3LQZA

Crystal structure of hla-dp2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HLA-DP2 and implications for chronic beryllium disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
total genus 31
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqzA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3lqzA01
1TQBB 1ZLUH 2HJFA 3JV6B 2ITDA 2NW2B 2R15A 2QTEA 4P5TC 3H0TB 1OCWL 3GSRB 2BHYA 3TCLB 4XNZB 1EPFA 4DGVH 4CL7A 3IDMB 2R23A 5J9PA 4UT6L 5DUPH 3DVGA 5HYJB 3AS1A 1P1ZB 2VDKL 4GAGH 1J0YA 1JZ5A 3RZCA 1S5IL 4MXVF 5FB8B 4PV8B 1CDJA 4LEXH 4G8GE 1HEZB 2NX5B 1MRFH 2P5WD 1A4KA 3I6GA 3WJLC 3V5HB 5CUSH 4FXKA 4JQIL 3EO9L 1M05B 3TPKA 1RSFA 1FQ9C 3FQXA 3PWNB 1AD0B 1IL1B 2BY3A 3VE0B 1BQHG 1NBZB 1JPGA 2OQJB 1P4IH 1C12A 3ARTA 4YDLB 5CD3A 1C5CH 2CKBL 4JDTH 4GBXC 4X9HA 4DGIL 1BF2A 2O5ZH 4JFYA 5GRVL 2MCG1 5BVPH 4MD5B 1MJJB 1I8IB 4BZ1L 3D6GA 4NUGL 3BH8A 3NPSB 3PQYE 4ZXBB 3D3VA 5D5MA 1JGVL 1JI1A 1F4AA 4H26B 3KG5A 1XIWC 4Z7QF 5BV7C 2OTUB 3F12A 1IZJA 3L3KA 3VDCA 3O9WD 4H25B 4YXLH 3EOTL 4ZAKB 5A2IH 3UO1L 2GSGA 3OKYA 5C0FA 3X3GL 3QUMB 2XRAH 4K94C 8FABA 4PB9H 1B88A 1RZIB 2DIAA 1R24A 4PTUB 3O9WA 1H8NA 1KCVH 4LCUA 3VXSD 4NNPL 1KFAL 3U4BL 3IXTB 1JGUL 2W07A 3ALPA 4ODHH 2EZ0C 2C3VA 4LRNH 1YEKH 5D71L 1T4KB 1MFNA 2JIXA 4WO4C 1FRGL 1G9MC 5DJYB 5F8RC 3VXMD 1BOGA 1UACH 3GK8H 3F62A 3LN4B 1T04A 4L8SA 5EZJA 1J0JA 4UT6H 2W0LA 2JELH 3QEGH 5I8OL 2XTLA 2X1XR 3MV9D 3QI9B 4AH2A 1KB9K 2MQ3A 2R2BA 2FHCA 3GSUB 2UYLA 4NQVA 3N1FC 3VMOA 5JOEA 3N0PB 4WUUB 3BWAA 3W9EB 2PYFA 1O0VA 2YD5A 1FL3B 1ORSB 3AU1B 3ZYZA 1PG7X 2VDRL 1GC1L 2ZUXA 1DDHA 2DQJL 2EE3A 1MFDH 2EO9A 5ANMA 5FM4A 3OF6D 2WNGA 3U79A 5D7IB 5EFIB 4YFDB 4WEUD 1S9WA 5HGBB 1FHGA 3C60D 4XPHH 2LU3A 5D5MF 5L2JA 2Z91B 1U3JA 12E8H 4JFHE 1I3VA 4WHTA 3GMPA 1MHCA 1A6AB 5TQ2L 5E5RB 1BQLL 1AY1L 1YC8A 1FFQA 3B9KC 2VISA 3DHMA 5HPMB 5C2BL 2B1HL 1OD7A 1D6VL 3BMVA 4HCRA 1VADA 1N5AB 1HHKB 5CBEB 1MOEA 2GJZB 2QHRL 3S34L 5A16A 5F3HA 1KLFA 4WU7B 3DMMD 4I0PC 3QPQC 4WTWA 3E6HB 3D9AL 4MJIB 5GRXG 3QUXD 3V6OE 5IROA 4GRWE 1UACL 1GH7A 3MRRA 1W2KT 4JFPB 1GSMA 3P9MB 4MWFB 4XT1C 3C5JB 1OAUH 4Y5XB 4N90E 1HSAB 1M6OB 2R1XB 4GKSA 5F7FA 4IOFD 3BDYL 3MBEC 3MYJB 2XA8H 1GHFH 2NY3B 5HHVH 3WFHB 5SWSE 4LLDB 2K7PA 4XNQA 4ZS7L 5J4MA 2DTML 3BVNB 4OZIB 3EIFA 2AP2A 1IZKA 4HKJB 5E5MB 4MQTB 1XF3B 5CJOL 4MMZC 2DQGL 5C6TL 3EO0B 1MQKH 2CGRL 5DQJA 1W72L 3H7LA 4QT5A 4PP2B 1DQML 1MFDL 1GGUA 1KB5H 1J18A 1FSKB 4S1RL 4OB5L 3VRLE 1QBAA 4RMVA 2D7TH 3IDYC 3DGGA 2CRMA 3P3YA 4NT6B 3MLYL 3QH3B 3QJFA 1RJYA 2FNBA 4JFOB 4IHOB 5EOCH 1P7KA 1T7XA 2VZOA 3C6SB 4QHLB 1IGJB 3RWGB 2ZSWB 2QSTA 2OMBA 3PQYB 4HUVB 1F58L 4O2CB 1T1ZB 1YEEH 3QEQB 5AUMA 4NBYB 1AD9B 4PLKD 4X7CC 2BNUA 2RAMA 4HPYL 4RMTA 4L8BA 2NY3D 3TO4A 1K5NB 1F4HA 2GFBA 1OP3H 2Q1EA 3SO5A 1ZHNB 3KHQA 4CBPA 4HD9A 5K59E 4U1NB 4DK3A 4KKCD 3W82A 4R2GC 1J8HE 5KS9E 3UZQA 1RHHA 3QA3A 1ZVHA 1YMME 2Y23A 4HC1L 3SKNB 5EUKA 1A1NB 4CW1A 1IEAA 4APQD 5B21A 3MCLL 4J4PA 2DMKA 3HI5L 4TOYL 1RVFH 4H88L 1I1AB 4D0DA 3OV6A 4WI8A 1XGQB 4ETQA 4H0HB 3LH2L 3LY6A 3KXFE 1OAXH 1QFUH 2D7OA 1KJ3H 4WJ5A 2WBKA 5HYJE 1DQDH 2FX9L 1R3KA 5T1DL 5L9DL 3BJLA 1W72A 3JTSA 5L8LB 1IGFL 1M7DB 1A4JB 4UTBL 4GG8A 3VGDA 1ERNA 1FZOA 1DUYA 4O4YL 5C07D 3W5NA 2YBRA 4LQ1A 3WLBA 5FGBA 1U2CA 3EOTH 3VGGA 5IWLA 5TFSH 4MCZB 4ZNCD 4MJ5B 2UZIL 5E6YA 5E8PB 3QAZB 3MJGX 4PJFE 1LD9B 4RAVA 3MROB 1N3NB 4KDWA 4LRNL 5J7CC 4M8QA 1R0AL 2BERA 3ARRA 1ACYL 2GK0B 3K4AA 4XVSH 4JHWL 4HPYH 4JQVC 3MC0A 2WLYA 3FQNB 1GGCH 2Z35B 3THML 4IOIB 1JF6A 4OLZL 2ARJB 2KDGA 3IJHA 1H3TA 4CNIA 3SKOA 5IMOB 4WI9A 2XZZA 3BP7A 3KPSE 5BZDA 5E8NA 5DEZA 1MHHB 3CXDL 1EAPB 4ZFZA 4PJXE 1RZJC 4G7VL 1MFBH 2XICA 5J3HD 2C3XA 4ZFFB 5CZVL 4Z18A 4XPBH 3UTZA 1C1EL 3CUPB 4KRPD 1BM3L 5CIPB 4OGXL 3MLSL 4PJGF 4D8PA 1R3JB 3ARYA 3D18B 3CFJA 2Z92A 3DUHA 5JW4N 2K7QA 1YNTA 2B4CC 4D9RD 5BCAA 4XCCL 1FORH 3U7WL 1HXMB 2EH7L 2P45B 4RMQA 3MBXL 1XMWA 1SYVA 5TDPA 4L4VE 1BGXL 4PJ9B 1WVZA 4LHUG 4NPYA 2AK4D 2B0SH 5EBWB 2V9RA 4PV9A 1IE5A 1VDGA 1S7RA 4LK4A 2J5LB 4U1KB 5JDJA 5C0EA 1T1YB 4WW2B 1TZHB 4N0UA 1FO0H 3QWQB 3O3BA 1FN4A 1K8DA 2BX5A 3MO1A 2I24N 5E99H 3TH4T 4YLQT 2GTZA 1DLFH 2B7DT 3V0WH 1ZVSA 1MCWW 5BOZG 1HHIA 3RUGA 3C2AL 5D1QC 5CFHA 1G6RL 4L4TD 2QR0B 3S3SA 4U1SB 2OI9B 4ZSOA 1SJHA 2JF1A 1RUMH 2NY1C 2AJXL 5EA0H 3SOBH 1IKNA 1WBZB 4PRAB 2ARJQ 4KROD 5FCSH 1ORQA 1QFHA 5CILL 3SDCD 3I6LD 5E00A 4I77H 1I7ZA 3HUJB 2EXWD 4U49A 4XX1E 4QHMA 2WBJC 4GRLA 2VDPH 3SE9L 5SWSD 7FABH 4G7VH 3NIGF 1NBVL 1CVRA 1T7VA 4YO0A 4GLRH 1U0QA 4QRQA 3IDIA 3QISA 3T0XA 2VO5A 3E8UL 3HI6L 4GXUM 2FSEB 5ID1A 4JDVA 4KTYA 3X3FH 2GKIA 5D6DC 3FT3B 1ODAA 3H9YA 1FH5L 3ARVA 3WFCH 1JNHA 1AC0A 1KLUB 1EJOL 5ESAB 3TN0A 1N7MH 1U8OA 3IVKB 1OW0A 2H1PH 3TH3T 4L9LA 3STZB 1MQ8A 3CFEB 4P57B 1ZLSH 4FQIH 4OIAA 3TN0C 1JGDB 1J12A 2NLJB 4YAQB 1DBBL 1CQKA 1KJVA 2VH5L 3UPCA 4BUHA 4I4WA 1KJMA 1JL8A 1IC1A 4N0CD 2BSSB 1NCUA 2F5BL 5L0QB 4O51A 4LEOB 3VXUA 2LAAA 4FXLA 3WN5B 2XPGA 5E8DL 3T1FB 2YS4A 5ILTL 3TT1H 4ZYKA 2FLBT 4IRJD 1DEEA 4KI5E 3B2UD 3EOYG 4MB5A 4GG6E 5D1ZC 4UIMA 3I2CH 3AMKA 2DRUA 