3LQZA

Crystal structure of hla-dp2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HLA-DP2 and implications for chronic beryllium disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
total genus 31
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqzA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3lqzA01
3M17B 2JJTC 4NM4H 3VD3A 2KDGA 5DRXB 3VXSE 2X1WL 4QYOB 4QGTA 5T3XH 1S9VB 3WE6A 2YC1B 3OKOA 1YMHA 4WU5A 4GJTB 4DKFL 3O45A 2ZUYA 5JPMA 3I6LE 2O93L 5C9JA 1S9WA 3EO1B 3P9MB 2WK2A 4WWKD 4Y4FD 4X9GA 3EYUL 2BNQD 4BSWA 4MA7H 5JXEC 3NIGE 3I3EA 3F7RA 2R0KH 1SBSH 3PP3K 1G7QA 1I9RL 1YEIH 1S7RA 3UJIH 1A6WL 3MLZL 2BX5A 4G9DA 4NQUA 4P9HL 5F88B 3NMEA 2R23B 4RGOH 4Y2OA 1T5XB 2Q8BH 1RD6A 2NXYC 3X3GL 4ZSOE 5HGDA 3OWEA 1F2XK 3QO0B 4P9MH 1FFNB 1U91A 1OTSD 3P4MA 2EDEA 3KPLB 3N9GH 4YHKL 2O5YH 2AV1A 3ZT7A 1RU9H 1PYWA 1QD0A 4O2CB 3KXFD 2EKJA 3MV8E 4L4TB 4Z18A 1DBBH 3H3KA 4JO2L 3SQOL 4E5XA 1HHKA 2DQFB 1SEQH 3MXVH 4L9LC 4PJFB 4YWGL 5T3ZD 4NPYA 1G9EA 4LPUA 3KWWB 1CCZA 5IJVA 1EDQA 2VN7A 5C0DB 1MJ8H 1DLFH 3TN0D 4QRPD 2E7LA 4Q6IB 1G9MC 2HT3C 2DM3A 2NY0D 4KVCL 1BD2A 1T03H 1JHKH 2PN5A 4S10A 4JAMB 2I9TB 3AGVA 3K4AA 2XA3A 1U58B 3KS0J 1IAKB 1U6AH 2HG5B 2WW8A 2DQEH 3S35X 4RAVB 3U9UA 4N8CH 1OL0A 2E5EA 3HMWL 2F5AL 1VFBA 4Y19D 1MH5A 2A9MH 4R4FL 5F7YC 3BHBA 4NWTL 3L1OL 5GRUL 5GGQH 3U9PL 5CIPH 5I74B 4ELMB 4DTGH 2HTLC 4PRIE 3F7QA 4G6ML 2ESVA 4AH2A 3QI9C 5HBBA 1S5HA 3MRPB 4GBXC 2E7HA 1FSKB 3REVA 4OCLC 7FABH 4KQ3H 1IM3A 3M1BA 3V6ZA 1RUKH 1I8LC 5TE4L 4H0IA 3RNQB 3LS4H 3X13B 1LO3L 1IC7L 4N8PA 4PBVC 4XB7A 4RCAA 5J1AA 1E0OB 1NL0L 5LJYH 3W0WE 4P4RB 4JB9H 1T1WB 5ALCL 5GS0C 2W65B 1HKFA 1QBAA 5CD5D 4JRWA 2CIKA 4JREB 4HUUB 5EU6A 2IAMA 4TOYL 2R29L 2OR9H 2J88H 4MNGB 3V7MA 2FH6A 2PW1B 5IHBA 4MXVF 3QUYD 2UWEB 4MA3B 4WFHD 3J7HA 5EO0A 3L3IB 3H9ZA 3B2UC 3L3HA 4FQLH 5CJ5A 2HT2C 2Q86B 1CLCA 5EO9B 3B9AA 3BKCH 3R0NA 4U31A 3HFMH 5DUPH 2AABL 4X7SH 1K85A 5T1KB 2V2WA 3ULUC 3DYPA 2VXVH 5B4MC 5DK3A 3UZEA 5JHDB 2Q8AL 1MFCH 2PYFA 1B6DA 3IXAB 4PJBE 2YPLD 4M62H 5J12B 4UDTB 1IC4L 1QFUL 2Y7QB 5DI8B 4WFFD 3HHRB 3KG5A 4PV8A 4QY8A 1VDGA 3BEVB 3LCYA 3WXVH 2A83A 4PRNB 1INDL 3UBXG 5B21A 5K9JH 3AM8C 4RFEB 4P2OD 3R1GL 5JHLH 5BV7H 1MJ7H 3RFZC 2PETA 4QXGH 3X17A 1VPOL 3VG9B 1DBJH 3WBDA 2ICEA 5HTSA 2WQRA 4LCWA 3SKMA 4RQQA 4HLZG 5D96B 3DX8A 3QDHA 2AXGA 2NTSP 2NZ9C 5IGXL 2BSED 4Y2DB 4LLMA 1Q94B 4Q97A 3K74B 1UCBL 3QXDA 5IHUH 5EUOA 5LWYL 5FO8B 1WCBA 3ZMRA 2G2RB 2X4SB 3WHE0 5KG9B 1G0XA 1VGEH 2PCPA 2XZAH 3D0LB 1BIIB 3V8CA 5SWSB 4Q0XL 2F19L 1A6UH 3KPRA 4WW2A 4GKSA 4Y88A 3GSXB 1JE6A 5J06A 2VDOL 3AMLA 3G08B 4EI5B 3OGCA 3W0WD 5C09D 1NBYB 3PWPA 1KTDA 5DR5H 2E27H 2DQDL 3WN5B 1A7BA 1OAXL 3C2AH 3H9SA 2E7BA 3B9KC 2H45A 1MCDA 2A77H 3QUZB 4XNXL 3S96A 4NKIH 3VW3L 2IPKA 1T3FA 1D5BB 2VWEC 2BNRD 5BZWA 4NSKB 3KHQA 1XR9B 5J11B 5EWIL 4XCNB 3WL9B 2A6IB 3JWDL 1CLYL 4Z7OF 3EO0B 5HVGB 1R3KA 4M6OH 1OPGH 2J88L 4KKBD 4YNYA 1BQHA 1JPTH 8FABB 1NFDF 4HH9B 2OXGA 3FQXA 4P2QA 4RAUA 5GISH 3MV8D 3RIFF 2FHFA 4FS0A 3SDXF 3UCRA 5ALCH 1TTUA 5DWUH 4JRYB 4JLRA 1DQLL 3WLBB 4EDXA 1MHPH 2VIRA 2A9NH 4U1IA 2LE9A 4H25B 4RZCA 3N50A 3ARGC 1ZV5A 4MQ7A 4HPYL 2ZCHH 4JVUA 1L6ZA 5E5MA 2WNGA 3O0RH 4P46B 4LPVA 1ZT7B 1A7PH 2P7TA 3QXUA 2P4AB 4ZUSA 1AGFB 4KY1L 4PRHA 4M7ZC 3FKUS 1UM5L 5C0GB 4WWKA 4NQCA 4JPWH 4MQXC 5TDNB 3F6LA 3IU3B 4EIGB 3MMEB 2C7UB 3U9PH 2P5WE 1AR1D 1BQLH 4YGAB 5A2IH 1F90L 4M93B 5BQ7A 1IFHL 2CUIA 1CVRA 1N6QL 5KVFL 1Y6MR 4HBQA 2GJZB 3O3BA 1UB6B 3QI9A 2DJ4A 5CFHA 1A4KB 3QUMA 5HVHC 5MEOB 1T7ZA 2UY7A 4RRPG 4PV9A 4ZO6A 1CLOL 4LHUG 2I9LA 4KKNA 1A3LH 1NGPH 5DHVB 4ODHL 1KXTB 1T4KA 4H20H 3QIBA 1I1AB 3HAEA 3KYMB 3MLZH 3SDDA 1YMME 1WZKA 1MCOL 3F65A 3NOIA 4CN6A 1F6AA 1O0VA 3BUYA 5FYKD 2XKNB 4H1LB 3MJ7A 2NTFA 1OAZL 1KBGH 4CMHB 1K8DA 3HE6C 4HWNA 5LBSL 5C08A 1JWUA 4RMUA 3JV6B 1J1PH 5DD1H 5J1TC 3SDCB 3T77B 3U82B 1C16B 2AJZA 1FN4B 4AT6B 4PLJD 4XT1C 5H8DA 4P5TC 5LGHL 4P9ML 4YC2C 1P9MA 4LVEA 2GY5A 1NCWL 4OJFL 4NC1C 1JRHH 3T2PA 1OSPL 1E27A 3WDJA 2VAJA 4RX4D 4TTGA 2DYPD 3MJ9L 3ZO0A 5IT2L 1RUPL 5EFIB 3UJIL 2YPLE 3D25A 3WIHA 2AJYH 1Q0YH 2AXFB 1CR9L 2N7BA 4JRXE 1NLBH 5TGBB 1HXMB 5CEYB 1CE1L 3MBXL 4X83A 5E95B 1G7IA 1Z9LA 3MLYH 3GHEL 2WWKT 3RTQA 4BSVB 1BQUA 5HHQB 3FTGA 1TZIB 2X4QA 4WFFE 3QNYB 4IRJA 5EC2A 1QOKA 4EN3D 5J6HB 3VWKC 3AU1B 5DTFA 1A1MA 4NM4L 2HJFB 3B9EA 4N8VG 2DM4A 1KXQE 5FOBA 1KN2H 2E9JA 2XWTA 3EAKA 5A3IC 4XBEL 4MGXA 2XZCL 4Z78B 2W9DL 1MRCL 1RJYA 4PG2A 3U0PA 5SWQA 3TO4B 4X6BB 1NEZA 3BE1L 4PJHF 4M5ZL 4I77H 3QO1A 1R5IB 5F3HB 2ATKA 3GSVA 4X6DF 3HMXH 1ZVSB 3CXHK 1N59B 1J0JA 1RUAH 2X9XA 1INEH 4PRPE 4MNQD 4HWZA 4XPTH 4JFQB 1N5AB 1Y6NR 5IB1A 4HIIB 4WNQA 3CZFA 1KLGB 3BQUA 1TVBB 2G75B 1A4JB 4YPGB 5E9DB 4UQ2B 3WUWA 1EV2E 4LOUC 4NQED 1TLKA 5CBEA 3V4UH 1OCWH 1P84J 5C7XL 2UUDK 3HUJA 1U8MA 3JWOH 5D7IA 3HRZA 3PP4H 4HJGB 1BJ1J 1GC1H 1YN7B 4GQ9L 4DQOL 5HYJA 4HS3A 4HKBB 5E6IA 5L2JA 3BP6B 4JPKL 4ZTPL 4PJXE 2JIXD 2EO1A 4KHTL 4JFOB 3E2HB 4P2OA 4UV7H 1MWAB 2XN9D 4GAGH 4U1NB 3WD5L 1LK3H 4LRIA 1CR9H 1RJCA 2AJVH 3ME0A 5JO5A 5KVDH 2AEQH 1U8QB 4X6EB 