3LQZA

Crystal structure of hla-dp2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Crystal structure of HLA-DP2 and implications for chronic beryllium disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqzA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3lqzA01
4OIIH 1F6AB 5CEZL 4XTRC 5K9QI 3GKZA 3RL1A 4HXBH 4PRHE 4YPGA 1KV3A 2JJSA 1NMBH 1FZOA 2DMCA 1H9VA 3N85H 2DTMH 4HEPG 4LHUB 4P4RB 1TVHB 5KSBF 1CD1A 3FQRB 5LQBL 4J3VA 4LLVA 1A14L 5LKNA 5DHVH 1T6VN 3RIFK 3QRGH 4NWUL 4ZOEA 2D03L 2OLDA 1AI1H 1GAFH 1UCTA 3CFCH 3MSPA 2NX5B 4JHAL 3BPNC 5GS1B 3PIQB 3V4PH 5F9WB 1FL3A 2HMIC 2IADA 3PGCA 5DZNA 2R29L 3BKYH 4XVUD 2NY4C 4H1LB 1Q9LB 1G9MC 4KROC 4KMQA 5GGRB 4Q97A 5IBLD 1MFNA 4WEBH 1W0WA 2CMRL 4HIXL 3FFCB 5D1ZD 3TO2A 3AS2A 4FFWD 1FQ9C 2WV3A 5DJDA 4RX4A 5GRZA 3HNVL 1QFOA 3JV6B 2OJEA 2NZIA 3RAJH 1WK0A 3HPLA 1E6JH 1T04B 1DTUA 1IGTB 3EO9L 5I1CH 3QBTB 3HC0A 4IDLA 3MUJA 4FG6C 4HUMB 3HI1A 2A6JA 3GK8H 3FO1B 4GRWH 3D39E 3MBED 3RWFB 2DM2A 5HYIA 3GI8L 5T3XD 3STZA 1B0GB 3QZWG 5J06A 1FNAA 4LSRH 3T0EC 2FX8L 4HS6B 4YHML 5J89A 5MHSE 1FVEA 1KPVB 1H15A 4U6XB 2B8OT 3WXVL 1PD6A 3L7FB 3MREB 4R8WL 5GS2D 2VXUL 3ZE1E 4LVEA 3SDCB 4M7JL 4U1HA 4WHYH 3RPIA 5DO2D 4HWZB 4JZJC 4PGDA 1SM3L 3NZ8A 2X10A 3PXJA 4PP2B 1FLRL 2ZOLA 4JJ5B 1JWUA 3OB0K 4DGIH 1NLBH 4H20H 3FQNA 1Q0XL 5T3ZD 5GHWH 3FHQA 5GSRB 1INEL 3WN5C 4EOWH 4FXKA 2B2XL 1NUGA 3BEWA 3U4EB 1IAIH 1ZT1B 1SJXA 3O0RH 3GRWA 4M93B 1EGJA 4ORGB 3ARRA 5E56A 1IRAY 2BC4B 3LD8C 3EYVA 3K80A 4L29B 5ETUA 1KIRA 4M6AA 3LMJL 1I9JH 4KJWD 1S5IH 3IRZA 1CS6A 1OT2A 3MOAH 1DVFB 3MACL 3DJ9A 4DWHA 3F12B 3KDMA 5DEGB 5C6WH 3FQTA 3JTSA 3WLBB 4K3DH 3X11A 5D71H 1LE9A 4PBWD 1S8DB 2ESVA 3VWJD 3BHBA 3VXSD 3P9LB 3BQUB 2IPTL 3GMNA 5DJ2B 3T4YA 1TJGH 4EUPG 2P5WE 3DUSA 2AKRA 3WL9B 1T80A 5F44A 5I1EL 1LILA 3P4MA 2QQNH 1B0RB 5D1QB 5FA4A 4JY5L 1Z5LA 3QEQD 3T77A 4PG9B 3EFDH 3REVA 2GUOB 4JVUA 1TVDA 3NZHL 1JNLH 3MV11 3U9UB 2ZCLH 4CAGA 2CLVA 1KJ2H 1RUAL 2MQ3A 3MNWA 4J3UA 5GGTA 1GZPA 2FNBA 1CFQB 3P4OB 5HPMA 4IS6A 2ZUSA 1LK3H 5EU5B 4J2XA 1N7MH 4NPYB 5IB5B 3KPPA 4L8CA 4KUZL 3OGCB 5DQJB 4WW2A 4GMSL 4ZFOB 3NPSC 3CFJB 3FT2B 4YR6B 3SOBH 3CAFA 3KHOA 2IANB 3CDCA 4LRNH 1HIML 2PW2A 3ECBA 4IOFC 1BLNB 1NC4D 3SO3C 1UB5A 3ABZA 4I1NB 1CXFA 3HN3A 4PJAE 3TIEB 1JZ3A 1NFDA 1YEGL 3GSNB 3SN6N 1CXIA 1Q0YL 4KK6D 5F70A 3VH8B 2ERJB 3TN0D 5KJRH 2EDNA 4OIAA 1ZE3C 5GISL 4G9FD 1JNJA 3S5LG 4LCUB 4KJQC 5EN2B 2B1HH 5DJAB 3TBVA 5CP3A 4BSWB 4L8SC 3ZSSA 3IAQA 3P9MA 4IOIB 1AXIB 2I60H 4OCMC 1QRNB 1JE6A 3AY4C 4M8QA 4ERSL 3TP4A 2A38A 4L5FH 2QADD 3MV8D 3QUZA 2ZG1A 2ZNWA 1UQSA 3MLXH 3LKNB 4B7LA 4XVJL 2YD9A 3G6JB 3V52H 4WWKA 3GKWL 3GNML 1X5AA 1RIVH 5D2NC 3CX5K 4X6DA 5IQ9A 4Y4HA 4OB5H 4IRJB 4AL8L 4AYFA 3GDBA 5D7JA 3QI9C 4G42B 3QPXH 3QUMB 4P5MB 3EBAA 3ZE0E 4C4KO 2DYPD 5TQ2H 4C56A 4EI6B 3IJYB 1N4XL 2HVKA 4RQQA 1JFQL 4NHUA 4P2QB 3GB7A 1AO7E 3EJZC 4HUNB 3DUUB 2WK2A 1FORL 43CAA 2H41A 3RVXC 3SGEH 1FL5A 4L4TD 1NCWH 4U4BA 4DN4H 1E4KA 2VLRD 5D9SA 4UDTB 1YZZA 1JHTA 1WCBB 4TNVK 2HT2C 1I3GH 3DRQB 1A7BA 2H32H 3RBSA 1X3DA 4QGTA 4GAYA 1HILB 3IDMB 4UT6H 1J88A 2ZZUT 1W0VB 4Q6IB 4NQXB 4QHKJ 4KKLC 4KI5C 3FCTB 5KSUA 3T4AB 3E2HC 4FZ8H 4BZYA 3FQUA 1NKRA 1XF5A 3I75B 2H2PC 4X6CE 3O45A 5MEQB 4XXDA 1CZ8H 5I16A 4MJIA 4LNRB 4QRQB 4R7DA 4HS3A 3HI5L 4JVPA 1DBKH 3I2CL 3QIUD 4MNQE 4XWOC 3TV3H 1C5DA 3LN4A 4PRDB 2NTFA 5ESQB 1PZ5A 4XWGH 3OKYA 2Y7QB 5J3HD 2MKWA 1XF2B 1X9QA 4TULL 5EORH 5JORA 1UKTA 4HLZH 2CUMA 4UAOB 3FOLB 4WI3A 5IW6B 4D9RE 4W4OA 4X9BA 5E2VH 3MQIA 4UOW0 5E8EB 4ZNCD 1A64A 4PJFB 2IG2L 5HYQB 1X6LA 4FTVB 1M1SA 4U2YA 2C3VB 3DI2B 1K4CB 5JOFA 3DYMA 1K8DB 3P0YL 3RVUC 4MQTB 5ADPH 2HKFH 3BPCA 2KQNA 4BM7A 3VXRD 3MZTA 4C83A 1U8OB 2FBJH 3ILQC 5A43C 2A83A 2R69H 2JB5L 3P4NA 3K46A 5E7FA 1A3LH 2ZPKL 5SX4H 1D3CA 2IQAB 4ODHL 3FTGB 4S1QH 3QUZC 1OTUC 4DW2H 4OLUL 4Y19A 1YPZE 4JGUA 1OTSD 5J4MA 2EE3A 2EZ0D 5EZJA 1GIGH 4NN5C 1UWGH 5C09E 5EOCH 1RUMH 1DUYA 4Y4HC 3WNKA 2PW1A 1C16B 4TVPD 4K2UH 5FOJA 5D7JC 4DOHB 3F58L 4WIQA 5D8JL 1LDPL 4IJ3B 4OKVB 2DMBA 1RZJL 2PYED 3U0TB 4FQLL 2NY1D 3RZWA 2ATPA 3QDJA 1FFNA 4WUUD 4X0KB 1YDPB 3UJTL 1J05B 5EUOE 1L0YA 1RVFH 3QFJB 4HUXB 3DX7A 2VERN 4WDIB 2AI0L 1D7FA 1TXKA 4LKCA 1V7MH 1E4KC 3UTTD 1U8HB 4X4YB 3RVVC 3E8UH 4QWWC 5HHOE 2G75B 4MVBC 3SKJL 3LKSA 4QF1A 1PG7W 2R1WB 4PY8I 2NTSP 5EO0B 3GIVB 1HYRC 5C07B 1QSFD 4CADA 2Z31B 3GIZH 4KQ3H 4ZFZB 1U8LA 3BN9D 2DD8H 5CJ5A 1ZHBA 4X4XB 4WY7L 3NA9H 1ETZB 3SDDA 4OLWH 5DVKA 3P77B 4M1DH 4X7DC 4Z5RA 4PRID 3B83A 1I9RH 4JAMB 1T3FA 5F9OH 1AQDB 1IKNC 4MHHI 5GRJH 2MCPH 5DT1L 4L4VD 2DQJL 3KNBB 3QQ9C 3WFHB 1AP2A 4JPWH 5DGRA 5FUCE 5DQ9B 1JZ6A 4NO5A 2W9DL 1NBZB 4XPGH 1EJOL 4HWNA 4PJ5A 1KXTB 1MAMH 4YHKL 5DR5H 4OCLC 3L5XH 4XZUB 1C7TA 4I18B 1EUTA 1T2QL 2C9AA 2EDRA 1S7QB 1KCVL 4W4OC 1CD8A 2VWEC 4K9EC 5AZEL 1BVLB 2IWGA 4OZFA 1VKXB 2GW5A 4XC1L 5EU4B 5F89B 4RGMB 1C08B 3RZCD 2BVOA 2VR4A 3IDUA 1MPAL 4KDVA 4E0RA 3X13A 2R2BB 2EDEA 3MXVL 4LSSH 3SDAB 4PJXA 5MI0C 4H25B 2IGFL 5JUEL 3UTOA 2XWBA 4M00A 3RWEA 2QKIB 2VXTL 2X4RB 3RDTD 2APFA 4D0CB 1CE1L 2AK4A 3WDHA 3KPOB 