1LO2L 5A3ID 5EOCJ 1JPTH 5C70A 4KKAC 2Y9RT 1J5OH 4JJ5A 4PJGE 2R69L 2XN9E 3DSFL 2DDQH 3K8KA 4GUPA 3GSVB 5DD1L 1CGVA 1CZ8L 1OM3H 1ZLVH 5DMGD 1WFUA 4RWHA 3W0WE 4LVOB 5HBBA 3VXNA 3QDJB 4U1IA 2NY2C 4X7FC 3BYTA 4GSDL 5FHBH 5T5FL 5FYLE 1INEL 3HAEH 3IDGA 4NBXB 3ROOB 1NDGB 5E9DA 5I71B 2GK2A 5J13C 1PEWA 4XNXH 5DA4A 3MACL 3MRJA 3A6BL 3SJVD 5DD5L 2DQFB 1JCKA 3O2DA 4QRRD 1ZS8B 2EXYC 3CFKB 3UYPA 3AY4A 1FIGH 2VDKH 3OGCB 1G7JA 3BZFB 5C3TA 2W9DH 4YR6A 4QOKB 3RWFB 2V5RA 1U6AL 3O6KH 1CN4A 3KR3H 3PWJB 1JHKL 3LEVL 3G6AB 4XPAH 1K6QL 2WWKO 3FRPG 1RULL 5JMOC 2BRRH 1KTDB 4JO2H 2Y4SA 4KHTH 1RFDH 1F2XK 4XBEL 3FJTA 4LCWA 1TJIH 1UWEH 5ETUA 2Z31B 3NN8B 3C60B 1YMMB 5INCB 3L3JA 4OLWL 1LO0L 3AGVA 2BOBA 2Q7YB 1FYHB 2JKXA 3GKWL 2RB8A 4G6FB 5F9OH 3WUWB 3ARUA 5GS1A 4LLYA 4BZ2L 3TA3C 1GPOL 5DMGC 3TJEL 3VRIB 2DB8A 1UVQB 1RK0A 3P40A 4R7NA 3KXFB 4NDMB 3BPCB 4YGVA 4KAQL 4NUGH 4YHPB 3GJFB 1YEFH 5BO1L 5KVDL 2B4CL 4K3JL 4KHXH 1OAYL 4OCLC 2IQ9L 4AMKL 5F72S 2ESVB 3KPNA 2WM0A 4OLUH 4X7TA 1MJ7L 4MLIA 4E41E 1OB1A 2A0LC 4EDWH 3OKLB 2CDGA 1AO7D 3LDBC 5BQ7B 1NANI 1J8KA 2GJJA 1FAIH 4M00A 3WIHA 1BBJA 3L6FA 4YHOH 4CGTA 4FQLL 3FQUB 4KRLB 5IVZB 2GT9B 5J57B 3RPKA 4JRXE 4PFEA 2OK0L 4OI8A 5D9SA 2D31B 2OZ4H 4MQXD 2D0GA 3DIFA 4X6DB 1LE5A 2VNCA 2I25N 4Y4FC 4KKLC 3RHWK 4HIHA 2NQCA 1H3PL 2J4WH 1PKQA 1JRHL 4X9IA 4JB9H 3FFCA 5C3LD 3SE3C 4NC1C 4XC1H 4P2OB 5TDNB 4RFEB 3ULSB 3S4SA 4KI5F 4B7IA 1PGRB 4RFOL 4OF5A 2P4AB 2IAMD 3L5IA 5D96B 3JVGA 4NFBA 5FUZH 3MNVA 4K7PH 4D9RE 3F58H 5IV2B 2OL3B 3AB0C 4L3ED 4OZHB 1ZGLP 4X7SL 4JCLA 2WUCH 3WXWL 1VACB 1CL7I 1IBGH 2V7NA 4IRSB 4A6YL 4LBEA 4OZGE 1MFAH 1M7IA 2NY1D 4XNYL 4ELMF 3KYMA 5DJCB 5KVGH 2VDLL 3UAJD 3O41A 3B6SA 3PV6A 3T0EC 2CDEB 3PWVA 3KNBB 1BJ8A 3VG0H 3SDDA 1UZ8B 4K55A 4N0FB 1GOGA 3DV4A 3U0TB 1DFBL 4O2FB 5C09D 1S7WA 4NJ9L 4IOSD 3HS0B 5A1AA 4L4TB 2MOVA 2GJ6A 4Z7OF 5J0BA 1S7VA 4M7JL 1FYTB 1QRNA 1V7NH 4RCAA 1JYWA 5DHXB 1F4XH 3LD8C 3MMEA 4EUPB 1ZVYA 1J1XL 1UM4H 4NZRH 2VQ1A 1I7RA 4U3HA 1RUQH 2VLJB 4V2CB 3CC5B 1Q9KB 1YQVH 3VFVA 5HYQA 1PJ9A 2BNRB 4M48H 1F02I 3DXAA 1G7LB 5CP7A 4AT6B 2APBA 4K71C 1ZHBB 2XY2A 2IQAA 4FG6D 3LRSA 1U8HA 4FMKA 5HI4C 4MJ6A 1S9YB 2G5RA 3LZFL 4QY8A 2X42A 5C9JB 4NN5C 3GHBL 4Z77B 1OP5K 1RZKL 5D7LD 4J3SA 4K7PY 1OTUC 3U6RA 4P4KD 2L7JA 3GMQA 4PYGA 1J1OH 5CZXC 5F44A 2BZDA 1QLRA 3RGHA 2IPUG 4JZJC 3EYVB 1LO2H 1S7UB 2DQGH 5C6TH 4NQEA 2CLVB 3BISA 3CSBA 5TH2A 3FT4A 3S98A 1B6UA 4PJAF 3FCTA 1UC6A 1MCKA 3T2QA 5BVPL 2AQ3A 4MYWB 2J6EL 1N6VA 1RZ8A 3P2TA 3DPBA 1U3HC 3DBXA 4X4ME 5EWIL 5I1JL 4YDJA 2ICES 3AAZA 5I16A 1S9VA 4Z8FH 4L8CB 2Y36L 4ZD3L 1QQDB 5KOMC 1I7UB 2V7HA 3ZE2E 5FOBA 2VXSL 5DK0B 1WV7T 2VZVA 5DVKA 5T5FH 4Q74A 4W6WB 2C26A 4XPFL 4KQ4L 4FQXA 2H32A 2WW8A 4JPWH 3B9KA 5I1HL 1E0OB 2VTFA 1KYOJ 5F1NA 4NKOA 2EDXA 2GAZB 1X4ZA 3ARGA 5C0IA 1AP2A 1X7QA 2DQHL 5I1DA 3MRHB 4PJCB 1ZEAH 4IS6B 3IJYB 3I02B 4I2XA 5K9QG 2ZP0T 4HUXA 2NY5C 3K8LA 1JGLH 1RURH 4HLZG 3ZKXB 3CFCH 3HCVB 4G3YL 3VI3E 5DWUL 4N1EA 1CFQA 1JZ8A 3G04B 1UWGL 4MDIA 1A7QH 2IMNA 5JQ6H 3OB0K 1X5KA 3IKCA 1TVHA 2W0FA 1NH6A 4KKCC 1GPOH 1TVBB 4LCCB 1ZWIB 4BH8B 2GY7B 3VXRA 5KTEH 4GRMA 1VESA 4UOW0 1D9KD 1U8JA 4UAOC 4EVNB 1BEYH 3AC0A 1V7ML 2E7LC 1S9XB 1E27B 4KVNH 3MREB 5IMKA 2RFXB 1XH3B 2NY3C 1P4LB 1WWBX 1YJDH 3RL1B 4JM2B 4GW5A 1AQDA 4HJ0D 4PLKC 5EOTB 2HTKC 5H2BA 4XH2B 1FAKT 1TIUA 2IH3B 5DJ2A 3EYOB 1SJEB 3HLAA 5CEXB 4HS8H 2B5IC 4E0RA 3KPRB 4PJ7E 2DQIL 1CE1L 1P5UA 4LDOB 5HYFA 1B2WH 1EVUA 1FV1B 4K3GA 5IFJB 1WT5A 4X4YA 3MV8E 5F1KC 4N8CL 3VXMA 3BPOB 3DARA 4NFCA 3LQAL 3ARBD 1QPPA 5T1KB 3LPFA 4LHQB 4OGYL 4KTDH 4CAGA 1NC4A 2B5IB 2QQQA 2AVGA 1QSVA 4PS4L 3MV9A 2J8OA 3OJVC 1RMFH 2M1KA 2W65A 1NCWH 2R8SH 1J86A 2ZUYA 3M17A 5DJAA 4OT1H 2ESVE 5T33L 1ZHKB 4JFHD 2YN5A 5F9DC 1FVEA 1KIRB 4Y2DB 1F6AA 1IILE 4I18B 5K9KB 3K7UA 3WFEL 3N9GH 3SBWA 1R3IL 5JOFA 1IAIM 2FJFA 4IOFC 4CDGC 3UJIL 4I8DA 2B8OT 1G9NH 2A74A 4QKXB 4ZFOL 3GJFH 5DUBA 3RNKB 5EUOE 2EYTA 4KUCF 1JWMA 4HKXB 1LP9B 1X5YA 2WIMA 3QEHB 4IBLT 5I1AA 4ZS7H 4HIXL 4I3SL 5EO9B 1EEZB 4J7RA 2N4IA 4EXPX 4KQ3H 5J06A 3RI5K 4JRXD 1DVFD 3QPQD 3H9HB 2F58L 3ARDB 1QP1A 3EFDH 1X5XA 4OFPA 3ZL4H 2R2HB 1OAKL 5ITFA 1TCRB 4HDIB 2JLLA 2CR6A 5C0BB 2BFVH 4L8DB 3ZDXE 5DMKB 4ERSL 1QFWI 3QIBB 5DRNA 1BX2A 5C0AD 4DZBB 1YJDC 3MV8A 4G9FA 3SJVB 1K85A 4OM0H 4LKCB 3ARDC 3PWLB 4EN3A 1JUFA 1EFQA 5F88B 4NKDB 3FT2A 4JZOA 3U7YL 2HJKA 4AEIH 4PJ7A 4KVCH 4CMHC 3JTTB 3U4BH 1OQOA 1YMHB 1T7WA 2Y72A 1OLZA 3VH8B 5GZOC 3GM8A 4X98A 1JGEB 2HG5B 1Q72H 2O5XH 4ZOAA 2JIXD 2EE6A 5E6ID 2O61B 1OAQL 3L3IA 1YYMH 3H7BB 1KCKA 3C08H 4OF3A 4OJFH 2BVTA 2LTQC 2R29H 2VAJA 5DEGB 1NJ9A 5TE4H 4FNLL 4Z7WA 5H8DA 4MAYC 5LGJB 4ZFOB 5C0JA 3PGDB 3PQYD 3K2UL 3RVVD 1KIQB 3B5HA 2Q86A 4FFVC 3RPIB 4HGMA 5T3ZL 2CO7B 3HUJF 5F1IB 5DQ9B 2I5YL 1HH9A 1G7MA 3TBYA 1LQSR 4PJHF 1FYTE 2LTQB 3QDMD 4JN1H 1H5BB 3VU2A 1XZ0A 4LPYA 3ZE1F 4U1MB 4WW1B 4POZD 1KB9J 4HF5L 3ARFC 3BE1L 3WDJA 4Y2DD 3BH9A 2NCMA 3H9SA 1H5BA 3BFOA 4XWOC 4K9EC 4MS8D 3MODH 1UYWH 4WO4D 1ZLSL 3TBYB 1KXQE 5DQ9A 2DJ4A 2FCBA 3RPIA 1S7SA 3LPWA 1E6OH 5JHDA 1T83A 2FWOA 2F5BH 2AJSH 