3LKQB 3QUXB 3G6JE 1MHEB 3V4VH 1ZGLM 3DUUB 4M6MH 4CVXA 2BSRB 4C56A 2H32A 2W9LA 3UTSE 2O5XL 4DQOH 2IH3A 4PRIB 3RTQC 2JCCE 1BFVL 2WWMD 5J3HD 1FGVH 2G5BA 4DCQA 2DMCA 1JTTA 1U2HA 3EDFA 3ARXA 3K1DA 2EDKA 4ZUUA 4WI9A 3OXRB 3H42H 5DJXB 1BIHA 2E9IA 3LKOA 4FFZL 4OB5H 4OLUH 1KEGH 5LXGL 5DD3L 4X7TA 1CXFA 1FYTB 2RJMA 4FN0A 3I2CL 4PRDB 5I8CA 5D2LE 4LLUA 3L3GA 2YA0A 5JLZB 4EDWH 1A3LL 1MRFH 1NGPL 4NCC1 1T21B 3P4OB 3L3DB 1AR1C 1ZGLB 2IALB 4UTAH 4CW1B 3QG6B 3CFKB 2H2PD 4X9HA 3VFMB 4QHNB 1J8HB 4JM2B 2YN3A 5FUCE 3JBG7 4M43H 1A2YA 4XC3H 5BXFB 5AYQA 4PJHE 4XPFL 3EFDH 3L3KB 3QIWD 2J8UB 5DQDH 5D71H 3T1FA 4ZD3H 4YGVB 4ZMAT 1MRDH 5E8OA 2FJHB 1LDPL 3QXAB 1FE8H 1JCKA 3GSOB 1WBYA 3C8HA 1KIRA 3U7YH 4YHYB 5I73C 4X4YB 4BA8A 5IV2B 1G6RA 2XRAL 1PG7L 3MR9B 4LSSH 1EGJL 2YUVA 5D6CB 1BBJB 3RI5F 3ARGB 2I24N 5ACLA 1A7PL 3J8F7 3D5OF 1Q0YL 2DL9A 3IJYB 3TBYA 3F62A 4ZPVB 2NXYD 4L29A 4UNVA 2IPTH 1CDBA 4W4OA 4WU7B 1ZSDA 4PP2A 3FRPG 4WW2C 2BJMH 2E9BA 4MJIA 5KSBA 3CUPA 1HI6A 3PGFL 3SJVB 4WV1B 4HPOH 4JPIA 2VLJA 3PQYA 3PDOA 1UJ3B 2H9GA 2PTTA 3GUTB 1X7QB 1P9MC 4LLQA 5I1AA 1OW0A 1HH6B 3IDIA 2A0LC 5LGHH 5EZJB 1MFAL 3VJ6A 3VXME 1MF2L 1AXSA 4HH8A 1CDIA 3B2VH 4PJAA 2PXYB 1FZOB 2EXWC 4P5KA 3FT3B 1CFNB 1QUNA 1I8KA 5DD0L 1H8NA 1NEZG 2I25N 1QLRA 4PJXB 4F3FA 3ZE1E 3MRLB 1MCOH 2A77L 2BVUA 3EFFA 5HD8C 1BM3H 4LEOA 1F00I 2Z93A 2DKSA 2VUYA 2V6HA 2QSCL 3NIFE 2Y1VA 4MCYB 1GCFA 3V5HA 4PRPD 1Q1JH 2NX5B 3EZ8A 3Q3GA 4PJFF 3EYFB 5IBUG 4X80H 4BFEA 1KYOK 4GXVH 4DAGH 1VGEL 3PWUA 1JTPA 3QWRA 1V3MA 1FVEA 2NNAB 5TQ2L 5KVFH 2QQLL 4OCSL 4Y16A 5T1MB 1UCBH 2VQ1B 3FMGH 4PJDB 1CZ8L 3HUJE 3VRLE 3FQUA 4KUCD 4ZFFA 2EDDA 1N3NA 4ONHB 3HE6B 4G6FB 3DI2B 4KQ4H 2Z31B 4DKEL 4JHAL 4S2SA 3FB6A 2C4FU 1S7TA 2Y07L 3F7YA 5FECA 1T7VA 3BKJH 3PIQB 5GS1C 5LGKA 1KTLB 4OIBA 1KCLA 4TULL 1AR2A 3TA3D 1XCTA 5I1HL 4EN3A 1JRHI 1JVKA 3UTTA 4NUJB 4X6FA 4LQ1A 4EOWL 5SX5H 5HGHB 4PTUB 5GGSA 1OP9A 1ZLUK 1RIUH 4K2UL 4ZUWA 2HRLA 4NN5B 2UZYB 4MAYB 5JIKA 3TO2A 2VDKH 3K1KC 3HC4L 3F58H 4U1KB 4QHMB 3JWDH 4ORGA 1DQJB 3TIEB 5DSCB 3OAUH 1Y6KR 4RDQG 3GSNH 5FYLH 5JW3H 4OZIE 3SDAB 1EBPA 4HG4K 1KCVL 43C9A 2NY4D 3DGCR 4PGEA 4N0YH 2VLRA 1B3JA 1BQHG 3MCKB 1PD6A 1J1OL 2E3VA 4FHBD 4Z7WA 2A6JB 3S34H 1TDQA 3BKYH 3MLRH 5HPMB 2V5SA 5ACZB 2WWMC 4I18A 5E70A 4LHJB 1BEYH 5DVOA 4S1SL 2FATL 4GRLD 4NQEA 3TFKC 4PR5A 4ZAKC 4I0PD 5D5MA 5D1QB 1NKOA 3MGTA 1HHJA 3QISA 2ITDB 3ARUA 4UNUA 3TYFA 1VSCA 2ZNXA 2BNQE 4YDLC 1S9XA 1WBZB 1RJZB 4FTVA 4X6DE 3LSOA 3BKJL 4LLVA 1F02I 3Q2CA 3GDBA 3NN8A 4X0KB 3GO1L 1DBJL 5JIPA 4HWBA 1B90A 5F96H 4HZLB 2BNQA 3MRQA 4PP1D 4YHOL 4KQ4L 2BOBA 2H32H 1IM9B 3FOLA 5D1XC 1FZKB 3RZCC 3SDCC 3DPBA 3B8YA 4WI5A 3L1OH 2GUOB 1INQA 4NKOB 5GRUH 4CADA 1DDHA 3TESA 3QIUB 3TBSB 1DQDL 3NAAL 4KKAC 1LGVA 1N64H 1U8LB 3PP3H 4OKDA 4J4PC 4M7LT 3VCLB 3NFPB 2FCBA 4AJ0A 1MCKA 2VLLB 1GH7A 2IANA 4G43B 4HX1A 2EDOA 3GI9H 3AXLA 3VFRA 2NW3A 3GMLA 3ARBD 5EBWA 1KFAL 3GSNB 1WTGT 4WHCA 3BAEH 3VXNA 3DUSA 1IGYB 1ZOXA 1I8MB 2EIBA 1XH3B 2MHAA 3RX5A 2BRQA 5DMKB 2XPGA 5EZOH 4OCYH 1PAMA 3UC0L 4N0UA 2V9RA 1IEBA 2QHRH 4JEGB 4APQD 2E9WA 1OTUC 4HK3N 3OJ2C 2EECA 4UINL 1C5BL 5IB3B 3FZUD 1S5IH 3UTSD 2F53B 4JFFB 4PJ7F 3O41A 4XXCA 4ALAL 3O3DB 3DVGB 3TN0A 5DJ6B 4Y7MA 5C0AD 3T4YB 4S1RL 2OR9L 3VGBA 4OCMC 5CZXD 4GKZB 4HF5L 1Z5LA 2HP4A 5ID0A 5GS2H 1U8IA 4ZFOL 3NFNB 4FQXD 3TBVB 2XXMB 4X6CB 5DRWB 3GM8A 4RBPK 5KTEH 1IC7H 1I9RH 2C3VB 3L3OB 5ICYA 1S9VA 1YY9D 3EYUH 3U1SL 2P5WB 4JKLA 4WTWA 3S4SB 5F7KC 5C0CB 3WJJC 1QSFB 5KOVC 4PJBF 1B4RA 2BHZA 3GMQA 4HIEA 3C60B 5DZNA 5F7WC 3RDTD 3D9AH 5DD6A 1DVFA 4XVSL 1G7QB 1WGOA 5IEKB 5JW4R 1YC8A 4MB4A 4XC3L 4GS7B 3AB0C 4LRNH 4JFEE 2F5BL 5E2VH 2Q6WA 2DQEL 3GMPB 2ITCB 4LSUH 3ECBA 3FN9A 4UQ3B 4QHKJ 2IAMD 4JM2F 3ZZ1A 1GJIA 4BUHA 4Z7VA 4MAYC 1FFNA 1ADQL 4LLDA 4NZTH 1K5NB 4K3DL 1SVZA 1BX2B 2AV1B 4YZFE 1JWSA 1EERB 1HQRA 4WI3A 1A7RL 4S11A 1R3JB 4UILL 5C0NC 1HHKB 2DQFA 5ERWA 1AE6L 4CDGC 4PJFA 4JO2H 2O61B 3MBEC 1TJGH 2WINB 1WT5A 3LOWA 4P5MB 4DFIA 4NQDE 3VFGL 1NC4B 4L9LA 4H5SB 1B2WL 1RZGB 1NFDE 5ENWA 5I2IB 1XF2B 4AQ1B 4GW5B 4PJFE 2DICA 1AI1H 5MHSD 1RZKC 5DZOA 4HUVB 4F33A 3CVIL 2MQ3A 4R0LA 1KV3A 1B0WA 3VWJD 3MRGA 3MRJA 2IMMA 3DVFA 3I3BA 1I1RA 3MLPA 3BSZL 3V6FB 1I7RB 2P1YA 1UZ8A 2O5XH 3VFSB 1G0DA 4RAVA 5F71A 5C0FA 1YPZE 3HE7C 1RJLB 1A6WH 3L6FA 1YEIL 1JYVA 4YDIH 4YQXL 4HKZA 5T3ZE 2XWBA 4NZDA 4G5ZL 4C83B 3MRNA 1CFBA 1WK0A 1VFAA 3LPGA 4OGXH 2ADIA 3O3UN 1DQML 1R0AH 4LDOB 1T1XA 4U3HA 5FYJE 1FVCA 2ESVB 3MLXH 3NIFF 2VAAB 3MRPA 5C8JB 4ODVL 1FPTL 2RCSH 3CSBA 3GRWL 1IM3B 4E42B 3JWOL 2PTUA 2R1WA 3BPNB 1VEPA 4YX2H 4E41D 3GHBH 4CU7A 3TFKD 2PF6A 1A9EA 4PJBB 4ZAKD 2CD0A 2OL3H 3HI1A 4GG6F 2HTKD 4OZFA 1X3DA 5GIRA 1N0LA 2R8SH 4GAJH 1Z6JT 1D6EA 2OTUA 3GKWL 3K0WA 3QCTH 4F7EB 3MNZB 5T1DL 3RVTC 2BY1A 2R56H 4CN1A 4JFXA 3C6LC 3H9SD 3EGSB 3ALXA 5F9JB 5A40E 1AQDB 1VKXB 1QQDA 5I8EB 2ZUQC 2PW1A 1E4KC 4JY5L 1JYNA 4U6HA 4MA3A 1MVUA 2VTFA 2UYLB 2XIDA 3WYRA 4LOUD 5C0CE 4GBXA 1HZHL 3C5ZD 4NFCA 4Y5XB 3GIVB 4PJGF 4MXVE 2DWDA 4I2XE 3GMMB 3G6DH 1T04B 3JTSB 3QWQB 4YBHA 3QZWA 5ANMB 4AEHH 3S97C 4PRBB 