1JF6A 3ARBA 3MV9B 1KIPA 3RX7A 4HKXA 1QP1A 25C8L 3LN9A 4JLRA 3HG1A 1JHKH 4IIQA 1KJMB 1FFOA 3GSRB 1A7OH 5T3XE 1OAYH 4B0MM 5EC1A 2AAVA 4YH6A 5C0BB 4JKKA 2JK5A 5DJYA 2Q3AA 4NQCA 4JDZB 3TO4D 3B2VL 1A22B 1ZWIA 1IAKA 4NQEB 3IXTA 4Y2DD 4PBXA 3L1OL 1QLFB 3HAEA 4GSDH 32C2A 1KC5H 5HDQL 3W0WD 2R0ZL 5JO5B 1QD0A 5DHYB 3SKMB 3CH1B 2JJTA 1FIEA 3CPLA 4NUJB 4D8PA 5JPMB 1EH9A 1KLUA 1MJJA 3ZLQC 1XGQB 1BIIB 1F3JA 4FN0A 3GZKA 3VXUA 1FYTB 3AREA 3NFSL 4X80L 4QRSB 2RCSL 1ROWA 3PHSA 3RWDB 1LNUA 4S0SD 3RY4A 1XR8B 4XNZB 3MA7B 4UAOC 2VDNH 4L3CB 3PWUB 4FQXA 2Y07H 2JELL 1VDGA 2EEAA 3SDDC 4KJPC 3LPGA 1N0XH 4LCCA 1S78D 3VXSE 1WT5A 2HLFC 1RZIA 5KZCB 1T7XA 4MX7A 1F58H 3BWAB 3S9DB 4P3WA 3WLWD 3T2PA 3MLTA 3I3DA 2CKBL 3QEHB 5IG7A 4R4BA 1FFPB 2I24N 5D1XA 2X89A 3TYFB 3QEQE 3BGFC 1FNGA 2BNQB 1RZ7L 4LQFH 4F9LA 3L3JA 5IEKB 4FXLA 4ONFL 4P23A 3RI5F 4PJIF 5E8OB 3MRQA 4JFXA 1NGXA 3QSKB 4XP6L 1JYWA 5T33H 2VXQH 4WTWA 4OZ4A 5LXGL 5I1GH 4M5ZL 2XKSA 5C8JB 3MMEA 1EEZA 1R3KA 5T1KB 3U4BL 4QRTA 5FB8A 4NCC1 3Q6FA 1GGCH 4IRZH 3KLDA 3EYQD 4HF5L 2YZ1A 2NR6C 1T0MB 2F53B 1KG0A 2ZSWA 5D7LB 3W39B 5FHAH 3IDIA 2C1PA 4G80A 1A9BB 1MRCL 1U93A 4AEEA 3ARBC 4EIZC 3I02A 4JPIA 1IVLA 1GOHA 3NOIA 3SDYH 2A6KA 1QO3A 4YBHA 3CCHA 1QTYT 4G9FE 4IIQC 1MWAA 4O58H 3PV6A 4YIQB 3FOMB 3ARFB 4MAYA 2QTEA 1UXWB 3BEVA 4PJHE 2GAZB 4W4NA 3UMTA 5CLWA 3MV8E 3DLQR 4TNWF 4LQ1A 2OK0L 5I76A 1FN4B 4GKSA 1RZKH 4R26H 2B1AL 4Z7VB 3G5ZB 1INDL 3GGWB 2P8LA 3MRHB 3EGSB 3C60A 4L9LB 2JJTC 3D85A 3QCVH 3VA2C 5I30L 2KL6A 2OTUB 4F33A 5TGBA 4JRXB 1FL6B 2ZCKL 5HHME 1JJUA 2RFXA 1ZA6A 5DWUL 2Z4QA 5HD8D 1CT8A 4L4TE 2ICES 4NQDE 4YDKH 1N8ZB 1F3DJ 2EKSB 2ZG2A 3AREC 4NOBA 5T5FL 5TH2B 5I19L 4Q9QH 2OL3B 2VDLH 2VLRE 2JB6B 3BP5B 2EE9A 1FZJA 3SKOB 3IFNH 5EOTA 3CSPA 1AR1C 1NKOA 3SPVB 3V0VA 1QKZL 1T20A 3CVIH 5BS0B 4U1SA 4FQXC 3BH8A 3X3FH 1S7UB 1YECL 3BXNA 1QFWM 2Y5TA 4LCCC 5I1DA 4HIJB 2E7CA 4JGMA 5GJTH 1WQVT 4OUOA 1CWVA 3GMLA 1A7PH 5C0AE 1KB5H 5D2LA 1DBBH 4X7CC 1GGIL 5KSVA 4QCIB 3EYFA 3C5SA 5JW3L 4HWEL 1QPXA 2LTQB 2Y1VA 4FS0A 5B8CB 1JWMB 4KTEH 4P23C 1ONQB 3CVHB 3NVQA 4P5KB 1OSZB 4YNYA 5DRZA 4FZEH 3QDMA 3RWHA 4M5YH 3EOBB 3BJ91 4TTGA 2R0LH 2YBRA 5J7CC 5HGGS 3H9YA 2X70B 4F7MA 4RBPH 3PDOB 1M6OB 3NH7L 1N5AA 4JFPA 4HIHA 5J57B 4QEGA 1MCSA 2FHBA 2X40A 3KXFA 2UVFA 2NY7L 5CSZB 5HDLA 1TNNA 3QWRD 1C5CL 1VFAA 4YWGL 1MHHB 5K93A 3FO0L 3GJFH 2VC2L 2X41A 5DC0A 1KLGB 1IILE 2XQYG 2Z91A 4X5WB 3HPJA 3VXRE 3WE6B 4RRPA 1TJHH 3JSSA 2YA2A 3V95A 4F15B 5D7KE 5C0JB 5HYJD 5K9OA 4LK4A 4QXGL 2AEIT 2AJZA 5BV7B 4U2ZA 3U0WL 1T7YA 4NUGH 4TTDD 1AGDA 2R0WL 1Y6MR 4JFYB 4P9MH 1A4KB 3WHE0 4MA3A 4WO4A 1NLDH 2VKXA 1ED3B 5D6CB 1P4BH 4RGNC 1KJ3L 3JZ7A 1CLYH 4MCZA 4HWBH 4MQXD 4N90D 3PWLB 1XF3B 4E42A 1WWBX 3MJ8B 5A2IH 4PJIE 1GGTA 4TVPE 1U95B 2C1OA 4O00A 4JCMA 4OLYL 3QNYB 1NJ9B 3C60C 4UB0H 1A7RL 4QRPA 3MLSL 2PYEE 4PRBB 4WTZG 4NO0B 3N1MC 4WUUE 5ALCH 3UC0H 2YRLA 3HNSH 3NIDE 4QHUB 4H5SB 2DQUL 1DQML 3IKCB 4DCQA 4AZ8A 4I5BA 5EU3B 1BGXH 5CJQH 2AV1B 3S36X 2F58L 3UTTE 3E6HB 3KWWB 5JA8B 1E4XI 3V6OE 3ZTJH 4AIZA 4HKZA 3BP7A 2CIKA 4MWFA 5FYJL 1WZ1L 4JO2L 2EYSB 1XF4B 3FRPA 1OTTC 2VLKB 4JPVH 4LIQE 4MMZC 3I6GA 5B3JE 3MLUH 1YEFL 4BA8A 5E2WH 2D9CA 1JN6A 3SGJA 2W0FA 4JFFD 4CJ1A 4JHWH 1G7QB 4PRIE 3CK0L 1Z3GL 5FKAA 4OZHA 4MDJA 4GRWB 5TE7H 3H3BC 4UT9L 3V6FA 4L4VE 1JI1A 4KK8D 1D9KD 5ICXB 4Z7WA 3RWIB 1IAOB 4XNQB 2BERA 5DJZA 2H26B 4UTBH 4HGKC 4ODXB 2XT1B 3M8OL 4UINH 1LO4L 5KVEL 1KNOA 3OKOB 4GKZA 4NKIL 2OXGA 2DLFH 4TVSa 2VKWA 4OGYH 4R96B 4M3KB 1DQJA 5HGHB 4LAQL 4ALAL 2ZOKA 3MO1A 3S3JA 3ZE2F 3RP1A 3S37X 4AK1A 4GBXB 4Y5VA 3KYKH 4ISVA 1NANH 2AK1H 1HXYA 4N8VG 4Z77A 5L9DL 5C6PB 4UIKL 3RWJA 1NCAH 2G9HB 4OM1H 4X98A 4NZTH 4X6FA 3BFOA 1M7XA 5DDHB 2IAMA 4ZNEA 3RUGB 2FIRT 1TZGH 1GH7A 2F8VA 5TE6H 4KY1H 4KVCL 1XF1A 2OR8A 3TH2T 1T0NA 5CEZE 2FR4A 2CIIA 4HKBA 3O2VH 4WO4C 5JW5B 5DD5H 4GRMB 1BX2A 5D7SH 4ZO6A 1G0XA 3IFOA 4O9HL 2VN4A 1U6AL 5HVHC 1T1ZB 3VFUB 2QSCL 2C4XA 4K7PH 3S4SG 2YD3A 2DI7A 4XX1G 2ICWA 1C8PA 2FD6H 1MHPH 1A1NB 4GXUM 2Q8BH 4KRNA 3MLVL 1U8NB 1BQHA 5TQ0H 3BH9A 4PJ7A 5C7XH 2F5BH 2A9NH 2GTWB 1IGIL 5SWZB 2PTTB 3N1QC 3TYGH 3O2DA 4OJFH 2B0SH 1BIHA 5FXCH 1FSKB 4HKJA 5AYUL 1D6VL 2C7UA 2ADIB 1HHIA 1QFWI 3I9GL 4JQXA 3MJGX 1OAUL 3T0XA 3HRZA 1MFAH 1NFIA 2ZUTA 1WWAX 4U1IA 3DV6A 1OM3L 4W6XB 4R90H 2OZ4H 4U0RB 4LSVL 4YK4C 5D5MA 3ORJA 2YUVA 3VXMD 3HE6A 3VD5A 4KGLA 4PJCB 3HC4L 2AJSL 1DLFL 4X4ZA 3C9NA 3ARDB 1L6XA 4MLIA 2ZKHL 5DUML 2HVJB 3FFDB 3HUJB 3U6RB 2EH7H 2F5AH 4YAQA 4APQC 1JBJA 4CU8A 1CR9H 4MXVF 5J1TC 3GSNL 4I3SH 4OZGB 4Y4FA 4CU7A 3OAYK 3Q5OA 1AR2A 2FO4A 4UZGA 1XGPA 4JFDA 2WIIB 2BJMH 4H8WL 5J9PB 1KB9K 3LN5A 4ESKA 2ZJSH 3O9WA 4FQCH 4Y5VC 4K9EL 5IT2L 4P59L 1W0YT 3E6FA 3AB0B 5EB9A 4F7PA 1MIEH 1P7QD 4KJYB 4U1KA 1AHWC 3TGXA 1ZKAA 1FP5A 3T0BA 4FXGA 3LKOA 4XBGA 4JO3L 1HOCB 4PGCA 4LCIH 2A74B 2IAMC 2DQIH 4FP8H 2VITA 3A67L 3DMMA 1ZTXH 1YEIH 1AD9B 3IDYC 4X7SH 4UU9B 4PB0H 4QOKB 3SGKA 4NNPL 4ZS6C 5IK3A 3GMMA 1MJUL 3VWKA 1QSEE 1RHHB 4MS8C 3O3EA 5DQDH 2MMXA 2P8PB 5E4EC 3ZKMC 4BH8B 2DLHA 1I7TB 5CGYD 3L3HB 1QBML 3GMPA 