1J11A 1ZUAX 3EXSA 3SUSA 2QCNA 2VI0A 3FEQA 1YDOA 1MFVA 5HULA 2J9XA 3BLOA 4PBGA 3FN9A 3GLCA 4DVOA 4LS1A 7XIMA 1PZ2A 4I7VA 1QHPA 1JZ2A 1RALA 3SQMA 3T81A 4PTXA 5G5IA 1V6YA 2B7QA 4GI9A 1DORA 1DWHM 3FAXA 4TUFA 3TQ0A 2ZUSA 4D6JA 3N4FA 3H7VA 3B8DA 2AGKA 1LZOA 2GQ3A 1YBQB 1ZGDA 3AS2A 3JRKA 2IQDA 3CT7A 4IWWA 2OKOA 4I5RA 3SDOA 4HZ7A 4MVAA 5CZSA 3ARVA 3AMKA 3EPMA 4C5YA 2D2GA 3BLDA 3ARSA 2FMOA 1W3NA 3FW6A 3F2DA 4OUEA 3PNUA 2CBIA 5HMDA 4AD4A 1YPIA 1AZ1A 3TFXA 1ISYA 3NPUA 2A85A 3RF9A 4QE4A 3L0GA 2PRLA 1TVNA 3AIBA 1UZ4A 3THUA 4ZA0A 4GACA 4PE8A 3CHFA 4GXPA 5I2UA 3KEHA 5J5RA 2BODX 4G56A 3FYPA 1WDDA 1OM0A 2WSYA 3NL6A 2DEPA 4QX4A 3TLQA 1QU4A 1BWVA 1AW5A 5CC3A 3R79A 2LLEA 1S1PA 2VZUA 1P0NA 4UTFA 1QI4A 2QF7A 3BC9A 5AHEA 4GD0A 4C6IA 5AY7A 3T4WA 1XLIA 1V3JA 2JIWA 4WDTA 3G1SA 2NZLA 4A35A 1OT2A 5DT5A 1XBVA 4ERIA 3CYVA 3ZVHA 4QM1A 3VMPA 1XLEA 2BY1A 4K39A 2WPBA 2ZXBA 1S2VA 3WQVA 3TK7A 2GSJA 1WUFA 3M5VA 2PAJA 3TMLA 2FFCA 1XRVA 4TU1A 3WDRA 4H9ZA 3WK2A 4R9OA 2QDDA 5KZMA 1ME9A 5FJRA 1F3XA 4LSBA 1VFFA 1HJSA 4PC8A 5I06A 5DF0A 3NQ7A 1PXGA 3ITLA 5D8WA 2QV4A 4PRWA 6A3HA 3MBDA 1SW3A 3LTSA 1SFLA 4JL2A 1ML1A 3ZVIA 3RPMA 3PWGA 1FXQA 1UC5A 1KM1A 2QDHA 4L6HA 3BAJA 1ESWA 3LLXA 1J0IA 2UV8G 3NZQA 4A3YA 2QYGA 3TV8A 1P0DA 1DWIM 2UY2A 4LUTB 2INZA 4R88A 3MUXA 3EEGA 2VFHA 4H4IA 4IL0A 2ZUWA 4C1LA 3BW3A 3UR7A 4G6CA 2G3FA 3TNBA 4IUOA 5AYXA 1OQFA 3W2UA 3BAKA 3E0LA 4IIBA 2G3JA 1IR1A 3BLFA 3C5QA 4EAMA 4AD0A 1ICQA 2GUBA 3LCIA 1M01A 1VGAA 3VNKA 3PJXA 1GYMA 1DJHA 4RZ6A 3BJFA 4ZOEA 3A3XA 1XLKA 4QJ5B 1BVWA 1OF8A 1TA3A 4UMBA 3WDIA 3ERPA 3E6EA 4UNIA 4Q4SA 1DTNA 3KVMA 1KM4A 1Q2RA 4C60A 1IT0A 4IMFA 3VDAA 5BZAA 2X1RA 3MKVA 5IM51 5HMSA 1SU5A 4IQEA 3MUAA 2DT3A 3OP2A 4C6PA 4D6FA 2HJPA 2QW5A 4AXKA 1HX0A 1S2UA 2YDSA 1OWQA 2HS6A 2A3LA 3F2CA 1J6OA 1B9BA 1HZYA 1Y5XA 2XN1A 3PG9A 1UOZA 3PZ9A 4QIUA 3NQ8A 4I3GA 3IAPA 1KXVA 3AQUA 5L9FA 1MNSA 4XTIA 