3PGDA 4NN7B 3QXTA 4ZFOA 3OAZH 3HMXL 4YHLH 5I30H 4JLRA 4ONGH 1LGVA 2NZ9D 5FYJH 1FGNL 1KENL 3H7BA 4KV5F 3L3IB 5DJ6A 3HMWH 1VEMA 2O61A 4EUPG 2OTPA 4OUUA 4JREB 2H45A 3O4LD 4X98B 3VH8A 5B3JE 3DYOA 4PTTA 5D2LE 3TZVD 1YMHA 5JW4R 1HZHH 4JG1H 2P43B 3JTTA 6FABL 5FIEA 5KW9H 2R4RL 2WZPD 2OXHA 4AENB 4NKDA 3MRLB 5HGAB 3RGVA 3RHWF 3PWLA 4EN3B 3OXRB 3QDJD 5IB5B 2AJ3A 1X5JA 3M07A 4M02A 3IFNH 4DZBA 3KPLB 1MCWM 3GSWA 1BX2B 4MXQC 4NN6C 5DRNB 3QIBA 3C5SB 1WAAA 3P30L 5KAQG 4L8DA 3QCTL 4U0RB 1KCRH 3OL2A 1H3GA 5C0BA 5GS0H 4WHCA 1GRWA 5A2FA 1KEGH 5HI3C 1TCRA 2R2HA 4Q6IC 5GGTL 3S5LA 5D1XC 1TTUA 4AZ8A 5FKPA 1QLEH 2RIKA 1EEZA 4NN6B 1YEHH 4IRJB 4KK8D 3DXAD 4LLMB 1K3IA 2ICWB 2LE9A 3FO0L 2ZCLL 1TETL 2EYTB 4TSBH 3RNKA 5DUBB 4BK5A 8CGTA 3ES6B 3MODL 1Q1JH 2BHZA 3WD5L 4LOUC 1ZANH 2DQUH 3QHFL 5EU5B 3UJJL 5JOFB 4Y7MA 1R5IA 1FGVL 5A40E 3VFNB 4KDTC 1QR4A 5T3XE 4WUKL 4P4KA 4I18A 5GGUA 1NAKH 25C8H 1F6AB 4Y2DA 3QXWA 1ZHKA 3AXLB 5F7DA 4TRPL 4WGWB 5DJAB 3M17B 5TE7L 2W65B 2HRLA 1DP0A 2NY5L 3JV5A 1NC4B 5SV3A 1FDLH 5HVHB 2DM7A 5JIIA 4AMKH 4UT9H 6FABH 4CJ1A 4HIJA 1FV1A 3PIQB 2EIBA 4XCEA 3BHBB 2FEDC 2XFXA 3DWTA 4K3DL 4QOKD 1AHWB 3EYOA 2AEWA 4AL8L 4ONHB 4DAGH 3QCTH 4P9HC 1NBVH 1P4LA 2AK1L 4JM4L 4NKIL 1XH3A 3RX8A 3MREA 1NBYB 5IMKB 2YPVL 1WCQA 3U1SL 2DYPA 1E27A 3MBEA 4UNTA 4HIXH 5GIRA 4DKEL 1JYNA 1U8JB 1CU4L 1P7HL 2FD6L 1PX4A 3FONA 2BMKA 4BH8A 1ZWIA 2F19H 2FIKA 2G5BB 4LCCA 3A6CH 5DDHA 7CGTA 1NC2D 3VFMA 1PW3A 1TVDA 1R5VB 3BYYA 2VLMD 1Y6MR 3IKCB 4Y89A 3HKFA 3HNVL 1A2YB 4MDIB 3G04A 4K23L 4P59H 1CFQB 4IJ3C 1OGAD 4OGZA 2F9BT 2NTFB 2L0DA 1F3DH 1G9EA 4HUXB 4J3VA 3I02A 3IJYA 4F7EB 1PZUB 1IBGL 5K9OA 3N1QC 5GJTL 3BRGC 2O5ZL 4DZ8B 5I1DB 1X7QB 1R0AH 1OSPH 4HS6A 3V4UL 2GAZA 2FHBA 5I1GL 3CVIH 1G7PA 2Q3AA 3KPQA 5FM5O 4UB0H 5KVGL 3B9KB 4L5FH 1UH4A 4CMMA 5GGSB 3RWHA 3V79C 3C2SA 3QHZH 2Q76B 4FQXB 4FTVD 5LCVL 4DKFL 4LPCA 1D3CA 3QRFM 5DURD 4PGBA 5DD0L 4JFDB 5HGDB 1I7UA 2V7HB 1QQDA 1KB5A 1ES0A 1T66C 3QEQD 5GS2H 3AAZB 4YDJB 5T5NF 1EIBA 5CEZH 1RZ8B 1JGUH 1A22B 2V5TA 2FECI 4N1HB 2CIIB 3TN0D 5ACMA 3T0WA 3CXHJ 1P9MC 3VDAA 3BKJH 3A6BH 2CLVA 5HSFA 2ZUUA 1GVIA 3TWCL 3CMGA 1S7UA 2WANA 3WO3B 3V6OC 4BSWB 1QLRB 35C8L 3VGAB 4QHNB 4MNGB 4DQOL 4M48L 4BZYA 4ONFL 2GSIA 1NCCL 4W6XB 5I8OH 2QQKH 4Z77A 5C9JA 2DD8L 4QY8B 3LEVH 4MJ6B 4R26L 3DNKA 4FFZH 4UDUA 4WTZA 1U8HB 3ZKSD 2VLJD 2IQAB 5GGQH 2YZ8A 2VDOL 4NCC1 5ENWB 3GHBH 3ZT7A 5KSAA 3PP4H 3ETBF 1G7LA 3QXVA 4OLWH 2DIJA 5E99L 1FE8L 1YEIL 5LBSL 1NC2A 4RRPA 1Q9KA 4HG4J 2VLJA 5K9QI 1CLOH 1I3RA 3ZYJA 3HC4H 2VQ1B 2ENYA 2NNAB 4CN6A 4QF1B 4W4NA 1BIHA 4EUPA 4ZFGL 4GMTH 1JPSL 1F45A 4QRPA 2X4UA 3TGXA 3CFIC 1IKFL 1QRNB 4EQ3A 2EEDA 1FYTA 1VPOL 1S7VB 3HTLX 3RY4A 4IIQC 2GJ6B 1Y6KR 2XN9A 2J12B 2B4CH 4X6CE 1QSFD 4PJGA 4L4TA 2FR4A 1OP9A 2EDBA 3K3QA 3N1GC 5DRWA 3HS0A 3O2DH 3GI9H 5E9DD 2XWTA 1F6LL 1A3RH 3SPVB 3KNBA 3PWVB 3UC0L 4GG6A 3PV6B 1MEXL 3O41B 2KL6A 3G6JF 2VN7A 2QHRH 4G6AC 3KYMB 1EMTH 5D70L 1M7IB 3CPLA 2E27H 1AE6L 3OKDB 5MENA 3OR7A 3WJLA 4R2GB 3SDYH 5FYLH 4IRSA 2V7NB 4MXWL 3E3QC 2WQRA 5KG9A 2ZUSA 3PUCA 3BPLB 5F6IC 5TF1H 1Z3GH 5IBUG 3UBXI 3MNVB 2X9WA 4U6TA 1NCTA 4KRPC 5F6HJ 3MV7E 5C1MB 3OKKA 4RX4D 1WZ1L 1LO4L 1UWGH 1OWWA 3GBML 3C5ZA 5J3HC 4HWEH 2DQCL 4NM4L 3TJHD 1CD8A 3WS6A 1XT5A 1XGRA 5F3BA 2KBGA 1U91A 4NYLB 4HSQA 3OB8A 1EDQA 1NCDL 3WXWH 5KJRL 3S34H 4JKPH 3SKJH 4PYHA 3TYFA 2CJUL 3EYQC 3DIFB 2D31A 3QCVH 4J3TA 1S3KH 1QSEE 4ZUUA 1XR9B 3QDGB 1CFVL 2ED9A 2VXQH 5DD1H 2AV1B 4NCC2 3UTSD 3S35X 1BBJB 3L6FB 2DBLL 1KF9B 1H3VA 1D5MA 3CXHK 1RQ5A 5BQ7A 2CDGB 1RUPL 1B4RA 2GQHA 3OKLA 5E2VL 1OB1B 4GSDH 2AXJA 3HAEB 2FYYB 1AI1L 4X7TB 2A9MH 4KTEL 3BO8B 4BM7A 4JM2D 1NDMB 1B2WL 2EIZB 5L6YL 1X5GA 2KPNA 2ESVA 1FYTD 1JTTA 1IRAY 5H37G 2XN9D 5B8CA 3MV9E 3NZHH 3VXTB 1I1RA 4YGVB 3BRFA 1RK0B 1N5YL 2DS4A 4WY7L 3VRIA 4BFGA 4KC3B 4LLYB 1FNAA 3ILQD 3NTCH 4XX1G 2VYRE 1FBIH 4I13B 4PRIB 4ZPTA 2YOCA 3VD4A 1KTDA 4AG4L 4JDZB 4MLSA 3G6AA 4R2GD 3WHE0 3PWJA 1YPZF 3RWFA 4C55A 4FP8L 4YR6B 3LH2H 3BZFA 1G7JB 3OAYH 4PJXA 1HKLH 4PB0L 4X8JB 4X80L 3CFKA 2CMRH 4ETYA 4JKPL 1UQSA 4UB0L 3BIKB 5GSRA 3MRJB 3T04D 4OV5B 1IMHC 1VB9A 4AIXA 4YE4L 1CLZH 3K1DA 4JGJA 1YN6B 4O4YH 3IDGB 3ROOA 5IOPA 3HPLA 3VFUA 3O6FC 3ZHDA 2Z4QA 3TNMB 5ICYA 4PD4K 3VXNB 4ZTOL 4PJFA 4LVNB 3LN9A 4WNQB 1YY9D 2XKSA 4D0BA 2A9ML 4OM1H 3QDHA 4GUPB 4I2XE 4R0LA 1TCMA 2RBLA 1DBJH 1X4XA 3L5WB 4JHAL 3QT2A 4HPOL 4MZ3A 4X6BB 4PJBA 4HCRL 1H3PH 4Y4HC 3GUTA 3G5YA 4DQOH 4TSAH 4JB9L 1MCOH 1MY7A 1DEEB 3ESUF 1ZEAL 5EN2B 2IANE 4ZYKB 1G6RA 3MRIB 4EEEA 1OTSD 1TPXB 1TFHA 2R9HC 2J7LA 4LEOA 5IBLC 4IDLA 3VXUB 3AMLA 5EBMA 4I4WB 2OTWB 5T3ZH 4YAQA 1P69B 1FE8H 4NUJA 4P57A 3SKMA 5IT2L 2EEBA 3CFEA 4L9LB 4OSUH 2A9NL 1U8OB 3IVKA 2BNQA 5ESAA 2CUHA 1JNHB 3KPSD 2WP3T 1KC5H 4DFHA 1HKLL 3UX9B 4PJXF 3AREB 3MLXL 5DFVD 5E8OB 4JDVB 4TUKH 1WZLA 5ID1B 2FSEA 2QSQA 4M1GH 4XVTH 2ED8A 3IDIB 4PJ8D 4QRQB 5JOPD 3BQUD 4I48B 4WWKC 3LKPB 4YO0B 1Y0LA 3GI9L 1CT8B 3IFLL 3H42L 4JFXB 4JAMA 1IT9L 3KLHC 4OFYA 1PFCA 3EAKA 3UC0H 1DBAH 3UO1H 2CK2A 1I7ZB 4YDLC 1YDPB 4IRSC 1JZ2A 1BD2D 1HQRA 1ORQB 1CE1H 