2BDNH 1AH1A 4N1EA 1YN7A 1ZA3B 3GM8A 5CD5D 3O2WL 3I3EA 1JUFB 5JOPD 4ODUB 4KUCF 2C3GA 4KI1A 3EYOB 3B9AA 1U9KA 5GGSB 3F5WB 2PYFA 2EDXA 3SE9H 4JFHD 3RWCA 5DLMH 4PRPB 1X5IA 4E5XA 3O3AB 2RIKA 3GJEB 4PJBF 3KYNA 1G7HB 2R23B 1QQDB 4PYGA 3JXAA 3VG9B 4OZIF 3CIQA 3ZE2E 2LE9A 1V05A 3FB8B 3MRGA 5EZLB 5FF6B 4NKOB 2NXYD 4PRHB 1CU4H 2NY4D 4JQXC 4AM0B 3QO0B 4GG6A 1AGFA 4JM2A 3PL6D 2EE6A 1ULVA 5BW7A 3F7VB 1G9NH 4L3EB 4L8DB 4N68A 4C57C 2HRPH 2XZQL 3G5VA 3S8WA 1NL0L 2P4AB 2RR3A 2AGJH 2AXGB 3OG4B 2LVEA 4X7TB 5J1AA 5DVMA 2Z8RA 2JKXA 3AS3A 1YEJL 1M05B 3C6LD 1IGCH 5LGJB 4JFQB 1FBIH 1C1EH 3EOAA 3H9SE 3QQ3A 1DN0A 4LSTL 3MROB 4DUVA 2BSTB 2DTSA 5DUBA 1DDHA 2NLJA 2HKHH 1RU9L 3Q6GL 3PWVB 3NGBC 1T1YB 4IHOA 2H3NA 2FJHA 4Y4FC 3L3KB 1RMFL 2WUCH 5KVFL 4X8JB 3T0ED 5F9JB 2YPVL 1FV1A 2GQHA 6FABL 2GYSA 3KPQB 1MJ7H 2GTZA 4PJGB 4M7LH 1SJVA 3VFWA 5IVXA 3O9WC 4EBQL 3V0AC 4DVBB 4N0YH 3PGDB 3O8XB 4R7NA 1ORQA 1BD2D 5C0CB 3BN3B 4OLZH 2R0KL 4TN9A 4RWYL 3FONA 3D39B 1IL1A 1MFBL 1UGNA 5E5UB 1G6RH 2CSPA 2MHAA 1T7ZA 4ONOA 3QJFB 2F19H 4KKBC 1WAAA 3U2SA 1AKJB 3DMMC 4Z7UF 4XAWH 5LBSH 4U6VH 1ZVSB 5TE4H 2UVEA 3IDJA 2BVTA 3SGKC 1UM6L 3VWKC 5HYJE 4YGAB 3SGDI 4PV8B 4HIIB 3GBLA 1RK1A 3CLFH 4NKQB 3WUWB 2QLVB 2CLZB 3CXDH 4U7SA 1FNHA 5EO9B 4FA8A 3NIFE 1KTDA 5I73C 1I9IH 3WFCH 2XTJB 5BMFL 2EXWC 1LHZA 5KN5A 2F54E 1E27A 2UZYB 3HMWH 5E2JA 1UYWL 3C8KB 4N90E 2VH5L 4R4FH 4K3JH 1F6AA 2E5EA 4ODSL 5IBTL 1NDGB 4NC2B 3V9FA 3ARGA 1XIWA 1NCDL 4MXVE 1N6QL 5J12B 3CMOL 2YKLH 1U3HA 4LHUA 2DQTL 1TVHA 1DJSA 2LVCA 4ONHA 3FQRA 3VFNA 4J1UA 2VDQL 4U6HB 4NNXA 3B9KA 5CEZH 5E1HB 2I25N 1WJ3A 3AU1B 4R2GD 1AGBB 5GS1A 5A3IC 1QSVA 3PIQA 4JN2B 3MRDB 1TCRA 3VA6A 3ARWA 2FGWL 5LQBH 1CTNA 2VMFA 4HJJL 4GAGH 1A14H 5BW7C 4NBYB 2WP3O 4RX4D 4H1LA 1Q9LA 4NWUH 4P46B 4IOFD 2D03H 2PN5A 3OTTA 1RZFL 4JHAH 3OKNA 1N3NB 1URLA 3C5JB 3NAAL 3T3PE 4JFFE 3JWDL 2R29H 3X3GL 3RHWF 3HE7C 3E3QE 3SDXF 4TUKL 3WNNA 4YLQT 1UJ3A 3U83A 2P5EA 1RPQA 5H37H 4HIXH 2HTLC 5DURD 3T2OA 4X6EA 5DJXA 4HEME 3MRCA 3FO1A 5ESVB 5J6GA 1QNZL 4LVHC 4WHTA 5DRWA 1B0GA 3HZVB 3V79C 1A6AB 3W11C 4BZ1L 4U6XA 5HHNB 3RU8L 2EXYC 4CUCA 4G9DA 5E70A 1AD0B 3MREA 4PJBE 1U58B 1N26A 2OX5A 4PJDE 5C0IB 3GI8H 3SDCA 4FQPA 4XX1E 1R3HB 1U0QA 4XCCL 4ZUUA 4PP2A 4GJTB 4NDMB 2OTWA 3EJZD 2FX8H 2JCCB 4P9HC 3U4AA 4HULB 3S96A 1G0YR 3WXVH 3ETBF 3QNZB 4POZC 3V0WL 1OLZA 4R8WH 1K3ZA 1QSZA 4P2OB 2VXUH 2Y36L 1DZBA 3U4EA 4M7JH 4EVNA 3E1F1 1JGEA 2AQ2A 4L29A 3SY0B 1SM3H 4WJ5A 3DTXB 4LLDA 1FLRH 3T2NL 3VG9C 4PYHA 4UUJA 2ESVD 2DQGL 5DEGA 1Q0XH 4JKPL 5EIVA 1W8OA 3KYAA 1VGKA 4MB4A 1INEH 3L5WA 2DKMA 1UJTA 1NAMA 3SHSA 1FIGL 2B2XH 3GSQA 3KLHC 2OI9B 3QR2A 5BXFB 1S8DA 2H2PD 1Q1JL 2VDOL 1QLRB 3DV4B 3ARGC 3IGAA 1XIWC 3LMJH 5DJ2A 3MACH 1U3HC 1T5XB 4GG8B 2VYRE 4XWOD 4X4MA 2CO7B 4Z6AT 5F6HI 1I7ZB 4HFWB 1E6OL 3L3DB 5LJYH 3B9KC 2VLJA 3MGTA 1PGRB 2CDEA 3J8F7 3O4OC 3V5KB 2GUOA 2EDTA 2IPTH 1WBZB 5CIPA 1CFQA 1CDUA 4DKEL 2YPKB 2BP3A 4FOMA 5EU5A 5D7IE 4X6CB 5I1EH 4X8XA 1CGYA 2VDPL 3QUYA 12E8L 3LOWA 1F8TH 1KN4L 4JY5H 2J8UF 4RFNC 1BF2A 5DQJA 3HFML 4Z7UE 5HI5D 1ZLWK 1FDLL 2R1XA 3FN0L 4NWTL 3NZHH 2JIXB 1RUAH 4XVSL 4YR6A 3CJJA 1PFCA 3ES6B 3RVUD 3THML 3OJ2C 4BFIA 4YZFF 1E4WL 3VXME 3OJVC 1BLNA 4LLWB 5L8KB 4F7CB 4KUZH 4Q2ZB 3ILQD 1UJ3C 1MVFA 3MCKA 4GMSH 5TDOB 3C09B 2V9TA 3U30C 2YRPA 3ULSB 5TDPB 4HH8A 4HHAA 3VH8A 3OJDA 3F7QA 5KSBA 1HIMH 1OTUD 3CSYA 1OF2B 5DJAA 4PG2A 5FEBA 1CI5A 3UBXB 5IW1A 2ZG3A 4WWKD 1Q9OB 3JV4A 3LIZL 2EDLA 2R4RL 3NCMA 5IJKA 1YEGH 5GS3A 2XOTA 1E4XL 2ENSA 4Y4HD 1Q0YH 3OQ3B 2R39A 2YR3A 3WNMA 1G9EA 3B9EA 5D7JD 1TITA 4JGJA 5GISH 4LCWA 4C56D 3GHEL 4FRWA 5SWSB 1L0QA 4IRJA 3BIKB 1CD0A 2FSEA 1AO7A 2F74B 1M7DB 4ERSH 1BOGB 2Z8SA 1YPZB 3W5NA 4XVJH 3RY5A 4KHXL 3EDKA 3GKWH 3G5XA 3RVVD 3PGFL 3GNMH 4QWWD 1W72A 2X9WA 4MVBD 5C09B 4F3FB 5F7MC 2VIRA 5IFAH 1QUNA 4AL8H 1QVOB 2O61B 4XB7A 1PAMA 4DAGL 4QXUL 1OARL 5K9KA 3NABH 3KPNB 1R24B 1N4XH 1WV7T 3K8KA 4LNVA 1JFQH 4Y16D 4HDIB 5EUOB 2LV4A 1FORH 2OL3L 4NN7C 4I2XE 5CINL 4MJID 4N0UA 3C5ZA 1R5VB 1PKOA 2V5SA 1CGXA 4YX2L 3QQ9D 4RNRB 1H5BB 2NY6D 3BMWA 2CGRL 2VDRL 3NCCB 5IHZB 1BBDL 3VFRA 3KPRA 1F4YL 1YEDB 4JFHE 3M07A 4QRQA 5FUZL 4LPYA 3D0VB 3EO0A 5HI3D 4NSKA 4NZJA 1ZVYA 1DQQA 1EZVY 2IPKB 3V2AR 4LLUA 3SQOL 4P3DB 3MRMA 2R9HD 1DLHB 3QUYC 1U92B 3CVHL 1LGVA 3HI5H 5IW6A 1MCPL 3I2CH 4ELMF 3KG5A 1F45A 4HIEA 3VFOB 5J56B 5MENA 1CXKA 4YHZL 4GLRI 3MZGB 5C2UB 1LP9F 1YJDC 4K8RD 4TULH 1S5HB 1VACB 3INUL 3DGGB 4UIMB 3C6SB 4YDJA 3HTLX 3A6CL 4Q58C 2B5IB 3IXAA 3QZWB 4UI2A 3ZT6A 1IBGL 4KC3B 2BOCB 5C92A 4Y8AA 1EBAA 2IG2H 4PP1C 4Y19D 5T1MB 5D1ZB 4PG2C 5FDWB 3T0EE 2GJJA 3P0YH 5F7KC 2W60A 2IQAA 3HMXL 3RVWC 3FTGA 3LDBB 5HDBF 4V2BA 3VD9A 1CFNA 4JPKL 1KENL 4U1JA 4Z9KB 1QFWL 1EAPB 5BV7L 3K4ZA 2JB5H 1BD2E 5FYKD 2K9UA 3QDJD 1J0ZA 1IGJA 2W38A 4WW2F 3MBEB 2ZPKH 3RKDD 1R5WB 4D3CL 3PQYA 4HXBL 4Z76B 1P1ZA 4ODHH 2EDOA 4N5UA 2VISA 1YUHA 2CRMA 1OT1A 3IFPA 4OLUH 1NCTA 2AERT 5ACLA 1K4DB 3D0LB 4RISL 5HHOA 4YHYB 4PREA 4HUUA 4XNUL 1KYOK 4P5TB 1U8KA 2X1XR 1TZIB 4R0LA 3U7YL 3F58H 3GSWA 5D8JH 1LDPH 2QV2A 4DJMA 4YQXL 