3LQZB

Crystal structure of hla-dp2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
212
structure length
198
Chain Sequence
RKFHYLPFLPSTGGSSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Crystal structure of HLA-DP2 and implications for chronic beryllium disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 198
sequence length 212
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqzB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3lqzB01
1OTUD 3LQAC 3DOSA 4CVZB 5FYLE 3G9AB 4PJIB 4LPCA 4X8XA 1CXIA 2CMRL 1UT9A 5EBGA 1KPVB 2JCCF 4DTGH 1A6TA 4MNHB 4XCYA 5D7LB 3SKMB 5GGUA 4KKNA 3GSOA 3KXFD 3IXTB 3PWPE 1F3DJ 2ARWA 4QRUB 2QTEA 5I74B 3PP4L 2ADIA 3W39A 2NTFB 3R4DA 4HLJA 5GISH 3MRNA 4DTGL 4Y16D 3U46B 4UNVA 3G6JE 2QQKH 3I6LD 4HIEB 4P59H 4YO0A 1C5BH 1S5HB 2ICEA 2DJUA 4NSKB 1N0XH 5LXGH 5FA4B 1IM3A 2DYPB 4LCYB 4M8QA 1CXFA 2F58H 4ZPTB 5GISL 3CC5A 5JMRA 1N7MH 3HE7C 4U7SA 3O2DH 3QQ4B 4N68A 2QQKL 1EIBA 2P5EE 4UOW0 1FLRH 4NQCE 1K5NA 2PYEA 1C5BL 4P59L 5IB2B 5KS9B 1GHFH 1UB5B 2OP4L 2F58L 2MQ3A 1JRHI 4BK4A 1XH3A 4L8CA 1N7ML 3O2DL 5GGSY 2ZUSA 2X1OA 5BRZB 4XWGH 2PN5A 3BWAB 4QRRD 5MHSE 5EPMB 4ELKB 1QSEA 1GHFL 3H3PL 1QR4A 1CLOH 4JRXA 4MQXD 2IH3B 2WWKT 3B9EA 1NAMA 1JNNH 25C8H 2EIEA 3TPKA 5C07E 2QHLA 3OKYA 4XWGL 4MAUH 4KDTC 5KSAB 3PGFL 4N0UE 1F8TH 3VRIB 3GZKA 5LAXA 1BQSA 3H9HB 4IOFC 1S7QB 2F8OA 3G08B 3MLWL 3KYKH 3QO0A 4N9GB 25C8L 3LKOB 4FQIH 2X70B 4PJ8A 4Y4FD 5HGDB 4MAUL 2VMFA 4IRSD 1E4WH 3ARPA 5KN5B 4D0DA 5IB5A 4S1QH 5D5MA 2AJSH 3V8CA 4PIRF 1CDIA 3BEVA 2DD8H 1DZBA 2VAAA 1M7DB 4FQIL 1VPOH 1KYOK 5D7SH 3EIFA 3HCVA 4PY7B 4X6BA 1S7UA 3S34L 4XC1H 1E4WL 2DQTL 4S1QL 1FL6A 3OMZA 3QHFL 2VN4A 3MLUH 3QUZA 4I2XA 3E1F1 4PJ7F 1YYML 4FQQB 1I7RA 4HS3B 4UDUA 1N5AB 4TUOB 4CVWA 1RZGB 1SY6A 3V5KB 1YPZB 5T5NG 5AD0A 3RVVD 3V6OA 3MLUL 1QOKA 2VZTA 4NO5A 1Z0MA 3MJ7B 3KNBA 1LHZA 3LHPL 4GRLA 5C3LD 5JXAH 4PJCE 1ERNA 1UEMA 1YY8B 4AZ8A 2DBLH 4NRZA 1MCWW 1RJCA 3HC4H 3O8XD 1ZT1A 4YHZH 3UZQA 3IFLL 4DCQB 1AGEB 1T66D 1G6RL 2VABA 4DZBB 3PWVB 1W72A 1WZLA 4PJEE 5JXAL 2XZQL 4JAMA 3WIHA 3FTGA 4ZS7H 1A6WH 3HPLA 3HMWL 3ES6A 3CX5K 3D85D 2JK5A 5AZEL 4YXLH 3HC4L 1I8KA 5F3HB 4TNWK 5AAMA 4AYFA 1W2KT 2XFXA 4IMLB 1FO0B 4JG0L 3W81A 4GBXD 3T04D 4P5TC 3BD4A 3VGHA 1MCFA 5DQDH 4QY8A 1Y18A 5D1QC 3T09A 1XGUA 2WMPA 4J7RA 