3LQZA

Crystal structure of hla-dp2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Crystal structure of HLA-DP2 and implications for chronic beryllium disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqzA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3lqzA01
4LLVB 3FN9A 1HOCB 3L5HA 4GRLC 5C8JB 2ZOKA 4FQPA 4X5XB 3V4PH 3TCLB 4U1MA 2HLAA 2H9GB 2R2CA 4HW6A 4QXWA 2BRRL 4X98B 4E42A 1NEUA 3VXSA 3W11D 4EN3A 1KOAA 1FZJA 4JJHA 1GOFA 2A73B 4LLWB 1T20B 1U3YA 4BSWB 1BLNA 4X0KA 4GG8B 5AZEH 1DLFL 3TZVD 1S7RA 2LVEA 3IKCA 2ADFH 3MGOA 5EOTB 5FYLL 1D5ZA 2NMSA 3T4YA 3IYLW 2XTJC 3L95A 1Q0YH 5IFJB 1IEAA 1C12A 2XYCA 1D6VH 1NUNB 4NQDA 1IKFH 1CE6B 2I5YH 4UU9A 3PP3H 4JFQA 1PKQB 4L4TA 4X9GA 1F58L 1XGYL 4YHLL 3TEUA 3DHJA 5FGCB 1AFVL 3DYOA 4YHOH 5CZXC 3HZVB 5IFHH 3CIQA 4JANA 1BFSA 2E5EA 3CFCH 1WICA 2UZIL 3OQ3B 4TVPH 4NKQB 1PYWB 1W8OA 5EFIB 1XGRA 5ID0A 5IEKB 5C0DB 3MACL 2EEDA 2D0GA 3BIKA 5DJ2B 4U3HA 3TFKC 4NO3A 4BELD 4U1HB 3L5XH 1H0DB 1KLGA 1SYVA 4OF0A 3VGAC 3O11A 1XGTB 2FX9L 4PRNB 2VH5H 2CIIB 4F7MB 1OTTC 2EEAA 1ADQH 3BPNB 2HAZA 2H8PB 1HHJA 1H8SA 1Q9LA 4GKZA 1T0MB 1WAAE 4JN2A 1TJIH 1BWWA 3AVEA 3L3GB 4MD4A 1GPOH 2ZKHL 2HKFH 4MX7B 1KCVL 1HXYA 1MFNA 1KN2H 4GS7C 3PWUA 4X6FB 1HEZA 3TT1H 2EDBA 4OUOA 3TH3T 1KEGL 3GGWA 3MROA 4UBDC 4U1NA 4ZUTB 1KBGH 2R2EA 4U1SA 1P9MA 2AEIT 4HZLB 2RQ8A 1NSNH 2OMNA 4EQ3A 3MLYH 3DIFA 5E2WH 1AHWC 5E2VH 1MFAL 3JV0A 5H35A 4ORZC 7CGTA 4JB9L 1CU4L 2GK0A 4R4BB 5D8JH 2R0LL 3HZKA 1I1RA 3AM8C 1F4YL 5EB9A 4CNIA 1IC5L 5D9SB 4JFFD 1XAUA 1CFNA 3G5ZA 2ADJB 4OTXH 4AQ1B 3MRLA 5IB4A 4ZAKC 3QZWG 3SPVB 4X99A 4KTEH 2W9DH 3O3BB 4IRSA 4PREB 3VXPB 4J6RH 3QB7C 4JY4A 3TVMC 3OKOB 5C08A 3EKCA 4HZAA 1T1ZB 2WW8A 4HKJA 1P7KA 4WW2C 1KJ2A 3SGJC 2NNAB 5AYQA 4ZUWA 3C60B 3IFPB 3SDDC 5HBBA 5FEBA 1E27A 2NXZB 2DQEL 3I02B 3GSVB 4OJFL 1ED3B 4W6XB 4KU1A 4OCYL 5DVMA 4O51B 2UWEF 5E8PA 1Q1JL 2FECL 1I8MB 1OAUL 4AENB 3O8XC 4NUJB 1BEYL 1FSKC 3ES6A 1MNUL 5BS0D 2DQHL 2XN9E 4YDIH 1A1NB 3WYRA 2QQNH 4FXLA 4ODTL 1RUKH 3HMXL 2ICWI 3JV4B 2ZOLA 4LPYA 5JMRA 1MWAL 4OLWL 4PG2A 4OGXH 3TBYB 3MOBH 1U91A 3RIAK 3PWPB 3BE1L 3NGBB 5D1ZA 2IADB 3FOMB 5DEGB 3EYVB 3O6FB 3R0MA 4MSWA 3SKNB 5IB2B 1YEGL 1M05B 3PWNB 4U6HA 1R3LB 2YKLH 3IXAA 7FABL 4PGDA 1WCBA 2DIJA 1P7QD 3STBA 3NCBB 1MCNA 2FBJH 3REVA 1AIFA 5AUMA 1MJ8H 3DJ9A 1YPZE 3FHAA 4J8RB 3X3FH 3UYRH 3E6HA 3K4ZA 1I4FA 3G6JB 5J12B 1OCWL 3MUGA 1CGSL 4Z95L 4NQTA 4Y0GA 5KAQF 3O3AA 3KPMB 1JYVA 3TIDA 2H32B 5I2IB 4JRXB 1JYNA 1NKRA 2FGZA 3BW9A 2EH8H 3SN6N 2EYSA 5E1AB 5EU6D 1YY9D 3CU7A 1EEYA 3S88H 4FMKA 1KJVA 2P48B 1XZ0A 1TJHL 1X5AA 3VDCA 3CGTA 1ROWA 1I3RA 5TFSL 5HYSA 1FRGL 2C1OA 4HT1H 3VCLB 3T04D 5GSVA 2AJZB 3D0LB 4HWUA 5EOCJ 5IM7B 1MUJA 1C5BL 2GJ6B 3DARA 3LN4B 3PQYB 3S97C 4LQ1A 1MCPL 1YZZA 2EECA 3ZL4L 3TNMB 2DDQL 4PV8A 3GHBH 1AJ7H 3FB7A 5IHZB 5H37H 1DUZA 4YE4H 1XGPA 1UZ8B 4YWGH 5F3BB 2APTA 5D2NA 1X5IA 3MRPB 4UIKH 3DX7A 5EBWA 2X1XR 3BPCB 5TDOA 3VXOB 5J06A 1U58A 5DJZA 1EHAA 2A1WL 3CLEL 4K3HA 3HE7D 1J8HD 3T2NH 5I1JH 5I1AB 4DFIA 2PF6A 1UWGL 3ECBB 3CK0L 4ZUSA 2GSIB 1RMFH 4H1LH 1EHNA 2P8MA 1GZPA 1DN0A 4V1DB 1MFBL 2D7TH 2BJMH 4KJQD 4NRXA 5KSBE 3W11C 1QBBA 5BMFL 3VWJB 4K3DL 3UC0L 3HS0A 3VXUA 5L9DL 2EYTB 1T7ZA 3MFFB 3QUZB 5IW1B 4P59L 4U4BA 2PR4L 1PEWA 1W0VB 5GGUA 4NIKB 4MA8L 4P5TD 4XHQA 4TPRH 3R8BB 4L9LA 3TZVC 5CUSL 3LAFA 3ARDA 5E2TH 5FKAA 1C5CH 2IEPA 4GOSA 1JV5B 5GGVL 3U9PH 4NQCD 4JGMA 1CK0L 4HPYL 2F9BT 1JRHL 1ZEAH 5D70L 4AEHL 2V5TA 4ZXBD 4UILH 2CLVB 3MBXH 5F89B 4DW2H 3Q2CA 4GLRI 3OB0H 4LCCA 5E9DA 5T1KA 4OFKA 4NBYB 1U8KA 5FHBL 4FFVD 3C8HA 5F7DA 4PLKD 3AS1A 4M7KL 5HGHB 2MHAA 3B5TA 5SX5K 4EDWH 2XPGA 5SWZA 2FECI 3GUTB 1MH5A 3L6FB 12E8H 1UACL 2IJ0C 1A7PH 4I9WD 4CRPA 2JTDA 1UXWA 1WWBX 1KPVB 2H6PA 1LILA 3KPRA 5DO2D 3I75A 2DQJH 4O9HH 8FABB 3RZCA 4ZS6D 1F00I 2XKNB 3GMRB 3HE6A 2J4WH 1VDGA 4RCAA 5FDWA 1DVFB 1FHGA 5DFTA 4UQ3A 5MHSD 5DFWH 4OSUL 3MLSH 5JQ6L 3GB7A 1VB9A 2DQUH 2L0DA 5C9KA 3FN0H 1KC5L 4GRWH 5D1XA 3T3PF 5D7IA 4FQ2H 2GAZB 3MGTA 3MZTA 5JA9A 1SY6A 3KPOB 1NBVL 4MB4A 4DVRH 2NX5D 1TCMA 4D0CB 1FVCB 4PP2A 3LRGA 1FZMA 5E00A 2DBJA 3ZYOA 4DEPC 3FFDA 1AQKH 4U7KA 1Q94A 1BGXL 4R4ND 5DMKA 5C2BL 3FO0L 2XTJE 2J8UB 3UTSB 4P46D 3ARGA 1CGTA 2ATPA 3VFSA 3SKMA 3FQWA 4NJ9H 3G5YB 2Z31A 5FDYA 1MCOH 5FO8A 1MFEL 2VXVH 4FQLH 4N9OB 4OD1L 5EUKA 4J3OC 2HT3D 2JLLA 4TRPL 2JCCE 5GSRB 5IBUG 4F8QA 1QSFE 4IRJB 4UZGA 1T1YA 3ZE2F 5MEQA 4NO0B 3IU4H 2YD4A 1ZGLP 3ULVF 1AKJD 1EPFA 2YPVH 4FQJH 3MSPA 3TA3B 5I16B 3K1DA 4EUPH 3K1KC 3HAEB 2EE2A 4OFDA 4AY0A 3GBML 3GIZL 3WFCL 1JGEB 2HVKA 4MA3B 1X5HA 3LQMA 5FUOL 4C58B 3F6IA 2YUVA 4HIIB 3U9UA 5GGTH 2H41A 4XHJC 5CD3A 3H9ZA 1OF2A 3KS0H 4X83A 4E5XB 1A8JH 2JJSA 2MQ0A 2X4TB 3LKQB 4HDIB 1LE9B 2Q76A 2UY7A 4PJ7F 2P7TB 2XT1B 4N8CL 2WP3O 8CGTA 3EZJB 3DO3A 3MC0A 1E4KC 1MAMH 5DQDL 2D03L 4PRHE 4HSQA 5B39B 5M94B 3VRJB 4WEUD 3V5KA 3T1FA 1ONQB 2A83B 3GBLA 5L7XL 4X4XA 2UVFA 1FPTL 4JPIB 2VLJE 4XZUB 4XC1L 3IU3A 3K81A 4K7PX 4OGZA 3DLQR 1L6ZA 3AROA 5B3NA 4L9LC 4G80B 1YA5A 4LPXA 4OAWB 5JTWA 3IFOB 1RJYB 3UO1L 4XP6L 5FYLD 2GUOB 1FV1B 5HHMD 