1MCCA 1U8HA 1J86A 2EE2A 4F80A 1RZJH 3V4PL 4FQLH 4EUPB 1RULL 3V7AG 2D7OA 3SDDD 2X4OB 4KJPD 3UJTH 2G2RB 5C07A 1LO5B 5F7DB 2Z31A 3UBXI 1J7VR 1KCKA 5GRXG 2HLFD 3C5ZC 5TF0A 4X4XA 1T22A 1HHHB 3P77A 3JV0A 3D69A 3SKJH 3SJVD 2H8PB 1WIOA 4M6NL 5E24E 3B4NA 4JAMA 2GFBA 1RJZB 2WBKA 4HXAL 3X17A 1TVBB 1OOAA 2OTPA 4WY7H 3T04D 4FQQB 5L8LB 5IB3A 5IB1B 3VXSB 5F7NC 3QXDA 3L95A 3ME0A 4YBQC 4P2RA 4XBPB 4Y5YA 5KSAA 3MCLL 4I48B 1S9XA 5DT1H 2B4CC 4WHCA 2DQJH 1GJIA 2I5YL 3UPRB 2NR6D 4K3HA 1WZMA 1A0QL 3QEQB 5JTWA 2W9DH 5LGHL 1EJOH 3G6AA 5ABDE 1XEDA 3IF1B 4YHKH 1RZGB 2R2BA 4POYA 1NDMB 2Y06L 3G6DL 3HLAA 1TQBB 4H25A 4G6AC 1JHLL 2DWDB 2X4SB 2AK4D 5E8DL 3S5LB 3X12A 1T2QH 1LO2L 2KQMA 1KCVH 3ARBD 2PUQT 5AZEH 1LK2A 4F9PA 1RUKL 2DF3A 1LD9B 2Q7YA 4JY6B 4Q9BA 2DBJA 4XC1H 2HWZL 5CZXD 1Q8MA 1J8HA 3S3SA 1QBLL 3HG1D 4D0CA 1MPAH 1JGUL 3KPOA 3OB0H 4MNHA 4XB8A 3MXVH 2FJFB 2NNAB 3VFGL 4OZFG 2IGFH 1I8KA 4JDVB 5JUEH 3QUXD 4NQCD 3V8OA 1UVQB 3O3BA 2GY5A 1JP5A 1NAKL 4WUKL 2VXTH 1GL4B 1OSPL 2WLYA 3QJHA 1CE1H 2XN9A 5IJVB 2BY2A 2EEDA 4TOYL 3I6KB 4XRCB 5GS0D 1NBVL 3TN0B 5C0NC 2UZIL 3WDJA 4Z8FL 25C8H 2YD6A 4G9FB 1F3RB 4OUUB 2A0LD 1ZHLA 2XWJB 3EJJX 5A2LH 3TESA 1CICB 3OKLB 4ZDHA 4PJHB 2GSGB 2ZUXA 4M7LT 4UBDD 4HMCA 3B2VH 2QADB 3QNXB 3VXUD 2XPGA 4R0LC 9CGTA 2C4FT 3GSOB 2BVQB 5C0EB 3DX9A 1T03L 3PWJA 1L4IA 3L1OH 1NC2A 1F5WA 2X9YA 4O51A 5DTFB 1ITCA 1N59A 1P4LA 4FQXD 3MODL 4MQ7A 5CEYA 1BIIA 3CFBB 4GXVL 2AABL 2ESVE 2R0ZH 5DC9B 3RWDA 4IM8A 4G8EB 1XR8A 4OCSL 3HAEG 2DYPB 3PWUA 4JEGB 4YXKL 1EAJA 1ZHKB 2VZSA 4KMTH 5ESAB 5HHMB 4XP5L 3SOBL 5I17A 2ID5A 5EZOL 5D1XD 1HXMB 5FUCC 4L4TB 4NQDB 3AC0A 1I3RB 2R4SL 3NFSH 4X80H 2RCSH 2VLRB 3NIGF 1U41A 2ED9A 1BPVA 2FL5A 3FO9A 1DE4B 3ZKXB 2B5IC 2JELH 2OCFD 3TYFA 3NCEB 1MI5A 1NSNL 5IMOB 1G0DA 3WIHL 3IJHB 4U6YB 2Q87A 3MX0A 5IBLC 4Y5YC 5KSAC 5SV3A 2YPLB 4LL9A 5DVOA 3OHXB 5FYLL 1S7XA 5C0AB 5L2JB 2CKBH 3BUYB 3K3QA 4BKLA 4YC2B 1S7WB 4FFWC 4I9WD 2P49B 4PGEA 2I60L 1WITA 1CXHA 1P84J 5L2KD 2MKLC 1RZ7H 1UXSA 2YC1A 2CK2A 4HC1A 3CH8A 3MLPA 4MJ6B 4R97B 4XCYA 3VXTA 4XP6H 1NFDE 4BSJA 5E5RB 1R3JB 5LXGH 4D9QD 4M5ZH 3LQZB 3MBEC 5D7LA 5FAAA 1HI6B 4U3XA 1YN6B 5I8EB 3IU3A 4NNYA 3U4BH 5AZ2L 4I8DA 3HZKA 4MD5A 2ADJB 1INQB 1NH6A 4Y5XA 3KJ4C 4N9GA 4HF5H 4MAYD 1LQSR 3SCMA 3MRLB 3BZEA 3QXAA 3F7PC 1H8OA 1TIUA 1PG7X 1OGAA 4YFLF 3DYOA 2ZUQB 5GSVA 4EQ3A 1I1YB 4WW1B 3LVEA 4RGND 3VG0L 2FYYA 2R8SL 1MRCH 5DO2C 1M71A 4F57L 5DI8B 1ACZA 1I8LA 1LO3L 4IMLB 2HFFB 2GSIB 2V6HA 2AXJA 4X9IA 2D0HA 4G8GB 2Y23A 3C60D 3D85D 4C56E 5D93B 4P2CG 4HD9A 3NA4A 1UWXK 2KBGA 4PD4J 1FGVL 3MRHA 3SQBA 5LG1A 4KJWC 4QHKI 3RRQA 2CH8A 2OTUA 1BJMA 1SQ2N 5I8CB 2WM0A 4AEIL 4LGRB 5IV2A 2OK0H 4G3YL 1R3LA 4ZFFB 4NM4L 1DL7L 2QJDA 4YDLB 2B1AH 5DMYA 4K94L 5IVZA 1INDH 3VWJC 3CZFB 4MB3A 2JB6A 3D48R 2VRAA 1OTTD 4M62L 3RNQB 1QFUL 2X4NA 1LE5A 5BS0A 5I30H 2PYEB 1ZT4B 4QRRA 2NY1B 1NGYB 4LCYB 4WUUB 3KR3L 4U7KA 2G60L 2E9WA 2V7HB 2ZCKH 5DWUH 5DJ6B 4MJIE 5F93C 4QHNA 5I19H 3ROLA 4X5XA 1I1FB 5EBLB 3BYTA 3FMGL 3QEGL 4M7ZC 4PIRF 3QIUA 5DK2A 4OF6A 5F9DC 3UTTB 1QKZH 2HAZA 1ES0B 4QCIA 4C55A 5C0DB 4YDVA 5FGRA 2BCKB 1I3UA 4DN3L 1R5IA 1UFUA 3QDMD 5ITBL 1YECH 2AQ1A 3S34L 5IKCB 3T1FA 5B8CA 1TZHA 2HYMA 4U1GB 1ONQA 3AMLA 4D0DA 4X7FC 5C0FB 3W9DB 5JW4N 1WF5A 2YA1A 2RQ8A 3EOBA 4Q9RL 1GGIH 2VWEE 2YD4A 4BQCA 5JW3H 3L6FB 4PRIB 2X70A 3OKMB 4HWEH 3MNZB 3IS1X 2VR9A 4HCRA 3KXFD 3V5DA 1Q38A 6CGTA 2LU4A 5TPWH 1M6OA 1WTLA 5JQHC 4M1GL 4OTXL 4YGVB 1JNNL 2FWOB 1ZLUH 3T0WA 4LSUL 3ZYIA 4JVWA 4WI5A 4PJ8A 4AJ0A 3V4UL 4KK6C 1S7TB 1TNMA 2N7BA 2IEPA 5IB2A 1FAIH 1WC7A 4WNQB 3SCMC 2W1NA 1KLGA 1S9YA 3KGRA 2UWEF 5GRVK 3LPFA 3RZCB 1U42A 1LEIA 3V4VL 2X7LB 4WO4D 2NY7H 4Y19E 3WO4B 2J5LC 3BWUC 1U3JA 1C5CH 4YWGH 5T1DL 5CBAB 1I8LC 3FO0H 3NIGE 3QIBA 5H2BA 2VC2H 4JFYA 3V7AE 4KH2A 3ZT7A 1UG9A 4DFHA 5DRXA 5EC2A 3U9PL 4CVUA 1ZEAL 2ADGA 4QRPD 5ENWB 1WLHA 1UWEL 4GKNA 3HI6L 4WI9A 5FYKE 4J8RB 4JANA 3QDJE 2ZSVB 1JTOA 5DHVA 3U0WH 3QNYA 2R0WH 5DEFA 1KJ3H 5ADOL 3OR7B 1YMMD 2VZVA 1UACL 3REWA 1XH3B 4H26A 2FATL 4FQ2L 3ZKXC 2VABB 3TO4B 2VZ1A 1LDSA 3MUHL 5JW4R 2HJKB 2HFEA 5F3BB 1P9MA 2HJFA 1QSFA 2VAAA 4Y2DB 1U8IA 4OLYH 3E6HA 3KWWA 4LFHD 4NZRH 1A7RH 2I9LB 1IM9D 3MLSH 2J6EL 5CSGA 3O6FB 5FECB 5FO9A 4Z78B 4DZBA 1UB6A 1GC1L 3IDGB 2DQUH 3B2UD 1DQMH 1EJ6A 2VLKA 4HJGB 1MLBA 2E6JA 1OAQL 4ZUVB 3FQXB 1UT9A 1MVUB 1TETL 3S3PA 1EGJH 2F58H 3QIUC 4OM0L 3DX8B 1G7QA 5J3HC 5DJ0B 2WUBH 1WZ1H 4JO2H 2ARJB 1MAKA 4QHLB 4PJ5E 1BZ9B 3L3OA 5GRWA 5ICXA 4OQTL 5IF0A 4P57A 1IAOA 1YEFH 5F7HA 5EU7C 3QHFL 4BQ8A 1VFUA 5E7BA 5J6HB 3FRPG 2H26A 5I18L 1RK0A 4LFHG 3CK0H 3O3UN 1Z3GH 3K8MA 3G5YB 2ICCA 3G9VA 3C8HA 1JHKL 1OCWL 1KJVA 4UT9H 4KMLB 1EDQA 4PJXE 4R96A 5IR1A 4HG4J 5HGHA 4PJ8C 4X5LA 4I4WB 1D5XA 2R15A 3MV7A 3ZDXF 3M8OH 2C3HA 3IB4A 4GBXA 4TSBL 1LO4H 4GUPA 5JR1L 5LGKA 5KVEH 4G6FD 3RDTA 4OQ1A 2AK4E 1YJDL 4NKIH 5I9QC 3TVMB 4QXTB 2X44D 3AROA 3TBTB 1SBBA 2EC8A 4LAQH 4ALAH 3HG1E 3QH3B 3CUPB 2E7LA 1FVDB 2QR0A 3BYYA 5HJ3B 4MS8D 1P7KB 4RZCA 2EZ0C 3KYMA 2BNRB 5CAYB 3JWOL 4NQCE 1X5LA 4KV5E 3QIBC 5L9DH 1S7RB 2NY3C 3OR6A 