3P4NB 5ESAA 1U8NA 4E41A 4RGNC 4PS4L 2CUHA 4PGBA 3BW9B 1NCUA 1RZKC 2LFGA 3QEGL 5I8KH 1A9EB 2R4SH 2C7UB 1BFSA 4LCWD 3T3PE 4OZFB 3V52H 1R24B 3W0WD 1TCMA 3C2SA 3VJ6A 4OZIA 2I9LA 5I2IB 1IC7H 1CLZL 3T77A 5F7MC 4KKAD 1NDMA 4N8VG 1MCEA 5D7KD 4H26A 4LNRB 2R4SL 3C60B 5ALCL 4OZGF 4QRQB 5DMYA 1KT2B 2HMID 3TZVD 3TNNB 1P7QB 5TE7H 1TZHB 3INUL 4PJHB 2UUDK 4EXPX 5IB1A 4RX4A 2GTWB 4NKOA 3CU7A 3HG1E 3ZSSA 5DT1H 1BD2B 3QPXH 5DJ2B 3IF1A 4BFBD 4PJBF 2DQJH 4LLWB 5TE7L 5D6DA 2AK4B 3AFLA 4OF8A 1KACB 3HZMB 3RUGA 4M62L 5DFWH 4MJ4A 2DKSA 3IDIB 3EFFA 4Y2DD 5DT1L 3QPXL 1L9MA 4Y19A 2XKSA 1JVKA 4CGTA 4ODTH 4O9HH 2A9MH 1LDSA 2YSSA 3MLXH 4P5TB 2XWJA 4XVJH 3F12A 4OLEA 4MD4A 2X4NB 3TBSB 2B0SH 3IGAB 4P2QD 4UQ2A 5ENWB 4YHLL 1RZ8B 4PJGF 4ODTL 4JRWA 1OD7A 4NQVA 1B0WA 1YYLH 2A9ML 2YD1A 5CJQH 3WNLA 3MLXL 5F6HJ 4ZD3H 4U6HA 1MJJB 3WV0A 1PKQE 5DO2C 3QZWG 3B43A 3V95A 3C9NB 5IW1A 2MCPH 5ADPL 2B0SL 1IC4L 2X5PA 5KTEH 2R1XA 4XMLH 5CHNA 5EZJA 5DD1H 1AXSA 2D03H 1YYLL 2EDRA 4O51A 4ZD3L 3DROB 2FO4B 4TN9A 4F37F 4HUMB 3VWJB 1BM3L 4LSRH 5JDSA 4HK0A 4C58B 1XR9B 1P7HL 4EBQH 5JTWA 5HDLA 2MCPL 4JN2A 1GC1H 1IC5L 1V3MA 2D31A 5ECJE 5IMOB 4YNYB 3QDGD 4HS6B 5KTEL 5DD1L 1N4XL 2DN7A 3OAZH 3U9PL 3LEYH 3DARA 4EBQL 1ETZA 1UEYA 2OR8A 1CGSL 1OTSD 1UM4H 1GC1L 4HKXB 3H9SB 1MCRA 4XHJD 2R15A 1FJ1A 2HT2D 5KJRH 1YMHA 1T3FB 4LLUA 5E1AB 3F6IA 4QXTA 5HGAA 4LASL 3LEYL 5LJYH 2NY4D 4GW5B 4PJCB 2XZZA 4Z6AT 4KH2A 5CJXC 5JHDB 1UM4L 4X8JA 5H2BB 4ZO9A 4JFXA 2J6EL 1IAIL 1ORQA 2NNAB 1KNOA 4HPYL 4PJIF 3N50A 1ZT4A 3VXQB 5T3XE 4UIKH 1QO3A 4PP2B 1TQCC 3UC0L 5KANG 4TVPH 4X7DC 4YXHH 1FSKC 3AB0B 4ZPVB 3ZE1E 4PYHA 4L3EE 1YN6B 1QPXA 3TBYA 2GI7A 2C1OB 3D0VA 3ELAT 4TVPD 3RDTD 3OB8A 4UIKL 2Q3ZA 3GFUA 2C1PB 1HHJA 3OKEB 4Q6IB 1YMMD 2PO6D 3CMGA 4TVPL 1ZS8B 3ULUE 1KTDA 5DMGD 4JHBA 2DIBA 3BP4A 1XF4B 5SWQB 2BSRA 5EOTB 4LLYA 5DUBB 2DI9A 4PGZA 1IGTA 1SMOA 4KMTH 4U1HB 4H1LA 4JDVB 1DVFC 4G8GE 1RJZA 5HGBA 2W59A 3HUJB 1E28A 2W38A 4P5KB 5FOBB 2Q76B 3IDYB 5F3BA 4K07A 3R06B 5I15H 2AS5M 3D48R 4UBDD 3RNKB 3NOIA 3LN4A 3BMVA 4KMTL 4CADB 1FL3A 3QIBA 4KTDH 3VXNA 3MLSL 2EYSA 4FP8H 1I9RL 5EIIB 4NKDB 1M1SA 4XNMB 3ARDA 4EUPH 3GSVA 5HJ3B 3BKCH 5D7IB 3SDAC 3UBXB 5KW9L 1UKQA 3T65B 4MAYB 4KTDL 5DWUH 2ED9A 3VWKA 4KY1L 5GS0H 4KMQA 4Q2ZB 2Y6SD 5C0EB 1IGIH 4RGMC 5A2FA 4RRPA 5C7XH 1OP3H 2CPCA 