2IGFH 3P4NB 4KFZC 4MWFB 4GG6A 4Z8FL 3RTQD 3TYFA 3UJTL 3DSNA 4Y1AB 2CD0A 2CRYA 1ES0B 1N7MH 1T03L 2YS4A 4XNXL 3L3IA 2YPKB 3BIAX 3I6LD 4FQQB 4PJDE 3VH8G 2MQ3A 5I17A 1A9BB 3MV7B 1KG0A 1NMCC 2DIBA 1HN1A 4YHKL 2RJMA 1JRHI 1XR9B 3U0TA 3RGVB 2B1AL 4MB5A 3ZE0E 1EMTL 5IQ7L 4JQIH 2XFXB 4NKDA 2RAMA 2HMID 2AEPH 3CSBA 5I15H 4GO6B 1U3HB 2HKHH 3K2UL 4G42A 3KXFB 1QSEE 2W0KA 5J1AB 1IKNA 3CFEA 4LSUL 4R8WH 3QDJB 4AT6B 1A4JB 3F65A 4IDLA 5DS8A 4WGVB 5L0QB 3UBXI 1CD1B 1UM4L 1F13A 1TVHA 4LDOB 2Q86B 1LD9A 3E3QC 4NM8L 3MBED 1A22B 3TJEL 4HWEL 3RWJA 3VXSE 1AO7A 4K3JH 3IFNL 4JDTH 5GRZA 1R3JA 3E2HB 1JK8A 4KJPD 4L29A 2GITA 3GM8A 5B22A 2EH7H 3CFJA 4S0SD 5JXAH 2XKSA 3MMEB 3SKOB 3TV3H 3HE7C 4ZQKB 3NIDE 2BY2A 4RMQA 3QWQB 2BSTB 2E8ZA 3SY0A 4IS6B 1LP9B 4ZNEA 3EDEA 5CIPB 3EO9L 4RGOL 5D93B 4X8JA 4LIQL 1VFMA 2E9IA 1S7XA 4GKNB 4NQDE 4KJQC 4WU7B 3P0VH 3QCVH 4QF1A 1LO3H 2D7PA 4G9FA 2OM5A 3MQIA 4WEBL 1JWUA 3P4OB 1A1OB 4P5TC 4OD3H 4XH2B 1R3IH 4Z7WB 1HILB 4MDJA 3GI8H 4JM4H 3RNQB 5F9WC 3MCKA 1NDGA 1K8DB 1G7HB 2KH2B 4YQXH 5E8EB 3QIWB 1N0XH 2BNRB 3OMZA 3PWJA 3CVHA 4RA0C 1WZLA 4ODHH 3R4DA 3ALPA 2R2BB 4YZFE 2VLRB 2AJSL 1S5HA 3SE4C 1QBLH 2V5RA 3H3PL 2ITCB 4LVNB 4QLRA 5DHVA 4YHZH 3X14B 1LEKA 3ARRA 1OSPH 4FFVC 3TNNA 1VFBB 4PLKC 3DBXA 2AGJH 4TUJA 3RUGA 5JOPE 1RVFH 3IFLL 2DWEB 5C0AE 4N0RA 5FA4A 2C3GA 3J8F7 5HHOB 3C9NA 5CCKH 3IAPA 3ETBF 1PW3A 5JPNA 3OPZH 2ZSVA 4D0DA 4X6CF 1LO0H 3EYOB 1NAKH 4O58L 4CGTA 4LCYA 2GHWB 5BCAA 3B43A 3I50H 5DO2C 2OL3H 5F1SA 5JW3L 4ZS6C 3OKKB 3S96B 1FYHB 4LLDA 4Z5RA 4MS8C 1S7UB 1A0QL 3BI9X 3MJ9H 3WIHA 1LO4H 3BRDA 1EHXA 2J5LC 2QADD 2BERA 2HA1A 4JFDB 5C0JB 2FYYB 5H8DA 2VIRA 1U8OB 5F7HA 3DXAD 4XGZB 2X1OA 2G60H 3MCG1 4MQ7B 4RMRA 2NTFB 4YC2C 1OWWA 5HY9A 2WV3A 3HZMB 1KTKE 4XBGA 4LLYA 3BQUD 4HEPG 3RX5A 1WGOA 4OF7A 4TYUA 1K6QH 3P73A 5BVJB 1NJ9B 4YXKH 1WT5A 2E27L 2Y5EA 3D85D 1MJJA 1U8MA 3QUMB 5C08E 4XPGL 4L8DB 2AJXH 3H9YA 4HUVA 3HC3L 2VOTA 2DTML 4R4NC 3BKCH 4LK4A 3C6SB 3HUJF 1BMGA 1GSMA 4P46C 2VXTH 4MQTB 4PJBF 4F37K 2X2YA 1E6JL 3JVGA 3AMKA 1RZGB 1HINL 2HT3C 4IM8A 4ZPVA 5CZVL 4NDMB 2BCKA 2GK2A 4WUUD 1NMBH 2QQQA 1GGCH 4TUKH 5CKAA 2FX8L 1ZGLB 4XP1H 5IVXB 2V2TA 1C08B 3QO1B 4DKAA 3G5XA 3NABL 4XVJH 2DJ4A 3RVUD 5C07D 3D39D 4MB3A 1TZGL 2AQ3A 2I9LA 3BKML 1KT2A 1IGTA 4WDIB 4UIMA 4PJHF 1RHHB 1ND0A 5CINL 3FT2B 5D5MA 1T22B 1YEJH 3LKOA 4LLUA 3QIUB 3UPRB 1E4WH 1EEUA 1SJHB 3C5ZB 4QHUB 1RZ7L 3DVNB 1FQ9C 1WFOA 3AAZA 1YDPB 4MQXD 5J6GA 3GK8L 4LU5L 2VXUH 2ARWA 4LF3A 5FA3A 2R1XA 3FL7A 3I84A 3RWEA 4CN4A 1XIWD 5E4EC 1RPQA 2CJUL 3OKEB 4OQTL 2CPCA 4P4RB 4JKPH 3LQZB 3TYGH 5KVDH 2XIDA 1DQDH 3AFLA 3HMXA 3ULSB 1JGLH 5ERWA 3AY4A 3BWAA 3HI1A 1UB6B 3GSXA 2O26U 3CVIH 2BNQB 4X5WB 5BJTB 1MJUL 4R7NB 1KN4L 5GGRA 1DL7L 1CE1H 1LDSA 3ZSTA 1P1ZA 2CSPA 4QXTB 4XNQB 3W9DA 3HCVB 4PJFA 2BFVL 4NRZB 3WHXB 2GTZA 4D3CH 4JRYA 5JIIA 2AJYH 2C3WA 4NN7C 4X80L 1OWRM 4NHCH 4G8IA 2FH6A 1QSZA 2ZUVA 4YHYC 2I26N 3RTQC 1HE7A 2NY2B 5C7XL 5GZOD 4PJ5B 4YPGA 4H20L 2VLME 5FUZH 3SDCB 5EO0A 4JZJA 3UDWC 1FNSH 2IQ9H 3VGEA 3N1FC 4Q9BA 2FATH 4OM1H 2Y36H 4Z77A 3LRSB 1LQSR 1ZHBB 4YNYB 5IVOA 2HMIC 5C3LD 4JM2F 4QRSA 1MCHA 1N6UA 3FQTB 3ARBB 1WWWX 5GS1C 2WQRA 1MCWW 3OKNB 4KI5C 1Z9LA 5B8CA 5HYEA 4Q2ZA 5BS0E 2IMMA 3UJIL 2HFFA 4PJ9B 1X5ZA 1R24B 2BRRH 4G5ZL 4HC1L 4UTAL 5DJCA 2JB6B 3KPPA 3VWKB 3MTRA 1WLHA 1W72B 3BPLB 4ZNCD 5K9QG 6CGTA 5ICYA 2YBRA 4OQ1A 3AUVA 5F7EL 1DLFH 1KB9J 3QAZC 1ZHLA 3RDTA 4I2XA 5FYLH 4KJPC 3WIFA 1ZSDA 2WIMA 4XAKD 1PAMA 3LEYL 3WO4B 1JN6B 4H1LG 1U8NA 4MMXC 4HJ0C 5L88L 1I8IB 2E7MA 5IJKA 1F58H 1XGYH 4YHLH 5D2LE 1AFVH 1J05B 4OZ4A 4NQVA 4CW1B 3OG4B 1UVQB 4N1CA 4X6BB 1S7TB 2UZIH 5ALBL 2P5EA 4PRPD 1EJOL 4P2CG 4MXWL 3MACH 3T0BA 2ED8A 1EUUA 3MRKB 1G7PB 4ZFOA 5IB3B 3WS6A 3HR5A 1T0PB 5A2LH 3MRDA 3RVVD 1DSFL 3GSOA 5SWZE 3RBGA 2CO6B 3DUUB 2FO4A 3OTTA 2WIIA 1G0YR 1YJDL 1U8HA 4QEGA 3TJHD 2YMXL 3T8XA 3V4UL 5DEZA 1QLFA 3KPRE 5AD0A 2ZKHH 3FAXA 4ZO9A 1KCVH 3UROR 5MENB 5DRZB 3ZLQC 3UYPA 2ITDA 5INCB 3AS0A 1PSKL 2V9QA 3RWDA 2V7HB 4QRTB 1NCTA 3FMGL 2PTUA 5DJ0B 3WFZA 3E3QE 1NGPL 1VFUA 4R26L 2LU4A 5EBLB 1FZOB 3QO0B 3TBWA 5D7IE 1I7UA 1JWSB 1MFAH 5DK3A 1FFNA 4Y4KD 3KWWA 3U6RA 5IF0A 3JV6B 3EYFA 4RMWA 1K2DB 1NEZA 1NGWB 4JB9H 1CU4H 5CSGA 3BP4A 2DI7A 1Y0LA 3HR6A 4E9LA 1F4YH 3BAEH 1HYSD 3KPSA 3UX9B 1J8HE 3U30B 4CVXB 4HUUB 4XTRD 3RL1A 5BO1L 4R97C 3O6ML 2FLBT 1Y18A 2O61B 4XX1G 4Y19D 5HGAA 15C8L 1I1AB 2D31B 4U2ZA 1UKSA 2OR9L 5BW7C 1OL0A 4J4PA 5KSVB 3FCTA 4XNZC 1BJ8A 5LQBL 4P9HH 1J86A 2HRPL 4GLRH 4MNHA 2L7JA 1DLHB 4F33B 5DRXA 1S9YA 2DQEH 4OJFH 5SX4I 4YLQT 4M6OL 4OCYH 1BZ9A 4NNYB 5MEOA 3ZO0A 1QO3B 3QZWB 1Q1JH 4OFIA 3DVGA 4ZTOL 5EC2A 4NKIL 5DDHA 4JFHE 1BEYH 3T0AA 1MNUH 5KSUB 2DQHH 4QRPB 1FYTB 1FN4A 4C83B 1BD2B 1I7TA 4ODTH 1LDPL 2BRQA 1N59A 1I8KB 3HMXH 3U4AA 3RVUC 3V6FA 3VXMA 4GAYA 1MWAH 1CFSA 3B83A 1HOCA 1WJ3A 3GDBA 4I9WE 4UNUA 5C8JA 4X6DA 2R0ZL 3CLFL 3BE1H 1DUYA 3P3YA 4OZHF 5L2KB 3ARVA 4LSRL 4PRIE 5CP3A 3FOLB 3BP6A 3O2DA 1YEGH 4JVPA 4QRQB 3RZWA 2A73A 4R3SB 2X9YA 7FABH 1R6VA 1T20A 1ZWIB 1CF8L 5E2JA 5MHSE 4OZIF 3MV9A 3QNZB 4MNGA 