3THMH 2XNAA 3TNNB 2LABA 3H7BA 1XIWA 3T3PF 1U3HC 5I0DA 3TZVC 4N0RA 1FIGL 4G6KL 2P42B 1ZAGA 3DXAD 3MLYL 5E94B 1XGTA 1HNFA 4XVUC 1OTUD 2A83B 4UT7H 4IOFD 2VZ3A 2NY3D 4RFEA 4R97C 5DUML 1L4IA 3F7VB 5DMJB 1PVHA 1IZKA 4K7PH 3U6RA 2QADC 5F3BB 2PR4L 5IT2H 3PE9A 5C6TH 4G8EB 2X2YA 4LVNB 2CKBA 1IAOB 5FM5M 5L6YH 2IMNA 1NCWH 3MACL 5J7CC 3EZJB 4LHUA 3RX7A 1G7LB 1HH9B 1ZVHA 1CF8H 1OB1A 3MV9D 2PCPB 3VFVB 2ZSWA 3DMMC 2DQJL 3GB7B 3KYNA 3G08A 4M48L 4EI5A 4X5WB 5GGVH 1I1FB 4KKLC 2FGZA 2QKIA 3U0TB 1JF6A 3QEHB 4OZHB 1EZVX 1O7VA 3GMOA 1BFOA 3HA0A 5DZLA 4R26L 1L0QA 1ZHKB 2YSSB 3G5YB 4NFBA 4MNQE 3BESR 3GSRA 4ODHH 5ITBH 1IRAY 4JN2B 1N8ZB 5A16B 5I8KH 5MERA 4GAFB 1T6WA 3WL9A 4YX2L 5E6IC 2J8UE 3DHJA 3QDJD 4KTDH 1ZA6B 4AEIL 3HE7A 3QULA 4YNYB 3T09A 4HUWB 4LCWE 4FQXA 1F4YH 3C9NA 4UZGA 1NCDH 1RULH 3L7EA 3QDMB 4LMQI 5I18H 5CEZL 4U1GB 2ATPB 2W1NA 2VDQL 1T0MA 2Y06H 4DKDC 4GG6E 5HGAA 5HDOA 1WZLA 4MS8D 1ZT4B 1FP5A 4HW6A 5FB8A 3QPQD 4NNXA 1XAUA 1XR8B 1YMMB 1G7JB 4YQXH 1KF9B 3Q5TA 1SVCP 3QCUH 2DM2A 3ROOB 3LQZA 2OSLB 3C8DA 4HIHA 3IDNA 5D93C 4NQCB 1T20A 5TDNA 4LCCA 5IW6B 4OQTA 4XCCH 2A1WH 1MCWM 1WFTA 4N5ED 2A9NL 3ZTNH 5B3JE 4IMKA 3I3DA 1FNGB 1EAPB 1TZGL 1FL3A 2NR6C 2A6DB 2X89A 3E1F1 2OTPA 3X11B 2V2XA 1MCLA 4MCZB 3RWHA 5JIIA 1S7QB 1UWXH 1JNHA 2GJZA 4HCRA 1CICB 4JFED 1ZS8A 3VFPA 1JNNH 4M6OL 5FK9B 1A4KA 3QUMB 2UUDH 5EU3A 2CRIA 4XHJC 4DGVH 3UYOD 1K3IA 2IQAB 1U8JB 5LCVH 5DQJA 4MDJA 4LAQL 2C1OA 5HJ3B 5FYKH 4NN6B 1QHOA 4M8VA 3KYMA 5F6HI 4Y8AA 1P4BL 1D5IH 5ABDE 3R8BB 2JELL 3C8KA 2MWCA 4PGDB 1I85A 3UO1H 3VI3F 4F58H 2EIZB 1UKSA 3D39D 1K8DB 1UB5A 2NZ9D 3Q1SL 5C08B 5DJCA 2ZKHL 4NQDD 2FX7H 4MD5B 3STZB 4DGIH 5D70H 3O9WB 4IMKC 1OGAE 2XQBL 1T83C 1ERNA 3K4ZA 1KJ2L 2HTKC 5DHYA 3MRHB 4P48A 4YHNB 3PABB 3VFTB 3EJYD 3QDAA 5CLWA 2XACC 2AJUH 2HVKA 2AK4A 4LGSB 2WBJA 4L8CB 4X9IA 3GNMH 5IK3B 3ZYZA 4ETYA 2ZJSH 4ODXB 1NJ9B 4CMMB 2VITB 4YO0B 1BVZA 5HHOB 2BMKA 3QH3B 1INDH 1T1YA 2X70A 5DJYA 2X7LA 3SGJA 3UX9B 5DUBA 2OI9C 1G7IB 1WZ1H 3AM8A 5DJ8A 5EG6C 5F1IB 3RGVD 3CNKA 1P7QA 4O00A 4O02L 1MFCL 4IMLA 5FO9A 3G5ZB 4JDZB 1DEDA 3KJ4B 3SE4C 1PKQB 4ZAKA 5EO1A 4UU9A 4RFOH 4OZIB 4HUNB 1C08A 5D2NC 5EOCL 4JFZH 4RRPA 1X4YA 2FWOB 5L0QB 2X40A 4QHUB 4U6XB 1RJYB 3RJQB 1T6VN 5I16A 3MLTA 4U1JB 5DJ2B 3QBTB 3WIIL 5JOPE 5F3HA 3U46A 1B6UA 4JN1L 1F4WL 1AIFA 3BFOA 4XNQA 4NO3A 4NC1E 3WFEL 5FGBA 4ZQKA 4KHXL 4LKXA 5I76A 4FZ8H 1ZLSH 5IB1B 4ODUB 3MUGB 5A3ID 4Q9RL 5AYUL 3C08L 3MV11 3CH8A 4NZUH 2D0GA 3PGCA 5I30L 2CRZA 2NY1D 1SJHB 3CCHA 3VE0B 1QSZA 3ULSB 2EE3A 3MA7A 5JW4N 2H3NA 1LO3H 2OP4L 3ESUF 4Q9CA 1I8LA 1U93B 4JGUA 1R24B 5HYJB 4LL9A 3EDJA 4F37K 2R2BB 5EZLB 3LD8B 4LF3B 3LH2H 4HV8A 4ZFOA 4Z77A 2DLFL 4PYGA 4MA8H 2CRYA 5FDWA 4JHWH 1RZIB 1A6VL 5D2LB 3UP1A 3V4PL 3VXRB 1YNTB 1RHHB 2VLKD 3WIFB 4D3CH 4LSPH 3STLA 1OY3B 4R4FH 1RFDH 5J11C 2X4OA 1MHEA 4YHLL 3DUUA 1QLFA 3QEQA 4XC1L 4C56B 4CNIB 4GSDL 4FG6C 4Z7QE 2IH3B 3EUUA 4N8VB 5E99H 1C8PA 2X4NB 5B38A 2CJUL 1Z2KA 4KJPD 3QEUA 4KZDL 5CEZD 3RUGF 3BH8A 5J89A 3G5VA 3CXHJ 1PX3A 1E28B 1U8NB 3I85A 2WBJC 3IYLW 2GI7A 5JW3L 2Z35B 2BNUB 1OOAA 4RMVA 1H3PL 2AEPH 2QHLA 4NRZB 4WUUA 5DK2A 5CCKL 1H3WM 1NDGB 2VDKL 5C0BB 1UQSB 2FLRT 5DEZA 1FYTA 3GIZL 3PF2A 3P73B 2HFTA 3ULVC 1J0YA 1CBVL 4OT1L 4K2UH 3DROA 1HEZA 2BFVH 4R8WH 1U95A 3T0VA 3FO1A 2DQUL 4HWEL 1MQKL 5HYEA 4YE4H 1F3JA 4GW4A 1TVHB 3QUKA 4B41A 5IF0A 3P4OA 4DEPB 1JTOA 4HWBL 1AGCA 2M1KA 4LVHB 4M61B 1RIVH 4PJDF 3UPRA 3Q6GH 2EDWA 3VFMA 5EN2A 1BMGA 1YEGL 2JB6A 3ZLQC 3QQ4B 3L9RA 2GIYA 4R4ND 2AJ3B 4JG1L 1PLGH 1A1NA 1TCRA 1U8OA 1Z9MA 3C09C 5T5FL 3IDJB 3AAZA 4OI8A 4ZXBA 1SBSL 1J1XH 3QRGH 5TF1H 5IVZA 1QBBA 5J12C 3UTPE 3KPNB 1J8HE 1EFXD 2A74A 5E8OB 2R2EA 1JHTB 4R7DB 4F37F 3OGOE 3DVNA 4F8TA 3LN5B 1J1XL 3PWVB 5D6CA 1I7TA 2X4PA 3FFCA 1JV5A 1QZ1A 2H6PB 3OR7A 3OJVC 1FL5A 2HLFD 4WO4D 4XWGH 4WU7A 4QXTA 1RZ8A 5J9PA 2VLKE 1FYTE 3SJVA 1OP3K 2VLJB 1MCPL 3EYSH 4ZNCD 2IG2L 1X7QA 4P57B 5E6YA 4OT1H 4R26H 4M7ZB 1HH6A 1BZ7A 3VXUB 1T2QL 5GS0D 3D1MC 2DDQL 4IRJC 4QYOA 3FQTB 3WFHA 2H41A 5ISZE 1S7XB 4PJAB 2N56A 2ED9A 3OKOB 3MNVA 3MGAA 1FZOA 4JCLA 2HRPL 4KJQD 4UB0H 1L7IH 2IFFL 4PG9B 1S9WB 35C8H 3DSFL 4PJAF 2K1MA 2DD8L 4BSWB 2NY3C 1LO2H 5JORB 1QRNE 5DEFB 3D39A 5LVEA 2UV3A 4JFDA 1JGVH 2ZUQB 3IU4L 4POUB 3Q3GB 3KLAA 4ONOA 4PJ8D 1LE9B 2V7NB 2GTZA 2LAAA 5FYLD 5I1GH 4OTXL 2VR5A 3QAZC 5E4EC 1ETZA 4D0DB 4V1DD 1U91B 5I66A 4XMLL 5K9KA 4TSBH 4PJDA 1I9EA 4FOMA 1PYWB 2DS4A 3DETD 4JHWL 2R39A 3VD4A 4RWHA 4L4TA 4QRTB 4YXKL 2ICCA 1KNOB 3PWPD 1CWVA 2HT3D 4N0UE 4BH7A 5IQ7H 3IKCA 2EH7H 4XPFH 4P2OC 3RY6A 5E00B 4M43L 2HT4D 4MJ6B 4EIZC 2QBWA 2AK4E 1O5DT 2GJJA 1HN1A 4LSVH 4DN4H 2FHCA 3SHSA 1T0NB 1BD2B 1JUFA 4LSTH 4HIJA 2Y36L 4D8PA 4X99B 2R15A 3PJSA 3PL6C 1VEOA 4LCUB 2I9TA 4Z9KB 4EN3B 3GSUA 4NDMA 1ACZA 1SJXA 1ZHNB 5I0ZA 4FFVD 5GGSB 4WI8A 3DIFB 2WM0A 1X44A 2YR3A 1MH5B 5DD3H 3ETBF 3U48A 4ORGB 1EA9C 3GJFA 1HNGA 1PZ5A 3KYOA 4OB5L 5FUZH 5F7MC 5BW7A 4G7VH 2LVEA 4KUZH 3SDAA 3P9LA 1XGRA 4AH2B 1JGDB 4TRPL 4TSAL 4PJ8C 4LPCA 3IDXH 2R1XA 3ARQA 4XNZC 1K4DA 1TENA 1U3HD 4YLQT 3ZTJH 1UWEL 5T3XD 5IG7A 