3TCXA 4Y4KD 4ENED 4MS8C 4JFDD 5DWUL 4ZOAA 3AM8A 2CIKA 1RHHA 4ODWA 3ZDZF 5EU4B 2V17H 1PZUB 4YHIA 5DJAB 1IGIL 3SJVA 1Z9SA 2XWBA 4YK4B 4JHWH 2PYFA 4JG1L 3BPOB 3BGAA 3JTTB 2WBJA 1R5VB 2VQ1A 3QXDB 1HHKB 3O6KH 2V17L 5I71B 1B0GB 4APQB 4Z7WB 1TJIH 3BH9A 3B9KA 4JHWL 5DHYB 3NABH 2D7NA 1FHGA 3EJYC 1LDPH 4ETQB 2FECL 2R2EA 5DQJB 1LVEA 4RMVA 5C0GB 1YC7A 5EO1A 1HILB 3NFSL 1EUUA 5EN2B 4U1JB 2FR4A 4R3SB 1YPZF 2F19H 3O6KL 4G8FA 4G7YL 2JIXB 4FS0A 5KSBF 3RVTC 2F54E 5F89A 4FZ8H 5FYJE 1JWUB 2ED8A 3NABL 4XCEA 3CVHH 4WV1B 1LDPL 4E42B 3FO1A 3P73B 3GB7A 1WAAE 3IFOB 2FEEL 5E0QA 5JUEH 4NQDE 1NBZB 1ONQA 1PYWA 3DVNA 3SQOL 3T2PA 4NZRL 2DB8A 2ITDA 3PWNA 5AYQA 4FZ8L 3KHQA 1MI5E 4HWEH 2AXFB 2YZ1A 5TH2A 5IEHB 1Z6JT 3GGWB 3RPIA 1INDL 3PIQB 5JUEL 3IVKB 4GXVL 4Z7QF 1BQLH 1D7FA 3MV8E 2QSCH 3OR6B 5D2LA 3QUXA 3DJ9A 1FE8H 4L4VA 4X7TA 2VLJA 4LK4A 1XIWC 2RFXB 4JY6B 1UWXH 3GJEA 4G6FD 1AR1D 5F7DB 2H32H 4U0QB 3TT1H 4BQCA 1QG3A 3CFEA 5EU5B 1IEHA 1X7QA 2QSCL 1GGTA 3OJDB 1D6EB 2DICA 4HGMA 1MFBH 4AT6A 1T0MB 1K8DA 3FT2A 3BEWB 5C6PB 5AZ2L 2ZP0T 3THMH 1R5IA 2ZUVA 4HGKC 1JF6A 1MFCH 4U1NB 4YHOH 2P5WD 3T4YA 1HH9A 3TT1L 2GCYA 4Y5YA 5IW3A 1FZOB 3KPMA 3GO1H 1TMCB 4YHMH 2FX9L 3NPSB 4YPGA 4PRPB 4RIRA 3FZUC 3THML 4QRTB 4M6NH 3V7AE 2H2PD 4YHOL 4I0PB 1YJDC 5CBEA 3UPRB 1T04A 2QSVA 4PJHF 3GO1L 1FAIL 2P46B 1MWAH 4YHML 3RY6C 3E6HB 3S5LA 2E7BA 1RJLB 2ZCHH 3ZHKA 1B0RB 1KJ2H 1YNLH 3VFTB 5EH1A 4MD0A 4YC2C 2AV1A 4WNQA 5ITFA 1Q9OB 5SX4H 3MGAA 4JREC 5DRWA 3GSNH 4ZSOA 3QDME 3E2HC 4DVRH 4CJ0A 3LV3A 4M61A 3WDIA 1EBPA 1RIHH 2ZCHL 2MMXA 2HKHH 2EDKA 1YNLL 1FNSH 4CN1A 3QIWA 2AW2A 5DD6A 3SO3C 1LO4H 1PLGL 2DQHL 3DV6A 3GSNL 4Z7OF 3WD5H 4GG8B 5EBMA 4Y0GA 5IEKB 4I3RH 1JWSB 4PR5B 4DVRL 4PB0L 4IOIB 1S7TA 4KKBC 1TNMA 5IT2L 1FNSL 3MO1A 5GGRY 4XCNA 3EO0B 3PWLB 1LO4L 3CDCA 1G7HA 4BM7A 2WNGA 4I3RL 3L5XL 3PQYA 1EGJL 1HXMA 3F62A 3DGGA 3MR9A 3K0WA 4K23H 4P2RE 4PLOB 3WS3B 1A02N 2IC2A 2ICCA 4RQQA 3H9YA 4YGAB 1OCWL 2RB8A 4ODXB 3EOTH 2XXCB 2IAMA 1T0NB 3R8QA 1X5ZA 4OF3A 2MJWA 3L95A 2NXYC 3FFCB 3TF7C 1KJMA 3BKJL 3QFJB 5E08H 2FHBA 5GRXG 4K23L 2GTZB 3GJFK 4RSVA 3QA3B 4M03A 3QDJA 3UMTA 5D2NC 5KBNC 3EOTL 1GZPA 5HDOA 4NHCH 5HI3D 4WI7A 3F7YA 5DTFA 2UZIL 3LKNB 1ROWA 5I6XC 3L3OB 3MACL 1F4HA 3UTOA 4RGOH 5HYEA 4JR9L 2E7LC 5FGRA 4Z8FL 4F33A 5FECB 4JPIA 4C54A 3EHBD 4C56D 4JREB 