5ICZA 1FJ1A 5IB5A 1XIWC 4XBPA 2I9TB 1OCWH 3LDBC 4YDVA 5IFJA 1CGSH 4Z95H 2XA8L 5SWQB 2V5MA 3C60D 3FO9A 3H9SA 2E7CA 4Y16B 2NXZD 5DC0A 5ENWB 1PKQA 3OR6A 4P0DA 2LABA 5C09D 5I18L 2FL5B 4HG4J 3HZVA 2G75A 3MLVL 5IHBA 1MHPL 5A43C 3D2UD 1EX0A 5TH2A 1TJHH 1I3GL 3I6GB 4Q6IC 1TMCB 3OR7A 5TFSH 5DJ2A 3PHOB 4U1HA 5DMIH 3QIBB 5H2BA 4APQB 4HIEB 2BXYA 4QRUB 2X4RB 3WFBL 5GZOC 5K33A 4TSAL 1C5BH 1UB5B 3LZFL 3F5WB 4OB5L 4PJ7A 4BFIB 4Y8DC 4ODWB 3TN0A 3NIFF 5HI3D 5E94A 1MCPH 5IT2L 3ZL4H 3FTGB 2DDQH 5DVKA 2FIKB 4UOW0 4YDJA 4WNQB 3PWPD 4KGJA 1WZKA 2VE6A 1T5XB 2AK4B 3O6FD 5M95B 5DD1L 1PDKA 4X6FA 1QRKA 4PRDA 2A1WH 3CLEH 1BM3L 2IFGA 2FSEA 5D6DC 2F54A 5JHDA 4HZLA 4HIHA 4P23B 3MRFB 4QHKJ 2AV1B 1QR1A 1BBDH 1UWGH 3CK0H 4JKMA 4AIZB 3QUML 1QPPA 1RZ8B 1G7LA 1MFBH 1X5GA 1DBBL 1NGYB 1IC7L 3BEWB 2DTSA 5BMFH 4K3DH 4FTVB 1IAKB 4ZNEE 3UC0H 5DQJB 5L9DH 4YFLF 5DLML 1JMXA 1XH3B 4P59H 2PR4H 2GCYB 3DUHA 5EIIA 4JRXD 5D9SA 4MA8H 5FOJA 4GW5B 3FQXB 1NCDL 4G9FE 1PG7L 1X4XA 4JREB 3U4BL 1QLEL 2YA0A 3UXFA 2QSVA 4Z7UF 3VXPA 3CXHK 5JW4N 1WSST 3F62A 1TETL 4HLZG 1U8IA 1KGCD 4K3EL 3G08B 3IDYC 3OKOA 4DCQB 3EJYD 4HPYH 1VEPA 3S35X 4HD9A 4WHTB 5FYLE 5D70H 3WUWG 2VAJA 4M7LL 2P8LB 4QXGL 2WANA 5JMOC 4PJGF 2GJ6D 4OF8A 3WMSA 3PQYD 5FHBH 2GFBB 3I02A 3GSVA 4IJ3B 4KHXL 5DZOA 3S37L 1JGDB 2PXYB 1XCTB 1TZHB 4V2CB 4PG9B 4MCYB 1I8MA 4CDGC 2RR3A 3PL6A 3RUGE 4ODVL 1UACH 5SX5H 4NUJA 1UXSB 3Q48A 3RVVC 3SKJH 4GXUN 2DQFA 5TJWK 3WDIA 1A1NA 3KYKL 2XRAL 1YYMH 3TJHC 5JW5B 2YHGA 3QYCA 4GW4B 1MPAL 5EZJA 3V52L 2W9EL 4Y4HB 3BN9D 5KSAA 1C7SA 1QFWL 4KI5E 2CDFA 3RQ3A 3IAQA 4V1DD 1XF4A 3KG5A 3TBYA 4O02L 3VWJD 4LLQA 4OSUH 5FYJU 5JQ6H 2VZ3A 3SGKA 3QUZD 1JHTA 1X3DA 1KC5H 1UENA 3HKFA 1RZFL 2ZUTA 5IB2A 1ZHKB 1M05A 5EU4B 3KAAA 1NBVH 2X4QB 3NCJL 4IRZL 4M3KB 3EO0A 2X09A 4BSJA 5DT1L 2QJDA 2CQVA 1CDBA 2E9JA 5IWLA 1A6AA 2JJTC 1LEGB 5C2BH 3FO0H 3ELAT 4JO4L 1X5KA 3IDGB 1FBIL 1HYSC 1KB5B 4L3CB 2GT9A 1BQHG 2DM4A 1C5DA 3NCEB 3LB6C 2P24B 1XGQB 5TDPA 4MJ6B 3VRLE 3RA7L 4OD1H 3JZ7A 2C3HA 2IH1B 2ADIB 1IGYB 5DK2B 3D25B 4HUMB 3CPLB 3IETA 1PZ5A 2IC2A 3P9MB 5C0FB 3VCLA 3MA9L 4PR5B 3D0LA 3GBMH 3NIGE 4KV5F 3C5SA 3B9AA 3L1OH 3TESA 4A2LA 4K94C 3KDMB 5FUOH 3MRHB 3KYMB 4XCYB 1DVFD 5IBUB 4WV1A 2R0WL 2FNBA 1W72L 3KR3L 1CIDA 5D5ME 3QDGB 1K3IA 3VFVB 4ZSOA 1ERNA 2DICA 1HHKB 4WFHE 3QWOA 3QA3B 4NJAH 4MJIB 4YHNB 4G8FA 2YSSB 5D1QD 1WBYA 4X8XA 2D03H 5DQDH 4JHAL 3INUL 3BPCA 3VXOA 1T21A 4NSKB 4IMLA 2GIYA 1U92B 1J0YA 5L7XH 3GSNA 4OV5B 1FPTH 3ECBA 2UUDH 4I0PD 3V7AE 1KENL 4XC1H 3UTSD 1GOHA 3W82A 1BZ7B 1CDJA 1IAMA 4QHMB 1M7IB 4RIRA 5IFAL 1BPVA 4MGXA 4NWTL 5IW1A 3HUJA 3NPZB 4UDTA 4XRCB 4XP6H 2WUCL 3RNKB 3P11L 1OY3B 3KJ4C 4PJBA 1KTDB 4IRJD 1FFOB 2IPTL 4PJFE 4NO0D 3V6BR 4RA3A 1LK2B 4Z8FH 3UJTH 1JV5A 5ACMA 1K5NB 3TA3D 4RDQG 4XNXH 4XVSL 2HTKD 3P4LA 3C60C 2AI0L 4DKEL 3S7GA 4XWGL 3SJVA 2NXZC 4YHKH 1N5AA 1KELL 1NCUA 2CLVA 1EMTH 5F89A 4ZFZA 1JNNL 4IMKA 3DV6B 1VHPA 3RHWF 3C5JA 1CGXA 2LTQB 1KNOA 5HGHA 2Z31D 4LCUB 3K2UH 3DX8B 3OG6B 5GHWL 5IKCB 3RX7A 1HXMA 2DLGA 1H9VA 4ZOCA 1UC6A 4WUUE 4FQHA 3HRZB 3GUTA 1QEWA 4LSUH 3VH8B 2APVA 1DE4B 1N2RB 4R9HA 3X11B 3HMWL 5HI3C 2EZ0C 3U0PA 1CFQB 1BHGA 4RGMB 1UM4H 1G9NL 1GAFL 2XKNA 4D8PA 1IC4L 4NM8H 3SGKC 3TJEH 3NGBC 1TVDA 3DTXA 1QFWI 3OJDB 4NYLA 2X4PA 4AEIL 4EBQL 1Q9OB 3IFNH 3TO2B 1U8PA 3O6FC 5BQ7A 4IOSD 4RWYL 4HS3A 5BZWA 2PYEB 5CLWA 4X7TA 2HFTA 5JNYB 4Y5YA 3Q5YA 3HG1B 3HZYB 5CD5D 3RP1A 3GMOB 2DM3A 4I2XE 2OLDA 5IWLC 3KPOA 2DYPB 2EDTA 3EOYG 3TO4A 3B2UD 4HLJA 2E6JA 3A0OA 5E5MB 1GCFA 3EO9H 3GJFH 4RGOH 1HSBA 1OSZA 4LIQH 3BGFB 4M4PA 4S2SA 3RU8L 4MA7L 4P49A 2YA1A 4NFBA 2H26B 4Y1AD 1SEBB 2X70B 5KOVC 3W5NA 4QRRB 4I8DA 4ONFL 1ODAA 4HXBL 3FRUA 2COQA 3QNXB 5IR1A 4O2EA 4WEBH 1TQCB 3IJYB 5EU3B 4EZMA 4OCWH 2JJUA 3CH8A 3RGVD 3MXVH 3C6LB 3G5YA 1D9KA 1NFIB 3DMMB 4I48B 2WM0A 3DRTA 2P5EE 5CJOL 2GKIA 3C87A 3ZSSA 3BDYL 5GSRA 4QOKB 3SDAB 3QDMA 5CP7B 1J1OL 1MAKA 3ALWA 2XNAA 3KXFD 3REWB 1U8QB 2LU3A 4JM2A 2AJSH 2QBWA 4FQXA 3PWLB 4RFEA 3WLWC 3QDJD 5I16A 3H3PH 3MV01 2F53A 4ZFFB 5C0EA 3HAEA 4PJAF 4TUOB 2W07A 5IESL 4ZUVB 1KXTB 2OS7A 4HCRA 3MRRA 5DTFA 1JGEA 3IFLH 1YMHB 5ISZB 1MLCB 3LH2L 3E1F1 4GUPA 4MXVE 4UDUB 1NCAL 1OP9A 5DUPL 2DKSA 3TT3L 4WJ5A 5HHPA 1D5BB 4O58H 4M6NL 3NCFB 1HHHB 2W60B 5DJXA 5JW3H 3VJ6B 1IQDB 4NKOB 4FP8L 4HX1B 3BN9C 1A0QH 4F7TB 5B39A 2R4SL 3WL9A 3BRFA 4OFYA 2A83A 3U36B 2VLKB 3EYQD 2H32H 4OZFG 5T1LB 3VWJC 1INEL 1II4E 5LXGL 3QUZC 3W2DL 3QCTL 1RK0B 1KXVC 5F3HA 4G80A 1YNTA 4OAWA 2PETA 3IJHA 4N0UA 2E27H 4XPGH 3CFIC 2A74B 2Z35B 3QIWD 1JGVL 3HC3H 2DTMH 4KROD 4UAOC 1IL1A 3DNKA 1T2XA 3BP5A 4JAMA 2VLRD 3BIBX 3MNWB 5BRZB 2WBJB 2PYFA 1E6JH 1F90L 1CICB 2BOCB 1ES0A 1CTNA 4QCIA 2A6DA 2SEBB 2YN3A 1A9BA 3MV7A 1R5VB 2HTLD 1HINH 2A6KA 5CZVH 4WI8A 4HH9B 1IGFH 3O2VL 1OTUD 2OTUB 4GXVL 4P2QA 4NZTL 3X13B 2XFXA 4YGVB 3W5MA 5CGTA 5FV1L 5HHOD 4M3JA 1GGBL 3NABH 1U3HA 3L3OA 4FQCL 3VA2C 1TZGH 3U2SA 4LCWB 3BKMH 3BGMB 3VXME 3ARFB 1EV2E 2NYYD 5DUML 1A4JA 5CINH 4K07A 2EDHA 3QH3B 3VGAB 3D3VB 4EI6A 4JZNB 1DVFC 4KDVA 4K8RL 3QUXD 4X6DE 4JFDD 3IXTB 1T04A 