1B3YA 1ADOA 1V3KA 2V2CA 3HGRA 3S42A 4HN4A 3CTLA 4LUTA 4H6QA 1FFRA 7TIMA 4DJFD 2BXYA 3RR4A 1F74A 1UC4A 1EDQA 1WE5A 4KBXA 4AMCA 1LT7A 3N13A 1D7KA 1UR9A 4TO8A 1HL2A 1R86A 2ON3A 1EZ2A 3R43A 3QPYA 5C2XA 3AHVA 2XFRA 3L4ZA 2NV1A 3TYCA 4DBUA 4HA3A 4LF1A 1WDPA 4IFKA 1FH9A 1PDYA 3BMXA 3E2VA 1TMLA 4AISA 4JTSA 1GOQA 1TIWA 5E6ZA 3STCA 3KOYA 4JTLA 1RK5A 3NDOA 1BLIA 4IP4A 3W38A 3RPTA 2C8NA 4OGZA 3W1UA 2HCVA 2ZYFA 4GUIA 4ICCX 1TPEA 2ZZ1A 3URNA 5C0QA 4ADSA 2I9EA 3QTGA 3LGEA 2YX0A 1TTPA 1GZGA 3ZVHB 2BZNA 3D5HA 4QEHA 3E2RA 3V0UA 3KWXA 2PTDA 2CZDA 4PL2A 3WUFA 4EXAA 3LMYA 1TJ2A 4IFKB 2GDQA 1IT8A 4ZO7A 2VNCA 1IIHA 1TV2A 3W6YA 1CGYA 3N6JA 4IM4A 4JOMA 3S47A 3WBYA 4V2XA 2F61A 1FA2A 3VILA 4C7FA 4W84A 4R33A 1EXPA 9XIAA 3AZSA 3A4JA 5M3WA 3NPWA 4NJGA 3RMJA 1XLJA 1KKRA 1JVNA 2RGMA 2XH0A 1YQ2A 3WD0A 4NI3A 1KRAC 2NQHA 1MXGA 4GZEA 2HV5A 2NXHA 3GZAA 5BOEA 1GVEA 1BRLA 4S3GA 3VTRA 1W1VA 5HA7A 4CN6A 2DPEA 3WLSA 1ZRQA 2BVDA 3IWPA 4DWSA 1JEZA 3F4WA 3GU2A 1HJUA 2PC8A 4PH6A 2E6DA 3SURA 1NWTA 1W9XA 1ZPTA 2QPSA 1XSIA 1Z69A 4ZSUA 3I68A 1L6YA 3K4WA 1GG1A 3ZYZA 1N2VA 1I75A 1VJIA 4NIRA 4AZHA 3D6NA 3MSGA 4KMQA 4DNHA 9XIMA 4UZUA 4US5A 3PP7A 2VFIA 1XL9A 3WMCA 1WQ5A 3E2SA 3TLLA 4ZCWA 3VKJA 4AH7A 3WD4A 1I60A 2Y7EA 2GUYA 4D8AA 4N4PA 2Z24A 3CH0A 2V5LA 3T4CA 3UPWA 3UFYA 1PZ3A 1KTCA 3UP8A 2XZ7A 4ZO6A 3RU6A 3LRLA 2BB0A 3OA5A 2NVDA 2I14A 3U48A 2FGLA 1FOBA 1OC7A 2VUYA 1CIUA 2WCAA 3O0KA 2NQ5A 4Q7BA 4Q8WA 1EDTA 3P3BA 3N9SA 4KT2A 1FRBA 5AC8A 3E38A 1LOSA 3LUTA 2G50A 2B4GA 2GDUA 4R7WA 1TCMA 5A3HA 4HA4A 1W3KA 2YDAA 3M0YA 4IL2A 3DG6A 7TAAA 4YCOA 4N0RA 4HGXA 4H7VA 2PDCA 1SR9A 3EZ4A 4HPXA 3CPGA 4ECLA 3MSRA 1GOKA 1C9DA 3WQOA 2YCLA 4IQLA 3UWEA 4ML9A 1UA3A 3S9YA 1NEYA 4JTKA 3P82A 2BS9A 4MDOA 1K6WA 2PDBA 3ELFA 2ZZ5A 4JKLA 4AWSA 1K7FA 5J8LA 4HHMA 2VQUA 3G3MA 2AL2B 1G9HA 5F2MA 4EXBA 2J8TA 4GNKB 1V79A 1N8FA 4WGHA 1SYTA 1TX0A 4XTDA 1B3WA 4MWAE 3UY8A 