1WISA 1JHLH 3CCHA 1CICA 3FQWA 2VZVA 2YD9A 2VSDA 4P57B 2H9GB 3E2HB 1PSKH 3L5WA 4YUEH 1JPSH 2F54B 3EYFB 2PXYB 2Q87A 4LSQL 3BOVA 4R0LA 4RGOL 5FM5M 5C0FA 5MEOA 5BMFH 1A9BA 4PREB 3UJJH 2AAVA 1W0YT 4WO4B 5IOPA 1JHLL 1QFUH 4J1UA 3ZE0F 3GRWH 2F74B 4YHYC 4JQXC 3ULVH 2ESVE 3RWIB 4W81A 1PSKL 3FKUS 3KWWB 1MI5B 1OPGL 4U1KB 4X4ZA 5I1HH 1J18A 1A4KA 3I6KA 2DQCL 4KTYA 3GJFA 1QFUL 4U1IB 5GZNC 4JFQB 1U2CA 3OF6A 5ACMA 4AENA 2KUTA 3WKMH 4ZNCD 1E27B 4EOWH 3BE1H 1UVQB 5BV7C 4LF3A 3C8DA 4HDIA 1RAMA 4JFEE 1SEQH 1ITBB 1NC4A 4MMZC 4X99B 4U6YB 2DQIH 3CDGA 5C92A 1A6VH 4HV8B 3KG5A 4FFWD 3GSQA 3NMEA 3WSQH 3PV6A 4JQVC 3P9LB 1CGTA 3PHSA 1XCTB 43C9A 1HH6B 3BVNB 3QIUA 1UZ8B 5DEFB 3BZEA 3HUJF 4XZUA 3BQUB 2BNRB 2DQIL 1H5BB 5F9WC 2P42B 1A6VL 2BNQD 5D72H 4KJYB 3ZKNC 3KYNB 3OKOB 4CU6A 3TA3C 4N0YL 2NY2D 2BVOA 2ZUWA 3S96A 5I1IL 5FUZH 3B4NA 2VLKD 1AD0A 3M1BB 3MCLH 1MSPA 2YPVH 4HKZB 5KOVC 3DETD 1U58B 3EOBA 5D72L 3HNSH 3SBWA 5D7IF 1KFAL 2I07B 3IJYA 1T4KB 3NCYS 5FUZL 3WNKA 5FYLH 3MCLL 5MEPB 3NH7H 5IG7B 1BZ7A 3O41B 4XRCA 2C4XA 4WWKD 1Z0NA 3GMRB 1DBAH 5FYLD 5HHQA 5IFJB 3QDMB 2VDOH 4I0KA 4QHKJ 3JVGC 4RAVA 3OKDB 3OZ9H 3MZTA 3T0EA 4WUUE 5EUKB 3SO5A 5FYLL 3LB6D 2G60H 4KK5C 4DK6A 4FQ2H 1CU4H 5J6HB 1S9WA 3P4OA 3PWPD 2IBGA 2OCFD 1DBAL 1R3LB 2CK2A 2VDOL 2ARJA 1NBQA 3OZ9L 1A3LH 1HHHB 5E4EB 1MY5A 4RWYH 3KS0J 1EH9A 3PL6D 1CU4L 3C60D 3C5ZC 4Z78B 3UX9B 5MP6H 5SX4I 1ND0A 2EIDA 1E4KA 1U93B 4Z7WF 5C6TL 2A73A 5CZXC 4PJDF 1TETH 3RFZC 2OL3H 4L4TA 4N0FB 3ZT5A 3MLVH 2CDEA 2OI9B 2P5ED 2DBJA 3V7MA 4MDJB 4M5YH 4TTDC 4NQCD 4NUJA 2VR9A 4B41A 3EDEA 5F9JB 1JGVL 4OBSA 2RQ8A 4H8WL 4X6DE 2XN9A 2OL3L 5T1LD 3STZA 4CDGC 3RBGA 4YE4L 3MLVL 3QCVH 1Q9LB 2EO1A 4L29B 1JK8B 1NDGB 3L3DA 5F1KC 5I16B 5K9OB 1XZ0A 2W9DL 1VEMA 1F90H 4LGSB 1N64H 5MHSD 2HLFC 4TQEH 4MQSB 2H26A 2UWEE 5CD5D 3GSRB 3J8F7 4X5XA 5C07D 5BW7A 2V2WA 1LO3H 3GHEH 1MCQA 5D1XC 1F02I 3HLAA 1VGKB 1N64L 4NRXB 5JNYA 5ICZA 4LARL 1AD9A 4W70A 3O45B 3B6SB 2GJ6B 1CFTA 3DVFA 3BPNC 4Y16A 2H8PA 4PJ9A 4X98B 3L3KB 1HDMA 2F53E 3LEVL 3TH3T 4KROC 4N5EC 3RRQA 3MYJB 4POZD 3LQZA 4PJXB 3BP7B 2H6PB 4JCLA 2X4PA 4QOKB 3UTSB 3VWJD 3C5ZB 1BVLB 1OT1A 4HUVA 4K3EH 3PGCA 2CKBH 3ZDYE 4OZHE 1UFUA 3R0NA 4OLZH 1AQKH 1TCRB 5GS3A 1MHEB 2BSTB 3O81A 3TVMD 2JTDA 3O2DA 4J4PC 5EO0A 3GIZL 3ULUF 1MUJA 1H3UA 2EDEA 4RAHA 4C4KT 