4LKXA 1RZ7H 4PGEA 1P69B 3LVEA 3Q3GB 3WE6B 3GK8H 3BH8B 5IBLD 3KLSA 4LU5H 5D1QC 2CDEA 3CD4A 3G6AB 5I0DA 2FJHB 5KVFL 4NZDA 4FQIL 4OQTH 4JJ5B 5DJYB 1WBXB 2AXFA 1WAAF 1KPRA 4MNGE 1B0GA 4WVRA 1MHCB 4ORGB 2BSTA 1AGEB 1ZT7B 4I0PC 4IS6A 5CIPA 1FO0A 2BSRA 2CH8A 1KN4H 4M8QB 2NTSP 3ZTJH 4PGCB 4EOWL 4WU7A 5DMYA 3GSQA 5I1GL 1SVZA 3H7BB 1S7SA 1PKQE 4WTZG 3CSGA 1YMMB 5AAWA 3P4OA 5I1IL 2BFVH 4M1GL 3PIQB 4IRJC 1KUMA 3OZ9L 1PLGL 5SX4H 4X9IA 4H25A 1X9QA 1KLUB 4J3SA 4OLVH 2D3VA 2BNUB 3H6JA 5E8EA 4H20H 2OI9C 3TA3C 2BNRA 4LHUD 4X6EB 4AMKL 2HTKC 3MRNA 4NGHL 1L0QA 1VFAA 3VMNA 3TVMB 1V8HA 4P9ML 4KVNL 3RX8A 3N1GC 3NA9L 1EZVY 1AXSB 1UWEL 3GMPA 3O3DB 1GVIA 1VFBA 3QIUD 1OAKL 3HRPA 1KXQE 2VDLL 2YPLB 2YUWA 1U8LB 2B2XL 3GSWA 4Z76A 1VPOL 4HIJB 1ACYL 4NQEA 1VGKA 1CLZL 4MHHG 2DM2A 5M7QA 4XNMB 1ZVSA 1YJDC 3UCRA 3K8KA 5JHDE 2C4FU 2N7AA 1IC1A 4QWWD 4G5ZH 1OLZA 4HC1H 2GQHA 4JDVA 5FYKL 3BWUC 4UTAH 1KB5L 1MEXL 4D9LL 2R2HB 2BNQD 1WVZA 2YD8A 2VYRE 4GH7B 5F7EH 1K4CB 5C0JA 1T89C 3LPWA 4L8SB 1VACB 5IMOB 4RZCB 5CD5C 2NTFA 2OMBA 3LEYH 3T08A 3MO1A 3Q1SL 3BD3A 1NPUA 4LDLB 4ZOEA 3B2UC 2AJ3B 5LBSL 1X4YA 1W2KT 3GEWB 4A6YL 1NJ9A 2NY2D 1CD8A 5EZIH 4PJ5D 1L0XA 1CFVL 5I9QB 4L8DA 1XR8A 4LKCA 1WIOA 4OF3A 5ALBH 4MD0A 3BH9B 4MXWH 4YR6B 4OI7A 2RCSL 4MD5A 3RGVC 5GS0L 5DYOB 4Q74A 1NC4A 4QKXB 4EVNA 1TZIB 3OXSB 1AP2A 1EHLL 1ETZA 3ORJA 4J23A 4NDMA 4H1LB 2AABL 3JSSA 2OYPA 1H15B 5T5FL 1DSFH 3IRZA 1AGDA 1U3HC 3ARBD 1YPZF 5E99L 3MLZL 1YJDH 3L3DB 4Q9RH 1C08A 2YMXH 3QJHA 2VAAB 4PTTA 3DV4B 3V4UH 1RY7B 4PJ9D 1ORSA 2C1PA 3F7YB 3TIEB 3WO3B 4G8EA 1DBML 1BJ1J 5L0QC 2AS5M 1KJMA 4G7VL 2JIXD 1JZ3A 1AE6L 1PSKH 3VWKD 2VRAA 4ODXB 3FMGH 5CBAB 3PUCA 2WWKT 1NGPH 4R26H 3PWPE 4G6JL 1HH6A 3UPRA 3WKML 3C5ZA 3I9GL 4QHUA 1A14L 3E2HC 4N8VA 1YEKL 1DQQA 3V8CA 4NO2B 3O9WB 5F44A 1LE5B 4KK6D 3BDBA 3V6ZA 3MUZ1 4YO0A 5D93C 3UZVB 1X5FA 2XWBB 3MLTA 3EYQC 1RIHL 5BO1H 1BFTA 2R39A 3MFGB 3O6MH 3QI9B 5HVFB 3O45B 5F6IB 1UB6A 3WHE1 1M6OB 3DX6B 15C8H 5BJTA 3HN3A 2W1NA 1TJGL 4RFNB 1CDCA 2OR9H 3FB6A 3JTTB 1R5IA 2EDOA 1AD0B 2QEJA 5LQBH 3HCVA 1KIQA 1FNAA 2HRPH 4NRZA 3KYNA 2EDXA 3WHXA 3WNOA 3PJSB 3QIWC 2DI8A 4KROC 2A2QT 1JTPA 4L3EA 3R1GL 2ENSA 1HHGB 3RFZC 4WFED 5SWSB 4M6OH 4GRWB 4W4OA 2BMKB 2W59A 5KSBF 1BX2B 2KUTA 1OAYL 2NY4B 3SDCA 4LVNC 4Z7UB 5MEND 1JF5A 2O5YL 2Z8RA 5DR5L 2HTLC 5FIEA 4NKIH 4IHOB 1CDYA 3PQYE 3HC4L 3V5DB 3TBTB 2VKXA 5EG6C 5FAAA 2X44D 4ONGL 4YNYA 5I8OL 3LKPB 4Q0XL 1LDPH 3O3EA 2B5IB 4JCMA 3GM0A 2R1YA 1EVTC 5LAXB 5IOPB 3NCMA 5CJQL 1Q9WB 4ZPTA 2R0ZH 3CLFH 1WCQA 5HGBB 1R24A 1H8NA 4GKOA 3S36L 4LSRH 1ZA6B 2YOCA 3VD3A 4RAHA 5F7WC 4F9LA 1T1XA 3QUXC 3L9RB 3BYYA 3LEXA 2JB6A 3FONA 3S5LG 5HGGS 1CF8H 1W72A 2N1KA 2H45A 5HYQB 4F9PA 1I1AD 2ZPKL 3FJTA 1Z2KA 3QQ3A 2Z0BA 4DUVA 3K8LA 2X9XA 5I1CL 3UP1A 1F3JB 4Z78A 2CKBB 2PW1B 2CRMA 3WJLA 2XA8H 3UJJL 3DHMA 4Y2OA 3IVKB 3TPKA 4L8BA 4P5KB 5I18H 3BUTA 2V5YA 4LP5A 1HI6B 3MLVH 5IEHB 1MHPH 4HUWB 3PP3K 2DN7A 5EO1A 3DO7B 1UM5L 1T3FB 5INDA 3MUHL 3W9EB 1GGUA 3QUKB 1IKFL 4QRPD 4MQSB 1FH5L 3FFCA 3TBVB 4JFFB 3G5VA 1BD2D 1LO5B 5JOFA 3FQRA 3CFBA 4GBXA 3O4LD 4TSAH 3LZFH 4GQPH 3GJEB 4OB5H 3MRQA 2AQ2A 4AYFA 4TVPL 3MRGA 1EO7A 5H94B 1FNLA 2PO6D 5IT2H 3PNWB 3PF2A 4UNTA 5DVLA 2YC1A 1CLCA 5FB8B 4TNWK 4NCDA 5L2KD 2A38A 4FXGA 5DD1H 2JCCF 3QIUC 2HH0L 3RWCB 1BM3H 4WWKD 1D5MB 5FM4A 4BQCA 4QRTA 1DQML 1I1CA 4ONOA 5J13B 1FZOA 4LDEB 2XZQL 3QUMH 3MV8A 3RPIB 4Y2DA 1JWSA 1ZLSH 4BSVA 1DBBH 2I25N 1IC7H 4QWWC 4K7FA 1LEIA 1KIPA 1MQKL 5DLMH 4Y16D 5DVNA 3VXQB 3IDMB 5DRWA 3X12B 1MHEA 4U3CA 2VITB 4CVXA 1NCDH 4H88L 1PG7H 3DOSA 4OZGB 2OZ4L 2ZUWA 4IOFD 3UTSE 3U4BH 4D9QD 1QLEH 2O61A 3U0WL 3RWFA 1KPUB 3GRWA 5C0CB 2YRZA 1TETH 4K3EH 4JCLA 2D31A 3L7EB 3UYOD 5HYJA 1QKZL 1DQLL 2BX5A 3QIBD 3QDME 4P4KD 1DP0A 4APQD 4M7LH 4QXGH 2NY2C 3QPQD 1F42A 2GSGA 2W9DL 3NZHL 3SDCC 4KMTL 1P7QB 1CDHA 3MODL 4GMSL 4KHXH 3S37H 3KHQA 2WWMD 3EDKA 4ZTPL 1I1YB 3E0GA 1N3NA 2F53E 4G8GA 5F71A 4HK3J 3NFPB 5IB1A 1S9XA 3ULVD 2V6HA 2E7LC 1BECA 4HQQL 5F7NC 1U95A 4EI5A 2YWYA 1FYTA 3ARBC 3MLWL 4I3SH 3WUWB 4AEEA 4LMQI 5F6HI 2PCPA 2XRAH 5ANMB 5GRXG 4C83A 4W81A 4P23D 4NRYB 1N6QL 5EU6B 5DQ9A 1MPAH 2W9EH 4PUBL 4BA8A 1QFWH 3J7HA 5EWIL 4PJ9C 4PJDF 5CJXA 4HS6A 5IJVA 4LLMB 1T1WA 4DZBA 2BVEA 3QULA 4O02H 1KCKA 4Q7DA 4BK5A 4K8RD 3ZE0F 1I7ZB 3VWKC 3OJVC 3KPNA 3BPLC 1RZFH 5I71B 5KW9L 4F9PC 2EYRB 3ARSA 5HDOA 3ET9F 3SGDI 3NCJH 4IRZH 5LCVL 2DQTL 3SDXA 3WS3A 3VFNB 4YJZL 3NMEA 3QFJA 5DT1H 3W39A 3WJLC 3WO4C 5C6WH 3QNZA 5T33H 4JLRB 4JO4H 1INQA 3DYPA 1FBIH 5F7UA 2A9NL 3NAAL 3U4EB 1LWRA 1NBZB 4FXKB 3RA7H 2VJXA 4HHAA 5ADOL 1PY9A 4Y1AE 2ZCLH 2FBJL 1J9CT 4TSBL 5JXEA 3MV7E 5K9KA 1NAMA 3VGFA 2W0LA 4PJAA 2OR7A 2AJVH 2JJWA 1DDHA 3I6GA 4HXAL 4P2QE 5CMAA 3NIDF 1PGRB 4LRIA 1TFHA 4L4VA 3HPLA 2HVJA 4G43B 1BQHB 3MA9H 2XXMB 3LN5B 5A40E 1WZ1L 4QRUA 4KKLD 3CZJA 3H9HA 1OM3L 1FAIL 2X4NA 5CWSA 3LIZL 2R0WH 4PJCA 1TXKA 3FTGA 3CSYB 4MAYA 3ZE1E 1XF3A 4NQCB 1YEDB 3QDJE 2OXHA 4WNQA 2NY3D 3N9GH 1F11B 1BIHA 5JIKA 1KFAH 5KZCD 3O41A 5I73B 4ZXBB 3HLAB 2WQ8A 3QEGL 4JHAH 3INUH 4JHBA 5HYSG 3MRCA 1MRDL 