4TPRL 4HW6A 5DSCB 1CGXA 2ATPA 3KLDA 3RA7L 4ORZC 5GRJL 4TSCL 1MWAH 2ZUQC 4LLUA 1CTNA 3I3DA 4RA0C 1SJHB 2CPCA 4U1SA 3K0WA 2QR0A 5KW9L 1OPGL 5LVEA 3RIAK 1XIWB 1ONQB 4KROB 3QG7H 4KPHH 3RUGB 3TCXA 4OGYH 1JK8A 4B5EA 1XF1A 2GTZB 2EH7H 3MO1B 1FN4B 4N0UB 3VG9C 1TZHA 2RHEA 3QAZC 4WW2A 3ULUH 3KJ6H 1T1YA 3MRKB 2YA1A 2AS5M 3EGSA 2IAND 1S7RB 2ORBH 3L5JA 4KWUA 1XF4B 5C07E 1I1CA 3EHBC 4M7ZC 4KKNA 1KPRA 3C9NA 3EW3B 2I07A 1G0DA 5C0DB 2PO6D 1HSBA 1N2RA 1Q9OB 1RZ7H 5KZCB 2V17L 4K2UL 1BJ1H 4YBLB 2Z8VC 1HXMA 2JCCF 4MNQD 3MRDB 3TV3L 5D7IF 3X13A 4Y4KD 1JFQL 1IVLA 2Z92B 4J6RL 4I3SH 2AK4E 3CFJB 3D18A 1A6UL 1JVKA 1ZSDB 3FQTB 3L3HA 5CIPA 3SOBL 3GIZH 2HT2D 3CUPA 4FFWC 3SDXE 1CGUA 1YY8A 1HXYB 4PBVC 1KV3A 3UTZB 4Y1AE 1U58B 3OJDA 4M1GL 5CS7A 1MCCA 4JQVA 2FEEI 3G6JE 3T0DA 4P5MB 3C09B 3QRGH 1JTOA 4ZFZB 5LAXA 4AM0A 4PUBL 3UROR 4WTXA 4P5KA 3SE9H 5E8NB 4K7FA 5HXMA 3BP7B 2VRAA 1N8ZA 4P2QA 1WEJL 5ITBL 3IJHB 1PKQE 3NA4A 1DJSA 5IWLC 2CRYA 3FQNA 3UYRL 4U1HB 3BW9B 4RGNB 3CMOL 1CDYA 4M8QB 3VD3A 3OQ3B 3FN0H 3HNSL 4GKNB 1N3NA 1CICC 3MROA 1LD9A 4Y88A 3NTCL 4A2MA 4MJ5A 1Q72L 3VFRB 2NX5D 5AG9A 4MCZA 5HHQA 4G6JH 3WFDL 4JCMA 2IFFL 4XVUC 5ANME 5I1KH 4KV5E 5GSVB 1NBQA 2PYEE 3MRMA 4HKBA 4R4FH 4I0KA 5FHBL 5JLZB 2YBRB 5ESQA 2F54D 4TNWK 5GRZA 1M7DA 5DHVH 3OAUL 1NCBH 2JTDA 5GISH 2KUTA 1NLBL 4DKEH 2E5EA 4Z7VF 4F7CA 3CDYA 4Y2OA 4R9HA 2OYPA 4XI5D 1F13A 4R8WH 3OTTA 1BEYL 2Y06H 2W1NA 1FJ1A 2IANA 4LF3B 4MMXC 1W72H 1N4XH 4OIIL 3X14B 3O3EB 4LPXA 4WI6A 3P0YL 5JHLH 1CLZL 1IEAB 3OB0H 1A1NA 1DCLA 1QVOA 3AS0A 3EJYC 1GGBL 3O4OB 3MXVL 1CYGA 4U1NA 1UM5L 4YPJA 4KI1A 5KANG 3VI4F 4NNYB 1ZHNA 4WUUE 3RTQD 4P23A 5IF0A 2GFBB 1WFOA 1K5NA 2VXTL 1KACB 2AEQL 1VFAA 1YNLL 1FNEB 4L8BB 1B3JA 2PKDA 1AD9A 1KCSL 5AUMB 3V52L 3IU4L 1T1ZA 4XPGH 4HUVA 3PQYA 3I50L 3KR3L 3O6KL 1MAML 1H8SA 1FNEA 2XQYG 1NC4D 3LMJH 1VFAB 2ZSWA 4QHLA 3C6SA 4KK9D 2C4XA 1IM9D 1P7KB 5IF0B 4IHOA 4P23B 4S11A 1HYSC 1T03L 4NNYA 4XBEH 1RJYB 3QJFB 1CCZA 4YHOL 4WHDA 4NT6A 1MCHA 5GXBB 3P30H 3DGGB 5D72L 3BDBA 2BDNH 1NCBL 1YQ2A 3RIFK 2R0LL 4PP2A 1QVOB 3QI9C 4QT5B 2YPLE 5DQJB 3N06B 3S35H 4PJ5D 3HFML 3O3EA 3X14A 4TN9A 2A2QT 4OZIA 5KVDH 3KYKH 4HWBH 3UJTH 1FJ1B 2IANB 3QZWG 4LF3A 4UBDD 1UKTA 4XNQB 5JHLL 4GQPH 3MYJA 4F7CB 3VXUE 4GOSA 1P6AB 5GS0C 1MJ7H 4GKSB 4R6UA 3SN6N 1HSAA 4Z7OE 2N7BA 5FUZL 3OSKA 4Y5XA 4K7PL 5F7UA 3C5JA 2O5YH 5ESQB 5HI5C 4HKBB 3MRMB 3MRRB 4KXZH 4LGRB 5JLZA 2B20A 5GSVA 3OBAA 1S78D 1G9NC 4LSPH 5HHQB 4J3UA 2VN4A 2VMFA 3W2DH 1W0YT 3VFRA 3GBLA 2YRZA 5A16B 4JG0L 2OX5A 5CBEA 4GKNA 3RY6C 1N5AA 1CGWA 1BFVL 4GAJL 1NEZG 3QIBD 3BW9A 4U1HA 4KDVA 3MZTA 2VISB 3BT2L 3ULVE 3HAEG 4MJ2A 4OI7A 3K2UH 1MHCB 3GMPB 1JHLH 3IKKA 4RGNE 4P2QB 1N8ZB 4JKLA 4K7FB 4P5KB 5CIPH 4AM0B 2V17H 4K2UH 4NC0B 5LAXB 2H2SC 4P5MA 5HGBA 3GRWA 5D72H 3S9DB 4WFFE 3TV3H 2BDNL 3MV01 1U58A 3OJDB 5ANMB 1DDHB 3DI3B 1HXYA 4DN4H 1YY8B 2C4FT 2ZJSH 3QEQE 3TH2T 3RUGE 1KULA 3L3HB 5LWYH 2MKWA 1ZSDA 3AU1A 1FLRL 3FQTA 5JW4M 1FL3A 3X13B 2PYFB 1C7TA 3WNOA 2QL1A 3MUZ1 2YWZA 4I3RH 3BWAB 3MRDA 1P53A 1EO8L 4NQVB 4AYFA 2UYLB 1N0XH 1RUKH 1HSBB 1N2RB 1Q9OA 5DT1L 4D9LH 5C0DA 2R2BB 2Y07H 2I07B 4AH2B 1KPRB 3C9NB 2HLFC 2F54E 1XF4A 5F96L 3EGSB 4TVPL 5C0ND 2FH8A 4Y8DC 3MRKA 4TQEL 3CVHL 3UEZA 4HAGA 5DJYA 3VMNA 5D7JD 3GM0A 1T4KA 2JIXB 4M5YH 2JJVA 4M3KB 3QUML 1JK8B 1I3UA 1CDUA 2H32H 5I1GH 1QOKA 3O9WB 1JZ7A 4Q9QH 1ONQA 1XIWA 1L7IL 1YQVL 4GJTB 2FGWH 4M3JA 5B38G 2IFFH 3QUMA 5C0FB 4LLUB 1X5AA 2G60L 5MP6L 1QKZH 2ATPB 3EDEA 4OTXL 4DEPB 5DSCA 3SO3C 1OVZA 5I1IH 1HQRB 4B50A 1QD0A 3S7GA 1P6FA 1YDPA 3S37H 3WIIH 2EDOA 3BIAX 3WLWD 3BPLC 4H26A 4M9PA 2J88L 4JAMB 1A0QL 3D3VB 2X44D 3ARED 4JFXA 5FHAH 1CT8A 3BH8B 1Y0LB 3SDDD 5BV7H 3JVGC 2ZWLT 3LKPA 3S8WA 1OWRM 1I8IA 4GXUN 4GO6B 4I48A 4MD5A 3CX5K 2E9WA 2K1MA 4TVSa 1MJ8H 2IMMA 4EN3C 3WFCL 3LS4L 3PGFL 5E8OA 5CD3B 2ZCLH 3AREA 4ZOBA 5E24E 3SE3A 3O0RH 2X41A 5LQBH 3VE0A 4XP5L 4N0YH 1BWMA 5HTSA 3PWNA 2DKSA 1FNFA 5EIQA 4RGOH 2BNQB 1Q0YL 3V5HA 2GIYA 1A4KB 3I6GB 4NUJB 3SKMB 1BD2E 3BDXA 2ID5A 2OTWA 4PV8A 3RZCB 2DLFH 4OBRA 5EBMB 4M03A 1P1ZA 2ED7A 5HYJA 5J11C 5JZ7D 4PJIE 4LPTA 3MLZL 5GZNC 2R23B 3IDMA 4KRPB 3MRIA 1G6RB 1OQXA 3PL6C 5EN2A 3TCLA 3GSRA 5HDBF 2VC2L 1C5BL 3G5YB 2C4FU 3GUTB 2DQHH 5HHXH 5FUOL 2I26N 2HJFB 4PJBB 3GO1H 4X6BA 3UYOD 1NFDF 4LVHC 3L5WA 5IQ9B 4TULH 3JWOH 1I9EA 4P2QD 3QDGD 2AKRB 1N64H 4R0LB 3O2DL 5FM5M 4TUOA 4D0BB 4WNQA 4TNVK 1Z5LB 4PJFB 2R0WH 5ICYB 4MGXA 3TNMA 1NL0H 2Z4QB 1OSZB 4G43A 5A2LH 3WFBL 3VFUB 3F5WA 3EO1A 4HFUL 3HPLB 4HH9B 5IOPB 4N5UA 3D5OF 4Y5YC 4MAYB 1YN6A 1U9KA 3MJ7A 5TPWL 1CDIA 1WT5C 5FV2A 3WS3B 1H9VA 4OV5A 5BW7A 1FC2D 1C5DA 5GSRB 3BIKA 1IM9B 1UQSB 4MA7H 3RTQC 4KI5C 3NCFB 4X8JA 4I9WD 4PJXB 3G6JA 1E6JL 1NEUA 1BZQK 5FDWB 5KVEL 4PR5B 4Y1AA 5ISZA 4JN2B 4JDZA 4BKLA 3O8XB 5C8JB 4P2YA 4QGYA 5FV1L 5HD8D 4ZPTB 4ODTH 4M7LH 4PRIA 1IGYB 4FABH 1YEEL 2XWBA 2QADD 5J6HA 1PZ5A 3ZKND 4PRPB 1JMZA 4J12A 1T2QL 1CR9H 1MI5E 2VZTA 3EOAA 1BFVH 4N8VB 5D2NE 4RQQB 1FFPA 3VXTA 1NAMH 4M6AA 4OCNC 2WSKA 5B8CB 5DJXA 2E6JA 5E7FA 3RY5A 1LK2A 3TVMD 1CXLA 1NDMA 2EIZA 3BO8A 4XP6H 