1X6LA 2CKBL 4LVHB 1AQKL 4LCCC 1MRFH 2A0LC 2ICWI 4QRRA 1V7NL 2DI8A 1BFTA 1DBKH 3SPVA 3H2WA 3S36L 2ADJA 4NKMA 5IMLB 5KG9B 4CU7A 3SDCC 4TOYL 1OP5H 4AH2A 5E8EA 1C7TA 5GS1A 3IAGC 1OTTC 3RZWA 3LRHA 1QLFA 3G6AA 2DM4A 1ZTXL 2EDXA 4FQXC 2ZPKH 2VXTH 4K94H 4YGVB 3JV4B 1DBKL 4AG4H 2OS7A 32C2B 5CP3H 2OTPA 2CUMA 4OFDA 3GBNH 4U2ZA 3M17A 4Y4FA 5CEXB 1U92A 4CN4A 3LS5L 4IRSA 4PJFE 1GOGA 1N26A 4JVWA 2EDDA 2ZPKL 4OB5H 5DJ6B 4F7PA 3BX7C 2VXTL 4K94L 2A83B 3VDBA 3ZKXC 3GBNL 4J6RH 2ILLA 5TE6H 3RKDD 5JPNA 4NNXA 3F58H 2R2BA 4MJ5A 3AS1A 2EXWD 4OB5L 1MCPL 5AUMB 1A6AB 2OTWA 4KHTH 2IF7A 1MVUA 3HRZA 2XKUA 1TITA 3OXSB 4J6RL 4TULH 5HHOE 3SKJH 5TE6L 5ACLA 1ZHNA 1IEAB 1YEHH 5HHVH 1IJ9A 4XC3H 3F58L 3L6FB 3DWTA 2E27H 4R4NC 4M7KH 4F7EA 2VE6B 1CD1B 3E3QC 5ETUA 4W4OC 3REVB 4KHTL 5A2LH 4CMHC 1IL1A 1N3NA 3CLEL 3HKFA 4LCCB 4Y4HD 5LCVL 1E4XH 3SKJL 3P3YA 2W92A 4WU5B 2C26A 5HHVL 4POYA 3O8XA 4XC3L 1RJYB 3B2VH 3QHZH 2R23A 4PJ5B 4WFHE 3RNQB 2WUBH 2CRIA 5DJ0B 1T1ZA 2DQFB 3HG1D 1MHPH 5KSVB 1FNLA 3OKNA 2R8SH 1E4XL 4JEGB 2PTTA 4R26L 5J0BA 1RQ5A 5GGSA 4UOJA 4FQXB 3MA7B 3QHZL 3D69B 1G84A 4I48A 5JLZB 1KCVL 3WHXB 1WAAF 1J1PL 2QL1A 1I9IH 2WUBL 5J13C 5D7JD 2B2XL 1MHPL 3HE6C 1LQSR 3V0VA 2R8SL 1H3GA 3S4SB 1CD0A 3UDWA 1EFQA 3FHQA 1T83A 3P4LA 3ZL4H 3VXPA 1IZKA 3OHXA 1GRWA 1TPXC 2YRZA 1U3HD 3N1MC 1D5BB 1B6UA 1T1YB 3ZKXB 4DAGL 5I18H 1FYTE 3BGMB 2JKXA 4ZTPH 3W0WA 4OZ4B 4CKVX 3ZL4L 4ZDHA 3BN9C 5LGJA 4LRIA 3L9RB 4QT5B 2XQYG 3MOQA 2J12B 1WFOA 3ARFC 2D7QA 3C5SB 3SGJA 1RI8A 3ZYOA 2ATKA 5GRVL 1P69B 3BMWA 2DTSA 3S98A 2I9TB 5B8CA 5C09B 3ABZA 5JW4N 3RTQD 4MWFB 1J0YA 3FMGH 1S7VB 1VENA 2DIJA 2CO6B 2APFA 2A9NH 5CINH 3KLHC 3U36A 3HZKA 4CMHB 3LAFA 3TJHC 2HT3D 4KK6D 1D5XA 5D71L 4MX7B 4AEFA 4OIAA 2IQ9H 3HC0B 3ZTJG 1IAOB 3U30C 1TXKA 2FDBP 5DJ8B 3ZO0A 3OKLA 2A9NL 2GFBB 2B1HH 1G9NC 2DJSA 3ME0A 3AGVA 1LD9B 4FXLA 1FAKT 4HIHA 2EZ0C 4YHNB 5ISZB 5EZIH 4Y2DA 4CVXB 5DJYB 3CDYA 1RUKH 5I1DA 1ZT7A 4BSVB 5CP7A 3SDDA 1T5WB 2BOCA 3P0YH 4PLKD 4XBPA 3U0PB 1Y0LB 3KYOA 3S4SG 5EZIL 5HVHC 4KZDH 2ZG3A 3OAZK 3ALWA 3VMNA 3D39B 1P53A 2YKLH 4N0RA 2LVCA 1MCIA 4P4KB 5T3XD 3DMMB 3P0YL 2CJUL 5I19H 4PBWD 2IFGA 5T3XL 2J4WL 1IGFL 5A16A 1SBBA 3AY4A 3EYSH 4HAFA 2JLLA 2QQQA 2YKLL 3RVUD 1RULH 4L3ED 1AHWA 3TIDA 3BXNB 4JGUA 4JQIL 4MD5A 1VA9A 2NCMA 1I3VA 3X17A 5I19L 5FGBA 1YNTA 