2XTJB 1IC5L 1BBDH 3HNVH 4U1HA 3ARWA 1DQQB 1MCIA 3VFOB 3RWGA 1HDMA 1I75A 3ULVF 4LFHD 3HC3H 4PGCA 1WBXA 5DMYA 1H0DB 5ID1B 3PWJA 3O8XB 4I18C 3VRIB 4GT7A 4BQ6A 4L3EB 2VQUA 3DX7B 5FO7A 5I73B 1DP0A 5F70A 3SE8L 4JY6A 1S7SA 3DBXB 4OLVH 3ULUE 1FL6A 2HT4C 4M7LL 5C3LD 1WBZA 2A6KA 1RJZA 4FTVB 3VWKB 4PJ9D 3T08A 3VXSB 5I19L 4YHZH 2DB8A 1RVFL 5DJAA 1I1YA 1T22A 3IFNL 5EUOE 3EW3B 3BD4A 2BNQB 3MRQB 4E41E 1A7NH 4DZ8B 3GSWA 4Y1AB 3RDTA 1I3RA 5DJZB 1WF5A 3C2SA 1INQB 4NKOA 1DN0A 4DGIL 1UM4L 4J7RA 3V9FA 3HR5A 3U0WH 5T1KA 2FX7L 5ILTL 2XQYK 4G42A 5DJDB 2CLRA 4HLJA 1S9YB 3VCLA 3R06A 2GJ6D 1DUYB 3N85H 4X6CE 3D85D 1A5FL 3IXAA 4ZOCA 3IDUA 6FABL 5JQHC 2NW3B 5F44A 5DVKA 4IRSD 4XTRC 3CC5B 3RZWA 1CG9B 5E8DL 1IGYA 5E5UB 3MLVL 1IGIL 1XH3A 2DQCH 2MHAB 2PTVA 4R90H 1A02N 4XPBL 5LGJA 2B1AH 1IEBB 4WUUD 2XYCA 4PD4K 5E8DH 3WUWG 3W9EA 1WWBX 1OGAA 2CQVA 1X5AA 1IGCL 1UENA 3ILPA 2MKWA 2W9DH 3K8KA 2XG5A 1FYTD 4MZ2A 5DT1H 5EU5B 1WEJH 3LMJL 4QWWD 4LCWB 4LQFL 3SKMB 3SO3B 3VXOA 1KB9K 1WIUA 3O41B 4FMKA 2HMID 1GGCL 2M26A 4PTTA 3TN0B 4M1GH 5BS0A 3BPCA 1Q94A 3IFOB 4PY8I 1BF2A 2FLBT 4EUPG 1X5GA 3MYJA 3D9AL 5FV2A 3RGVC 3BDYH 5FO8A 1UZ6F 1KEML 1FJ1A 4GW1B 3ZTNL 5KG9A 1MOEA 3WKML 3EJZC 5GRJL 5SWSA 3LHPL 3KDMB 4XPGL 1YEDB 3U1SH 4MD0A 3P0VL 4YFEA 1TCMA 1NC2B 1KIQB 1KJMB 2EC9T 1H3TA 5IMKB 3TJHD 4JHZA 1QFHA 3TLRA 1YY8B 3FO9B 3QUZA 2B1HL 1UXSB 2J8OA 4P5TD 4PJGE 4LIQE 2FB4L 3G6JF 4HJ0C 4M1DH 3S4SA 3VXMA 1FQ9C 2HVJA 2PO6B 4P4KD 3MLSH 3E6HB 5FF6A 1R3KB 3M8OL 2F54E 2CKBL 5FM4A 4S1RH 1D5ZA 1LO5A 1J1PL 5DD1L 2XFXA 1XGPB 2RIKA 2FX9H 4KI5D 4YH6A 3SJVD 5C1MB 4R2GB 3SDYH 3IDXL 1CICC 4OV5B 3ECBB 1QEWB 1D5XB 3GK8L 2F58H 4D0CB 4GG6B 2YK1H 4H25A 1C1EL 1LP9B 4E9LA 2OL3B 3NABH 1F6FB 1L7TH 4W68A 1NGQH 3PHOA 4YHIA 5CMAB 1BX2A 3KPMA 5D1XA 3RZCA 2O5ZL 1HINL 1G7PB 1HQRB 2I5YH 2P7TB 3OPZL 4XP5H 5E6ID 5DO2C 3KNBB 5F7DA 2DLTA 3ELAT 4P4KC 4K3JH 4RGMB 6CGTA 4OZ4A 3NCJL 1P6AB 4RSVA 5TDPA 4QOKB 5HHPA 2VDML 2O61A 4D0BA 3PV6B 3EO9H 4P5MA 4Y4KD 3MODL 2MCPH 5C07D 2KH2B 1CGVA 4AL8L 4OLXH 3PNWB 3V5DA 3B9KB 5L6YL 5I6XB 1LEKB 5C6WH 3WNLA 3OJMB 2WLZA 3MUHL 3O6FC 2X4TB 1WISA 2D7MA 1NFDB 5GZOC 5MEOA 3WNPA 3RHWK 1I7RA 3MRBB 3VFSA 1NBVL 4FFWD 3WE6B 3HRPA 5JHDE 1YMHB 3FQRA 1OAKL 5INDB 2J2ZA 5JPMB 3GKZA 5JQ6L 1W72L 1Y0LB 3EO1A 3MRNB 3VDBA 3NZ8B 3OKEA 3BUYB 5L2KD 4CGTA 1DQLH 2VQTA 1EJOL 2XKNA 5FCSH 4NUGH 4OLWH 5GSRB 4Y4HB 3DX9B 1JZ8A 4QRPB 5FGCB 3MQIA 4FQQA 4G8IB 3SDCA 3FJTA 3IU4H 2APFA 3GJEA 4CMHC 4K94H 3S34L 3UYRH 3FB7B 4WW1A 1CLYH 2R1WB 1OF2A 2FZ3B 4F15C 1P4IH 3Q5OA 4YJZL 4J8RA 4NIKB 4LNRA 4N1HB 2NY2B 1BJ8A 1N5YH 1D6EB 4V1DE 4NZRL 3MNZA 3W9DA 1U8KB 4MB3A 3RBSA 4DGYH 4XPAL 4JFXB 4E5XB 3P2TA 2GHWB 3C6SB 3JWOC 1NFKA 5FYLE 1QQDB 5I8EA 4NPYB 1WVZA 4J23A 1EO7A 5CEYA 5IJVB 2XKSA 1RIUL 2UYLA 5IUSA 4G6JL 4Q6IA 3CMOL 3GIVA 3PWLB 3KR3L 3O2DA 5I1HH 3B43A 3FTGB 1TZIA 4BKLA 4ZDHB 1IT9H 5EC2B 1HHIB 4ELME 1Z3GL 3WSQH 3PL6A 1M4KA 5LG1A 3TPKA 5HDBE 3VFUA 4FFYH 3H7BB 4JRYD 1QTYT 4WEBH 2EICA 4K9EL 2R69L 4KXZI 1R0AL 1OAYH 5AZ2L 4WEMB 5HVWA 4FQHB 5E8NB 5GGRB 3TZVA 1FRGL 1NAKL 1MCCA 1ZWIB 1YEFH 3MBEA 2J5LC 5FM5O 2YPVH 5EA0L 5KS9B 2QQLH 4OCSH 4RMQA 1GOGA 1YEEL 2BHYA 4M62L 4HWZB 3EIFA 4XPHL 3V6ZB 3BH9B 3QXWA 3RNQA 5F3BA 3X13A 2IFGA 4MQSB 3TYGL 5GHWH 4YK4C 2R9HC 1HIML 2EXYD 4XVTL 3CVIH 3C6LB 3LRGA 2C1PB 4AY0A 4UQ2A 3D0VA 4P4RA 4JKKA 1JYXA 2ZOKA 1T66D 1T1WA 5BRZD 3NIDE 2UZIL 5DURD 3BDXA 4KJYB 1UVQA 4N0FB 3HUJB 4N9OB 3L5WB 1H3VA 4LHUB 4ERSH 3BIAX 5I71C 5CJBA 5F9WB 1MWAH 1PX4A 4Y8DC 5EOCJ 1U2CA 1YN6B 5GRVL 4KRNA 1H3PH 1YUHB 2B2XL 3QPXL 4NN5C 3MRIA 4KK9D 4G9FA 2VZVA 4JDVA 2EO9A 1SMAA 3VD9A 3S5LA 3BZEA 5GXBB 4NZTL 1MIEH 5EO0B 3O4OB 4OZHA 4QRSB 2AK1H 2CDEA 5AUMB 3ARRA 1KIUA 1OAQH 4IOSD 3LKQA 3EDKA 3SY0B 3BQUD 4CVXB 1FG9C 2DL2A 2H32B 1NL0H 3PQYE 4G8GD 5EB9A 4B0MM 4DUWA 3HE7B 4A6YH 4MA1B 3UJTH 2PYFB 1GGUA 4UT9L 3N1QC 4KWUA 4ZUTA 1KPVB 1CGUA 3QDMA 4NQSA 5I1JL 5IKCB 3LKOB 4NO0A 4ZO8A 3WO4C 1J7VR 1I9JL 2XT1B 2AS5M 4AQOA 4NWTH 1NCBH 5DQDL 3OAZK 4NNPH 4MDIB 5ELIA 1ZKAA 4FG6D 5AEAA 3UMTA 1VADA 3MOAH 2GT9A 3HZKA 4RQQB 4HIHB 2MPAH 4LLUB 5K59E 1GL4B 1FGNL 4OF3A 1U6AL 3MFGB 3CSPA 3NCYS 2R0LL 3NCBB 1W8NA 2BNRA 4LCCB 3UTPD 1DFBH 3WDIA 1NGYA 3X14A 3ZKXB 1T03L 3CFKA 5IB4B 1FNGA 2G2RA 5IVXE 1WCQA 4H26B 1EEUA 1SEBA 1MIEL 2EH8H 4YFLI 4PS4L 4JM2A 1G7MB 2UY6A 2H1PH 1CN4A 3CX5K 3PXJA 1R3HB 4GRLA 4ODTH 3ZDZF 3I9GL 5ICXB 3GSXA 4XHQA 2J3SA 3OMZA 4X6DB 4XNUL 5GRZA 1KTDB 4Z0XB 3WN5A 3QXAA 1KB5A 2JJVA 3DRQB 1PY9A 2BC4B 3SO5A 4R96A 3X3FH 1U8JA 2AJSH 1JIBA 1LO0L 1OD9A 4D9LH 1DSFH 3ZDXF 1MCBA 4JFZL 2IPKB 1KC5H 2D7NA 5BZWB 3LV3A 4JG0H 5T33L 5F7NC 1DVFC 25C8H 1CIUA 2A6IA 3EOTL 4MXWH 1FGVL 3EO0A 3CPLB 1D5MA 1NQBA 4HIXH 4PJCE 4JY4B 5T1LB 1YJDL 3LD8C 2X5PA 4Z0BL 4MJIB 2CMRL 2VYRE 2YD9A 3TT1L 1T2JA 4Q2ZB 2C4FT 1FSKC 1NGWA 1JNJA 3CFJA 4M4RA 3LEXA 4MD5A 4HCRL 5KVDL 2EC8A 4LLQB 2MKLC 4OZIF 2NY4C 1FRGH 1NAKH 1QBMH 1B4JH 3UDWC 3VJ6B 3ARBA 1AXSB 3VXPB 4YFLF 4OCXL 3VFNA 4I0CC 4L8CA 2LV4A 2YUZA 1EHNA 2VABA 4OQTL 5L2KE 4PJXA 4UT6H 4PRHB 3RWFB 1GC1L 3PGDB 4I5BA 4GLRI 5TE6H 