4RBPK 2FYYA 3F7VB 3HAEA 2H2PC 3FB5B 4RMSA 4C57C 1CGSL 5C0RH 1D5MB 5TE6L 3WNMA 4NO2B 4RAHA 2AV1A 1OL0A 3QDGA 1XR9A 4FQXC 1UZ6E 3KPPA 4ZUUB 5DUPL 1KJ3L 4R90H 1P7QD 2FO1A 4YHIA 2Q8AH 3TYFB 3ECBA 5TE4L 2YD2A 1FNSH 1UB6B 2OL3L 4PRHD 1Q9WB 2VLKA 1U91B 4NYLA 3QUZC 5F3BB 1XGRB 2BFVL 5HGHA 1PYWB 4H8WC 3QDMB 4Y19A 4M4RA 5D6DA 5HDBE 3C5ZB 4Q9RH 3QIUA 4OM0L 3WMSA 3OKKB 4OQTA 2SEBB 3C8DA 4YWGH 3E2HB 3OF6A 3U7YH 5L7XL 1DBKL 1UADC 1W0VA 3F65A 1KN2H 5DLML 1G9MH 1F90H 3RVXD 4GRLC 5AYUH 4YHYC 1ACYH 1MLCA 3NCCB 4U7SA 2WWKT 5KG9B 3RWEA 3UP1A 2UWEF 4DGVL 3C5ZC 3QXUA 3A67L 1CDCA 4M62H 5D7KD 1CR9L 5DK3A 2CKNA 4OLZH 4MAUH 3OR7B 3OKDA 5MENB 1UFUA 5HHME 3PDDA 4UV7H 3CPLB 1W8NA 2HJLB 4Q97A 2C3WA 3WL9A 5B4MD 4NOFA 2EH8L 4FQPA 3ZSTA 4GG6B 2HT4D 4I0CC 3SPVA 2NR6C 3DMMA 4RMUA 2I5YH 2XWTB 1C1EH 4PJBE 4HBCL 5D70H 1KTRL 2QQLL 5DRWB 3LQMA 5F93C 3FN0L 2FR4B 5DVLA 5KSBF 4PJGB 2C5DC 1KEML 5DRZB 2XN9B 3NABH 2IGFH 4FA8A 1UCTA 4L3EA 1AGBA 4HIIB 3NOIA 2X4UB 4XP5H 4QRPB 2VKWA 2P1YA 2ZKHL 5I1KL 4QF1A 4IRSD 2NNAA 1CDHA 5JR1L 4QLRA 1I3RB 2AERT 1TJHH 3OKNA 4DVBB 1NC2B 3WNLA 3Q6GL 4JFFB 5I6XC 5AAWA 2FEEL 4X6CF 2H8PA 1F97A 5GISL 5CJBA 5KSAB 5ENWA 4PREB 1FO0L 2DLTA 4PJ8C 4QRRB 4U6YA 4UDUB 2PTUA 3RL2A 3RIAF 2FB4L 4R97B 1CD9B 3QFJE 3V6ZB 1YEHL 1GIGL 5E8EA 1QRKA 5DJ8B 2OP4H 3K8MA 2GSIB 3TBVA 4ODHL 1C5BH 5KAQF 4MNGA 4QHNA 2P8PB 4JG1L 3NCMA 3UPRA 4BSWA 1M4KA 5FUOH 4F58L 1QPXA 2VLRD 4KKBD 3B3IB 1CGTA 1GGBH 1DQTA 1I9IH 1XFPA 4FRWA 2CIIA 3CJJA 3G5XA 3NPSC 2VE6A 3C87A 4YDIH 1UA6L 5F6HI 2NY4D 4KZEH 2HLAB 3H42H 1EHLH 5AZEL 3UTSA 5IBLD 5L6YH 2NXYB 1ES0B 1KCRL 1KB5B 5HGDA 4JFDA 4PGBB 4J3XA 1L9MA 2WP3O 4HFUH 4ZAKC 3ZDZF 2PW1A 3QWOB 2Q76A 3SDXF 2ZZUT 4XAKE 5IEKB 5FYKH 5GGSA 3RWHB 4CMMB 1FH5H 5B39G 3VXUD 2DQJH 3BUYB 4H1LA 3KPQB 1G7PB 1K4CB 1GZQA 1DZBA 1YEJL 4EI6B 1KTLB 4HS6B 1NMAL 1E6JH 4DZ8A 5K9OB 2HKFH 4P5TB 4F7EA 3FB8A 4PJEA 4BFIA 3V2AR 2EDNA 3CU7A 2NY6B 2NTFA 3K1KC 2XA8L 43C9A 4G8GD 5TQ2H 5CKAA 2R0LH 4U6HB 2LVCA 1F00I 3T3PF 1HN1A 1A2YA 1CU4H 2EDKA 5IW1A 3QXDA 1MQKL 1J10A 1JI2A 1JPTL 1R5VA 3D48R 4OCRH 4PJDA 5EC2B 3VFMB 4WFGE 5IMLA 5DDHB 2FIKB 2G5BA 2BMKB 4LFHD 1RUAH 2HT3C 3FONB 4ODVL 4YE4H 4TUJA 5F9WB 5FYKD 4HX1A 5GIRB 5GRWA 3MBEB 4KJQD 3MNZA 1NCAH 1F5WA 2DYPB 3LHPH 3MZGB 3U7AA 5IM7A 1NBYA 2FATL 2BNRE 1I8MB 4FZEL 2G75A 3V7AE 5JTWA 3ULUD 1IAKB 3B9AA 2Q3ZA 3DTXB 1G6VK 5EOCL 4ONHA 4XP6L 3K80A 4NC1E 4YHZH 4LNRB 4ZXBC 1AHWA 5HYSB 1YEDA 5GGSY 2E9BA 2NMSA 1DANT 3LEYH 1MPAH 2XFXB 4N8CH 2ZNWA 5ITBH 3V7MA 3TFKD 5L2KD 2R0KH 3BHBA 3BPNC 4EUPH 4XCEB 1A7OL 2HH0H 3PIQA 4HIJB 2KQMA 1BHGA 3WUZA 1CK0L 1QSFB 4HULB 2OJZH 4GAJH 2X7LA 2XZAL 3CSPA 1FL6B 3QDAA 2W60A 2P49B 2F8OA 3WXVH 3L5HA 2DMCA 1HKFA 1MI5D 1IAII 1U8IB 2IBBA 4JO2L 1TMCB 5F7DB 3AXLA 5KVFH 4HC1H 3JWDC 4W4OC 5GGUB 3RJDA 4P4KB 5CGMA 4M6OL 5IUSA 4Y16C 3WHXB 3VFNA 4HLJA 4QRPE 1R5IB 5EU5A 3FO9B 3TJEH 3NFSH 5AZ2L 2F5AL 3ES6A 2E7BA 3EYQD 5GJSH 3QIUC 2Y6SC 4ZPVB 2ICWA 5E08L 1MRCH 4LLMA 2FX9H 5DO2D 4NN5B 4IRJA 3SDAC 4D2NA 1FPTH 3DROB 5FKPB 5J12B 5IQ7H 1EH9A 2LV4A 2RJMA 5I75B 4I0PA 5GRUH 3S5LB 1UENA 1UH3A 5DJ6B 5CEZD 5EU7C 3GMRB 2JJSA 2FATH 4M6ML 3QBTB 3T1WA 3C5SA 4YHZL 2GITB 3X11A 1LNUB 3GSWB 1HHHA 1Q8MA 3KPLA 1MWAL 4EOWL 1MJUL 2AJ3B 2N56A 5IB5A 3OXRA 4PY8I 5EC1A 2OZ4L 4U31A 1OCWH 3MRLA 5HGAA 3RGVB 4AENA 3MYZA 4P3CH 3EDDA 1HH6B 1NLDH 5D8JL 4EXKA 1QFWM 5DZOA 5ERWA 2ZKHH 3CX2A 4PTTB 4ALAH 2R29L 2MWCA 1A3RL 1JNJA 3CLFH 4X83A 5HHPA 1CF8L 1IC5L 4OUUB 5T3XD 3WIIL 2P44B 1IKNC 2BVUA 1TJGL 4F9LA 4JLRB 5DK2A 1BWWA 3KPRE 1CXFA 5TFSL 2W0KA 4O9HL 4B41A 2FWOB 3BP6B 5JHDB 1S7SB 1PG7L 3ZHLA 4BJLA 3TT3H 1PDKA 3BRDA 5C2UB 3SQBA 4KK5C 4LRIC 1A6UH 3I9GH 2X05A 3H9SB 3BH9B 4IMKA 3M8OL 3WO4C 4QNPE 4HWNA 1MRCL 2P5ED 3UJTL 5F8QC 2VDLH 4U1MA 4WW1A 5KSBE 1XZ0B 3GHEL 3TLRA 5I0DA 4QYOA 4NRZB 3PDGA 4X9GA 2JJTA 4F15B 3GBMH 1G7MB 1HH9B 3MJ6A 4WIQA 4WHYH 5F1IA 5GRUL 5IW3A 1B0GA 2Q86B 3PHSA 1KIQA 5EORH 4LASL 4MXVE 1RU9L 3BKCH 5C0JB 3UTTB 2O5YL 5LGJA 4JY6A 5C0CD 2APVA 4Z7WB 1NJ9B 2YXFA 5DEGA 2XXMB 3P77B 1BAFL 1U8NB 3NACL 4FQQA 5DZLA 5EUOB 5FYKL 2A83B 1LP9E 1MWAA 1J8HD 1JGEA 3HUJE 2HG5A 4LVNC 1A6TA 1QG3A 4HLZH 3RAJH 3T4AB 4P3CL 4V1DE 2EC9U 1QEWA 1DE4A 2DBLH 3D87B 3WDIA 4PJ7B 2HJKB 4KZDL 1JF5A 4JZOB 3FT2B 3H9SD 5F88A 4P48A 1JUFB 1CF8H 1IC5H 4LKCA 4G9FB 3MV8B 3SJVA 1FIEA 1NFKA 4RNRB 4IIQB 5DUML 4BQ8A 3ZTJG 5AAMA 5DMKA 5EO1A 2XKNA 3QPXL 4HQQL 4LARL 1J1OL 4HDIA 5ITFB 3FFCE 3ARDA 3H9HA 3FO0H 3QCVL 1EJOH 4CVUA 4NZTL 1N26A 1QFOA 1SY6L 2ZPKL 3FO2B 5EO9A 1VKXA 2VXQL 5HI5D 1L4IA 3V0AC 3DETC 3QEHA 5I1AB 3S96B 4HKXA 1JWMB 1LP9A 4ZD3H 2BVYA 4M9OA 4D3CL 4E41D 2FGZA 4HG4K 2A74B 1S5HA 1T22A 3HHRB 3JV4B 2FJFB 1Z2KA 4JQXA 2X10A 3WEXA 5ILTH 3QUYD 2VLRE 1IC7H 3PWPE 4OLYH 4XNUH 1KN4H 4TRPH 2WWMD 5K9KA 5F96H 1FL5B 3I85A 4DOHB 2VXTH 3SE8L 3NZHL 1KIRA 1FVEB 3JUZA 3MV8D 1TLKA 3CAFA 1ZE3C 3QFJD 3SGEI 1SVZA 2OJZL 4QTHA 3MV9B 3QI9D 3MOBH 4P2RB 2YD4A 5T1KA 3W11C 1CDBA 1LWRA 4TTDD 4K07A 5C0CA 3VXMB 1QBLL 4X4YB 5AEAA 2C9AA 3ZE1E 5IFJA 4PLOB 3PL6B 5I17B 1WF5A 3T3PE 3FL7A 2FEDD 3KPRA 1TXKA 5M7QA 