1MFNA 1XGPB 4R97C 3R8BB 4DN3H 4F58H 5MEQA 3ULUD 3BRFA 1MFEH 3DX9A 2NTSP 3BH8B 2FYYA 4RGNE 4JVPA 4WFGE 1RULL 1I7UA 5DMIH 3ULUL 1P4LB 2Y7QB 4BELD 4LLDB 1MCOL 3LRSA 1PX4A 1QSEE 4G8GD 2QKIB 2X1PA 1KIQA 1EFXB 1DDHB 3FFDB 3W5NA 2IJ0C 1UG9A 3VH8G 4K9EL 4FABH 1AKJA 5IB4B 5DMIL 1DSFH 4PRIE 4U6VH 4GXUM 4LMQE 4NFDA 3ARED 4J3TA 4KDVA 5JXEA 3QEHA 1J11A 5E6IC 3OX8B 4ZUSA 1M6OA 1U8OA 1IM9A 1KXQE 2BVPA 3WS6C 1DSFL 4U6VL 2FWOB 5E2JA 4HH9B 3RWEA 4Q74A 4DW2L 5HVHB 2VUYA 2IMMA 3WJLA 2QJDA 2PCPB 4YDLC 5F8RC 3N85H 1T7YA 3MRFA 2ICWJ 1LO2H 3KPSA 1DQJB 1QFWM 4DN4H 1INQA 2ZOLA 2Z35B 4K8RC 1HHGA 3SN6N 4GJTB 3L7EB 3QEQA 4ZMAT 5C8JA 4X6FA 5M95B 3NZ8B 5ESVA 1BPVA 3I75B 1F4WH 2CLVB 1YMMA 4JM2B 3N85L 4HJ0D 5HI5D 4I2XE 4PJXF 1LO2L 1X5HA 3X11A 4GOSA 1IAKB 1U8PB 5F7HA 5ID1B 2DM7A 4CN6A 1MNUH 3B3IB 5HGHA 3ZZ1A 2X4TA 4EIGB 1U9KA 2VZ3A 5F93C 5F7KC 4HKBB 1F4WL 1FYTB 3DV4B 4HMCA 3MRBB 1J86A 3G5XB 1CXHA 3VGAC 3MV9E 1D9KD 5DDHB 1WTGT 4LCUB 2FJHB 4ODSH 5EOQH 3IKCB 2IPTH 12E8H 1CF8H 3QRGL 5A40E 2Z92B 1TJHL 5E99H 3CFBB 3V2AR 3HAEB 1JYWA 2VDRH 5FYJH 2YRPA 1CFQA 1NSNH 4G6AD 5KVDL 3L5JA 5EZLA 4ODSL 2IPTL 2F54D 2PXYD 4LLAA 5FYJD 4J3VA 1I8MB 2H1PL 4BUGA 5IJVA 3CXDL 1G7JB 5E99L 3OB0K 4N9OB 1DUZA 5E6IB 2VDRL 5FYJL 3B9AA 3UTTB 4NQDD 4M7ZB 4WO4D 4EUPA 1NSNL 3DRQB 1C12A 3QJFB 3KLAB 4LVNB 2EKSB 3VFPA 5E8PA 4LEOB 3CMOH 4MXVE 2Q7YB 4V1DB 5JORB 1MI5D 4LAQH 3L7FA 4E0RA 1YQVH 4Y4KA 5KVEL 4M1CD 1BIIA 4F7CA 5DD5L 4N5UA 4JFDA 4EXKA 3MV8D 5BQ7A 4FFYL 4QEGA 5EUOA 3IDGA 1A6TB 4XCYB 4CW1A 2X1QA 1RIVH 3CMOL 1G9MC 4PFEA 3GSOB 5GZOD 4PJ8C 2J8OA 1HOCA 2KPNA 4LAQL 1TZIA 3VG0L 2VH5H 5IQ9A 2ADIB 3W39B 2WIIB 1X44A 4MA1C 1J1OH 2A1WH 1UCTA 3OSKA 1F4YL 3MRNB 2E9IA 4P3WA 5JA9A 1W0WA 1NGPH 3L3JB 1IT9H 4YO0B 2VH5L 2ICEB 1MPAL 4NFBA 1IM3B 4M8QB 4XPTH 1UWXK 2BNRD 4OKVA 1J1OL 2LABA 2Y25A 3CC5B 4XI5D 4PLNC 2BJMH 1I1FA 3GI9H 1IT9L 1K5NB 2PYEB 2DDQH 1PY9A 4OQTH 2I26N 4KI5E 4JCMA 2OBGA 5IROA 2E7HA 2W60A 4L8CB 2HFFA 3CVHA 2Y36L 1FQ9C 4GH7B 2EDHA 3O6LH 5C0CE 2DL2A 4V2BA 2DDQL 2ENYA 1QSEB 1VADA 4M48H 4JRXB 1NAMB 3OTTA 1KG0B 4N8CH 2DIAA 5I76A 3QDMD 1T5XA 5FYJU 1T20A 3TO2A 2LTQB 3IU4L 2A74B 3NCFB 3P40A 4EN3D 4NZDA 4LBEA 2CLZA 5LAXB 3HZYA 1T1WA 1FRGH 4ZXBA 2A77L 1UA6H 3QO0B 4HIJA 3O2WL 2QSQA 4N8CL 4PJ8B 4ZAKC 3CFCH 2H32A 2EDOA 1YQ2A 4D0DB 5IB5B 1ZAGA 2WWMC 