4NT6B 4DZ8A 3MJ6A 2ZUYA 4RQQB 3ZT7A 2XQYG 1QACA 4Z7NE 4RNRA 4YZFF 1HWGB 5FYKD 4GKSA 1VADB 1KENH 4F3FA 1G9NC 4XWOC 5IIEB 4O5LL 1RZ8A 4DFHA 2W0PA 3U30C 2DLEA 1MREH 1Q9KA 3D18B 4FTVA 1SVCP 2DLIA 4PY7B 1IAKA 3EOBB 2ZUQB 4NWTH 3MPCA 1XH3A 1HDMA 2FRGP 4JR9L 3C8KB 3RWGB 1IFHL 2WUCH 4RMVA 3P11H 5ESAA 1I1AC 4HJGB 2XICA 5J6HA 4FZ8L 4PRAB 2IPTH 1RMFL 4HAFA 3FO1A 3V7MA 2D7TL 4R7DB 4AG4L 1SBBA 3ZDZE 1A6VL 2YWZA 1ZV5A 3G08A 4XVSH 2VISB 3W0WD 5C0BD 4DCQA 4HWZB 2AI0H 4DKEH 3QRGH 4FNLH 2OJEA 5DHYA 2Z92B 5DJ8B 1OGAA 2P8LA 1IVLA 1KELH 2BNRE 4LNRB 5JIPA 1WTLA 5F8QC 2NX5B 4LL9A 4I1NB 1JNNH 2IQAA 4Y7MA 5GS0D 1FNFA 32C2B 4PP1D 2PXYA 3ROLA 1ZANL 2IPUG 5GHWH 4D0BB 4MJID 5IMKB 4E41A 5ITFA 3MBXL 1YECL 1S8DA 3QG6A 1P4BL 5I1DB 4F15B 5L2JA 1ZGLM 5CJXC 3HMWH 4D9RD 1CTOA 3QUYA 5JW5A 4JKLA 1G9NH 1A3QA 1GAFH 1RZJL 3VFTB 1IC4H 4X9HA 4EBQH 2KPNA 2W65A 3V0VA 2MMXA 4JY5L 4OF5A 4NZUL 4U05A 3CUPB 1A21A 4RWYH 3MOQA 3IDJB 4H0GA 5EZLB 1RHFA 5FK9B 2HJKA 4WWKC 4U0RB 2FB4L 2DQJL 3BKYL 1EFXD 3MNZB 3AMLA 1Y6MR 4XPBL 1FVEA 4R4FL 1VA9A 5IV2A 3RIFF 2YR3A 3EBAA 3RU8H 4MA7H 3OGCA 4S1RL 5CHNB 5FO7B 4XNYL 1C16B 4ONFH 3SE8L 2YD5A 4HXBH 1Z5LB 3FN0L 2ICWB 4Y16C 3OHXA 3IDGA 3PV6A 4IBLT 5F7FA 1HKLH 1D6EA 1QFWM 1JZ5A 3NACL 1XGQA 4JPKL 1JPST 2MPAL 5E4EB 1K8IA 4IOFC 3MREB 5CJOH 1EO5A 4ZO7A 3BDYH 3QWRD 1DCLA 3QHFL 3TLRA 4RAVB 3N1PC 1KJ3H 4LBEB 4HK0B 3QIBC 5DK2A 3D25A 1H8OA 4APQC 1RIVL 1MVUB 4G7YL 4KDWA 2FWOA 4FQLL 1V3MA 5IVXE 5CJ5A 2BSSB 5IESH 2J8HA 2X89D 1UG9A 4M93B 2BVPA 2NW3B 1A5FL 5HHMB 1A3LL 5D71L 2D2OA 3LH2H 3CMOL 3VU2A 3KDMA 3MRHA 4DAGL 4ZD3L 1V3JA 4XCYA 5DD6A 1NCAH 5ESQB 1UFUA 2Z93B 5DUPH 5F96L 5IK3B 3TT3H 4QNPF 3STLA 2Y1VA 2PYED 3QDGA 3VFVA 1WWCA 3HG1D 3QA3A 5F7LB 4M6NH 2VABA 4YHNA 3FHQA 4NZJA 4P23C 5DK0A 5D7JD 5GRVL 2CKBL 4FP8H 3T77B 2DYPD 5EZOL 5JPMA 3THML 2VQUA 4RISL 1ZLWH 3GI9L 4M5YL 5IMLA 5CEYB 5FGSA 1INEH 4QRRD 4P2RB 2ATKB 4OV5A 2R15A 4K8RC 5I30L 5JW4R 2VZOA 3FB5A 3W2DH 1NC2A 1BZ7A 2APXA 1UT9A 3T0EB 2EEBA 3NCYP 1JPFB 1EEZB 1FORL 3C6LD 5K9QI 1JI2A 1EZVX 1H3GA 3DMMD 4JREC 5JLZB 1NCNA 2B8OT 4M7LT 1SJXA 5I8CB 5HDLA 4Z7VB 3I3DA 3RNKA 4QOKD 3SDAD 1G6RB 1KTDA 2ERJB 1JGVH 4LVEA 1FFOA 3MBEB 4JHZA 4D2NA 3MJ7B 3ILQD 5F1KC 1LK2A 3DGCR 3CCHB 4OZFB 2DKMA 1OTSD 5LVEA 4L3EE 3GMQA 1N8ZA 1VCAA 3P4MA 5JR1L 4PJ5E 4KDTA 2X4SB 3O2VH 4BH7B 2PXYC 5ISZD 4GXVH 4NZTH 3JUYA 5GRYA 5E6ID 4NZRH 1L6XA 1QRND 5IUSA 3VDBA 3B4NA 1S9WA 4YBHA 1WIPA 1QLRA 1T5WA 3DX8A 3GSRB 2XA3A 1TTFA 4FQCH 4HKXB 3PABB 1SM3L 1MVFA 3MNVA 3HRZA 2C3VB 1YNLL 2NQCA 4KKLC 4M61A 3VH8A 4JFPA 1R3HB 4Y4HC 1L4IA 4XP4L 5DUMH 3QQ9D 4JFEA 3X11A 1S78D 2AEPL 2XV6B 1U9KA 3L7FB 3OJMB 4K8RH 4HV8A 5GJTH 3STZB 3CDCA 1NANI 3X17A 2O5ZL 5EA0H 2VDPL 1QFOA 2DL9A 5ID1A 2NY3C 2C7UB 4QHNB 4KQ3L 1AGCA 1F97A 2VSCA 4XC3L 5KVFH 1YEHL 1ZT4A 3GIVA 3ARED 5JNYA 4U1IA 3HZYA 1XCQA 3OAYH 3KPLB 2YA2A 4LP4A 2Y06L 3MLPA 1ZT1B 2K1MA 4YHIB 5FCUH 1M71B 4QHLB 3T0XA 5BRZD 1YYLL 1NBYB 4YFLI 2G2RB 2H26A 2WBJD 2X70A 3N0PB 4EOWH 1CICD 4PGJA 4LSDA 4Q9CA 5I1GH 3WFHA 1EFQA 2EH7L 4P3DB 5I1IH 1CDUA 3NN8B 1C1EL 5KSBA 3ILPA 4LEOA 4E0RA 3DSFL 1EGJH 3OZ9H 3DX9B 1PLGH 3GMNB 3P9LB 2QADB 5D7IF 3B8YA 4MZ3A 4OLZL 2R0KH 4WU5B 3SCMB 3JBG7 1NDMB 1MRFL 2BY0A 4NQSB 4AMKH 4NGHH 4TSCL 3LCYA 4NPYB 1H5BA 2B7DT 4P9MH 2VDRH 4KVNH 3BQUB 4FHBD 1RZIA 1RK1A 2BVOB 3NA9H 4OKVB 1TCRB 3GI8L 1GXEA 1IT9L 4G6KL 2P5WB 4R2GB 3L3HB 1UWEH 3D3VD 2VWEC 4WFEE 3D85B 2Q7NA 4ZUVA 5GS0C 3EFFA 4MNQD 1OAKH 4IIQB 4PP1C 5GQBA 1PBYA 3OF6D 1JZ6A 2VDLH 1BFOB 1I85A 4L8CB 1YMHA 1MLCA 2DD8L 2B2XH 1VPOH 4HUKB 5DMGD 1CLZH 2XZCL 2ZJSL 5BOPA 1R3KA 4HGWA 3RWIB 3KYOA 4WENB 2CDGA 1D5BA 2OTWB 2CMRL 1DBKL 5FYKH 4UINH 3EOAA 1HHHA 1F6LL 1G7MB 1EAJA 5DFVD 1KB5H 1MEXH 1YQVL 1TLKA 4D9LH 4XAWL 2YD3A 4HX1A 1CFTB 5F7KC 1NKOA 1NGXA 5E8OB 4KK9D 4QT5B 5EC1B 5HI5D 1MI5D 5T1LA 4YEFA 5C07B 3D39B 3LQAH 5T3ZE 3WXVL 1YMMD 4PBVC 3K8MA 1ADQA 5TF0A 4GFTB 4PJEA 4XPHL 3EO1A 2ESVD 3CDFA 5CEZE 3Q1SH 1RURL 1A6TA 1NGZA 5LBSH 1BIIB 4A6YH 1J1PL 1A4KB 2PTVA 2VQ1B 3FQNA 5HYJE 1CFVH 2Y7QA 2A74A 1SJEA 1HSAA 3BRGC 4HEME 5C0ND 4TTGA 2C9AA 1H3WM 5JORA 3I3EA 1I8LC 1ZE3C 3HB3D 5D7LB 2CR3A 3T0WA 2RCSH 4B41A 2BVTA 3LPGA 4Z0XA 5GS0H 3OB8A 1CGUA 2VN7A 2SEBA 1EHLH 1AC0A 4HH9A 2AABH 2LTQC 2ENYA 3LV3B 4JDZA 3BKCL 2YPLD 2F74B 5IROC 1OVZA 4YGVA 3MLZH 2VSDA 3F6LA 4ZDHA 4UMGA 1FYTE 1IM9B 1QSFA 3BHBB 4MAUL 1C7TA 2A6IB 5FO9A 3S37X 4P2OD 2EXWD 4GG6F 4GRMB 4Q6IB 2UY6A 1DBMH 3OX8B 4YFDB 3BO8B 4HULB 3VGHA 3FO2B 4RGMC 1GZQB 4LCWA 5DEFB 5LGJB 1AE6H 2DQIL 3ARFA 1QUNA 5F1NB 1JNHA 5E8NB 5F88A 3IXTA 4ETQA 4NHUB 3WKMH 3I9GH 5L2KE 2J6EH 1Z6JT 3VFWB 1YEKH 3ARXA 3ZDXE 3MRMB 3AGVA 3G6AA 4RGNB 5DJAB 3SDXE 2HN7B 1CS6A 2DIAA 1T6WA 5CSBA 2NPLX 4OCSH 2NY7L 2OSLA 5GRUL 3S4SA 4ZODA 1YEEL 1F2QA 1RIHH 3ULUE 5FUCC 5B4MC 2AXGA 1MHCA 1AGEA 4WGWB 1TQCC 3B2VL 5DA0B 4M8QA 1FZKA 4M03A 3SQBA 1BVKA 1PQZA 1LVEA 3C6LC 1AHWA 4BFGA 3S6CA 3DMMC 3UTQA 3B3IA 1D5XA 4XBEL 1B90A 2YD6A 3D69A 5F97E 3SDAC 5D7KE 3H0TB 3AM8A 4YHPB 2D7QA 2N56A 3CVIL 3R1GH 4HUXB 1S7WA 4HKBB 3ILQC 3V7AG 1JMZA 1KLUA 1ZXQA 