1JIBA 1PPIA 1S39A 1O68A 1UWTA 4L4OA 1AD1A 3C2RA 3L4UA 1CLKA 3SN1A 4AD1A 4LBRA 4P8VA 1U30A 2OLHA 4AAJA 3RCMA 4AZ6A 3PFRA 3MUZ1 4RNIA 1PX4A 1HFBA 3EDFA 5M5DA 1DJGA 2VX4A 3BQ6A 1YPXA 3HZ3A 1WXZA 1TV7A 4WHBA 5BOOA 1GVRA 4D6HA 3G6MA 1N8WA 2FYMA 3QZ6A 2EPHA 1RQEA 3R6IA 2BOEX 3U3HA 3WQ5A 1RY8A 4KWUA 4ZB5A 1P6CA 1BXNA 3UZJA 1RLDA 2E8ZA 2FGBA 3REQA 2G5WA 1EPXA 5JVLA 1VC4A 1XG3A 4Z1YA 5DMNA 2PDXA 1QCWA 3IUDA 1QHZA 5IOBA 3MI2A 4JS3A 1VZWA 3T8LA 1W8SA 3MVIA 4UCFA 4W8LA 2J7EA 1ZJHA 3FEMA 1ZY9A 1P1XA 1N7KA 3ZIZA 1QNPA 3WEZA 1OIMA 3OZYA 1SJAA 3FNDA 1EJTC 4B3KA 2BBFA 3TSDA 3LYEA 1NY1A 2BY0A 3HV8A 1D3CA 1GOWA 3F4VA 4R9XA 2DH2A 3CO4A 1ZLPA 3W7CA 2PSNA 3N17A 3VK5A 3QQWA 2Q6ZA 4MZ8A 3RNDA 4DJED 1EBHA 3P60A 1T40A 4O13A 1O95A 4Z42C 1P0KA 1EH9A 1AQHA 1JRBA 1Q6OA 3HM7A 5HNNA 1KXHA 4MAVA 3QVQA 3SADA 2JF6A 1DVJA 4ONVA 1JR1A 3GXMA 4HPGA 5KTLA 3U5UA 4UTIA 4AXNA 4JAWA 1G7VA 4DZ5A 4FLSA 5BROA 2I17A 3GH7A 4JZ5A 1ZALA 1TRIA 4AVOA 2AQVA 2VCCA 1HKMA 2ACRA 2Y85A 1GKRA 4NZ4A 4NJKA 3ZR6A 3MCNA 5CGMA 3Q37A 5AYBA 4PTDA 2DZXA 2VELA 4C6MA 1KGWA 3R0UA 4W5UA 4AZIA 3GXFA 3U57A 1QK0A 3SY8A 1M53A 4GPNA 4OOUA 3T08A 1KD0A 1JCTA 4RR4A 5BXSA 1OFBA 4NY2A 1BTMA 1BQGA 3A5VA 3QMSA 5ABGA 1KM3A 3ZLFA 3NZGA 1AK5A 1KM5A 2IKJA 5EMUA 3IIZA 4CNUA 2PRMA 1WV2A 4GKLA 3UPBA 4WCJA 2NQ9A 4KFNA 1R8LA 1V8EA 4CD4A 1GEQA 2VC6A 3INPA 1BVZA 1NF7A 2CITA 3C0QA 1FWHC 4H41A 1OSEA 1XLHA 3M1ZA 4LVDA 3HG5A 2J7DA 2J7BA 3TAOA 4OECA 4U33A 2C0AA 1MQPA 1CENA 1IGSA 4F4RA 3GRIA 4DAIA 5CPNA 1OX4B 2DQXA 4ZQOA 3GDTA 5T9CE 4GGHA 1F73A 3IIPA 4AY7A 3DCPA 3SEPA 2OLSA 2PDYA 2TMDA 3ZT5A 5JUVA 1ADSA 4MY8A 4JTEA 5FSDC 1HF6A 4DYKA 3LCLA 2G37A 1QNVA 5LIYX 4KRUA 2KZHA 3LZ3A 5A6BD 1PB0A 4BF7A 1AA1B 2WYSA 2NT1A 5A6BA 2Z1BA 3MY9A 4FXSA 2GUUA 1T8XA 3TE9A 4I6VA 4WZHA 2CU0A 1P6BA 3QKEA 2DW7A 4NZ1A 4U4MA 1OK4A 2F38A 1D8CA 3O05A 4MFEA 4IJBA 5I77A 2EG7A 3LHVA 4O1EA 1BXCA 1XBXA