4MA1B 5D5MB 2P5WA 2CRMA 1UA6L 1I8LC 4PGDA 1I1AA 2ZOKB 2VKWA 1ZLWK 4P2RD 1S7UB 4F2MB 3TP4A 4P9HH 3MNWA 1JNLH 2XNAA 1FL6B 1A6ZA 3FB6A 3QUZB 4I2XB 5GJTL 3MBED 2IALA 2ZUYA 3D2UB 3MSPA 1I7RB 4UDUB 4P9HL 1C5DA 15C8H 3W2DH 1JNLL 2E9JA 3GBLA 1CBVH 5AD0B 5IWLA 3QEUA 1MWAA 3JWNC 3S35H 4LSTH 4NO5B 2J2ZA 2YZ8A 3KNBB 4GRLB 1GAFH 4M5ZH 1KJ2A 4JRYE 1UH4A 4UINH 4NRZB 1KTKE 3HZVA 1U95A 2Y4SA 4MZ2A 3GSNA 3H42H 2D7PA 4GLRH 2UZYB 1Y6NR 1T22A 3S35L 2J5LC 3NIGE 2VABB 1MF2H 1W72B 2BCKA 4KI1A 1A4JA 4EI6A 1GAFL 4JAMB 3LEXA 2AEPH 3FTGB 4UINL 4LPVA 3HPLB 3ES6B 2JK5B 1I8KB 4U6XA 2UYLA 3ILQD 2FH6A 3RWCA 4LPUA 3O2VH 1QACA 2XFXB 5FYKE 5K9JL 2PTUA 1MF2L 3AVEA 5CGYD 4OF5A 5EO9A 4ZAKB 2ESVD 1UJ3C 2AEPL 4ZUVA 4QY8B 1Y18B 1XGUB 1E4JA 3WFEH 1CT8B 4DEPB 4E41B 1J7VR 3BPCA 3ECBA 3MNZA 4PGBB 2ZJSH 3B2UD 3QH3A 1JF5A 2KQMA 3QULA 2CK0L 2R1WA 3LOWA 2J8UE 3MJ8A 3WFEL 3VJ6B 4OZIB 4JFED 4DWHA 1REIA 2ZJSL 5EORH 1OB1A 2WLYA 3PHOA 3T77B 2NY0B 1AGBA 1NDMB 3STBA 5TQ2H 4H26B 1HZHL 3MRHA 4L9LA 5E7BA 5J1SC 2VXSH 1F11A 1BP3B 1CLYL 5JDJA 1NCDL 5EORL 1WK0A 3T1FA 1MIEH 1U6AH 4C56A 5IB1B 5TQ2L 4NKOB 1HIMH 2YEZB 2NY5H 4UNTA 2NZIA 4ODVH 3IF1B 5GSRA 4WI5A 2J5LB 5JMOC 3RP1A 4X4ME 3ARBD 1MIEL 2DQGH 4Z18A 3RUGB 3WKNA 3X12A 4OJFH 1HIML 3VFNB 1NCTA 3EFFB 2NY5L 4Y19B 2BDNH 5FEBA 4LOUD 1ULVA 3GRWA 2YS4A 5DK3A 3QUYA 4KKLC 2YSSB 2ICWA 2OJZH 2XWJB 2IBBA 3AUVA 4MD4B 5SWSE 4OUUA 1CK0L 4EDWL 4UQ2B 2BDNL 1ZV5A 2YD2A 4WHDA 2VTFA 4E9LA 3X14A 4WUUD 3UTQA 4NQVB 1DUYA 4XBGA 2AJYL 3VI3F 4G6JH 4JM2F 4JO1L 1MCDA 4U6HB 4N8VA 2OJZL 2LVEA 1WCBA 2X1WL 5GGRA 1R5WB 4ETYA 5IW1B 4QF1B 2K1MA 3KHOA 1X5XA 4IHOA 4QRPA 1IBGH 2ICES 4GG6A 3RVWD 4JO2H 3T2OA 5EZJB 1QBBA 1AXSB 5GQBA 2V7HA 1KN4L 3SCMD 4O51B 3ZTJH 3LPWA 2NW3A 5JDSB 4XP9H 4HK0B 1PX3A 1WFUA 1O5DT 1GZQA 4JN2B 1TLKA 5C0AA 1IBGL 2P8MA 4JPWL 2D31B 2GAZA 2NYYC 4G7VH 4H0GA 4O00A 3VGDA 4FHBD 4XVTH 3FT4A 3VXMB 3C08L 4WJ5A 1CD9B 2F8XC 2EKJA 1ETZB 2CQVA 2HFEA 1AIFA 1J87A 4EDXA 3F6LA 4G9DA 1FJ1B 4G7VL 5L6YL 2WANA 5D2NE 1YMHB 4LLUB 5F7WC 2FIKB 4QXTB 5HGAB 4XVTL 1A3RL 1WCQA 3O6FC 2P7TA 3QUMH 4X8JB 1T80A 2IH1A 1ITCA 4IRJD 4JFXB 3U4AA 1ORQB 3ORJA 5GRJH 1KNOB 3BKYH 1K2DA 1ZT4B 2FHCA 3GMQA 4EI5D 1FCCA 1QO3B 3Q2CA 3QZWA 3PWPA 2FB4H 4P49A 3BRGC 1A21A 3QUML 4PTTB 1M7IA 2AGJH 5GRJL 4Y5XC 3RL2B 3G9VA 3DO7A 3U7AA 4PY8I 