4ELMB 2EE9A 2Q3AA 1OTSC 3BEVA 1A2YB 1OAYH 4HGKC 4ZAKA 4JGUA 1MCBA 3K74B 4X6EA 9CGTA 5C9JB 3IJSB 5DR5H 2VXQL 4P5MB 4TN9A 3TVMA 3QXAB 5KG9A 1LMKA 4MCZA 3HC4H 5I8EB 4LVHB 3LN9A 1XF2B 4CJ1A 4WW2A 3NFNA 1QP1A 4ONGH 5I8OH 1F3RB 4Q0XH 2IANA 5E6IC 3SGJA 4GW1A 5IQ9A 3ZE2E 3CC5B 4KHTL 4HMCA 2AK4E 4U6YA 4RAUA 2VLJB 4PRPB 1CT8A 5C6TL 4HIJA 5FGBA 5CJQH 3CFDB 2PTTB 4Y5VB 2Y36L 3RBSA 1MCKA 3O9WD 4BFBD 4I4WB 2P43B 3QEQD 5HGDB 3S36H 1F2XK 4TVSa 3QQ9C 3R0NA 1S78C 3IF1B 3O8XA 5BZDB 1G1YA 1REIA 4XCCL 3CFKB 1RQ5A 3SGDH 4U2YA 2AV7A 4Y4FD 5HHQB 4C56A 3P30L 2R2HA 5EU7C 4ONHA 4FTVE 1DZBA 2ZPKH 3CZFA 3RUGF 3ZKND 5KS9B 2JELH 4HG4K 2VUOA 5I1CH 4L8SA 3AREC 1QHOA 1RV6X 4KQ4L 5EU5B 3BVNB 3UJJH 1AD9A 3KPQA 1CN4A 4KI5F 3ARZA 5SWSD 2WBJC 3S5LB 1CICC 5T3XD 2NY4D 3WBDA 4XPTL 1OGAE 1QSEB 4Y4KB 3RL2B 3JTSA 1T2QL 3BH9A 1UM5H 4YR6A 3VXTB 1YUHA 1UJ3B 5KAQG 5JDSB 3UTTD 4MJ4A 5DYOA 4BZ1L 1FH5H 1TZIA 5E0QA 2DOCA 5E03A 4H1LA 2MJWA 3ESVF 1H15A 1T4KA 2VDQL 1G9EA 4E41E 4PJXB 2OP4L 4Y19B 3ARQA 4EN3B 1FZJB 2IBZX 5EBMA 1HWHB 3D48R 1OAQL 1P5VA 3VG9B 4OLUL 3ARFC 1BLNB 5BVPL 3TIEA 2ICES 1S7RB 1UZ6E 1JPGA 3MGOB 2HH0H 1D5ZB 3FAWA 1E28A 3EOTL 1L9MA 3L95B 3U79A 1IGJA 5DMGC 1DQMH 4QY8A 1C12B 3WN5C 4NQDB 1JF1A 4Q97A 4UU9B 2XZQH 4JFQB 4L4TB 5C0AA 1G6RL 1YY8A 4M7ZB 5HHXL 2XACC 3B9DA 4LSVH 3NIGF 2AK1L 5DFVC 3C09B 1AGFB 1MQKH 1LE5A 4JANB 1V5JA 4I18C 3H8NA 5HI5C 1FL5A 3BIKB 4H88H 3VRIA 2R8SL 3SOBL 2OZ4H 4XP5L 3QI9A 1KLGB 4YX2L 5D5MF 3O45A 3U0WH 2CGRL 1T66D 5FECA 4HK3N 3VFUB 3BZFB 1A6ZA 1QKZH 1HHJB 1Q9LB 3BAEL 4GKZB 1DQLH 3JTTA 3GZKA 5KVGL 35C8L 2QQLH 5BXFB 4MA1B 3CNKA 2XXCB 1P53A 4QGTA 4EDXB 5C70A 1NEZG 2VUYA 3PJSA 4MD4B 1OP5H 3NZHH 1HXYB 4KMTH 5DI8A 3MODH 3PWUB 3KJ4B 4GMSH 4ZTPH 3TZVA 4ZOBA 3GGWB 3MROB 4U1NB 2R2EB 3LSOB 5TQ0H 4U1SB 4C55A 2F5AL 4P9HL 2NY6B 4HQQH 2DL2A 2Y9RT 3GJFB 4IHOA 5IG7A 2VWEE 5C1MB 3V5DA 1TITA 4XCEA 3MLWH 3RIAF 4PJFF 5H35B 4PV9A 4GJTB 5FGBC 1JTTA 3NCYS 5C09B 1N6QH 3QDGE 3HZKB 1ORQA 4PUBH 1QYGL 4PBWD 5EWIH 3D2UB 3ZDYE 2KBGA 4CN6A 3FFCD 1GC1L 5LAXA 5IOPA 3HI6L 1CFNB 3B9KD 1Q9WA 3G5ZB 3RI5K 1I9RL 2FJFA 2WP3T 3A6CL 3H7LA 3MCLH 4X99B 4D9RE 4FABH 4IRSB 2G9HA 5HGBA 4JY4B 5KW9H 2X10A 1DTUA 2HFEA 5JO5A 5C08B 4JZOB 3RVTD 2CUHA 5DZNA 1TNNA 2EO9A 2DQTH 5LCVH 4HKJB 4L8SC 3GHEL 4W6YB 4PLOB 5DZLA 5C0CD 4EUPA 1M4KA 1PY4A 3QHTC 1KV3A 1TNMA 4ZUWB 5F9JA 4I13B 1Q0XL 1UQSA 3EFDL 5MERB 4HBQA 5E6ZA 2A9NH 3NAAH 5I1HL 4LVOB 2W38A 5E8PB 1FLRL 5GGTA 4AM0A 1P84K 1P5UA 5I9QC 3WJJA 3IVKA 5ADOH 5FF6B 1WITA 3ES6B 1KACB 4TSBH 4K3GA 4JFYA 4G6FB 3P0YL 3MJ8B 2H3NA 2BZDA 1T0NB 2I60L 3WLBA 5TGBA 5J1SC 3DO7A 4HXAH 1T3FA 4U6XA 3W9EA 4BK4A 1IILE 3MYJA 4EJ1C 2N4IA 4M9OA 5FYJE 4JFFA 4AIXA 1WZ1H 1U91B 4S1DD 3WV0A 1LO5A 4ZUUA 5D1ZB 3UPCA 2EIZB 1OM3H 1XGUB 1FAIH 2RBLA 5H94A 4MSWB 3LIZH 4AEFA 3Q6FA 4U6HB 4OCMC 2OR8A 3VFOA 3IXAB 4JFEE 4PGDB 2G5BB 5DMIL 3TBSA 4L5FL 1CG9B 5AUMB 3QEGH 3MRBA 1I4FB 1MRDH 4HS8L 3RWCA 4F7PB 1I75A 1D5MA 3MUGB 4ACPA 4LMQE 2AEWA 4JFXA 3QFDA 1AGBA 1JWMB 3M1BB 2V2WA 3S34L 5HI4D 1F6AB 3DRQA 3O9WC 2WLYA 2ARJQ 3RPIA 4KMQA 1RZJC 3BW9B 4O5LH 4DQOL 2EYSB 2X9WA 3B6SA 1TVBA 2DMBA 2MFNA 1EEYB 5BS0A 3BD5A 3QI9C 1KJVB 5IHUL 5F6IC 3S8WA 3VXQA 4JR9H 2HG5A 4MXVF 1E4KA 1IFHH 5FUCE 5HPMB 2DWDA 1BBDL 3ZKNC 4RFNC 5HYSB 4FZ8H 4OZGA 5GSVB 3RJDA 4AG4H 3D0VA 1MUJB 2AW2A 2IWGA 1A6VH 1EBAA 1MF2L 5ICXA 3L7EA 5F93C 1HYRC 1N5YH 2BY1A 4BUGA 4HWBL 1RD6A 4PV8B 1JP5A 3FB7B 1HQ4B 1DUZB 1XGPB 2NY4C 1NL0H 3PWVB 1RSFA 1EERB 1P7QA 5D2NB 3DX7B 4NUGL 1BWMA 5D2LA 4UAOB 5DJZB 1ZANH 1N64L 1FFPB 5JDJA 5FOBA 4J1UA 1AXTH 4WFFE 3DURB 1FG2A 4WHCA 1YECH 3L3KB 5JXED 4IOIA 1P4BH 4ZUSB 1ITBB 3MLRL 2B5IC 2P8MB 1DN0B 2MKLC 1H3XA 3N1MC 1NANH 4NRYA 3BKJL 5EU6A 1RZJH 3VXUB 5JW4M 3LS5L 4XXDB 4JY5H 5GGUB 4NZUH 4TVPE 1KCRL 5DMJB 3VD4A 4KK5D 5DD0L 3SKJL 2WINA 3ARYA 3ARDB 1K9TA 2F19L 5FKAB 1DEEB 3QR2A 1ZKAA 4Q9QL 2FB4H 5F7MC 1YYML 2V2XB 1I1FA 2VLKE 3BKYH 3HPJA 3O6KL 2EYRA 2H2PD 2PW2A 2Q8BL 5IBTL 4XPBH 4JY6B 5EU7E 4G6ML 4R4FH 3VXRD 3VI3E 1J12A 1ZA3A 4PJEE 3HC0B 2VLLA 5DJ6A 4S1RH 4LCCB 5E9DB 4XNYH 3SE8H 3C8DA 3WJJC 1YNKL 4JLRA 5T3XH 3U4EA 5D1QB 43C9A 3NACH 4JPKH 2MPAH 4X6DF 2HYMA 2XPGB 1CCZA 2NLJA 5SWZB 2GTWB 1MH5B 1F3DH 3HE7A 1J8HA 3QHFH 1T66C 2IH3B 3NTCL 3WNMA 2IAMD 4I0PB 2OL3A 3I75B 3RZCB 4AQOA 3MJ9A 4I3RL 3HE6B 4YIQA 1RIVH 4G7YH 5FDWB 4WRLA 5IMMA 4G43A 1BQHA 3AXLB 5MI0C 1JHKL 4P5TA 4UQ3B 1A5FH 1A3LH 1MFCL 5D71H 2E7BA 1OLLA 3CMOH 4RX4D 4DAGH 1MELA 5D1XB 4ZD3H 4CMHB 4R96B 3MYZA 4LCWE 5F96H 3MGTB 1B0RA 2OI9B 4NQCA 1IEBA 1ZS8B 3EJZD 2J8OA 4OKDA 1F11A 4PP2B 1FZMB 3DVIA 1RUPL 5TDNA 5CEXB 1BFVL 4ZXBA 3SE4A 2Q6WA 3VE0A 2NY1B 1Q94B 2JJVA 5DMKB 3L1OL 5J13C 2CKBH 4L9DA 5EZOH 4MHHI 4NT6A 3ARGB 3THMH 2ATPB 5HYIA 4RISH 2ZUXA 3BMWA 4RQQA 3SKMB 3V0AC 3GI9H 2M26A 4M5YH 2Z31B 3HTLX 5FO8B 2B20A 5EUKB 5TE4H 1AH1A 5I30H 5EUOA 4NJAL 5IIEA 3OXRA 3WKNA 1T1YB 4HAGA 1FORH 5ACZA 2ADGA 3I85A 3RVTC 2UUDK 5MEQB 1NUDA 4UV7H 3C8KA 1O7VA 1N0LA 3V5HA 3RWGA 4PRIA 4L1DA 3L3JA 4HJGA 5DD3L 5EN2A 4AH2A 1YMME 1IBGL 3LKRB 4R7DA 3UAJD 1EJ6A 3M17A 2VISA 