1IGFH 2ZUUA 1M6OB 4OLYL 1JYWA 1FH5H 1RUQL 4DWHA 2J6EL 4HJJH 2X70B 4KFZC 2C7UA 1NMBH 2V5YA 4F8QA 4NM8L 2W0FA 4DN3L 2HMIC 3EJYC 2FGWL 5F1IA 3SKOB 4DFHA 3Q1SH 5EU6D 1KCSH 2VNCA 3MLRL 1WC7B 4XNMA 4JDZA 3AREB 3BKYL 3QJFB 3BO8A 3KLHC 1A1OB 3QDGD 4Y16B 1EAJA 5D7JD 5T1MA 4OZIA 3TVMB 3ILQD 3BRDA 5IHZA 4XCYA 2Y9RT 1I1CA 5ADOL 3T0EA 3RWJA 4JZJA 5CGTA 5FYKL 2H8PA 4U1SB 5EUKA 3HE6A 3E3QE 3HAEB 3BE1H 2CXKA 2X09A 5FYLL 1H5BA 3IJHA 4RISL 1MRCH 3D2UB 2W60B 1F97A 1ORQB 1CFVL 4NQEE 4X98B 4NRYA 4XP4L 4FQ2H 2LQRA 3K81A 4LLYB 3D69B 3V79C 4U7KA 1Q9WA 3G04A 4B53A 5HGBB 1P84K 4NO3B 3WMSA 3JV6A 2EIEA 4OLWL 5EIVA 4HLZH 4EQ3A 3BJLA 3BN9D 4ODUA 4JHBA 3CIQA 1J8HD 3PGCB 3VG0H 1H8SA 4Y19B 1KT2B 3STBA 5IM7A 1F11B 4RMSA 2CO6B 3DV4A 3P30H 2LU4A 3LVEA 1RV6X 2HA1A 5EFIA 3D6GA 1U93A 4JO1L 5MENB 1A9BB 4DKEH 4LPXA 4LF3A 4JRXA 3OSKA 3JTTA 3RNKB 4RGNE 5MHSE 2BP3A 4PGEB 3TH3T 1HYSC 5F9WC 1P2CA 1OSPH 1WV7T 1CZ8H 4DZBB 3FMGL 1IBGH 4EJ1C 4HBCL 5GSVA 5EU7E 1F4YL 4GRMB 1DTUA 3QIBC 1RHHA 2H2PC 1MCRA 2XZZA 1EBAA 3ARFB 3QHTC 2X4QB 3QNYA 1MCFA 2WQ8A 5HPMA 2DIJA 2Q76B 3MJGX 3WS6A 4X80L 2HJFA 5I75C 4K3JL 4HSQA 1Q1JL 4UUJB 5MEQB 1JWMA 5I15H 1WSST 3CVHH 1GAFL 2NXZB 2QSCH 1Q9OA 5SX5K 1NUDA 1NDMA 5GGTL 1MLCB 5BV7B 4Y5XC 4CJ1A 1PBYA 4JFPB 4O4YL 1PQZB 2YD1A 1G0YR 4JGJA 1GAFH 1QHPA 1ZVSA 3LSOB 4O58L 4PREB 2DQJH 2EDFA 1CLOH 1F4XH 4BZ2H 5B39B 2JIXA 3B2VL 2WLYA 4XBGA 1AKJD 2CKBH 5L88H 2LVCA 4QRRD 2FO4B 5C2BL 4HIIA 1DDHB 1N6QH 4P2QD 2YS4A 4OM0H 5F8RC 1U95B 1KLGA 4TSCL 4UDUA 4Y4FC 2QL1A 3RKDC 5IBUB 3QA3A 2EC9U 4WI2A 2BJML 4G43A 8CGTA 4M61A 4PLKC 2E6JA 1DEEB 3AXLB 3VFRB 1U8MB 3UROR 1A22B 4E41A 3HRZB 2EDYA 4WEUD 2AJ3A 1FNEB 4KY1H 5DUMH 5KJRL 3VGDA 4CU8A 4M6NL 2VXQL 2NPLX 4HS3B 4PJAE 4ISVB 3VFWB 4YHMH 5E2TL 3H0TA 1A8JH 3WS3B 3KPNA 2XICA 1CXKA 4P2OB 3VMPA 3SKUD 1FFPB 2VH5H 1CD0A 5DWUL 4JFFA 4I3RL 3MUJA 1YPZF 3QUXA 1U3ZA 3QUML 4QTHB 5MEPA 3O3DA 3PWVA 2BSRA 5C2BH 5B4MD 3KJ6H 1VENA 4F15B 2H6PA 2IAND 5CD3B 4PUBH 4NQVB 2G5BB 4A2LA 3MRCA 1CS6A 2GKIA 3RVWC 3T0EC 1ZMYA 3NCMA 4K3GA 3NFNA 2VJXA 1HZHH 2NMSA 1LP9F 5DJXA 3HZMB 4DKAA 1IGIH 4Z6AT 1AO7A 4R4BA 3SDDD 4WV1C 3LKPB 4KTEL 4APQA 4PY7B 2MJWA 1YEKH 5FM8A 5D9SA 1A5FH 1AXTH 4XWOD 4XMPL 5D7LB 4X4ME 1KEGL 4PJGB 2Y5TB 3QQ3A 2DWEA 2WUCH 5J13C 3FRPA 5C0AA 2V5RA 3BX7C 3U0WL 2BRRH 2GSIA 4NM8H 4GMTH 4OIIL 3TO4C 3OKLB 3O6FB 3U7AA 5DD6B 1NCUA 2DBJA 15C8H 2X42A 4UAOC 3JV5A 4OLYH 1EO5A 1OW0C 4QHNA 1MHCB 4Z7WE 4NBYB 2Q6WB 1PG7X 2ITCA 1A2YB 4A2MA 2V7NA 2YRZA 1U41A 1HKLH 4M6ML 5IB5A 1CL7H 3V4VL 3ULVE 4WCYH 1AFVL 1DQMH 4PBXA 2FJHA 1G84A 4WFGE 4GAGL 4QNPE 1VFUA 4QRQA 1ZE3C 4MMXC 4C54A 1CDGA 4JANA 4QRTA 1IC4H 1CFQA 3R8QA 3OKDA 5JMRA 1QYGH 3IJYA 4F2MA 1CXEA 5GRYA 4GRWF 4P0DA 3HG1E 3KPTA 1RPQA 4F57L 3EOTH 4MXWL 1NC4A 1F6LL 2B4CH 4LCIH 4MJ6A 4ODSH 3PWNA 5ENWB 5I2IA 1HI6B 4HKJA 5DUPL 2FEEL 3BPLB 1KOAA 4HIJB 3GUTA 32C2A 4LCUA 5IFHL 3M17A 3BRFA 3X3FL 3NTCH 4HFWB 3IDIB 3WEXA 3CU7A 3QNXA 3V6FA 5DO2D 4HG4J 4GO6B 3FN0L 1TNMA 4P5KB 4EI6A 3L6FB 2HTLD 1JGUH 1CFNA 1FORL 5ALBL 3VMNA 2ZNWA 1UEYA 3BVNA 1U92B 3O4LE 3GJFB 4I77L 3TVMC 1VFAB 2D9QB 1IC1A 4OGYH 1T1XB 4LEOB 2JB5L 3HI6L 1KPUA 3RY6C 2XZCH 1DFBL 2VAAA 1U3JA 2KBGA 2P45B 4KXZH 1UFUA 2FJFA 4IEFB 3LB6C 4NOBA 5D96C 4X4ZA 4HJJL 2AJXH 1G1CA 1AY1L 2X9YA 5IG7B 4KKCC 3PHQA 1T5XA 1EIBA 2E7CA 1IGTB 4JZOB 5EH1A 4HMEA 3LIZH 3VFOA 1FNSL 4UT6L 2NNAA 1A9EB 4OQTH 1HDMB 2FDBP 4ZO9A 2VC2L 5JA8B 1BVLB 1WBXB 1Q8MA 3TV3L 2CK0L 4TPRH 4O2CA 2VRAA 2OTUB 4DTGL 1B4JL 1XIWC 4Y4HC 2IBBA 4PJIF 4K7PX 4UT9H 4TQEH 2XA8H 4S2SB 2BVPA 4HCRH 3QDJE 2OR8A 4MAUL 3HMWH 3V52L 4LASH 5C0DA 5E03A 5DJAB 3MJ9H 2EE9A 3O2DH 1YJDH 2GQHA 1GIGL 4POYA 5AAMA 1IZJA 5CSGA 3AY4C 1I3RB 1Q9LB 2ARJA 1NGZA 1E6OL 3HNSH 2FEDD 1KELH 4PJ5B 4PTUA 1YNKL 2J5LB 4RAHA 5CWSA 5LBSH 4CN4A 1HXYB 1AJ7H 5I6XC 3RWEB 2HRPH 4UB0L 1QFOA 1MAML 1V7NL 4GXUM 3TO2B 5I1DA 4YWGH 3BHBB 4XCFH 1RURH 5BO1L 5CGYC 5LKNA 3FONA 4Y5VA 5L9DL 1V5JA 5E94A 1E4WL 1HOCA 2K3TA 1AJ7L 1V7MH 2ZP0T 3ZSSA 2H1PL 5DJ0A 3C60C 3WCYA 2DLEA 1A6AA 5JXAH 3B4NA 4XVTH 2ADJA 5DEGA 3D3VE 2JCCB 5EU5A 4F80A 2H26A 1UEMA 1G6VK 2UVEA 4NJAL 1SQ2N 4XPHH 4G8EA 5BS0B 4P3CH 5HHXL 4NQEB 5JHDD 5JOPD 5D1QA 4NQCE 3QR2A 4HHAB 1HH9A 4OF5A 5E9DE 3UTZB 5EULV 5J8OA 4KV5F 2ITDA 1LP9E 4O51A 3WFCL 4RIRA 2CK0H 3MYZA 1OQOA 1YEDA 1P4LB 4LLVB 3KPSD 4X5WA 4KDVA 3O0RL 5T3XL 1NC2A 5HYQA 2KKQA 2WWKO 3O4LB 3IB4A 2Q86A 2GYSA 1IM9A 1EHAA 3FOLB 3G5YA 3H6JA 1OP3H 3QHFL 1WLHA 4G6JH 1MQKH 3V52H 3QIUA 2WIMA 2F8VA 2K7QA 5CIPB 3SDCD 5MERB 4ELMF 4Z7UF 1DL7H 1CDJA 4HQQH 3NFSH 1FNAA 1CBVH 3NFPA 4WGVB 5E6ZA 1I9IH 4I0PC 2L4OA 4LVNC 1LO5B 5E8EA 2XFXB 1G6RL 3GMLB 5EBWB 1OT2A 1QKZH 5SX4I 3GSNA 5DI8A 5FA3A 5KVMC 1BOYA 4PV8B 4QY8B 4OV5A 3BZFB 1IQDB 3W39B 3DYMA 4XXCC 4N0UB 4NHUB 1XF4A 3QFJD 1XR8A 2YEZB 2FIKB 5IFHH 3IAPA 5CMAA 5D1XB 3RZCB 4X8JA 5GGSY 4LEXL 3ARDC 3MLUL 2VDOH 3MFFA 3QEGH 3GSQA 4LCIL 5KANI 1VA9A 4K3EH 4IM8A 4PGZA 4OZ4B 2A73A 4LLWB 5IW6A 1WT5C 4LLMB 3T4YA 3QDJA 4F9PA 4D0BB 1WTLA 4NUGL 2VLKA 1YPZA 3O3AA 5ALBH 5ID0B 4RGMC 4YFDB 1FORH 2X4SA 1EAPA 1NGXB 3B3IA 3LQAC 