1L0XA 3VCLA 3OZ9L 4E0RB 4XNXL 3QWRD 1SJEA 3HLAB 5CEXA 4HWBA 2PCPB 1X5FA 2F53B 3RDTA 4PBXA 1JV5B 1LEKB 5D2LA 5DJ2B 2IH3A 4DVRH 4XH2A 3U9PL 5H2BB 2YSSA 5EOTA 1AQDB 1KUMA 4GW5B 4JM2A 3RL1A 4PB0H 3LEXB 4R90L 2RFXA 2LABA 1S9XA 5JPNA 1XF2B 4EVNA 3HG1A 1Y6NR 1MRDL 2BNQD 5EZIL 4GRMB 4Y8AA 2ZUTA 1YJDL 3VFSA 3VXRB 1ZA3B 2OR7A 1FFOA 1RFDL 2RQ8A 1TVBA 3IRPX 1TVHB 2W0FB 3E1F1 4H20H 3HG1D 1IGIH 5CCKL 4JHBA 3MGTA 3RNQA 3RVWD 4XC3L 1SEQL 4K8RL 3HCVA 3SQOL 4LSTL 1I4FB 3OKMA 4XGZA 4EZMA 5K59F 2A38A 1GGIL 1EV2E 2E7MA 1FZMB 5I2IB 1J88A 4I2XB 1A1MA 5E6IB 3K4DA 4IMLB 4XI5C 4IS6A 4PJCA 4F9LC 4XVTL 3MRHA 4OQTL 1AP2B 3A6OA 3ARGB 5C0IB 2I9TB 4KJYA 4C56D 4MB3A 4NKOB 5HI3D 5F1NB 4L4VD 2FO4A 3H3KA 5LG1A 2P8LA 4Z7WE 5E0QA 4XPTH 2BRRL 4RGNC 2H32B 5MHSD 4D9QE 4JVWA 1U8LA 4X6DE 5DK0A 5FOBB 4EBQH 4O9HH 1QFWL 2Z8WC 4L8CA 1S9VB 1U41A 1CICD 4BZ2H 5I16B 1KEMH 5CSZB 5GGRY 3DBXB 3U9PH 1B6DA 5C7XL 4ODSL 3TZVC 5HPOA 2E9IA 4S1QL 1WBYB 2C1OA 3FCTB 5CWSB 4G9FE 2K3TA 3FT4B 4OCMC 4Y5XC 1WTGT 4JPKL 5JNYA 3ULUL 5TH2B 4LSQL 3D69B 3KPRD 4XC1L 5C6WH 4NQEB 3EYVA 4R4BA 3OHXB 4BYHA 1SMOA 1ZGLM 3GMQB 4NO3A 1AH1A 3U6RB 3SGEH 4D9LL 5L8JB 2LFGA 3NFPB 1EGJH 1RZ7L 1S9YA 4NQED 1JPFB 1HE7A 2ATKA 3TEUA 3LRSB 4H1LH 1ZHBA 3E0GA 3F8UB 2D4FA 1BAFH 1BOYA 4AT6A 5CP7B 3DXAB 4C83B 4LSTH 3P4OB 2YHGA 2OK0H 2BNRA 3ARFD 5HYQB 3RU8H 2ADJA 3VFVB 3CC5A 1AXTH 4Q9QL 1JE6A 1I7RB 3MMEB 4ZSOE 3L5XL 1DANU 2PO6C 4Y5VC 1OAQH 4PJDE 4KZDH 1HK6A 4OTXH 5EZOL 3CZJA 5HYIA 2GY5A 3MSPA 5ADOL 2ICCA 3P9WB 3X12A 3MLPA 1S7WB 1TDQA 4O2FA 5CUSL 4JO4L 3DV4B 3U0TA 1WWWX 2YD9A 4N0FA 1UZ8A 3SDDB 3U0WL 3IDUA 3TVMB 2CDEA 1HYRC 3T2OA 4NRYB 2R1WB 3NAAL 5GRVK 2NW3B 5GZOD 4XCYB 3B6SB 5B38B 5KSAD 2XACC 4A6YH 5DJCA 2X1QA 1IAIH 3UZEA 3N85H 4LBEB 4PJ7F 4NO5A 1WWCA 4JFZH 2FX7H 3L7FB 4Y1AD 1D6EB 5D7SL 4UINH 4NHCH 2HKFL 1MNUH 2IBGA 1VACA 4E5XA 1FNSL 2OL3H 3KS0H 2DL9A 2J1KA 4OZHA 3MJ9A 3OWEA 3V8CA 2OL3A 4C54A 3GSQB 3KLHD 5IV2A 1X6LA 4P2OC 1BBDH 2EDTA 1UJTA 3D3VD 3UTOA 3O2VH 4NM4H 3OPZL 5JA9A 1KN4L 1AR2A 4KRNA 5FGSA 4UMGA 1IJ9A 3S4SB 2OBGA 4RFEA 5TDNA 3ULSA 4U2ZA 3ULVF 3VXRE 4P2OA 3ZE2F 3C2AH 3FFCB 5BVJB 1QLFB 2YD7A 5DLMH 1PKQB 3CMOH 1F4XL 1FRGH 4HIHB 5KSAC 3GI8L 2DLEA 1VFBA 1LE5B 3JBG7 4X6DA 5D9SB 4LSSH 4UT7L 2GT9A 5IVZA 3FQUA 2WIIB 5GGTA 3BEVB 5EZOH 1SEBA 4KQ4H 2YK1H 2LAGB 4U7KA 2AXGB 4J3WA 1TNNA 2NY0B 2R0KL 2I9LB 3U2SB 3KPNB 1QUNA 2ZOLA 4WU5A 2NXYD 2WBWB 1KPVA 1YN7A 3KYOB 1A7NH 2NXZB 2HN7A 4YHNA 5JIPA 1INQB 3CNKA 5CP3H 4C59B 3GJFA 3LMJL 4G42B 4YHPA 3BPCA 4NDMA 4CVXB 5JOPE 4NKMA 3KXFA 4R7NB 4L3EE 3VWJC 1UVQA 3VGEA 2EDDA 1ZANL 2DQUL 1P7QB 4J2XA 5GS1B 3MCG1 1FNGB 2AQ2A 4NP4L 4KY1L 12E8L 3CFBA 3WUWA 5ACLA 4X4MA 4OBSA 4AEHH 2Q7YA 3RY6A 2BOBB 3O6FD 3P73B 2AAVA 4NQDE 1QBML 3L3JB 5INCA 1KPUA 1YMMA 3C60A 3NN8A 2Z31A 5ETUB 1BZ9A 5F7YC 1WBXB 4LCWB 1N59B 3HZKA 2AEPH 4I3GA 3ET9F 4ZS6D 3S35L 2ICEA 1VA9A 4XVSL 3TA3A 1DLHB 5I1HH 2VIRB 1X5ZA 4QOKA 4S1SL 4KU1A 3OGCA 4IM8A 1CXEA 1KCSH 4HH8A 1FLTX 1BP3B 1KELH 3ZKXC 1IC4L 1GYAA 2YPKA 1ZS8A 4DUVA 2DQFA 5JO5A 4G9FD 2NYYD 4GBXB 3DXAE 4P2OD 4M61A 5L88H 1NDGA 5E9DB 4XPBL 5F1SA 2DTSA 4LGPB 4HZAA 4RGND 2D03H 5C09B 2DM3A 4AEEA 1T6VN 2VDQH 3QDJA 4U1IB 2OI9C 5JQ6L 5DFWH 3UMTA 2DTMH 3DGCR 3O4OC 1BECA 3GSVA 3REWA 5C92A 1NUFA 2HFGH 3IAPA 3D1MC 4YGAB 3HFMH 4JJ5B 4ACPA 3TM6A 4ODUB 2R4SH 2M2DA 4R96B 3PWPA 1I1FA 1T89A 1LE9B 2KZWA 3UBXB 4PJ5B 4XXDA 4OB5H 4UIMB 3H3PH 1AO7E 4C56B 3GNML 4OF7A 3B4NA 1DN0A 4ZOEA 4GMSL 4JFEA 4WO4B 4RFNB 3PWPD 3T1FA 2XPGB 3NH7L 3OAYK 3WN5A 3BAEH 1X5LA 3CDGB 5F1OB 4O51B 2UVFA 4OFVA 4OF8A 4ORGA 4B0MM 2BSSA 3BN9C 3CCHB 1ZMYA 1KJMB 4Y19D 2VITB 2PXYC 1KJVB 15C8L 3NFNA 4FTVA 4JFED 2NLJA 4LPVA 2VSDA 4WUUD 1JGDA 2P7TB 5I75C 4D9QD 1RIHL 1NUNB 4P23C 5DVMA 3STZA 3T77B 3SGKA 2P46B 1PBYA 3TN0B 1KLUA 2ADIA 3UTPD 4K3EL 1A9BA 2X4QA 4KMTH 1F6FB 4L5FL 5CILH 4P4KC 3VGFA 3U30C 2IQ9H 2IPTL 1NCWL 4I77L 3FT3A 4OT1L 2OCFD 4G80A 1ZA6B 3K74B 3X17A 5DT1H 4J23A 1J0KA 2JJUA 1KBGH 1XGPA 1NCAL 2XWJB 3DVIA 3QQ3B 1RK1B 1CWVA 3DYPA 3WFEH 4LAJH 3BZ4A 3U36B 1QO3B 1II4E 1UZ6F 4GRLB 2C7UA 4QHMB 3FN9A 4HBCH 3HUJA 4FQJH 5E00B 3TBWA 1WK0A 4P9MH 1WBZA 2D7QA 1AQKL 4PRAA 2EYSB 5JUEL 1MLBB 4RBPH 1J1PL 1CE6A 5TQ0H 4ZSOB 1G84A 4ONFH 5JPMB 1CI5A 1YYML 3MLWH 1HHIB 3S88L 1TJHL 4I3RL 1ZVSB 2MTPA 5CJXA 1HDMB 5EG6C 3S37L 5IB4B 1MRFL 1K8DB 2UWEE 3O3BB 4U1LA 4QTIL 3K2MC 3T65B 1G1CA 1NGPH 4OV6F 5C0EB 4U1KA 5FK9A 3BKML 2FIRT 4I5BA 1JWUB 4L29B 3UAJC 3SGDH 4DKAA 1EK3A 2J2ZA 4PV9B 4XBPB 4NPYB 5EBWA 3MQIA 3EKCA 3V4VL 4PJ9A 1LDPH 2X9XA 15C8H 4KVCL 1SYVB 5TDPB 3ZTNL 2V2TB 1Y18B 2VWEC 3GRWL 4F58H 4G8EB 4MNHB 4LCIH 4M7LT 1YNTB 1EEUA 4JVPA 3U46B 4KMLB 4ZNEA 4QCIB 1R3JA 1FPTL 4D8PB 4HXBL 1D5XB 4OFDA 4Z7UE 2OSLB 2IAMC 3RVWC 1YC7A 5EU4A 1EA9C 4NJAL 1I8KA 4OLVH 4CN4A 3IFPB 2YUZA 4ZFFA 2X4OA 4LHUA 3GKZA 2W38A 4PLJD 3N1MC 2D3VA 1EAPA 2DQTL 1MHHA 2BSRB 5BZDB 4WFHE 4OGXH 3MRGB 5IMOA 3SKOB 4CNIB 2ARJA 4WCYL 2VSCA 5BXFA 4IOIA 2Z35A 4GH7B 5KS9F 4P9ML 1U6AH 5E9DE 1IARB 1ZV5A 4MJ4A 5E2WH 1K6QH 1T1XB 1ZT7B 2GK0A 5D7IE 1Z3GL 1KCUH 1UYWL 4MNQA 1BVKB 