4WO4D 3U9UB 3RRQA 5CD3B 2X4UA 4F7CA 5JR1H 1OF2B 2P8PA 4KRPB 1MCIA 2Q76B 2ZP0T 2FZ3B 2NX5A 2O5XL 2VDML 5I76B 4NNXA 3T4AA 3S3PA 3TGXA 1AXIB 5KANG 32C2A 1T83C 2BC4A 3ZYIA 2IANE 4P46A 1MRCL 4D0BA 3T1FB 1SM3H 2DBLL 5IMKA 4S1DC 1YNLH 1YY9C 2X7LB 2YPLE 4X4XB 3VFMA 4XP4H 5JHLL 2R1WA 4LARL 2UYLA 1FNGB 3ABZA 4J12A 2ZUSA 1BOGB 4JHWL 2O5ZH 2VDPH 4P2RD 4NBZB 5SV3A 3O2WL 1I3UA 3VFTA 2H2SD 4KQ3H 3MR9B 3MRIA 5I71C 1RJZA 1E4XL 3T0ED 5EDXA 4XC3H 1AKJA 2IALB 1YEHH 1H3TA 4C56E 4GG6B 5EZLA 5FK9A 3TYFB 5A1AA 1CDIA 4LGPB 1KCUH 4MXQD 4U1LA 2QTEA 3MNZA 1Y6NR 3L3IB 5HVHB 5I17B 4CN1A 2Y06H 4PJ8D 3K46A 2MOVA 4ZG1A 1X5YA 2YXMA 3U0TB 5GGSA 1YYLH 5IHLB 5FO7A 3ZKSD 1N4XL 1C16A 4NNPL 5EIQA 4U1KB 1IAOA 1BAFH 1Z5LA 2XN9D 3IDNA 2ICWA 2VKWA 3CXHJ 3MA7A 3GJFK 4NKDB 4M02A 1YN6A 1EXUA 2C26A 2O93L 1JYXA 5CGYD 1C1EH 3OAZK 3E8UL 4G42B 3ZKQD 4HLZH 3DSFH 4P99A 4BM7A 3UPAA 4WI5A 4BH8B 4OLZH 3CFEB 4RAVA 4ELKB 4OUUA 1MRFH 3KLAB 5DS8B 4TSCH 2FEDD 4OCWL 3RPKA 4RSVA 4Y5XB 4GSDL 3MXVL 3UTPE 3O6LL 3VD9A 1LD9B 5DSCA 1HZHL 1MVUA 1IT9H 4G6KH 4H26A 3KLDA 1AO7B 1Z9OA 4WHYH 4AIOA 4L3AA 1SYSA 2BSSA 4RRPA 4F57L 1IM3A 1R3JB 4KROB 2AJUL 4OT1L 2GITB 4BKLB 3CFJB 2DD8H 3KLHD 3RTQA 2DM7A 5I73C 4ZXBC 1P7HL 2XZCH 2ZJSH 1Q72H 4RMSA 3OGOE 2AXJA 3QDAA 3OKDB 3SY0B 1EIBA 4FFYL 4HFWA 3DGGA 3GSUA 3RJQB 3UDWA 1X6NA 2CMRH 1S7XB 1DBKH 2EIDA 3AB0B 2Q7YA 1AR1D 3BUYB 5E8DL 3QEHA 4QF1B 2YD7A 1YQVH 4G9FB 4XAWH 4CVZA 1JWUB 1QA9B 1AI1L 3UZQA 2HJFB 2XZAH 1CXIA 5FV2A 1GYAA 4QXUL 4MDJB 3EZ8A 3PGCA 1QHPA 4KK5C 5GS1A 3V9FA 2ZUQC 2IBBA 2OTPA 3WXVH 1JYWA 1U2HA 1UGNA 1NDGB 5T1DL 3V6OC 4XPHH 3HNVL 2H2PC 3PWJB 2IPKA 1P4LB 5EO9B 3CVHB 4F37F 1RURH 2X6MA 1OB1A 3U48A 1J1PH 5DD5H 3DETD 3OJ2C 4JO1H 3QUXB 1S5HB 4W4NA 1NFDB 4R90L 1G6RA 5EPMA 4G3YL 4UI2A 3SCMD 1G7QB 3MBEA 5DHVB 2DLFL 3O3UN 4XCNA 5B39G 5B38G 1UADC 5KN5B 5ITBL 3CCHA 2FJGA 5F21B 4TUJB 3RUGB 5DC4B 1LO2L 4Y88A 2P5WD 5FA4B 4R2GD 1RAMA 4V2BA 4KXZI 5E5UB 4GRWE 5JPNB 1NMAL 3N50A 3QJFB 2ZSVB 3K80A 5D96B 4XX1E 4BH7A 5K9OA 4BZYA 1A02N 4LSPL 1X44A 1JF6A 4WFGD 3MZGB 4PB0L 4LLDB 4Z5RB 4XMLL 3OKLB 4KVCH 4MAUH 4F15C 2GY7B 3GSRA 4ZOAA 5T1MB 4J7RA 3PABA 1IGFL 4POZD 2VIRB 3PE9A 4EKXA 2DQIH 2PN5A 2Z8WC 1QFUL 1RUAL 3F7RA 4KRNA 5HY9B 3L7FA 4LLYB 4YEEA 3S9DB 4NFDA 3EHBD 4LHUB 3LKSB 2BSED 4KC3B 2C7UA 1T7VA 3AU1B 2VL5A 4QHNA 4PJIA 4U0RC 1MJJB 1U8MB 1JUFA 4ERSH 1E4XI 4HUVB 2UZYB 2C4FT 5CJ8A 2NY7H 5TF1L 3A6BL 3U46B 5GRUH 4ZFGL 1Z3GL 1YEEH 5L8KB 1VERA 5B3JF 4ZPVB 3B2VH 5D7LD 4X4YA 4LPWA 2BCKB 1M71A 4QHLA 4UT6H 4JO2L 5CKGA 4NM4L 4P3DA 2V2TB 4XBEH 3QRFM 3G5XB 2V5SA 1MWAA 2QR0A 1WQVT 1HQRA 4FOMA 3DX9A 4DVBA 1OARH 1RFDL 2YD2A 4GRLD 2I9LB 3UAJC 1KT2B 1F02I 1IGTB 1IM9D 4UIMB 4N9GB 1ND0B 3BXNA 3DXAA 1NGQH 5D5MB 4JFFE 4NQSA 4WO4C 3QEUB 2CUIA 2VXQH 3LKOB 3RWHA 4LLUB 2VZSA 1FP5A 2Y5TA 3BQUA 4M93C 3QQ4B 2BVOA 5BW7A 1TCRA 3AAZB 1RUQL 5J6GB 4BZ2L 2J12B 4KJWD 3D85A 1U93B 4OLVL 1FIEA 3RWEB 4KHTH 2QHLA 2WUBL 4XP9L 4L8CA 5C6TH 3ROOA 1GGTA 3IB4A 2Y6SD 5ERWB 4RGND 3HI1B 4ENED 4X9FA 2MKWA 1MCWM 4POUB 5C92A 1SBSL 5GGRB 3S35L 4XCCH 4WUUA 5I66B 1CZ8L 5E7BA 1KIUA 1YEIL 3ISWA 4PS4L 1QQDA 4P57B 2DQGL 3W9DB 2H2SC 3P30H 1MCDA 5E8OA 2KQMA 5EC1A 3T0EC 4JRYB 2UWEB 2DS4A 4NO5B 4DTGL 5C07A 3D39A 4G8IB 1G84A 4YDLB 3OAUL 3GMLA 1OTTD 5DRNA 4KQ4H 3BJLA 4MXQC 4OZGE 4YPGB 2JIXB 2ERJC 5CSZA 5EO0B 1OW0C 3MBEC 2ICEA 1HHIA 2I07B 1G7IB 1B88A 1BIIA 4JZJB 3MX0A 4K7PY 2HFGL 4QYOA 4H0HB 4Z77B 5HSFA 1VESA 4XPTH 1FFRA 1T2QH 3PXHA 4I3GA 3K0WA 4QTIL 5CGYC 2EIBA 4PRHD 4M8VA 1XIWA 3F58L 4BZ1H 1BVLB 1SY6L 4NFCA 5B8CB 1KLFA 5EZIL 3I6KA 2HFFB 3QXDB 2YEZA 2VDQH 2VLJD 4L4JA 5JZ7D 2OP4H 2FEDC 2EKSA 3VA6A 5DJCB 1OAQH 4OLUH 4NN5B 3KPPB 2A6IA 3VI4F 5ANME 5BVPH 4GRMA 4Q6IA 5EU6E 1KCSL 1OAXH 3BO8A 4FMFA 3RDTB 3FO2A 4I2XB 5HTSA 1GZQA 5DEFA 2H1PL 4P9HC 3WIFB 1ZSDB 5EOQL 3EOTH 4Q9RL 3M45A 2D0HA 3KLHC 4GT7A 3E6FA 1CLOL 4Z0BL 2E6QA 1U8NB 2DAVA 4MJ5B 2A0LD 1G6RH 2PNDA 5HHXH 4KJYB 1F45A 2AVGA 5ABDE 4PGBA 3MRMA 4NQVB 2AK1H 2D7OA 1GC1C 4WUKL 3SDDD 4OZFH 1VEMA 2P5EB 4OBSA 2B4CL 3VD7A 2R8SH 3SOBH 5J7CC 5C2UB 4XP5H 4YX2H 4WI9A 4ZFOB 4MDIA 5D6DA 1QSED 4DGIH 2CGRH 1CLYH 1IAIL 3HR5B 1F4XL 4XVTL 1UWXK 3MRDB 4WEMB 5K93A 4M62L 3UBXA 4Z18A 2FO4B 4W70A 2LQRA 1U8HB 1UYWL 2YRPA 35C8H 5KVGH 4N8VG 2QADC 3DETC 1RJLA 1QLFB 4Z7NF 3T2PA 3SCMC 5AD0B 3UTZA 1UCBL 4J2XA 3VXSD 4EN3D 4QTHA 4H8WL 4CMMA 3BQUC 4ELMA 1EK3A 3RWDB 4R2GC 4POYA 2F5AH 1T7XA 3IJSA 3HFMH 2XTLA 4P5MA 1IRAY 3QXAA 5EBGA 5HJ3A 2Z4QB 4LPUA 2EDYA 4LFHG 5MP6L 4IIQC 3TBWB 4LCIL 1I7UB 1SMOA 5I8EA 4Z7QE 4OD2B 1XF2A 3KWWB 4P3CL 3EYFB 1NEZB 4NQCE 3BP4B 1ZHNA 3SE3C 2BHUA 4NQDD 2PKDA 1KYOK 1QYGH 2HP4A 1FVDA 3KPSB 4L4TD 2ARJA 1GC1H 4PRPA 1X4ZA 3HI6H 3RY5A 2BDNH 3RL1B 2CLRB 3K4DA 5J9PA 5AZ2L 4DN4L 1I9RH 3T3ME 2P45B 3A6CH 1Y18B 1U2CA 5HGAB 3IF1A 5BZDA 4NP4L 3SE9L 3CFKA 3O4LB 5EUOE 2ED7A 3GHEH 3IRPX 2PO6B 2VQTA 4LLVA 5ILTL 2AP2A 4X5XA 4MNHB 3TCLA 5KS9A 1C8PA 2H9GA 5I75B 1U8JB 3VFGH 1Q0XH 3EFDH 5DRXB 1S9YB 2NY0B 4X98A 5I1HH 1BZ9B 1I7RB 3R8QA 5MEOB 1FLRH 2MSPA 4LLWA 2AXHA 3LOWA 4WWKB 4BSWA 4JPWL 