1HYRC 3V4PH 5HHMB 2R2HB 3CU1A 3EYVB 1BIIA 4CKVX 1W72H 1LD9A 1CQYA 3FN0H 3P11L 4Z76B 4WW2B 2DLFH 1JNHB 3MO1A 4X6CA 5DRWA 5A2LH 5C2UB 3WFBH 5B38G 4H1LH 4QRUB 2C26A 2WUBL 5FK9A 1VPOH 1NFDA 2UWEE 3DX6B 2YXMA 3MRBA 5F7EL 3O3EB 2OP4H 1Z9SA 1OHQA 4FFYL 43CAA 3RAJH 2C1OB 5HJ3A 4ODSL 3SEPA 3VD7A 2R0WL 15C8L 3NZ8A 5FYKU 2EYRB 3O81A 1QYGL 5ITFA 1WICA 3SOBH 3EO9L 4G3YL 5B8CB 4M02A 1BQHB 4PB9L 5IEKA 1UB5B 3DX9A 5LQBH 3UYPA 4JPVH 1REIA 4KKCD 3TT3H 3BRGC 3OPZH 3WLWC 1S7WB 2GAZB 1DR9A 3VWJB 2DIBA 1F45A 5DHYB 3IDGB 2P49B 4MQ7B 2YHGA 3GK8H 4NC0B 2JCCF 4L8BB 3RUGB 4YDJA 3U30C 1BJ1H 3MV7E 1QP1A 4ODXA 5HSFA 4FQIH 4WWKB 4XBPA 2NW2A 5HHOA 3UYRL 1NLDL 5KS9F 1MFAH 4MX7B 1HILB 4R0LC 4U4BA 4O02H 5KSUA 2WUCL 1MCJA 3KJ6L 1YZZA 2Z31C 3QUMH 5BQ7B 2GSGA 4U0RB 5KSAC 2VDRL 1J86A 2R4SL 3CH1B 3JXAA 3PWLA 2KUTA 4G8GA 2NXYB 4BKLB 3LRHA 4HAFA 4R0LB 4WO4A 5SX4H 3I50H 1PEWA 5EO1B 3VXUE 2R4RH 4WWKC 4TNWK 2AK4D 4KQ3L 7FABL 1UZ8B 3B5TA 1RJLA 2WP3T 5DHVA 1NBVH 4FXGB 4NO0D 1I1AA 4NZJA 4KI5F 4NO2B 3RQ3A 4HKZB 3IXTB 4G6MH 4ZS7H 4FQJL 4NHCH 5GGRA 2AW2A 1OP5H 2VERN 2B5IC 1LDPH 1FZMB 5CUSL 2ZG2A 1BFTA 4DVRH 4U33A 5IMOB 1FVCB 1WJ3A 5KZCD 2E8ZA 4OBSA 2AKRA 2OYPA 4AYFA 5DLML 1NBZB 4B5EA 4O9HL 3OG6B 5FUOH 3BH9A 4XGZB 4ZQKB 5I17A 4GH7B 1WEJL 4E42A 3TPUB 5CJQH 3S36X 2DBLL 4S1QL 3L5IA 1P4BH 3CFEB 3VDCA 3ZHKA 3TCXA 4KJYA 1DLFL 2WIIA 2X6MA 4PLKD 4OGAD 1RK0A 1GRWA 5IB2B 4LHQB 4BELD 4F7EA 4KKBC 1AHWB 3EGSA 3MXVL 5F9JA 5TGBA 4N0CD 4U49A 4ODBD 3KYKL 5I15L 1YUHA 4TSCH 1G1YA 3FO0L 3S98A 4U6HB 4G9FB 4JO4H 2APXA 4I48B 4G8GE 4L5FL 3MXWH 4L4TD 1TZGH 4ONFH 4BSVA 1YNTA 3S3JA 2XWJB 4QRSA 4NQTA 2OR7A 3IETB 4HZAA 3V8OA 5GGVY 4YHYC 2FL5B 1IBGL 2I60L 4RMWA 2A1WL 5DTFB 3F5WB 5FA4B 5BRZE 3JTSA 3BP4A 4UOW1 4M1DL 1FFQA 1JNLH 2A0LD 1QRND 3DJ9A 3QXTA 5DMGC 4Z78A 4MZ3A 4POZD 2R0KL 3U0PB 4XCEB 2IWGA 3VXQA 1NEZB 1MJJA 3CVHL 4W4OC 1R5IA 1KPVA 3GSVB 2ATKB 1JF5A 1XGTB 2MCG1 4NQSB 4XPGH 3VRJA 3O11B 3S9DB 3QIBD 4OZHF 4OF0A 2VO5A 4LKCA 3RY4A 2EEAA 1KEMH 4I9WD 1NDGA 1AP2B 3D18B 3MV9E 4R9HA 2JJSA 3F7VA 5K9QG 5EBGA 4HBCH 2OX5A 3B6SA 1IMHC 2J7LA 1BBDL 4IIQB 1JHLL 3FRUB 4OFIA 3QEQD 4TVPL 3SDAD 3O6KL 3FO1B 5E9DA 3OKMA 4LQFH 1F3JB 4OAWA 2QJDA 2Z8WC 4X4XB 1JK8A 2AGJL 3LY6A 1HCVA 2WUBH 2X05A 5IFAH 2B1AL 2B20A 3QDGA 1YN7A 4M3KB 4WY7L 1G7MA 5TFSL 5IIEA 3CGTA 1GHFL 1ZVYA 1A1NB 1FBIH 2OM5A 4BZ1H 3VG0L 2ZSWB 4DVBB 4HKBA 3AAZB 5L2JB 3KAAA 2G5RA 4ZXBB 3T0XA 3GB7A 4FTVE 4X6DA 3WXWH 3LQMA 2QKIB 3S37X 2JTDA 3V0AC 4U1NA 2ADGA 1CF8L 2AI0L 1T83A 5D6DC 3HB3D 2FGWH 5JO5B 4UV4L 2F53D 2YSSA 2BVOA 4XXDA 4OZGE 2R0ZL 4LSVL 4LEXH 1UWXK 3FFCB 2NY0B 3BDBA 2YRLA 5A16A 2VDNH 5CP3H 5FYJU 3RTQD 4OQ1A 1FL5B 4RISH 3IFLH 2X1QA 1IGFL 1JGLL 1I85C 3QULB 4IRJD 5KW9L 2ICWJ 3CK0H 2NX5E 4FQXB 5ADOH 1NGWB 5IBLD 5GPRA 2KL6A 2C3XA 3OKNA 1O7SA 1QKZL 4OCXH 3REWB 2EZ0C 4GS7C 1T0MB 4JDTH 2HKHH 1EFXA 3SE8H 1B0GA 1I8IB 3OQ3B 1ZT4A 4DJMA 3C5ZC 1KCSL 3MRKB 1D9KB 1IKFL 2GJ6E 2Q20A 4EEEA 1G7JA 2X41A 4PJEB 1QFWH 2NY4B 4UOJA 3TT1H 3U4AA 2CMRH 5TF0A 3RWFA 2BXYA 1QG3A 3PGDA 4I5BB 1T20B 5D7SL 1RMFL 1M6OA 3ZE0F 5D1ZD 2XV6B 3QG6A 3D39B 4UNTA 2NY6C 2JJTA 2IF7A 1FL3B 3RBGA 4K7FB 2N1KA 3KLAB 1N0XL 1TJHH 4EVNA 1LO0H 3SKOA 5DXWA 4NQDA 1R3LB 2Y4SA 3RL1A 4HMCA 4L4VB 1KBGL 3SPVA 3AREA 3QJFA 3VFPB 1FFOB 1MIML 2PYEB 5EU3B 3IDYB 3TVMA 2QADD 4ODTL 4NWUH 3C09B 4P2RD 2R8SL 3O6LH 4LIQH 3RWJB 3T8XB 5E0QA 4GBXD 1MI5B 3C5ZA 4Z7VE 4YIQB 1T89C 2COQA 3KPOB 2XN9A 1Q0XL 3C8KB 5ADPL 1OWRM 1W72A 4WENB 1AKJA 4LSTL 3OTTA 5C07E 5J1SC 3ALWA 4XWGL 4NRYB 5BVPL 5IFJB 3OHXA 4HK3J 2F54B 3NH7H 3MLWH 5KSBB 5HGBA 1E6JH 4JO3L 4J2XA 4GMSL 5DJCB 4R6UA 4PJ8A 1IFHH 2CGRL 1FV1A 3MRDB 3BT2H 3PDOB 1XIWD 4PJHA 1J18A 4HT1H 5HI3D 5I1AB 5BO1H 1AQKH 1AH1A 1CTNA 5CINH 2C9AA 2NY7H 4YHNA 4ZYKA 1ACYH 3FN3A 3CFDA 2VSDA 3SDXE 1FDLH 2W9EL 5TF1L 1U8HB 2HVKB 5DMIL 2WBJB 3QG7H 1CFSA 3DV4B 3HS0A 5SWZD 1OAUL 5IK3A 3T2NL 1YEHH 3E0GA 3TNMA 4CAGA 2YD4A 5IBTL 2VITA 3KYOB 1XZ0B 2ICES 4S1DC 4KZEL 2FX8H 1T5WA 1UCTA 2HWZH 1T66C 2Z93B 3JTTB 5FCUH 4HWBH 4M7JL 1P6FA 5ICZA 1CI5A 1NUGA 3RU8H 3V5HB 1J05B 1QA9A 4PPTA 2EXWD 4Y5YC 2EDRA 4JR9L 4GRMA 2D7TH 1LO2L 1JPTL 4IMLB 3DSFH 1FVEB 4DOHB 1F3DH 2Q76A 35C8L 1B9ZA 1GGBH 2AEPL 3CVHB 4ZAKB 5CCKH 4EZMA 3EOBB 4CL7A 5EOQL 3QPXH 1C08B 1VFOA 4UUJA 1QR4A 1H0DA 5ID1A 3PWJB 3TJEH 3O8XA 3VRIA 4EI5D 1XGUB 4ZFFB 5HVFB 1AO7D 3U36B 3DX7A 5FO7B 1N3NB 3CSYA 4J3OC 4ONHA 3NCCB 4QHUA 3IRPX 1B88A 1TQCB 3GMRB 2NY5C 5EDXA 3G6JA 2IG2H 3K2UH 1OAXH 4XH2A 2DQDH 3DOSA 2VE6B 3I6KA 3VXSA 2WSKA 5FECB 2YKLH 2CDFB 3EKCA 4HK0B 3A67H 5MP6H 4LRNL 4XNQB 4DZ8A 3MRMA 3RDTB 1DBAH 4NKMA 1RFDL 4ZTOH 3TA3C 2IANE 4LSPL 1XCTB 5DRZB 3FAWA 3HR5B 5IHUL 4NUJA 4X6FB 5LWYH 3C5JA 1JGUL 5CP3A 3B5GA 4MYWB 2D31B 3CCHB 3R06B 1W0WB 3PQYD 3VE0A 1EGJA 1YEFL 3VI3E 4MAYA 4CUCA 1DEEA 2H3NB 4K9EH 4U7MA 5DSCA 3TIEA 4ZNEA 5BV7L 4U0QB 4BZYA 1WAAA 1CK0L 1BHGA 4Z7WF 2JJWA 3DTXB 3WUZA 3NA4A 3FZUC 3BD3A 4M5YL 1LHZA 3BGFC 3WS3A 2VLRB 4NZUL 4QXWA 4MNQB 1RIVL 1QFUH 2J4WH 3A0OA 1WUNT 3CMOH 2CUMA 4L1HA 3WIFA 4KHXH 3I75B 5E08L 4WHTA 3WNKA 2VR9A 3HAEH 