3N1PC 4RAVB 5FO9B 3Q48A 1LO3H 3QR2A 3W0WA 5DXWA 5E8PA 3MLVL 2CR3A 4NO0D 2D2OA 3ARQA 1JJUA 1FCGA 3WLBB 1FGNH 4YBQC 4POUB 3TYGH 3ZE0F 5CEZE 4LHJB 5HJ3B 1DUYB 1FZOB 4GG8B 1A4JA 1IQWH 3MLZH 3JTSB 1W72B 4W6YB 3S3PA 3O81A 1R3KB 3EYUH 4KK5D 5IIEA 4WJ5B 2HMIC 1NSNL 1FFRA 2XNAB 3LKOB 5FGBC 3QHFH 2DOCA 1XGQA 2EDEA 2NY6D 4LPWA 4ETQB 3KWWA 4D0DB 1I1AA 4XXCC 4MSWA 1RZJL 3BP5A 3ZZ1A 3DI2B 2JB5H 1PLGL 3O6ML 2XZQL 3NZ8A 3AM8C 3GIVB 3LQAC 5EU7E 4CW1B 5EUKB 4PJ9C 1CVSC 3SKNA 3QA3B 3LS5L 5F71A 4XPFH 4OCYH 1RHHB 2P24A 3PWUB 5JW4Q 1PVHA 3B43A 2XZCL 2VDQL 3TBTB 3Q5YA 5TE7H 1KEGL 5J1TC 3Q1SL 1RU9H 4PJEF 2DQTH 3QUYB 3IDXL 1T2QH 3ZYIA 5F9WC 5I1CL 3QQ4A 4UILL 3G08A 1N5YH 4UT9L 3TO4B 5MEOA 1TETH 3MXWL 2H1PL 5ALCH 2BNUB 2APXA 2CH8A 3I84A 3QEQA 3T3ME 3WD5H 1OARL 5IR1B 4O2CA 4XVJH 2NY2D 3RWGA 1IGJA 1JZ4A 5LXGL 3BAEL 4N0RA 4P3WA 2B1AL 4Y4HA 1FG9C 4NM8H 4M93C 4P2CG 4JFOA 1A7BA 1AGFB 4NOBA 4M6NL 3U1SH 4Z78A 3QH3A 3TC9A 2Y1VA 3TYGL 4HQQH 3TNNA 2R0ZH 4D94A 3QIUD 2A1WH 4JY5H 4N9OB 3SGDI 2DI9A 3V95A 4JPKH 2BSTA 2AXHA 2X40A 3EO0A 1HOCB 2A6KB 4P23D 4PBWD 3T8XA 4IRJC 2NY2B 3SDAA 3WUWG 1XF3A 2P8MB 5E5MA 4HKJA 3KLAB 4HC1A 4PLJC 3BVNA 4Y16D 3MLYH 4LLDA 3WFHA 1MCEA 2PW2B 4N0CC 2HFEA 3T0AA 5KZCD 3HE6B 1RZFL 3WHE1 2R1XA 1M6OA 2BCKA 1P9MA 3T0BA 4W4OA 2XZCH 5TDOB 4QGTA 5C0RL 2AJVL 3P9MA 1AXIB 4MWFA 3LQAH 3PF2A 5FCUL 4JFPA 3QNZA 3UBXG 4JPVH 2CSPA 1FG2B 4MJIA 5I15H 5I1CH 3E6HA 2FD6H 2GYSA 4NZUL 3FAXA 2R8SL 4WU7A 5FUCE 1L0QA 1VERA 2CRIA 4UV7L 5F3HB 4QO1A 3QULA 5DMIL 2GJZA 1S9KC 1HHKA 1VADB 4MJID 2BC4A 2EE9A 5HPMA 3N9GL 1AC6A 4TNVF 4QXWA 5DC0A 3QUXA 5F21B 3ULUC 3SDCC 1A6AA 1T21B 1U8QA 3LQZB 4WHTB 1KLGB 4LLVB 4F7PA 4JY4A 3V4VH 4H88H 2C3HA 2Z91A 5HDLA 1PG7H 5L2JB 5L7XH 5E2UH 2EC9T 5MI0C 1S9WB 5KSUB 5AYUL 5EFIA 5D7IA 3S6CA 3PNWA 4YZFF 4JO1L 1NCCH 1ZT4A 2CXGA 2JJSC 4K3JH 1HWGB 5T3ZD 2JB6B 1MRDH 3HRZA 1WCBA 2X89A 4PJBF 4UTBH 4K3HA 1ORSA 5FGCE 1E4WH 5ALBH 1MCSA 3W9EA 2H26B 3IAQA 3STBA 4WUUA 3FMGH 1EHAA 4LASH 4HUUB 3GSUA 2UZIH 3VW3H 3QI9A 4YUEL 1NMCB 3JXAA 3RA7H 2V2WB 3L3GB 3WS6C 4S1DD 1IKFH 2Z8RA 4L8SB 5EZJB 1T04B 1NKOA 3LN4A 1BOGB 1LHZA 5E2WL 1E28B 3MOAL 1WWAX 2C3VB 1OAUL 1J8HA 3IXTA 4LIQL 2G60H 4LCUB 5JR1H 1FVDB 4OLXL 4PTUA 1R24B 1RZIA 5AZEH 2ZNXA 3RVVC 5JXAH 8FABB 3BPOC 3EYFA 5D4QA 2GSGB 1YZZA 4ZAKA 4O2EA 4H25A 5DUMH 1HI6A 3D85A 3RWDA 4RAUA 2IPUK 3L3KB 3DV6B 1PY4A 3F12B 2FB4H 1YYLL 2OTUA 1I8LA 4ZO9A 5T3XH 5I8EB 4BELD 5D5MB 2V9TA 3FN3A 4P99A 4ZXBA 3FAWA 5C0GB 3B9VA 4JGMA 5TF1L 1MJJA 3WE6A 3BGAA 1F3JA 4JFYB 4JO1H 4OIBA 3MR9A 5D7JA 4NP4H 4YK4B 2HKHH 4ZXBD 1C12B 5GHWL 4UOW1 1JPGB 1NBZA 2OQJA 1IL1A 3GMOB 1AD0A 2XZQH 3O6MH 1CLYL 3FQXB 5I30L 1M05A 2IG2L 2NYYC 4ODBD 4FXKB 4ONGL 4WEBL 4KJQC 1WC7B 2KZ1B 2J8UE 3EJZC 1VGKB 2ITCA 2APWA 1HEZA 2NX5A 3TBSA 4YFLF 1CDGA 5ICXB 5FB8A 4Q6IA 1A14L 1MF2H 1L6XA 3VRJB 1HZHL 3DVGB 5SWSA 3HNSH 5J9PB 1IC4H 3DYMA 1BFTA 3MLRL 2R4RH 4QRSA 4ZS6C 2JCCA 4KJPC 4F7TA 1XF5A 3ISWA 2H6PA 4F2MB 5JIKA 3H0TA 2FX8H 2NW2A 4FZEH 2ITDB 2NR6D 3CK0H 1RUPH 4HMCA 1KYOK 3JV6A 5JQHC 1F11B 4R4FL 3RUGF 4KTEH 4MHHI 2JCCE 3V6OA 1GZPA 3P4MA 3HI5H 4YX2H 5IG7B 1K2DB 3IJSB 4Y4FA 3MUHL 3C8HA 3REVA 4AY0A 1MI5A 2HH0L 3O3DB 3HE6D 1AO7A 3D0VB 4G8GB 5E95B 3HN3A 1RJZB 2NX5E 3SY0B 1KJ2B 5F7EL 4WY7H 5CHNA 4YPGA 4ODXB 1T5XA 2NXYC 1OAKH 3O3UN 3TIDA 3UTQB 4TSBL 1S3KL 2AGJH 4M1DH 4ZAKD 1IGMH 3IXAB 4RGMB 1T83C 4RZCB 3D85D 2QSCH 2R1YB 5EWIH 5ISZE 2X4SB 1A02N 1IAOA 2BP3A 1HHGB 5KVEH 3EOBA 2VDMH 5CCKH 3WJJA 1MIML 4ZUTA 1JN6A 4HJ0C 1SQ2N 1BFSA 1W0WA 1GJIA 3QUZD 4CU8A 5GGVH 2COQA 5ELIA 5GJSL 3ZYOA 1S8DB 4NWTH 5GS1C 3OMZA 4XMPL 3EFFB 3FRUA 1EHNA 5GGRA 4OZHF 3V6FB 2NY4B 4X99B 4JR9H 5IQ7L 1ZLWK 1OGAE 1ZLWH 5D7KE 3GI8H 2FJHB 4WGVB 2VKXA 1MUJB 2D4DA 1NFIB 5DJZA 5IGXH 3DX7B 3GMLB 4YJZL 5FO8B 3W81A 2CLZB 4ZTOH 5CZVH 3CSYB 3WIFA 4NNXA 5FYJE 4DAGL 1ZT1A 3CZFA 4JRYE 4X7EC 4EBQL 5DHYA 2J3SA 5FKAB 4PRNB 4P46B 1C5CL 2CKBH 4JDTL 5D7LE 1DQLL 1UM6L 3DMMC 1RI8A 4HEPG 4KH2A 1XAUA 2QKIA 4PJIA 2X6MA 1JP5A 2X4NB 2A73A 1AIFA 5FXCH 3LCYA 2Q8AL 4ZODA 5C9KA 1IGCL 1J9CT 1QRND 2QADC 4UNVA 3LKNA 2B0SL 4LLWA 1KB5L 5F7NC 2CLRA 4PGCA 3L7EA 4JE4B 2D9QB 3V5KA 2HT4C 4WV1C 5CJQL 1UB5A 1KENH 1TJIL 1UWEL 1AGEA 4F7MB 5D5ME 3D3VE 2BVQA 3D2UB 2P5EA 4OD2B 1B0RA 1FO0A 1M1SA 3U30B 2NPLX 5M95B 1KG0A 4Z5RA 4LP5A 1CG9A 3MPCA 1F58H 3MUGA 4K71B 5BS0A 3FTGA 1VENA 1F90L 2OR8A 1OAZH 2BSED 1AGCA 3LKSA 5JIHA 5H35A 5BJTA 3BGMB 2X70B 4S1SH 4HCRH 4PRBB 4XMLL 3GHEH 4BUGA 2IBZX 2J8UB 4KXZI 4NBZB 3ESVF 1XGTB 4XHJC 1F4YH 4Z7NF 4YZFE 4NJAH 1X6NA 1JNLL 1DBAL 5IGXL 1SY6A 3IAGC 5FA4B 2VAAB 5FA3B 1IGTB 4O5LH 4JO4H 5I74C 4NQSA 5IFAL 5EU3B 1P2CB 1HQ4B 3VXOB 3CLEL 3UJIH 3X3FL 4YHYB 5GRJH 3GGWB 4XRCB 1HILB 3FOLB 1I85C 3O4LE 1PSKL 2VDRH 1SHMA 3U9UA 2EZ0D 4HWUA 3VD9A 1KC5L 4OZGB 3V8OA 3N85L 4XZUA 1MFEL 4UQ3B 2VZ1A 3PGCA 3GB7A 4XPHL 2F54A 3C6LB 4NHCL 5C07B 1S7XA 4HS3B 1Q94A 1YNKH 2X09A 4R7DA 4F37K 5KANI 3I6KB 4Q7DA 1QNZL 4FFZL 1N0XL 1RUKL 4XNZC 3DLQR 3TVMC 1DVFA 4JPIA 1J7VR 3L95A 2Y07L 3G5ZB 4RIRB 4WEBH 3PP4L 4HAFA 1MVUA 3OPZH 5GS2D 1DEDA 1XIWD 