2DMCA 4GG8A 4MQXC 3PG2A 3EDFA 4Q58C 5DDHB 3HI5L 3P0YH 4LSQL 5EOTA 1FN4B 2I60H 5GIRB 3F7PC 1S5IL 2NY6D 2BY3A 5D6CB 3ZTNL 1N59B 2JJTA 2NX5E 2PUQT 4RWHA 2QHRH 3WHE0 1CE6A 1V7NL 2HT4D 3RAJL 2EC9U 1CFSB 1CGVA 2UV3A 1QBAA 4QO1A 2R29L 3IKKA 2K7QA 2P1YA 4X6DB 1DUYB 4FFZH 5EFIA 3BP6B 4PJXA 1PYWA 3Q6GL 4Y19A 5IEKA 5C0DA 1U3ZA 1DQJB 1S7QB 1RU9H 3DPBA 4IRSD 1H0DA 5FYKU 3NFSL 2APFA 5GISL 1JPTL 4P4KB 4L5FH 4KK8D 1XGTA 3DI2B 3MV9B 4KJWC 4PRNA 1MSPA 2CIIA 5C08D 4F7MA 4TNVK 4MNGB 5ICZB 1FJ1B 5IB5B 2H8PA 4XBPB 4HS8H 1T0MA 4LHJB 3EAKA 4YDVB 4FQ1L 3CVHL 2C3XA 4S1QH 3S34H 3FO9B 2Y6SC 1GHFL 3H9SB 4RGNC 3TH2T 3L3GA 4ENEC 4MX7A 4ODUB 1ZLUH 5AAMA 3OR6B 5IVXF 2A77H 4DQOH 3I3BA 1HNGA 1A7OL 1QBML 2G75B 4ZUTA 1AGFA 3B9EA 1J8KA 4WW1B 5IHUH 5TH2B 4UV4L 5I6XB 3OR7B 3BISA 5F72S 1JZ7A 5L6YL 4G6FD 1SEQH 5H2BB 1ZLSL 4HFUL 1CQYA 5F9DC 5KTEL 2E3VA 1MF2H 1IAII 4R4BA 3VFUA 1XF5B 5TE6L 1HH9B 2UVEA 4PJ7B 3BZFA 2R9HD 2X4OB 2VR5A 3TN0B 5I8KL 5E94B 4HWBH 5BXFA 3CXDL 2ZG1A 3WIHL 1OQOA 2EIEA 4YDJB 4CL7A 4EDXA 4TTDD 2ADJA 4M6ML 5D1ZD 2VE6B 3SPVA 3O3BA 4PREA 3VGGA 3H2WA 1ZTXH 4NUGH 4PRDB 3LSOA 1N64H 2FLRT 1T1ZA 2FSEB 4K2UL 4LVHC 2F54B 5JHDB 4HIHB 3U7AA 5T5NF 5HHME 2NNAA 3GJFA 1LNUB 1QR1B 3MLRH 3C60A 1U41A 2BP3A 3IFPA 4PY8J 4R0LB 1G7LB 1ED3A 5JZ7C 3H42L 1QNZL 3FT3B 5C09A 3I6LE 3BKJH 4O51A 4Y5VC 4WHYG 3D2UA 4JE4B 2IG2L 3LS5H 4AENA 5EIIB 3IS1X 1FIGL 1KCRH 5CFHA 5DWUL 5DD0H 4RBPK 5C0RL 2F19H 2MQCA 2A6JB 4I3SL 4Q9QH 3IGAB 1U8IB 3O6KH 4P2RE 2Q8BH 5IBTH 4XXCC 4JZOA 3JV4A 5AWNL 5AYUL 4G6MH 2VLMD 3FQUB 2A0LC 3T0EE 2MNUA 2CO7B 2NY3B 3PWPA 1YNKH 5GPRA 4DKFH 1TPXB 2IADA 3FOMA 4TOYL 4Z7VE 5DEGA 5KZCB 3EYVA 5MERA 3LKNB 1CGWA 3V79C 1A6UL 3O6FA 4MMZC 3SKNA 2F5BH 4U1JB 3PWNA 3UTOA 3DUSB 5CBEB 1R3LA 1G0DA 4LRNL 3PL6B 4XHJD 4Y4KC 5FF6A 3NTCH 1FC1A 4FRWA 5T33L 4J8RA 1F5WA 1UJ3C 2DQFB 1J0HA 4U0QB 3MJ8A 3G6JA 3LEVL 1T0NA 5GS3A 1H3VA 2ZCKL 4I3RH 5EZJB 4XTRC 5KSAB 3KPMA 1K4DB 5A16B 5F6HJ 1BJMA 2CDFB 4U6VL 2H32A 5I2IA 1XF4B 4JRXA 1JHKH 2ZCLL 4EN3C 5E1AA 4LLQB 3TCXA 3VG9C 2E9BA 3VXUD 1MFCH 1WV7T 3D9AL 1JHTB 2EIZA 1XGUA 3VDAA 2AJVL 2FR4B 2BXZA 1QSVA 4A6YB 4ZS7H 3W0WB 3ARDD 5C0BB 3PGDB 3EO0B 2G5BA 1RUPH 2AJZA 3MGAA 1BFVH 5IM7A 3L5WB 4KKAD 1CG9A 1A6AB 1V7ML 4CBPA 2GJ6A 4WI2A 4PJIE 3LN4A 3PQYA 4F7PA 4M7ZC 2GT9B 4Z7OE 4FN0A 4KZDH 1C5DB 2NY5L 3TNMA 5TDPB 1JWMA 3ARPA 3M1BA 3N9GL 5E9DD 5T1KD 1F6AA 2NR6D 3C09C 5IHZA 1KFAL 1UZ8A 5F3BA 2YXFA 3MRPA 4KUCF 3VW3L 3HNTL 1WC7B 5SWZD 4MZ2A 1BZQK 2KDGA 4K23L 3IETB 4N0CD 5EORL 5HPMA 3OV6A 1PZ5B 5I1AA 5DD3H 1IBGH 2GSIA 3KPRD 4V1DA 3RZCD 1MREL 4MA1C 3HE6D 3VWJA 3C5SB 3RVWD 4X6CB 2EYTA 3MFFA 3QUZA 4KXZH 1A9EB 1W0VA 3CU1A 4K71B 4PRBB 4WV1B 1EFXB 3TF7C 4NC2B 6FABL 1O7SA 3DXAE 2DQCL 4ZSOB 1HQ4A 3QWOB 2O5XH 2VDMH 1P9MC 5D1XD 3PWVA 4G8FB 1WBYB 4F7EB 1INDL 4OQTA 2NY6C 1MLBB 2QKIB 2P5WE 1T21B 5C0IB 2I27N 3QRGL 1FFPA 4FNLL 2HT4C 3P0GB 1MRCH 4IMLB 2DBLH 5ADPL 3DURA 1AR2A 2NY1D 5AEAA 3GSNB 3L3KA 4NN6B 5JHLH 3ARGD 4LARH 2YK1H 2ID5A 4WFGE 1ULVA 4RIRB 4KUZL 4JHWH 1M1SA 3O2WH 3HNSL 3HUJB 4IRSC 4UDTB 4YAQB 4ZO6A 1IGML 4XXDA 1QVOB 3L6FA 1DFBL 1E4XH 4PJBB 4KK8C 2IFFL 4ZFOL 1DEEA 1KPVA 2CK0L 1MCCA 2V2XA 8FABA 1X6LA 1FLTX 3GMRA 5C07E 3D39E 2LU7A 4JY6A 2QV2A 3SJVB 4NC1C 1DVFA 1N5AB 5DC9B 4XPAH 3HC0A 4C4KT 1NQBA 4LVOC 2P49B 4WWID 5IVZB 4JFHD 5E6YA 1N4XH 4NNPH 4ZFZB 4OCRL 3PV7A 5GRJL 3C5JB 1E4JA 4C57C 2F8VA 4LGRB 1KNOB 4KRPD 4UOJA 2R56L 5D1QA 3TWCL 2DMKA 2GAZA 1NCBL 3E8UH 5D7JB 4DN3L 4NQXB 4PJHB 2CRIA 2OK0L 1HXMB 4D0CA 1FVCA 5D7LE 2GTWA 4YGAB 4FQHB 1IGIL 1GGIL 1QEWB 4M1DL 2XWTB 3OAZH 2IH3A 3ZDXF 4HC1A 4I0PA 3M8OL 3SDXF 2J8UA 2R9HC 3UTSA 2VMFA 4PG2C 1HKLL 3U0PB 2J1KA 4PRID 4N5ED 3F12B 4GSDH 5A2JH 4D8PB 3O6LH 4ODSL 1Z9SA 4TTDC 3P77B 4MS8D 2VDKL 1HZHH 5F1IB 3ULUF 5D1ZC 3DTXB 4N90D 4NYLB 1URLA 2X4PB 4FG6D 1U8PB 3AXLA 5BQ7B 1NUFA 4HS3B 3EIFA 4IRJA 4F57H 5BZWB 3MUJA 2AJUH 1KJ3L 3EJYC 4X7TB 4OT1H 4Y5YB 4NO0A 4R96A 3GFUA 3TA3A 1KJ2H 3TO4B 4FFYH 1ZS8A 5DJDB 1HSBB 1OSZB 5CEXA 4S2SB 3BP7B 5I1LB 5E8DH 4MA3A 3NOIA 5CZKA 3FRUB 5IR1B 4O2EB 4HIIA 5E6IB 1AI1H 1QRNB 5F9AC 2F58L 4QXUH 4RGNE 4E5XA 1D9KB 1DEDA 3MXWL 3L5IA 3DRTB 2ZSWB 3LKQA 2X4TA 4HDIA 2Z91B 1VENA 4KI1A 1LE9A 2P7TA 3CX5K 1CQKA 5E5RB 5FCSH 1ZLWK 4PJCF 5T1DH 3QDMB 3HNVH 2XNAB 1G9ML 1QTYT 1DBAL 5J1TC 3ZYJA 3VRJA 1ONQA 4JM2B 4FQXB 1ZLVK 4X7SL 4R90H 4RFEB 4G3YH 2F53B 1UA6L 4JPIA 4NOBA 4XZUA 2DLFH 2VNCA 5C0EB 2FHFA 1Y6KR 2N7BA 3LKRA 1PD6A 5ITBH 3MRRB 5DTFB 2WBKA 1T89A 2CIKB 1LO2H 3O2DL 3AREB 4GUPB 1AO7D 3IFOA 3JUZA 1RJYA 1NMAH 1YQ2A 5D2NC 4ELME 2GUOA 3LMJL 4WJ5B 1FV1A 5F8RC 5HHPB 3P4NA 4Y89A 2FZ3A 4LSPH 4XAKE 4MWFA 5I76A 1DR9A 3IDIB 5DJXB 1BJ1H 4Y1AA 4PB0H 5CGMA 4XMLH 1OPGH 2YPKA 4FQQA 5B38B 4CDHA 1WISA 3WL9B 3FB8B 1XR9A 3RGVA 3GO1H 5D7SL 3ULVL 4LNVA 2X7LA 5BV7B 4G9FD 4DK6A 2HRLA 1J5OL 4PRPE 1QFUH 1RUAH 4NZRL 1FNGA 1V05A 1G7JB 1BOGA 1KF9B 5F3HB 1YNTB 1MCEA 3ARDC 3KXFA 4AL8L 5KJRL 3IJHB 4XMKL 4KY1L 4N0UB 5J1AA 3MR9A 3LY6A 2IALA 4KKAC 3QDJA 4AT6A 1IL1B 3B5GA 3BP5B 5TF1H 3A6BH 4JAMB 4ZFGH 5GJTL 1Z3GH 2BHYA 4MNQB 2PYFB