3VXOB 1RZ7H 3WFEH 3EJZD 1FO0A 2BFVL 2QLVB 3LEVH 3ZKMD 3BPCB 4HULB 4JN1H 3IFOA 4EUPB 5CD3A 3R0MA 1UA6H 3EOAB 3D85A 2X4NA 3HFML 3MGTB 3BKCL 4DGYL 4UINH 1DBMH 5GJTL 5E1HB 1ZHLB 5IJKC 1GPOH 5FGRA 3ARDD 3KDMA 3UC0H 5L8JB 1QNZL 4HJ0D 2CKNA 1H15B 3LN4A 1YNLH 1CT8A 4PY7A 1KJMA 4NKQB 3BJ91 2JK5A 4NRZA 4HZLA 5DK2B 4OF6A 3KR3H 1J5OL 1PDKA 3BIBX 5C0BA 2BRRL 1ITCA 1UXSA 1FZKA 3WHXA 1HYSD 2DLHA 4HS8L 5IEHA 3DROB 5BOPA 4PRPB 2AQ3A 1U8LA 3O2VL 4JJ5B 3E6HA 4OCNC 4HX1B 1AGCB 3IS0X 2ADFL 2OQJA 3UPRB 3ABZA 1D5ZB 1A6VH 1DUZA 3SDDC 5EN2B 5BJTB 3CDCA 2CIIB 2ZJSL 1KB5L 3LH2L 3DUSB 3KPRD 1WAAE 2LFGA 4ZFZB 1C5CH 3RIFK 5IOPA 5JNYA 1FHGA 1WZMA 4HGWB 5EBMA 5EORL 1NKRA 1UWGH 3DI3B 5I30H 2JLLA 1MFBL 5TPWL 1OSZB 2F5AH 1I7TB 2X4PB 1EJOH 3VI4F 1ZLSL 3MODH 2GITA 1IQWL 3OR7B 1KENL 4XP1L 3PV6A 1KCUH 2VDMH 1U8IB 5AG9A 1JHKL 1TNNA 2IEPA 5J9PB 1J0KA 3PNWA 5MI0C 3JZ7A 4J1UA 2NYYC 3B9KA 4JM4H 3OL2A 1MELA 3QNZA 2K9UA 1QNZH 1KB9J 3IDMA 2ZUWA 2XZQL 2X4TA 3LDBC 4P57A 4YUEH 3WEXB 5GJTH 4NQXB 3L3OA 2YK1L 3FQTA 3MOBL 5HDQH 1R3IH 2VXTH 3WFHB 4KRPD 4I3SH 4U1GC 1S7XA 5A2FA 1XF5B 1DBBL 3SQOH 4AL8H 1T1ZB 4PG9A 3T0WA 5D4QA 1Y0LA 4S0TD 2O5YL 3FB5A 3EDDA 4EOWH 4KMQA 4LCCC 3HC0A 4FNLL 5JORA 1KGCE 3NCJH 5DFVC 5FGBC 1KPUB 4K71B 1D7FA 4RGOL 3QFJE 4JFDB 1X5FA 4NN7C 1HINH 4FQQB 4G8IA 4YAQA 3QHZL 3GJEB 1N2RA 2DMBA 1PKQE 4Y2DD 1LE9A 2EKSA 1U0QA 2GTZB 2OI9B 3PHQB 1YQ2A 4UQ3A 1OF2B 2FZ3A 3C87A 3QI9D 4JZOA 1XFPA 5EU4A 2D3VA 3GNML 5KSAB 4I4WA 5DA4A 4J8RB 4AIZB 3QUYB 4OGZA 4PRAB 3VXTB 4LNRB 1I3UA 1NSNH 4OKVB 4UIMB 4JFEB 2MMXA 3W9DB 3TF7C 2N4IA 1HK6A 5C0ND 1RIHL 4Y16C 2LU7A 2XQBH 3MPCA 3BZ4B 2X1OA 5LAXA 2CPCA 2BVPB 3ARBC 3RPIB 1S3KL 2CDGA 2WINA 3SGEH 3IFPA 2J8HA 1YC7A 5H94B 4L9LB 2A38A 4PGJA 4M8QB 2YZ8A 2YKLL 3BYYA 3SGJC 4IJ3B 5E1AA 4HUVA 4F33B 2OMNA 4MMZC 1IGJB 1Q9LA 2ARJB 4X99A 3QUYC 4WHYG 3VWJC 2RFXA 3P0VH 3BP5A 2YRPA 3CAFA 2Y6SC 3DIFA 4HDIA 4LAQH 5FGSA 5C0FB 2Y23A 4RX4A 2K7PA 1HXYA 1FVDB 2DYPA 4WDIB 5DD0H 3ROLA 5I1DB 4G6FD 4NN6C 4FQHA 3E8UL 3TZVB 2Z31D 3S7GA 1QSFE 3MBEB 1HOCB 1MCSA 2AQ2A 1RZFH 3MRRA 3INUH 3UTSB 1LMKA 2G60H 4WFHE 5KS9A 5L7XL 4MS8C 4HPOL 5F89B 5CGMA 2VWEE 2HFFB 3LMJH 2FR4B 1CU4H 4RFNC 4LSQH 5E2WL 3AVEA 5DDHB 2FX8L 5J3HC 5DEGB 2IPTL 2JCCA 3JUZA 1DQQA 5HHOE 3PL6D 1YEHL 2DQCL 1OAUH 4YHZL 4PJBA 2YOCA 5I19H 2NX5D 2ZOKB 5FHBH 1FO0H 4OZFB 4RWYH 4UT7L 2DRUA 4OUOA 5K9OA 2B8OT 3NPSC 3BN3B 2GJ6A 4L3EA 4XVJH 4NT6A 1S8DB 1FE8L 4FABH 3UTZA 1AQDA 4IRSA 3SDAC 2PW2B 5ILTH 4KK6D 2B7DT 2A6KB 2VL4A 4KMLB 3VWKA 4D94A 4HUXA 2MNUA 1DBKH 1X5KA 4MNGE 5HYJE 1CXHA 2ERJB 3O4LA 5D7IE 2FD6H 3T3PE 3Q0HA 1TQBB 5DJZA 1JFQL 3GMMA 3B9VA 4XX1G 5ESAB 4AMKL 5ANMA 4PRBA 3BWUC 5DC4B 4G42B 5DJDA 5I1LB 4OLVL 4LIQL 3TNNA 3I2CH 4NGHL 4I0PB 4MXQC 4HC1A 3CFCH 2FJGB 1E4KA 1E4XH 4HFUL 4KGJA 1ND0B 5E8EB 1KYOJ 5DYOA 5K9QI 3CXDH 4AEEA 3VGGA 2V5TA 2XXCB 1TVDA 3ARDA 4LCYA 5FA3B 1CG9A 5D5MF 5AWNH 5IKCA 5D7JC 5CEXA 1AGEB 2VXUH 3UTOA 5C09B 4YEEA 4KROD 3BP7A 4NHUA 1NCCL 4HIXL 3ULUL 1XGYH 2FIKA 1OGAB 4JZJC 1DLHA 1UWEH 4KKAD 4MD4A 3U6RB 5FDYA 1NCAL 5DC9B 4JG0L 3HZKB 3MFFB 2MOVA 1OM3L 2GY7B 4GXUN 3GSQB 4AENB 5I8OL 4D9LL 1BWMA 4PTTB 2BNRB 2HFGL 5FUZL 3TJHC 2PR4H 4K7PL 2VLJE 2ZUXA 3S8WA 1W0YT 2VLKB 1IKFH 5IB4A 4BUGA 4TVSa 3VMOA 3CFIC 4V1DA 4C4KT 4MHHI 3PHSA 2R2HA 3EYVA 3UTQA 4KHTH 2JJSC 5DQ9B 1LD9B 2FNBA 3EYOB 2BY3A 2EH8L 4JJHA 4MD0B 4G6KH 2ZCLH 4KUCF 4GQ9H 3UBXI 1VGKA 5HI5D 3O3EA 5B8CC 2NY6D 1ZHKA 3V4UL 3MA9L 4J6RL 2YA2A 1CU4L 2BVTA 3VXMB 1G9MH 3UDWA 3LV3B 3JUYA 1CXIA 4JN2A 1IGMH 5D7KE 5C0JB 4I2XB 2EH7L 3CPLA 3GBLA 2DAVA 3P77B 1M7IB 5B8CA 5CAYB 3MJ8B 3DGGA 3KYAA 2C3GA 3EBAA 3E8UH 4I9WE 4JM2D 5C07A 4UILH 2BY0A 5I1JH 5FXCH 5ESQB 4J3XA 1CDYA 1VHPA 4RWYL 2JKXA 1MEXH 3BW9A 1FBIL 4BZ1L 3GMNA 4YXHH 2R56L 1LP9A 3QPQC 1BP3B 4R2GC 1YMMA 2WAHA 1F42A 3L5HA 3LB6D 3KPMB 1G7PA 2NCMA 4YDJB 2VABB 4WJ5A 2OSLA 3KNBA 5F7DB 3EDEA 1BLNB 2G60L 5AD0A 5TDPB 1X5IA 4HKXB 2DD8H 2ZCKH 2AV7A 4MX7A 1LEGA 5DHVH 3S36H 3GRWH 1IAMA 4JM2C 1HCFX 3ET9F 4KJPC 3BPNC 3QUXD 2IFFH 5GS0H 2W0FB 5C71A 1ED3B 1LEKA 3OJDB 3CH1A 4Q9BA 1ZGLP 3HLAA 3FOMA 1N4XL 2R1YB 4NO5B 3SDXA 1T2QH 3BO8B 1EUTA 2FBJL 4KJQC 4LBEA 1A1OA 2FEEI 4ONGH 5JDSB 2J6EA 2HYMA 3EHBC 4Q74A 5EOTA 3GBML 3FQRB 1KLFA 3IF1B 1XMWA 1HIMH 4OM1H 3BSZH 1NMAL 4I0KA 4NO2A 5C09E 1S7UB 5DFTA 3VH8B 3ESVF 3P9WB 1FZMA 1G9NH 4NP4L 3I02B 4X98A 5BVJB 1AI1L 4XRCA 1PGRB 2A2QT 2YPVL 5EA0H 2YD6A 4KJWC 4QRPA 2AKRB 5BMFH 4XGZA 2DQHH 5CJ8A 2BVQB 3O9WA 1LEIB 1OAYL 3BZDA 5AZ2H 4MLSA 1C5BH 1N7ML 2XZQH 1XT5A 4Y19A 2V17L 4YXLL 1QBLH 2WIIB 2D2OA 2P5EE 4PYHA 1CE6B 2DM7A 3BAEL 4PJ7B 1IT9L 1NJ9A 1TQBC 1UYWL 2DI9A 4FXKB 4IHOA 4NBZB 4OZHE 1BAFH 1X4XA 3S35H 3U4EA 4I48A 2X7LB 1YECL 1P2CB 5HI3C 4YHLH 5GSVB 5DJ8B 1TMCB 5CJOH 2PXYC 2XWJA 4JZNA 4D3CL 1P7QB 3MV01 1JZ4A 4ZDHA 1K4CB 4Q7DA 2GW5A 3RIAK 4NZRH 2GCYA 3F5WA 4NHCL 5FA4A 3BP4B 4YHOH 3UTTD 4JREC 5F96L 5SWSD 4JE4B 4UU9B 4MA8L 2QR0A 3KPPB 2C3HA 3VFUB 1JWMB 4ZUVB 1UJTA 1EEYA 2FWOA 4XWOC 5F8QC 5AZEL 4FQ1L 3MLTB 4HPYH 5E8NA 3NCFB 1MCNA 3CX2A 2P5WD 4X5LA 4Y4KC 1GXEA 3F12A 1MFBH 