4KRPD 4UIKH 5JW5A 1F6LL 1NGZA 3AXLA 2NQCA 1T1ZA 4OFDA 1J10A 3K4DA 3W0WA 3QULB 4KVCH 5JIKA 3JVGA 2GITB 4J3XA 1I8MA 1A6VL 2FJGA 4LVNC 8FABB 3LS5L 1S9WB 4V2CB 1X5GA 1QSEB 4TUJB 3H7BB 4X6BB 4HK0B 4NOFA 4O9HH 1KJ2A 5HHVL 1JV5A 3V6OC 1U8NA 1U6AH 2K7PA 4YO0B 1NUFA 2QSCH 3VXUE 1FCCA 4XGZA 2PCPA 1K3IA 3VXQA 1P9MC 3ILPB 2GTWA 4LEXL 4LVOB 3IJSA 3BN9C 5D6DA 2VLLA 3P0VL 43C9B 1DBML 2WWKT 2HN7B 1YA5A 3MLVH 2O5YL 3LEYL 4U1NB 4Z95L 2YMXL 1JIBA 2LFGA 2VTFA 2IBZY 3HE6D 4HGWB 1KCSH 5JXAL 4HLJA 5DF0A 2IBZX 3ZHDA 1BQHG 2FO1A 3B9VA 3OX8A 3RIFF 5AYUH 1D6VH 1JF1B 3DETD 3HCVB 3I9GH 5FHAL 1OAUH 5CMAA 4WU5A 3ARDA 2DIJA 1WWWX 4Y4FD 1OM3H 3VRJB 4OD2A 2J1KA 4LSVH 4JFDD 3ZDYE 5IMKB 1IEBA 5E99L 4OZGA 3O9WD 1XCTB 5GGVY 3HC4H 5HHQA 1KBGL 1DLFH 4HV8B 5J13B 3H9SB 1CLCA 3BKCL 3IU4L 4QO1A 5ID0A 4YEFA 4ZUTB 1YNKL 3PUCA 3RDTC 3DVGB 4KKBD 4XNXL 3ROOB 3GSNH 5DMGC 3DMMD 4D9QE 4F37F 4QY8A 1PX4A 3LRGA 1I7UB 5DMJB 2ICWJ 1MCWW 4JZOB 5HYSA 1HSBB 4H8WH 3AMKA 4PJEF 3VWKD 1OAZH 2YSSB 15C8L 1Z9MA 4NN6B 2E7LC 4Y1AA 4K9EH 1PLGL 2IMNA 3SE8L 4AT6A 4P59H 5FKPA 3IAGC 1KULA 5CSBA 4QOKA 2H32A 1HWGB 5K9QG 1JGLL 2EXWD 4RGNE 2VB5A 4LLMA 4YDIL 4JO3H 2Z0BA 4MCYB 2P8PA 1A2YA 1HQRB 3A67H 3VRLE 4OCYL 1JWSB 1WBXB 5I1IL 3JVGC 1ZA3A 3TCXA 5CGMA 3MYZA 1JUFA 2DLEA 2L4OA 3P73B 4NNPH 4CNIA 1MJUH 2EH8H 5I74B 5E0QA 3ARYA 3EYOA 3KPLB 4OLEA 1ADQL 2MPAL 5EZIL 1QBMH 2D9QB 5JNYB 4J3TA 4ODWA 1B90A 4JFEA 1CFTB 3O2WH 2F54B 1G7HA 3QISA 2CQVA 5D6DC 5A3ID 1AFVL 2P8MB 1AIFB 2BXZA 5CKGA 3FT3A 3MYJA 4JM2D 4H88L 4XNMA 5BOZG 1NEZB 2QSVA 3VGDA 1I1AA 1G7LB 2XQBL 4UV4L 2X4PB 1OW0A 2ITCB 3STLA 3W2DL 1YQ2A 2A6DB 4RFEB 5D2LE 4EN3A 4L3EA 3MRKB 5BZWB 4OD3L 5DD1L 2G5RA 2BNUB 1CG9B 1EK3A 3LKQB 3TBSA 5MEOB 2XTLA 2LU3A 2WBJA 2V2XB 3RI5K 1MRFL 4MA8L 3O11B 3QG7L 5GRVL 1U3ZA 1M05A 5D70L 5GXBB 4MQSB 2FB4L 2HTLD 5F88A 3QDME 1KGCD 3QXWA 1NCBH 2P24B 4LRIA 2XZQH 1NL0H 1D5BB 1I7RB 4O5LL 3QFDB 1HH6A 5CEXB 1Q9WB 5C08A 4Z7QF 1X7QA 4X8JA 1KXVC 3W11D 1YEJH 4JFFB 2XZZA 2FLRT 1I3VA 2GK0A 1D5MA 4ZOAA 5ITFB 2ZUUA 3QG6A 4A6YB 4N8VB 4PJGA 1IEAB 3WKNA 3TFKD 3KXFE 4LSTH 4QNPE 1P4BL 5BRZB 3ULVD 1MLCA 3BT2L 3Q6GH 1RU9H 3PGDA 4ZS7L 4XNYL 3AVEA 1SBSL 5C0CA 3BIBX 2A2QT 5FCUL 1A6ZA 3QRFM 2NZ9D 1RMFH 5KVFH 1P5UA 2VE6A 2YPVH 2V7NA 4J23A 4POZD 6FABH 1J0IA 3WD5L 4Q74A 2QQLL 5DS8B 5HYJA 2AQ3A 4EBQH 4XHQA 4NKMB 1F2QA 1U8QA 2R0KH 4NBZB 4PY7B 4RWYH 2H2SD 3V5HB 1MFBH 3G08A 5T3XL 3S4SB 4PJDB 5L0QC 1AC6A 3M45A 4M61A 4PV8A 4HIIA 2WWKO 3EKCA 4PR5A 3WUWA 1Z9LA 3KLHD 3B3IA 3FB5A 4U1LA 1CN4A 4XCNB 4YHPB 3H7LA 2ICEA 1MCRA 1UM6H 4LHUD 4QRPE 4LBEA 1T1XB 4HH9B 1IE5A 3MLUL 1FAKT 1NDGA 3OAZK 1FNEB 4MGXA 1CGTA 4Y89A 1UKSA 3CFDB 2A73B 5FYJD 3B9KD 3H0TB 4MA1C 5HD8C 3EUUA 1GGBL 5BMFH 3QIWB 4Z7OF 1QG3A 5F1IA 3F62A 5DMKA 2NX5D 3VFTB 1UYWH 3OL2A 3VFMB 3PABB 2VH5H 2OYPA 1JCKA 1F4WL 4ODSH 1AGCA 5IBTH 2X09A 4XT1C 1I1AC 5KTEL 3GHBL 1NCDH 3NFPA 4MDIA 1AGBA 3GSUA 4EQ2A 3CMOH 4BSVB 1V3KA 4LPCA 2DQTH 1OW0C 3FB7B 4CMHB 4FMFA 3FFCD 2QBWA 3VXOB 5DA0B 2VDQH 1CVSC 4PJEE 2XXMB 5BQ7B 4P46A 4LHUG 4OZHE 1RFDL 2A6IB 4F7EA 2XZCL 1KCRL 1QR1A 1D9KA 1Z9SA 1X44A 4PS4L 4Z7WE 2P5ED 3VFSB 2FGWH 1HSAB 5D7IB 4HJJH 5DSCA 3D2UB 4LRIC 4WI8A 3O4LB 1NMAL 4U1MA 4WU7A 1UH3A 2DWEB 1CLOL 1RZFH 3DRTA 1FG2A 4ZPTA 1UZ6F 3NAAH 4TSAL 1TZGL 4CRPA 4H1LG 5MEPB 3JWDH 3VXMB 5HY9A 3BO8B 1SJEB 4TUKH 3SDCD 3HZVA 4OZIA 1HINL 1V8HA 1S7SB 2Q86B 1EHAA 5FOBA 4HUVA 3MRBB 5HSFA 2XG4A 1FGNL 5T1LB 3UO1H 1QNZH 2COQA 4WI6A 2EIZB 4LOUC 3U36B 4M8VA 4ZYKB 4ZNEE 1NGPL 5IOPB 4BZ1H 5CLTA 1ITBB 2IALB 3MRFB 3QNZA 3RU8H 2E7HA 3PP3K 1MFCL 4TTDC 4I77L 5BZDA 4LEOB 4UQ2A 4TUOB 4RIRA 2WW8A 4XCCH 3SY0A 3UTSB 5IEHA 2AEWA 4OJFL 5IHUH 2JF1A 1J1XL 3WV0A 1I9EA 3QXVA 3BQUD 2IH3B 2D0GA 3F7YA 3V0WH 4LKXB 1U36A 1XCQA 2WWMC 2Y36H 3U82B 3VXNA 1RJYB 3HZMA 4RDQG 1K5NB 3TH3T 4ORZC 1QLRA 2QSTA 2RHEA 2DI8A 3T2NH 1KLFA 2FLBT 2VLJD 1G7IB 2DQGH 2FX9L 5DJCB 4PJ7E 1KF9B 4JKPH 5J8OA 4OLXL 2YD7A 4AEHL 1WZLA 2ATKA 4HFWA 3FO2A 1WFTA 1FIGH 1EFXA 3L3DA 3ULVF 3D6GA 1Q1JH 2W65A 1HHJB 2VDOH 1RUQL 1WAAF 4QRUA 4N0FB 1H3PL 1IEHA 5BO1L 5JHDB 2Z35B 1X5ZA 3TC9A 5ILTL 3K8LA 1E6OH 2V2WA 3TJHC 2BSRB 2IAND 3D25A 2Y72A 5D5ME 3CZJA 5JQ6L 1A9EB 3OAYH 2WIMA 3PNWA 5MP6L 2EYRA 2ZJSL 3BPNB 3N1PC 1D9KC 5DC4B 3U0PA 4DKEH 5C2BL 4G7VH 1T5WB 2VDPH 1WCQA 3P9WB 12E8H 5B21A 2NY4B 2DQDH 5JLZB 5EA0L 4KROB 1FC1A 5I75C 4F7CA 4Q2ZA 1JK8B 2P7TB 1CD9B 3HFMH 5ICYB 4PP1D 1FDLH 3FN0H 4NWTH 4ZO8A 5TDPA 1QYGL 5DRNA 4XC3L 5FV2A 1DUZB 3QQ4A 4XVSH 4AENB 4X7SL 2GJZB 2P1YA 3GMOB 4JFDE 3RVWD 3THMH 1E4WH 1MHCB 2UZXB 3CXHJ 1GGUA 4NQVB 4LCWD 4LDLB 3LSOA 1VENA 3WEXA 4Z7OE 1O5DT 4D0BA 4DQOL 5B38B 4IRJD 1V5JA 1VGEL 1ZHNB 3PWPA 5E94B 3QWOB 5SWSA 3IAPA 3PF2A 4P2QD 4YHIA 3VH8G 3LIZH 3T0EB 2R4RH 4ZUSB 3RJDA 1RURL 1ZT7A 1UM4L 4MXWL 3L5JA 1Q72L 1TQCC 3BVNB 5I2IB 3VI4E 2VZTA 4KK5C 4ETQA 4ZFGL 2XQYK 4JZJB 4NIKB 1U3YA 3VGAC 3GHEH 1BD2B 2VJXA 1QA9A 3OXRB 3SDXA 3OB8A 5JW4M 3TNNB 4DZ8B 1QVOA 1ZS8A 1K6QH 1HKFA 4G5ZL 4PTUA 3WN5B 4HX1B 3C5ZD 3ARPA 3VGHA 2Q7NA 1KB5A 4KHXH 3LD8B 4TVPL 3PGFH 1A4JA 3MGOA 4OGXL 3KPRD 