2PNDA 1UCBH 3CSGA 2FJGA 4HKZA 1CS6A 3Q5TA 4G5ZH 1TZIA 3ORJA 4JFQA 4RISL 1ED3B 3HC4L 3HC3L 4A2LA 2QSVA 5GQBA 4J6RH 2MHAA 3DUSB 4XXCA 4PIRF 4HUMB 4NZTH 3DSFH 2P5WA 1KNOB 3KJ4C 2BVPB 3EDJA 3K4ZA 4Z0XB 3VWKB 4BA8A 2EDRA 1X4YA 2FGWL 2GJ6D 4M7ZB 5KSVA 3GFUA 1LDSA 3UCRA 2Y7QB 1U93B 1GCFA 1EUUA 3KJ6L 5IW6B 4PJ8B 1ZOXA 5I1IL 3LS5H 1KBGL 3OKOB 3HPJB 1FFNA 3L3DA 4XP4H 4C4KT 4GW1B 2UY6A 3O11A 3ARBB 3Q1SH 2AJYH 4FXGB 3SE8H 3ARFB 3D0LB 4Y5YA 4CVZA 4BFEA 5B8CC 3PABB 3O6FB 5CAYB 4F15C 1F4WH 4KKLD 4W68A 1AE6H 3BD5A 1BVLA 3OXSB 5I19L 5D2NB 3R06B 2ADGB 4NZRL 2LU7A 3E3QE 1JHKH 2FECL 4S1RH 3RBSA 4JRYB 1NMAH 4P59L 3FB6A 5HYJD 1U95B 3Q6FB 4WI3A 2I60H 1BGXH 1Z9SA 3VA6A 1WSST 5IJKA 1D5ZB 2CKBA 3RVTD 1GAFL 4HBQA 2A0LD 2IADB 4V2BA 5DRXB 2YKLH 3QO0A 5I8CA 5F9OL 4PUBH 4U3XA 5HGGS 3FFCD 3PHQA 3SEPA 3HMWL 1BLNB 3B5TA 4H5SA 3W11D 4OZIE 2YC1B 4U7MA 1NANH 4U6XA 4JEGB 3E6FB 1T5WA 4G5ZL 3SHSA 1LDPL 1NUGA 3MCKB 2HAZA 1RUAL 1UXSA 1A3LH 1N6UA 1A9EA 2HTLD 3GRWH 3UTPE 3TA3D 5CLWA 2PF6A 3IDNA 4TTGA 1ZTXH 2DWDB 1T3FA 3ZDZE 4NQCA 1U8PA 3I3EA 4LU5L 3QDME 1KIPA 1WTLA 3HMXA 3MXVH 3QUYC 3JWOL 4EDWL 4JANA 5MEPB 4P2RE 4Z7VB 5L88L 1N64L 3DO7B 4ZUSA 4JZNB 5BZWB 4MDJB 2W92A 3JSSA 2G2RB 4M43H 2OMNA 1A7OH 1R5WA 2VR9A 3D2UD 1DQLH 1UM6H 2EE2A 4QXTB 4GT7A 2VZ3A 4EN3D 3Q3GA 1CK0H 1CD1B 4NZUH 5SWQA 5CGTA 1T1WB 4GW4A 2R4SL 2V2XB 5I19H 3FQRB 3SE4C 4EQ2A 1AKJB 1OGAB 3SDDC 5DR5L 3FQWB 4OZIF 4HK0A 2E6PA 2WINA 3WXVL 4LSRH 32C2A 1MREL 3MFFA 5J89A 5EPMA 1NPUA 2XTJD 5KS9B 2E7CA 5FF6A 5DWUH 1GC1C 3BGFC 1MCQA 3STLB 4ZDHB 4WI7A 2WUCL 1SEQH 2VB5A 5DEFB 5GS0D 5HVHC 2K9UA 4JGUA 5DJDB 1DTUA 1F42A 5D7LB 5KTEL 1ND0B 5DO2C 4XNYH 2AEQH 5F89B 4GXVL 4PJHB 5I9QB 3S4SG 4K3EH 5D1XB 1JRHI 2BJMH 5D7JC 3OKEA 5I76A 2ZOKB 2JJTC 2UWEA 4KUCD 2W91A 4PG2C 4RA3A 1WQVT 2HLFD 5DD3H 3SGKC 3VXSA 3B2VL 2JE8A 1T03H 2VLRA 2GI7A 1C08A 4QRRE 3HNTL 3FRPA 3MTRA 1PLGH 3F7QA 2E7LA 3NVQA 4DW2H 3HI1B 4MA3B 3MRFB 5HVWA 3QFJB 3IU3A 1INEH 4LLQB 4NNPH 1UT9A 2VXUL 4PG9B 5IVXE 1JHTA 3O45B 5SWZD 4P3DB 4L1HA 5IP4A 1FZJB 4WV1A 1WUNT 2HVJA 4K7PX 2FRGP 3OR6B 5IB1A 3MA7B 1MFEH 3T0EE 4XNMB 1G7IA 4PS4H 1FIGL 2VDNL 3QIWD 3HR5A 4ALAL 1RIVL 4J1UB 1OGTA 3VFOB 3HNVH 5IBTH 5FYJU 4FQHA 2Y5TB 4QTIH 3CVHA 1TJGH 3VXQB 5I8KH 4XWGL 2PTTA 5JA8B 1R3IH 2XIDA 3GSNB 4G7YL 1VSCA 3DUUA 3V0WL 1BMGA 1E4KA 1CLCA 2HYMA 3HA0A 4G8IB 4HUWB 3VD5A 3VWJB 1CFTB 3GKWH 1D5IH 3RVUD 1A6WH 3RKDC 5H37H 3NMEA 5IKCB 2AK4A 1SJXA 1GC1H 3EZ8A 1QHOA 3C8KB 2AXFB 4FTVE 4QRTB 5DC4B 2JK5B 2YXMA 1MCDA 4GQ9L 5C0AA 3WNPA 3HZVA 3ZT6A 1I1AD 4NRXA 1X5IA 1SVCP 1NGYB 2F58H 1RIUH 3NPZB 3PV7A 1NGXB 3KDMB 4MVBD 2ZCHH 4XP1H 2D9CA 5B3JF 5C6PB 1RHFA 4APQA 5E2VH 5E1AB 3V5DA 3VFWA 1AXSA 2DWEB 5J6GA 3BT2H 4D0CB 5T1LB 5IB2A 4F8TA 3MLTA 1DUZA 5C71A 2B1HH 4LCCC 5DD0H 4GKZA 1F3DJ 9CGTA 1K8IB 5T5NG 3BZEB 2H3NA 3P9LB 4WTZG 5IEHA 3G6DL 3SDCA 5EBLB 5JW3H 4GRWF 4HHAB 4KUZL 5E4EC 4CADB 4IDJL 5ICZB 5JORA 1LEGB 1R3LA 3BX7C 5MEQA 3F7YA 2Y6SD 2YA0A 4DUXA 2YN3A 3ZT5A 4UTAH 3RAJL 5FGRA 4FOMA 4G6MH 3BQUB 5DMJB 4JPVL 4HV8A 1IM3A 4R3SB 5H94A 1OT2A 2C1PB 2FX8L 1CFNB 1JRHH 4H0GA 4DJMA 4X6FA 2UUDH 3BEWB 3AROA 3LVEA 2GTWA 3BPNB 4FNLH 2DD8H 4LEXL 1NEZB 1MFCL 3I3BA 3FFDB 2BVOB 1HYSD 2YA2A 5L2KB 4GKOA 2YRLA 4KK9C 4QOKE 2EYRA 3MNWA 3VI3F 4OD1H 3DX9B 3D39A 4KKBC 2EIDA 2EKSB 2MKLC 4GAFB 1A7NL 3PDOB 3EYSH 3KPTA 2YMXL 4P4RB 4KVNL 4Z7WF 3BE1H 5I1EL 5GRYA 5DYOB 4X6EA 1JPSH 3QFDA 3SCMD 5IFHL 3TO2A 4Y4KC 1B4JH 2A6IA 1JTPA 2DDQL 2VL4A 4HJJH 5ADPL 2Z93B 4KDTA 4L3CB 1LEIA 4FQ1L 5TGBB 1TTFA 5FECA 3ULVH 5FYKE 1RZJH 1U92A 4F33B 1D5BA 2GCYB 2F74A 4YHLL 3LAFA 5INDA 4Z76A 2KQNA 1CIUA 4Y4KB 1IC7L 5K93A 3LSOA 1O5DT 2GUOB 3MA9L 1A6ZB 2XG5A 5K33A 5DI8A 4NWTL 5JW3L 1QACA 1KCVL 3LKRA 2EDJA 3GJEB 3ULUF 4YUEH 3A0OA 3IF1A 2DF3A 2JJWA 5AWNL 1IEBA 5JHDE 4WWKB 4OCWH 1DL7H 2MJWA 5FYLL 2X9YA 1UM4L 3JWDL 1NGWB 2XXCB 3DURB 3QNXA 3WIHH 2WBJA 1MIEL 1MH5B 1MREH 1TNMA 4N0YL 1W8OA 1YUHA 1XR8B 2RGSA 4JRXB 1OARH 1FZKA 1VEOA 4Z7VE 2AV7B 4ELKB 2ZSVB 4U6VH 3W9DA 1I8LC 1TENA 2R2EB 4UV4H 5EIIB 5BV7B 5B4MC 1J0ZA 1PQZB 2OJEB 4XAKD 4RMRA 4OAWA 3U0PB 5LJYH 5D1QA 3Q5OA 4PJAB 4HWZA 3QXAA 1OAXL 1QFUL 1UJ3B 1MCPL 3TIEA 1E4XL 5CSGA 3C5ZD 5EO0A 5T3XL 3O3AB 2A1WL 3SKJL 2X89D 5CGYC 4LQFH 3RVXC 2VC2H 3FOMA 5I1LB 3L9RA 4NWUH 3PE9A 4OZHE 5I18L 1UJ3C 1ZGLB 3FB7A 5F9JB 1G0YR 1DR9A 3DX6B 2NY4C 2VXSH 1EBPA 2DM4A 2F53D 4LSUL 3MRBB 4QXUL 5ABDE 1CLYH 1AY1H 3WO4B 3CU1A 3DRTB 2R9HD 5C2BH 3GSOA 1MPAL 2R0WL 1G7QB 4XBGB 3ZTJH 1XCQB 4U1JA 3P4NA 1OT1A 1FDLL 2HFGL 1S7TB 2VABA 1WZKA 2J4WL 5CGYD 4UI2A 5BRZA 5KSBB 2XTJE 3D9AH 3RWCB 1NAMB 2EKJA 3MV11 4MA7L 4XPGL 5T1LD 3VFPA 1NQBA 4AQ1B 4HGWA 4Q9CA 5FDYA 4P0DA 4OZ4A 4X8XA 4UDTA 4ELMA 4YNYB 3CK0L 1U3HB 3EHBD 5IESH 4GMSH 5AD0B 3EO9H 4Q6YA 4PJ5E 3CFDB 5IHUL 4J3OC 1UWXH 1KT2A 4U1GC 2D7MA 1CIDA 3DX8B 4M5ZL 4YIQA 1QHPA 4M6OH 1JF1B 1LO5B 1P84J 4HMDA 2P47B 4J8RB 4UQ2B 5JW5A 3QUXC 4O00A 3UPAA 1G7HA 2X4RB 3IGAA 4FP8H 1AQKH 4I0PD 4KJPD 1NCNA 2IAMA 2E7HA 4HJGA 2YWYA 5DD6A 5FAAA 2J8UF 5C0BD 3U83A 1H0DA 4DN3L 2G9HB 5E08H 2CGRH 3KYKL 4HWBL 3ILPB