2RBLA 5TPWH 4GUPA 4UBDD 1AIFB 5B39A 3RVUD 3HCVA 5GISL 4W6XB 4FZ8L 3B8SA 4Q6YA 3D18A 3QSKB 4QXUL 3RP1A 5I76B 2NQCA 5IROA 1J5OH 2AXHA 2ZOLA 5ISZB 3DO3A 4FQIL 4UDUB 4BFIA 4LVOC 2ID5A 5IJKA 1H3XA 3S4SG 1KXVC 2YUXA 3ULSA 1UVQB 5E8PB 1B0RB 3UJJL 3L5WA 3GSNL 3BIKB 5EC1A 3ZKSD 3QCVH 1GYAA 5DR5L 3SGDI 1YN6A 4P2RA 1FAIH 1KCRL 4K07A 4Z77B 2IPUK 3C08H 3MRIB 4EN3C 4RFOL 4Q0XH 2O26U 4X7DC 3P4NB 4N68A 3S5LG 1RZIA 1QFWM 1OTTC 4Q9RH 3BZEB 3GI9L 5JMOC 1RI8A 1ODAA 1A64A 1UYWH 4QRRA 3ZE2F 1RSFA 4QTHA 1FAKT 3C5SA 2FYYA 3A6OA 3SO3C 1A47A 1CK0H 4GAYB 4Q58C 1NMCB 2HJKB 1GOHA 1MJ7L 5F7LB 2RGSA 3R4DA 4Z7UE 1MNUL 2W0LA 3R1GH 5JHLL 1YA5A 4ZUTB 5D2LF 3KPQB 2C5DC 5IMLA 3IRZA 3REWA 3P11H 4LLAA 3CLEH 5GS3A 2OJEB 3P3YA 4RMRA 3ZTJG 1EFXB 2DLIA 4DUXA 4CVUA 2P8PB 3H7LA 5D70L 4UTBL 2DF3A 2J4WL 2KZ1B 3OXSA 4MDIA 2D9CA 1MAKA 3HUJF 3VRLF 2BSSA 2VUOA 1VADB 2VXVL 4NYLB 1NMAH 3A67L 2DWEB 4HXAH 3CD4A 3O9WC 5MP6L 1CFTB 3O4OC 1NANI 1TVHA 3O6FA 4FQ1H 5AZEH 3X14B 3MOQA 1K9TA 3AROA 3HKFA 2VXSL 1D6VH 1F3DJ 2UWEF 3MCG1 4KRPC 2CR3A 4H26A 3QQ4A 5JXED 2E8YA 3D3VD 1U8OB 3F7PC 4OCRH 1MREL 4NQDB 3O8XD 4GRLB 1R3HA 1R3LA 5IVXA 1K2DA 4PFEA 3T2OA 4DGVL 1KJ2H 1FFOA 3ARFC 5D1QD 2PYEA 3F58L 1M05A 2R2EB 5C0RL 3BXNA 1JHTA 2ZCKL 5CGYD 4U05A 4NNYA 3ZDXE 4JR9H 4Y5VC 4JFDE 5C0CD 3S35L 3MV7D 1MI5A 1KTKE 1CFQB 1OLLA 1PFCA 4YIQA 3OKDB 4F58L 1JV5B 1PSKH 3C60D 1KPRA 2F8OA 2CR6A 2H2SD 2HWZL 3K2UL 1MLBB 5F1NA 5T1LA 1D5MB 1YY9C 3LS4L 4JY4A 2XTJC 1DVFD 1IAIL 4FRWA 1JPSH 1UH2A 4HKJB 3TJEL 4Q2ZA 4RBPH 4PJ8B 3OAYK 2PO6D 3OB0H 2ZWLT 2XG4A 4X9BA 1FDLL 2W9EH 4BQ8A 2EEBA 4HFWA 1DE4B 4O5LH 4ZS6C 3VXUA 3LKNB 1AQKL 2D7TL 4EI6B 2R9HD 1RULL 3JVGA 1IGML 3KXFE 1CFSB 3HS0B 3RL2A 1E6JL 3TNMB 3BVNB 1NMCC 4NJAH 1BFSA 1K8IA 4AEIH 4HAGA 5FFLA 1WWWX 4ZFGL 1WFUA 3UBXB 1T5WB 1ZANH 1MCHA 1EHXA 4OCWL 4AIOA 3GI8H 1UG9A 1I3GL 2FJFB 1KTRL 1KN4H 1IVLA 5DMIH 1U3YA 4N9GB 1Q9KA 1WC7A 4XNMB 2ORBH 1N4XH 4QOKE 3G6AB 1SEQL 4Z7UB 4HT1L 5L8KB 5I66B 2CK2A 3RPKA 5GS0L 5K9KB 3HC3L 1JL8A 1NCDL 3LN9A 4FFZH 4OLUL 4GMSH 4JZJB 4DUVA 3MLWL 2YN5A 3RVXD 1YJDC 4KTDL 5HDLA 2IADA 3ES6B 2P5ED 1VACA 3VA2C 1H9VA 3P4LA 4Z7NF 4BH8A 1ORQA 2RB8A 2CRMA 4WRLA 5FKPA 2VE6A 3I6KB 4PGBA 5D7SH 3PGFH 5E00A 5ITBL 4LLYA 3L95B 4TRPH 5KVGH 3D69A 3RI5K 4L8DA 2SEBA 4YDKH 4MAUH 5I1KL 4KDWA 1T0NA 1L0XA 3P0GB 4JQVC 1JUFB 4K55A 3WKNA 2OJZL 3PJSB 1QSEB 3JV0A 3VXRE 1IL1B 4YBQC 1T0PB 1P1ZB 1LK3L 2VL5A 4NDMB 3SKNB 3OZ9H 1ZHNA 4C58B 4PJ5A 5DGQA 4LSSL 5SV4A 4JDTL 4CVWA 1D3CA 1QACA 5E4IA 2D31A 4RGNC 3ZE2E 2NXZC 3FQWA 3BMWA 2Z91A 4NRXA 4J3WA 5EPMA 3T0EE 1F11A 3CK0L 2J1KA 3FONB 4Y5VB 4ZD3L 5MENA 3DYOA 4XAWL 3ARVA 1I7ZB 3TP4A 5IQ9B 2V2TB 4H8WH 4L3CA 5FYKE 3DTXA 4OZGB 1XGRB 4J6RH 3ZHLA 5C6TL 4DW2H 3MC0A 1A6AB 3X12B 2R1XB 4H8WL 2B0SH 2DMKA 3HZYB 4MNQA 2JB5H 3HI6H 1HHGB 3RVTD 4MJ5B 1HE7A 2ZCLL 5IQ7L 4LPWA 3ARFA 3H8NA 4U1HB 2Q7NA 2HH0H 3KLSA 4ODWB 4OFKA 1MJUH 1PW3A 5TH2A 4U6VH 3RWGB 1JPFA 2ZG1A 5CP7B 5F21B 5HYSB 1OWWA 4PGCB 4EUPA 1JZ7A 3UPCA 3IVKB 4HHAA 1KACB 3TIDA 1NDMB 2GK2A 3MUZ1 4V2BA 5JOFB 4RIRB 4JFPA 3DXAA 2XI9A 4PJEE 4PG2C 4R7NB 1FL6B 5E2WH 4GG8A 4FZEL 4XBEH 4PREA 3FT2B 4G80A 5GGTA 4QCIB 5I74C 3OV6A 1CT8B 1P7KA 5CSBA 2B4CL 2JIXB 5HI5C 5JDJA 1BFVH 3GSWB 4M1CD 4Y1AA 3QYCA 5FIEA 4PJCA 3D39E 2FO4A 4JFFD 1DN0B 4PLOB 1XGQA 3MLXL 3S6CA 1A0QL 2ORBL 4IJ3C 4ZPTB 4Z7OE 1V05A 3FB8B 1XCQB 4NGHH 4E41B 1YYLH 4HGMA 2AGJH 4ZTPH 3CC5A 4WCYL 3BYTA 1FNEA 2D7OA 1BVKB 1FLTX 1RUPH 1HKLL 1I3VA 3N1GC 3BZFA 5KBNC 1IQDA 3RWIA 1MVFA 3W39A 3H0TB 1JFQH 2ARWA 4X8XA 4YHPA 3SBWC 1JNLL 3CFBA 3IS1X 4MNHA 3BUTA 1AD0B 1IM9D 3ILPB 4AM0B 5J4MA 1R5VA 1HSBA 3CZJA 5EBMB 3ZHDA 2Y72A 3DMMD 3UAJD 4L4TE 1QRKA 2BNRE 1OSZA 2HKFH 4L5FH 1KJ3L 4LLWA 1U3HA 2YPKB 12E8H 3QDJB 2GITB 5EIIA 3MYJB 4NQVA 3O3AB 3RRQA 3G9AB 3MREA 4L4JA 4K9EC 2BK8A 1P5UA 3QRGL 4L8SC 1JZ2A 1FO0L 3EOYG 3QNZB 4XNYH 3HNTH 3T0ED 2W07A 4MVBD 1JPSL 4Z76A 5JW5A 3IDMB 3HZMA 4URTB 1ADQH 4M5ZH 5IWLA 1VFMA 3BGMA 4OZGF 1RZKL 2W91A 4GLRH 3LKPA 5EU7C 1BZ9B 4APQB 1ZXQA 3DX6A 1KN2L 5L7XH 4TNVK 1T1ZA 4PJ9A 4O9HH 4PJGA 5F7FA 1PEZA 1WFOA 3FO0H 3QFDB 5C0AB 4ZOBA 4I3RH 3KYKH 5DS8B 5D6DA 5MI0B 1IJ9A 4ZS7L 1A6TA 3NPSB 3MBXH 1CE1H 2YWZA 4G8FB 5GZNC 1ZEAL 2IBZY 2KPNA 5BZDB 3DO7A 1S7WA 5KJRH 3HMXA 2EKSB 2VXSH 2D7QA 4D0CA 4GG6A 2DBLH 2YPLB 5HGDB 1UH3A 3QO0A 1PZUB 2OL3A 5FKAA 5KSAA 4LSUL 3K3QA 1KENH 3PHOB 4XP1H 4YPJA 2V5MA 1MHPL 2UVFA 4GSDH 5IMMB 4HXAL 4G6AC 3QUYA 1UACL 4I3GA 5DLMH 5SV3A 3DRTA 4B7IA 4P59H 1GZPA 4KI5C 2L7UA 2ILLA 2XQYG 4OM0L 4BJLA 4UTBH 5EORH 2Z9TA 3QQ9D 3KJ4C 5CUSH 4F2MB 1RIHH 3UZQA 2CDGB 4XNZB 4TVPD 1OPGL 5FYJD 3QQNA 2I26N 3S88L 4YC2B 2CLVB 1F4XL 3CMGA 3PWNB 3V5DB 3MCLH 4K23L 2GSGB 4Z7NE 4XAKD 2FHBA 1NANH 4NCDA 3TBWB 2FECI 3VG9C 4G8GB 1Z9OA 3NZHL 2DQIH 4NKIL 2EIDA 1IGJA 2E6PA 4P23C 4YDVB 4WO4B 3QWRD 1LQSR 2CLZB 1C12B 1G7HB 3QNXB 1IAKA 1LNUB 3NACL 5D7JB 1QR1B 5HGGS 4NKDB 4MSWA 2VDLL 1NUNB 3ULVL 1MCWW 4FXGA 4ZODA 4JPVL 3RKDD 3TGXA 4IIQC 5HHOD 4G3YH 4ELMA 1NLDH 3QUZD 3OR6B 5IMOA 3U4BH 2YA1A 4P5TA 4ALAH 3ZDYF 5IGXH 1NBZA 2ICWB 2VXTL 5B39G 4F7CA