1FO0L 5CJOL 1NUDA 4DAGH 1UZ6E 4QXUH 1GVIA 1GHFH 1OARH 4UDUB 5ID1B 2VSCA 1B4RA 2H9GB 4MNGA 4RNRA 2OSLA 3AS1A 2E7BA 5FYLE 1YEDA 5E4IA 4IDJL 4XPAL 3RL1B 4YPGB 5C3LD 3CC5A 2OL3H 3LY6A 1P69B 1FZOB 2FIKB 5CINH 2Y4SA 2C4FU 4YBQD 4GG6E 2E9BA 1ZV5A 4FNLL 4N0RA 1CDBA 3PL6A 2ED7A 1CD1B 5FFLA 4YX2H 5M95B 5MEND 4LLVB 4Z7NF 2VDRH 3R06B 1BBDH 1F4YH 1OVZA 4LIQL 1U92A 5E8NA 1B6DA 2QEJA 5FUZH 2FEEI 5SWQA 4XCFL 4G6AD 1FL3B 3PGCB 1PQZB 3GJFA 4KGJA 1CFSA 3SQOH 3CSGA 3DGGA 3QUKA 4TRPL 1EHNA 2K7QA 1BFOA 2V2TA 2XRAL 3CVHH 3H9HA 5HDOA 2QSQA 1MY7A 4HK3J 1JZ5A 1MCPH 3NPSB 5EU6A 3DX6B 3TO2B 1KGCE 1KPUA 4XAWL 5DJDB 4YHZH 3CLEH 5CJBA 2VDML 3INUH 4EI5A 2OJEB 5FCSH 5IVXE 3SO3B 2C3WA 4ZD3L 4ZTPL 5A40E 4KDTA 3UYRL 3HPLB 3A6CH 4HWBA 4J4PA 3ALWA 5FDWA 1C7SA 1RZKC 3HC0B 4MXQC 4NT6A 3HI1B 1C5BH 2A6JB 1IBGH 4ODVL 3PQYD 3IRPX 3K2UL 5C0ND 4CW1A 2ZUYA 3VFPA 4F7TA 5HVGB 3ULUD 3STZB 5GGUA 1WAAE 4P0DA 4PLKC 4LMQE 5FO8A 3NBNA 2J8UA 2HTKD 4DKAA 1R5WA 3ZZ1A 4Z76A 1FVEB 2OMNA 1H15B 3HMXH 1J11A 1JZ8A 2DL9A 5EIQA 4WFHE 3NN8A 2VLMD 4JPKH 1T83A 2VQTA 4HPYL 4U1HB 5F7EL 1QFWH 3RPIB 2CLRA 5BV7H 5D2NB 2FH6A 3NZ8B 1S7VA 2ZOLB 5CGYC 1JWUB 3K81A 4NFCA 4P5TA 3DSNA 4OLVL 5C07D 3QI9B 3FQNB 4D3CH 1PBYA 2Z31D 4D9LL 5CD5C 4OCWL 3U46A 4FXKB 3S35L 3BEWB 3BPLC 3VDCA 1J0KA 2X4OA 4WEUD 2NY2C 3EYVB 4RISH 4GAGL 1KIRB 5F7DA 2P43B 4UQ3B 4C4KT 5K59F 1FHGA 1IGYA 4YBLC 4W6YB 4XNUH 1DBAL 3U7YH 1MCEA 4CDGC 3KDMB 3IS0X 1AGEA 5E2UL 4NRXB 4YQXH 3FQTB 1SY6L 5GRYA 3BKML 3JTSB 3QDGA 1S9VA 1RULH 3X11B 3WUZA 3G6JF 5B39A 1LE9B 2X2YA 1XFPA 2ESVB 2XIDA 5ALBL 2NXYC 3MFGB 2XWTA 3V6ZA 3FQWB 3GMNB 4BQ6A 2NX5E 3BMVA 3T4YB 3VU2A 3E2HB 4P2RD 5KSAD 4HGMA 1GSMA 2AKRB 3PL6C 5IB1A 3WJJA 1PVHA 3P4MB 3VE0A 1FJ1B 2F8XC 4M6NH 5FA4B 1Z5LB 4KXZH 1BEYL 3T77B 3W81A 3REVB 1TDQA 4XP9L 4HXAH 3FFCE 2D4FA 2CLVB 3SDAD 2EEBA 3MNWB 1GZPB 2XA8L 1KOAA 5DZOA 1UC6A 2E9JA 2QQQA 3C6LC 4IS6B 5HPMB 5IMMA 4Y88A 3TLRA 1D5ZB 5DD0L 1RZGA 2VXVL 1F11A 3HNTL 3LZFL 3ARZA 2AXFB 2CRIA 2CDFA 1J8HD 3KPPB 4K07A 4L8CB 4HJ0C 3MCLH 3DHJA 2P5EE 1NMCC 1MCKA 2I5YH 3F8UB 1BFTA 1A0QH 1MCDA 4BJLA 5LGHH 2PW2B 3ECBB 4JB9L 4GW5A 1CQKA 4EI5C 3EDJA 1KIQA 1UB5B 2Y06H 3G6DH 4KDTC 2FJFA 1EIBA 3O6LL 5C0BD 1JHLH 1NFDB 5E8DH 2XN9D 1OQOA 1LO2H 1T4KB 1U91B 3NTCL 5BJTB 2J8OA 2D0FA 1KTLB 4NQED 4DK3A 1RUKH 2FHFA 2HWZH 1QBLH 2BHYA 3MJ9L 5GZOC 1JGUH 3LKPA 3S97C 4O4YL 5E1AA 2A9MH 4YJZL 1G7MB 3VFGH 4XRCA 4ZPVA 4M8QB 4ELMA 1PY4A 2BVUA 3QUZB 3H3PL 1JGDA 1T1WA 4Z7NE 1UQSB 1NAKH 1T83C 4JZNA 4LSQH 1LP9A 4WUKH 4GRLA 1CICA 1NC2D 1OSPH 3X14A 3O3DA 4PJFF 3SKUD 1RJLA 4NN5B 5IQ9B 4X6DB 4HZLA 2BSED 4Y4HB 3QNXA 2YXMA 4GOSA 4TOYH 1DEEA 2IC2A 4FQJL 5D7JB 1NBVH 2BVQA 2UZIH 4Z8FH 2JJSC 3MLRL 4C56B 2HVKB 1EXUA 2MNUA 5FIEA 3PDDA 3S88L 4NHUB 2OZ4A 3GB7B 1H3VA 5CP7A 3KPMB 43CAB 2V17L 1Q94A 1F8TL 4LARL 4QHMA 1MAJA 5F21B 2PNDA 3DI3B 3PWNA 5D9SB 3VRIA 4EJ1C 1T03H 1JHTB 4KZDL 4X4ME 2CKNA 3KS0J 5M7QA 1CL7L 3MODH 3CDGA 4GAJL 1DANU 2VLJE 1ZLWH 4GXVH 4JREC 2AABH 2BNQD 4GAYB 3TPUB 1MI5D 1F2XK 4R2GC 4OCSH 1JL8A 2DKSA 5KSUB 3Q3GB 4YXKH 1P7HL 3FQUB 1X5HA 1XF5B 4JHZA 3EZ8A 1PKQA 4JRWA 3O45B 3WJJC 3ULUF 4XP5H 4XXDB 5EZOH 5J11C 5I16B 4U6YA 4MJIB 4AH2A 2R4SH 4GXUN 4R7DB 4HS3B 2YPLA 1EEYA 4N8PA 1KXQE 1C5DB 3LN4B 4DKDC 1BJ1H 1FZKA 2NY6B 5M94B 3KAAA 2NTFB 2XZAL 3BP6B 2F53D 3D87B 4PGBB 1JRHI 5FM4A 3QXTA 1NSNH 5JORB 5D7LD 1KCLA 3WIHH 4MJ6A 3WIFA 1WWCA 1CDGA 1A7NL 4IRSA 3F7RA 5FYLH 5EPMB 1L6ZA 2D2OA 3SGDH 3BIAX 3SCMD 2BSSA 2EDDA 5KSBE 1OGAD 2B20A 3K1KC 5EFIB 1NCCL 3ARFD 4H0IA 5MI0B 5JOFB 3WHE1 2BMKA 4K3EL 2DMKA 5IFAL 2M26A 4CN6A 3BPCB 4JKMA 4WW1A 3UYOD 3H2WA 3T0DA 4O2EA 2KZ1B 4C83B 4LCWE 1BVKA 3NABL 4LPTA 3CFKB 5AZ2H 5DI8A 3ZHLA 3P4NB 2HT3C 4G7YL 5EBWB 2HFFA 3PV7A 1YYLL 4G8GA 2VOTA 2RB8A 5FV1L 3V8CA 3VG0H 5HGAA 2H1PL 2J2ZA 2Y25A 3DBXA 4GRLC 4P2QE 4KU1A 2R8SH 1VEOA 5EZJB 4JRXD 3BSZL 4F57H 1FLTX 1LO3H 1AJ7L 3M17A 2PW1B 2YXFA 3GJFK 3P11L 5C0GB 3LEXB 5BS0D 4QRRD 3HB3C 2I9TA 5FA3A 1FFNB 3DURB 3T65B 1CK0L 4Y16A 5FK9A 1FGVH 1BVZA 1BFSA 3DX7B 3Q5YA 3HR5A 4LKCB 4N0UE 2E6QA 4AEIH 4G3YH 4NM4H 1DL7H 3V7MA 3N1FC 1UCBL 3LKSB 2CDGA 3KPRE 4K94H 3OAUL 2AJXL 3QYCA 1U8LB 4M62H 1IC4L 1QFUH 3DUHA 2W92A 2VO5A 1ES0A 1QACA 1ZHBB 5C0DA 3ESUF 4WW2C 3G9AB 4ZMAT 3SDDB 3KR3H 2G60H 4WVRA 4Z5RB 2X4TB 4D94A 1JPST 1T3FB 5HI5C 4YFEA 1MCIA 3FMGH 3QEGH 3WNLA 5MENE 1AP2B 4DN3H 2G5BB 2PO6A 1J5OL 3OKMA 5ITBH 4PJ8D 3BGFB 4NO5B 3S34H 4PJ5B 2YWZA 4L4JA 4TYUA 1G6RA 4K7PX 1XZ0A 5CHNB 4LSPL 4IRSC 1HCVA 4NQSA 1DQTA 1AXSA 4Q9RH 5DUPL 4A6YL 3BUTA 1CIUA 5E2TL 1NPUA 4OZFB 4S10A 3T1WA 1SYVA 2PR4L 2BVOB 3AUVA 2MSPA 1RZ8A 4E0RB 1U8MA 3X13B 3LKRB 1HWHB 4WNQA 4M1GH 4OTXH 1JNNH 4PJXB 4HZAA 1ZGLP 4WWKC 4LSUH 2GCYA 3DROA 4J3WA 1KT2A 3QIBD 2NY3D 2X7LA 4OT1L 3V4UH 3JUYA 3RWEB 3AAZB 3TCLA 4K3GA 2AK4B 2FZ3A 5L6YL 2N1KA 3ARBB 3EZJB 1KIPB 3HS0A 4NM8L 2GT9B 3PE9A 4XI5D 5F8QC 3PQYE 4HKXB 5IHLB 4JLRB 3KLAA 4IIQB 4JKLA 3V4VH 1FFOB 4MZ3A 3ULUE 5EC1B 4J8RA 5LWYL 2JK5B 5T1DH 1WFOA 3WFBL 3RWGA 4NJAL 3K1DA 2GKIA 1X5FA 1ZWIB 5F7LB 1IAKB 1FCGA 3MA9L 3IXTB 4ELKA 3U9PH 1ZEAH 4QGYA 1XH3A 3FT4A 4AQOA 1UWEH 2VABA 2OM5A 32C2B 3HI6H 4ZXBA 1RV6X 4G6KL 4DEPC 5BOPA 2AEPH 1G9NC 4Y16C 5C07E 5F3BA 5E00A 2VLKD 3CPLB 5INCB 5F72S 3W9EB 5ADOH 1Z2KA 5HYFA 4D8PB 3CD4A 1UACH 2V5YA 3C2SA 2NY6C 5D96C 1MJJB 4X83A 1ZGLM 2FATH 4FQ2H 3QCUL 4HJGA 3SJVA 1HQ4A 2HFGH 1F3JB 3AREB 3MRPB 1GPOH 1MJ8L 5E03A 3MUGA 1LNUB 5HI3C 1RIUL 4LHJB 4MD0A 1VFBB 5JHLL 4BZ2L 2J6EH 2X1QA 4FQXB 2DDQL 3U7AA 1GC1H 4AEFA 4LCCB 2R9HC 4PRAA 4Z7VF 3MRNA 1RZIB 3PP4L 2CD0A 1OAQH 1FFQA 4MX7B 4P2RE 5IM7A 1C12B 3T0AA 1TETH 2D31A 4JHBA 4Y4KA 4OM0H 3MLTB 3QDHA 5IG7B 4R4BB 2PO6C 4K8RC 4NRYA 4XPBL 3DIFA 5HGDA 3JTTA 1FNGB 4AMKL 3L3IA 3L3JB 3MV7D 4RSVA 4P23B 4LPWA 3OKDA 4GBXD 4OQTH 3MRQB 3GSXA 4JFXB 4M1CD 1VA9A 1ZAGA 5DMGD 4OZ4B 3QHFH 4U05A 2P44B 2KPNA 5A2FA 5I18H 3UYPA 3WFEL 1J8HE 2UYLA 5CILL 1EEZB 5FDYA 1R3KB 4YHNA 1OCWH 4QRTB 5FB8B 3Q6FB 5C86A 4TPRL 3AM8A 5K9JL 3TBTA 3VDBA 3QUXA 3WJLA 1KG0B 3FN9A 4WHYG 3IDIB 4G80B 4TSBH 5JR1H 5E6IA 2BNRA 1U93B 2D4DA 5JMRA 1YJDH 2XN9E 1Y0LA 1S7RA 3I02B 3SBWA 4JPIB 1E28A 3MLZL 5F7YC 3RKDC 2DJSA 2A6KB 1QO3B 5T3ZE 3CCHB 2W0LA 5ERWA 1MWAB 5TF1L 3NFNB 3PV6B 1I4FA 2D7QA 2NY0C 2FEEL 4KMTL 1PSKL 3JWOH 3QULA 1MCOH 1YMHB 1ZSDA 2VZUA 3BP4A 5DYOB 8FABA 2AJ3B 4RGNB 4TUJA 1B0WA 1IAMA 4RFOL 1HYSC 1UEMA 4GKSB 3TZVA 4ZXBC 4X9GA 3ILPA 1CXEA 2P8LB 3EAKA 5C70A 4GLRH 3C60B 3FAXA 5ISZB 1A6VH 3D85B 5KVDL 4ZSOB 3LS5H 5H35A 5ACZA 2UWEA 2AJVL 4F33B 3Q5TA 1G1CA 5TGBB 4V1DA 5HHVH 4N5ED 1DFBL 1ZA6B 2RFXB 4U1NA 3CFEA 5DK0A 1CT8B 1KEGL 4OF3A 4LEXH 1FZJB 3QAZB 5EOTB 3U48A 3V0VB 1T20B 3LS4L 5IIEA 3P0VH 4U1SB 2BVPA 3BH8B 1E4JA 3ARDD 4ONGL 4Z0XA 1DBMH 3BXNB 1MI5E 2O5YH 4HUWB 3LEYH 4PGJA 5I1DB 4Z95H 1V3LA 2YMXH 4PV9A 3GMLB 5HPOA 1QEWB 4JRYA 5JXAH 2HG5A 4Y4KC 5D2LB 4LLYA 3EYFB 5FM8A 3RIAF 5HGBA 4J6RL 1G9ML 1HH9A 1II4E 5L2KA 1MREL 2MQ0A 4ZAKA 4KZEL 3KJ6L 1R0AL 1CLZL 1FYHB 4OAWA 2YK1L 1ZGLA 4YNYB 5DRZB 2AP2A 5MERA 3QDMB 3RWHB 2CPCA 3MRJA 2YBRB 1A6TA 2A1WL 5D7LE 5CZXC 3FB6B 3GSVA 1VADA 3NACH 5E99H 3DVGA 3PJSA 4M3JA 4Y1AD 2GHWB 1KN2L 5GGQL 1KBGH 1N5AB 4HIHB 1HZHL 3MRRA 3BW9A 3QUXC 4G6ML 3WJLC 5KANI 1IT9L 4QOKD 1I75A 1OGAE 4JZOA 1A8JH 3BKCH 1H8NA 1P4IL 3IU4H 4OGZA 1UWXH 2PXYA 3ZKQD 5E6IC 4GRWF 2SEBA 1YNKH 1MCHA 4XNXH 1VFAB 3B6SA 5TFSL 3SBWC 1P2CB 4EKXA 2XNAA 1ORSB 1H3GA 2Z91B 3HPJB 5FO7B 1BQLL 3T3MF 5GS0C 2IH1B 2NYYC 1LEKA 3JV5A 4S1DD 4OBRA 2A0LC 2H6PB 15C8H 5F96L 3ESVF 5I15H 3BRGC 5E95B 3C87A 1PLGH 4I0PA 3SE8H 5I8KH 1TTUA 4UBDC 2FDBP 2XFXB 4JO4L 4WV1A 1JNHA 5F7FA 5HYSG 2W9EL 4E41A 4MA3B 4WO4B 1JGLH 1BECA 3CX2A 4GMTL 3VW3L 4JFED 2MCG1 3KPLA 4YDIH 1OB1A 3PHQA 5HVHB 2XY2A 4O2FB 4OCYH 3TZVC 3TM6A 2C1OB 2GJ6B 3WFZA 1BHGA 1I1AD 5I1IH 3H9ZA 3EO1A 4HBCL 3W5MA 2Z9TA 1WT5C 3BPOC 5BS0E 3FAWA 1L0XA 4QRRE 3TBWA 1ADQH 4EN3D 4L3ED 3DSFL 3RUGF 2MPAH 5EZIH 2E8ZA 5D1XC 3VCLA 4DCQB 2DQFB 5DFTA 2XG5A 4F9LC 1UADC 2WBJD 5TPWL 4BH7A 2A6DA 4RFEA 1GRWA 1AFVH 4NO3A 3BP7B 4O2CA 1AQKL 2CIKB 4H88H 4XPFL 4MWFB 3LKQA 2V2XA 2C3XA 3VXPA 1YNTB 4HLZG 4ZUWB 2XQBH 4GQ9L 4UV4H 3I6GB 1BWWA 5C9JB 3W2DH 3UP1A 5EU7E 4M43L 1FAIL 3ARTA 4DVRL 1A6PA 5C08D 4OD3H 5DD1H 1JN6B 5E8PA 4G43A 3OKEA 3RY6A 4YK4B 5I1AB 5FKAB 3QEUA 5JIHA 4OZHB 3D3VB 4ZAKC 3P30L 1MRFH 4MA8H 1KSRA 2NY5C 2WLZA 3O8XD 3QG7H 4Z7WB 5D70H 2FB4H 5C0CD 1VHPA 3LPWA 3D39D 1G84A 5DJZB 2DAVA 5BRZA 3QHTC 7CGTA 4O5LH 4APQB 1KNOB 4OCRL 4JFOA 4LOUD 1YNLL 4GKZB 3RNKA 3EDDA 4MAYC 2Q76A 5I71C 5GPRA 5MHSD 5IFJB 2OJZL 2WNGA 3B8YA 1WGOA 2ZOKB 4KKCD 3DVFA 3MO1B 5DS8A 4N0CC 4NQTA 4JG1L 3BT2H 4JR9L 2PXYC 4Y5VB 2P45B 4RMQA 4ZS7H 5GJSL 4XNYH 1XMWA 4ISVB 1SBSH 4C54A 4X99A 5FCUH 1HXYB 4PJCF 3P4LA 1N6VA 1YEHL 3M1BA 3RWJB 3VMPA 1AHWB 3RGVA 2XTJD 2HH0L 1CGUA 2N7AA 4X98B 5I1JL 3WD5H 4NZRL 4G6FB 2WWMD 2QQLH 3HUJF 2IAMB 5A16A 4P99A 4I0PC 3IDYB 2EDYA 3WBDA 4OZGF 5DJ8A 3KPSA 1T0NB 4WV1C 3WNPA 2FR4B 1FNLA 2CIIB 2WANA 4HKBB 3B5HA 5T3XH 1JRHL 1BX2B 3GBML 3GRWL 4WTXA 1EGJL 1YEEL 1YMMA 3HZYB 3QAZC 1FNEA 1NQBA 2I07A 3UJIL 5E4EB 1XR9A 1VFOA 1MNUL 2WUBL 2NXZC 4PTTA 5GS2H 1QSFE 1OP3H 1AXTL 3WUWG 3VFMA 1IM9A 5I1LA 4EUPH 3CGTA 1ZMYA 2W0KA 1P84K 1FZMB 2DI9A 4PJEA 1BQHB 5T3ZH 2VLKE 4S2SB 3TJHD 4AIXA 5A2KH 3BH9B 4P46D 1GGBH 4PJ7B 3UTZB 3ZO0A 3FL7A 2Q6WB 2HLAA 5EOCJ 3VGGA 1F4WH 4HKJB 2CR3A 3RTQA 1FVCA 4GRWE 5KTEH 2A6IA 2C7UB 3GHBH 1HHIB 2YWYA 2R1YA 4KUCD 3HRZB 5GGTL 4U1IB 3DV6B 5F6HJ 3ZL4L 4PLNC 1WBYA 2EDWA 3O4LA 3RY6C 1BBJB 5D5MB 1RFDH 5HXMA 4IMKA 1JMXA 2XZCH 4LF3A 5K33A 4P48A 2NW3A 5F3HA 1KCRH 4PS4H 5GIRA 3C9NB 1SVZA 5EIIA 2NMSA 1A1MA 5IBUB 3MV7E 4KPHL 1NMAH 5E9DA 1IC5L 5L8JB 3NGBB 4PD4K 1CLOH 1X5XA 4Y4FB 1VESA 1JPGA 3R1GH 1U8JA 4P3CL 4TSAH 2FO4B 1SEBA 1SYSA 4JFDB 4JJHA 1PY9A 1VPOL 4P2OD 3PHOB 1CDJA 2EDBA 3LN5B 4KK5D 4MSWA 3O9WB 1HINH 5IOPA 1OWRM 1HK6A 2D3VA 1BF8A 4K71C 1WTGT 1RZJC 4HFUL 3E6FB 3HRPA 5SX5K 4F7PB 4CU6A 3GMQA 4U1KB 3RGVC 1FGNH 2V9QA 4LEOA 2E3VA 2PKDA 4FXGB 4NO2A 3LKOB 4XBGB 3LRSA 4PGCB 2YD8A 3UTSA 4GAFB 4G8IA 3GMRA 2VITB 3DMMB 1NBYA 1NGPH 4D2NA 5EUKA 3O41A 4GT7A 3W0WE 4CJ0A 1MFCH 5HBBA 4JM4L 1EO8L 5IK3B 3GMMB 4I77H 3VWKB 1RJYA 2XI9A 1KCSL 3OBAA 4B53A 1T2JA 4PJGF 3O3EB 1N5YL 3BAEL 2E27L 1EFXD 3TIDA 1J1XH 5F7WC 3GMPB 2Z93B 1JTPA 5I73B 4F2MB 1EMTL 4XXCA 3CDYA 4P4KA 5IVOA 3R8BB 2AJYH 2CKBA 1QHOA 1B2WL 4N0FA 3SGJC 1HHGA 3B2UC 2PYFB 2FGZA 3RWCB 3T8XA 1TLKA 2FX9H 5JHDA 1MQ8A 2Z35A 4PRNB 4W6WB 4WWID 4OLXH 4E5XB 4AEHH 3EIFA 4QYOB 3KYNB 4MD4A 5E6ZA 1GZQB 1FPTH 1YQVL 1XGTA 2BSRA 1I8IA 4KDWA 3RTQC 3VJ6A 4QLRA 1RUQH 3IETA 5H94A 1J12A 3G04A 1H3PH 5BO1H 1AGFB 3DO7A 1MHEB 3BZ4A 4N1CA 4JM2B 3WSQL 4J3OC 1GXEA 5ILTH 3EOYG 1OPGL 4UMGA 1JPFA 5F1NA 4ZQKB 5JLZA 3F6LA 5LAXA 1JK8A 5JQ6H 5ICYA 5E08L 3S98A 4JY4A 5J1AB 3L3GB 4IMKC 1OAZL 5AEAA 2WP3T 5MP6H 4OZGE 3EFFB 3UROR 4AG4L 2GJZA 1IM3A 2ICWI 4KXZI 4MXQD 5C2BH 4M6ML 2ZUWA 1MHCA 3HE7B 3QQ3B 1B4JH 1TPXC 1DN0B 3BZFA 3PWPD 5EA0H 5DUBB 1DDHB 2NLJB 4FQHA 4IHOB 5SWSD 2H3NB 4K8RL 1QYGH 2FJHB 3MTRA 4PLKD 4XC3H 5F6IC 2DQEL 1ZHNA 4ODTL 1FV1B 3K0WA 3O6KL 4LVHB 4N9OB 1K2DA 2CJUL 2GTZB 3QWOA 5CZKA 1J9CT 5IVXB 2EH8L 5ANMB 4G8FA 4Y1AE 5GZND 3FN3A 4R7NB 1ORQB 3BZDA 5C09D 3DVNA 5T5NF 5HVWA 4DQOH 3FONB 4QOKE 3MJ7B 5AUMA 2UUDK 1VGEH 4KRPC 1IL1B 5I2IA 1K85A 5FYKU 3H42L 3O81A 1WVZA 3DO3A 2VL5B 2MHAB 4XCEA 3OXRA 5C0RL 3WS3B 3Q1SL 3U2SB 5EWIL 2NY2D 5JA9A 1RURH 3IDJB 4IEFB 4NQUA 5D72L 1UM4H 4GO6B 1V3JA 1Q72H 4MXWH 4OBSA 5KS9B 4HX1A 1MCBA 2HP4A 4XAKD 5FYKL 4ZFGH 3H3KA 1RK1B 4KK9D 3DHMA 2YEZA 5TDNA 2Z92A 4EIGB 1KTDB 2MJWA 4YFDB 4JFEE 1O7VA 1E27B 2H9GA 4G5ZH 4NGHL 4XXCC 4P4KC 1WSST 1KEML 1ZVHA 4CMMA 4TVPH 2VQ1A 1NCBL 2YN3A 3ARGB 3NCJL 1XIWB 1YY8B 4OGXH 2FIKA 3BESR 4KRLB 1FO0H 5CJOH 1U3HB 2JCCF 3HE6C 4ONHB 1RQ5A 4WI2A 4BQBA 4HG4K 4L3EE 4J1UB 3VFNB 3R06A 3N50A 4NNXB 5IESL 3B9KB 4KKAC 3S7GA 4LLQA 4IDJH 2E7MA 3O4OB 4XPAH 1EEUA 5INDA 4Z0BL 3ELAT 3DETC 3I6LD 3AGVA 1Y6NR 3QO1B 4NHCL 1KPRB 5AYQA 4HJ0D 1TCRB 1PQZA 4FNLH 3ZE0F 5EU6D 5I66B 1F4XL 4L3AA 3TT1L 2QHRL 4RFNB 4LIQH 1A1OB 3S6CA 4EI5D 2NW2A 3GUTA 2X6MA 3DX6A 3R4DA 3MGAA 3OKNB 4R3SB 2AS5M 3TA3A 4XCFH 5C08E 4KHTL 4J4PD 1X5JA 2NPLX 3BGAA 2N56A 1XGRA 2DLGA 4PJGE 4TRPH 1A6WH 4NKDA 2XRAH 1UJ3B 1WISA 5AWNL 3U30B 2P5EB 5GZOD 5C0CE 4M4PA 4F37K 4X6EB 1HEZB 1LEGA 5DJXB 3MRCB 2Q1EA 3FRUB 3L7EB 2BRRL 5J6GB 1G7JA 3DXAA 4X6CF 2R2HA 2VDMH 4KQ4L 3KHQA 4JN1L 3VD7A 4ZD3H 5CD3A 4WHTB 5DRWB 4L8SA 4ZTPH 3UYRH 5E5MA 2KDGA 3AY4A 4G9DB 4P5TD 4ODVH 2CXGA 3OAZH 3K2UH 2XKNA 4Q0XL 3L5HA 4PJ9A 5AD0A 5D2NA 4U0QB 4ZUUB 2X4QA 1FG9C 3LEVL 2OTWB 3QI9A 2XTJE 3S96B 5IB4B 4KTDL 4P4RA 4K7FB 4HPYH 5F7EH 5ACMA 4EVNB 1JGEB 2I27N 1S3KL 5JDSB 4UQ3A 3QDGD 5GS0L 4WJ5B 3UXFA 4LLDB 1FC2D 4OLVH 4UUJB 2ARJQ 4NRXA 4D9LH 2NX5A 4OCWH 3ZTJG 1VGKB 3L5WB 3S35H 1NAMB 2P5WB 3GSQB 4JM2C 3PDGA 1DQDL 1H0DB 3IGAB 3FQWA 3Q0HA 4NN7B 3U7WH 1DBAH 5GGRA 4UILL 5HHPB 5E2UH 3I50L 1F4HA 2QL1A 3FFCA 4GS7B 1SY6H 3BKMH 1YPZF 1FJ1A 1NBQA 2VLJB 3MGTB 2CDEB 2HT4C 4ACPA 3JV6A 5ALBH 4QKXB 4LMQI 3MBXL 2WINB 2VDKL 5CIPB 1T04A 4BK4A 1IGTA 1L7IL 3RKPA 4JDTL 2OQJB 3T09A 3S36L 5B39G 1RJCA 1D5ZA 3QUYB 3RWFA 3QQNA 3UO1L 2AXFA 1BEYH 5EUOF 1HNGA 4XP9H 5KOVC 2R1XB 4OGAD 3TA3C 4XMPL 4PJAB 3WO3B 4HS6A 2FH8A 2XA8H 1KPVA 2W91A 4BFIB 3L7FA 3TFKC 5DD0H 4JCLA 2VXVH 3LZFH 3HNTH 1F3DH 4WRLA 3ULVC 4OZIE 2VNCA 1UH4A 3PP3H 4HWZA 3MCKB 2AJUL 1BFVL 5IHUL 1T4KA 1U91A 2HT3D 4JJ5A 4JG0L 5BJTA 2R56L 2NZ9C 3EHBC 4M6OL 1KTLA 4HHAB 3OJDB 5KSBB 2NY5L 5GSRA 4JB9H 3CSYB 4DTGL 3IFLL 1ZT1A 1HCFX 3BDXA 4ORGA 1JPSL 4GRLD 5IW1B 1CICD 1G7MA 2BC4A 3O6LH 4DGYH 3JV4B 1K8IB 2JCCE 2YD1A 3VMNA 3NTCH 2YZ8A 3K2MC 1A7QL 1DVFA 2H2SC 4R4NC 5DA4A 2RJMA 1MWAL 3F12A 4J3SA 1AE6L 2ORBH 4PJ9C 4LCWB 1LO0L 3MJ9H 2ZP0T 3WLBA 4O4YH 3HB3D 3S37L 4R6UA 4YHOL 2IBBA 2FSEB 1AO7B 5KVGL 1BQSA 3BQUA 3P9LA 5KOMC 3H3PH 3IVKB 4U33A 2BHZA 1EHXA 3WL9A 4AQ1B 4FHBD 3G5XB 3TF7C 5HHMD 3KPMA 1W72B 1B0RA 2KZWA 4I3RL 5D1QA 2VIRB 4NQDD 2DLTA 4PG9A 4FQJH 1P5VA 4YE4L 1WIUA 5K9KB 3U9UA 3P40A 5GS1C 3MLRH 1ND0B 5F9WC 3P4OA 4ENED 3S88H 4M4RA 4G7VL 3TPUA 2DRUA 4NPYA 1IQDB 3T0VA 2V17H 2DQDL 4LARH 5IB5A 4N0UB 3OGCA 2VZOA 3C5ZB 3MRIB 3Q3GA 2YPLD 5C0AD 4ZFOA 4MNQB 4KZDH 3CFJA 3FT2A 2YUWA 1CL7H 4GAJH 3VFRB 3KPRB 2DBLL 2IANA 4UTAL 1IKNA 3EO0B 3OKKB 4NSKB 4XBEL 3WXWL 2OXHA 1DBJL 3TIEA 3BP6A 4IRSD 1CF8L 3GSNA 1DQQB 1IJ9A 1KFAL 4OF8A 4PGBA 4LLUB 3MRMB 4WHDA 1IARB 1DQLL 3TT3L 3LQAC 4H0GA 4LCUA 5EN2A 5EPMA 2BFVL 3QHZL 4BSWA 4HIEB 4NYLB 5MENB 4OF5A 2UY6A 2XZAH 4IOIA 1A21A 1P6AB 1QRNA 3D18B 2V5RA 5EFIA 4YDJB 3LKNA 3SDCC 2IFGA 3LCYA 3G6JA 1A7NH 3IXAB 1DEDA 4XP4L 1K6QL 2VAJA 3WYRA 3PWPE 4G42A 3QUMA 4G8GD 4P5MA 2FRGP 1EVTC 3CFKA 1V7NL 4OSUL 5DFVC 5FM5M 5D7KD 4EI6A 3IJYA 5SWSE 4L9DA 2WSKA 5IW3A 4HSQA 4M93C 1NCCH 5EBWA 4P2QA 4K3EH 2W60B 3DUUA 1ZLUK 4M9OA 4BK5A 4P2YA 1CFNB 1DVFC 1MSPA 1WEJL 1Y18B 2ADFH 3K74B 4U1JB 4GKOA 1GHFL 2BOBB 4UDTA 1WCBA 3BDYL 4YXLL 3DRQA 2WQ8A 4G7YH 1XGYL 3SDXE 3N0PB 1IGJB 2APTA 1HILA 3IDMA 3PQYB 1YYLH 1P1ZB 4MA7L 4GH7B 5C0GA 2VISB 3BQUC 1W0VA 1YUHB 4NQXA 4Q6IA 3LEXA 4U49A 1U2HA 5GGRY 3FCTA 3IFPB 3T4AA 5JOPE 1M4KA 3I75A 1KTRL 2H1PH 3DURA 4UOJA 3T65A 4GS7C 4O02L 4ZOBA 5DVNA 5MEQA 3BSZH 5HHOB 4G6JH 4PREB 4S11A 4HUUB 5D1QC 5F1OB 1AJ7H