4Z0BL 2YA0A 1CE6B 3CJJA 3TBYB 2GUOA 3PNWA 4FQLL 3PL6A 5E9DA 3WL9A 3WXWH 4MJIB 3G6JA 5J57B 2F53D 3FOLA 2APTA 3O9WD 3RZCC 1KULA 3GMLA 3I2CH 5E5RB 1KTDB 3WN5A 1XF5A 4WUKH 3BP4B 2BSRB 3GMMA 4FQJH 5FAAA 2YOCA 1ZANH 4LLYB 3ZHLA 1FZMA 4HIIA 1IGTB 4H1LB 4JFFE 2P5EA 2OL3A 4LQ1A 5HI4D 3SOBL 5HGBB 3I2CL 1E28B 4JO3H 2X44D 5FO8A 1P4IH 4ZSOE 1Q0XL 2FBJL 4GAGH 4WUKL 5C1MB 2NY6C 5F3BB 5T1LA 4FQJL 3RAJH 4BQBA 3LN4B 1ZANL 2YN5A 7FABH 1OLZA 1NGYA 4NN6B 4HUKB 5C9JB 1FL3B 3P77A 1KEGL 3NA9H 3HRPA 4JO3L 4UNUA 1P4IL 4GAGL 5JZ7C 4B7IA 5KVFL 3ARDB 1X6NA 1JBJA 1M05B 3GSVB 1JI2A 3PWUA 1MAMH 5C07A 1IGYA 5ERWA 3D39D 3JWOC 5EDXA 4N0UA 3MV7E 2A6IA 1P4BH 2GY7B 4P4KD 1FDLL 4XBEH 3HB3C 1JZ3A 4XAWH 3EYQC 3EO1A 1AO7B 3VFGL 1BQHG 4X4YA 5EU6E 4RCAA 4HQQH 3GIVA 2CIKB 1ZA3A 3LY6A 1P4BL 4ODWB 5D5MF 4U05A 4MXQD 3SJVB 2Y23A 2XWBB 5E56A 1NL0L 5CILL 4KV5F 2XG5A 2PYFB 2BY3A 3BDXA 1CDUA 3RZCB 2IQAA 3WIIH 2WBJB 5F7FA 2VQ1B 2R2CA 1H8NA 1L0XA 1QP1A 2VDNH 3Q6FA 4Z76A 2CKBA 3MOBH 1BHGA 4KDWA 3BH9B 3B9KB 2R2EB 4KK9C 2W65B 3QFDA 5HHOD 5D96C 4G6MH 4JN1L 5EO1B 3CPLA 2ZCKH 4XP6H 5FV1L 3V4UH 3WIIL 1W0VA 2FR4B 1JFQL 4O5LH 4IJ3C 4G8FB 2VDNL 5IIEA 3MOBL 5DQ9A 5F89B 1BLNA 4O2FA 5ICYA 2NY1C 1NFDB 4XCEB 5DRXA 1LP9E 4OFYD 3SKNA 3FO1B 4M6OL 4XNXH 4G6ML 3GB7B 1K8IA 3VGBA 1VKXA 3TV3H 1ONQB 1PYWB 2F5AH 4O5LL 4UQ3A 3BSZH 4NN5C 3RJDA 2XKNB 4WFHD 5EZOL 1FG2A 1YEEH 3HE7D 3PWNB 5TGBB 4B50A 2KZ1B 1QSFB 4O58H 5TH2B 3U48A 3RPIB 4OFPA 4PJAA 3EZJB 3IJHA 3JV0A 5L2KE 3TV3L 3GSXA 2F5AL 3QXAB 5CP3A 4OCSH 5CGTA 2CH8A 4RRPG 5D2LB 3QUXB 1YEEL 5SX5H 4L4VB 4X7TB 2VLJB 5DXWA 3TN0A 3DIFA 1VFUA 4LLMA 1F5WA 3NCJL 3MQIA 1KB5H 4JM2D 4N1EA 1OAKH 3CFEB 1MFDL 2LU3A 4X6EA 2X41A 1X7QB 5BS0E 5ELIA 2VLLA 4KAQL 4AT6B 1K8DB 3FT2B 4JFOA 5CEYA 1R5IB 1FYTD 4Q7DA 1OAKL 3O11A 5J3HC 2R0ZL 1HH9B 4X0KA 3T4YB 2GCYB 4IOFD 5TDNA 4OZIF 3KPMB 4ZUWA 2IAMC 4ZUUA 4MA8H 1FVCA 3ZDXF 4AIXA 4WEMB 5B3JE 4YPGB 2R1YB 1L9NA 1UZ6F 4HPOH 4LU5H 2Z31C 4RIRB 5EC2A 1OGTA 2I24N 4NBYB 4IIQA 4QGTA 1S8DA 3MFGB 5CBEB 5I75B 4AQ1B 1T04B 3Q6GH 5HHMB 3WO3B 1S7SA 4KZEH 3ESVF 3D3VE 4KFZC 3ZYJA 3M45A 3S5LB 4TNWF 2JJSA 4LU5L 3HG1A 3ARVA 3DURA 2AV1B 4WNQB 4DKEH 5ITFB 1S78D 4V1DD 3Q6GL 1DJSA 1KC5L 5DRWB 4BZYA 4KZEL 1OGAE 4JHAH 5E8DH 3KPPA 3RUGF 2R69L 4A2LA 3LV3B 4M61B 1RZJL 5DZLA 4RDQG 3S6CA 1W8OA 2QR0A 3LDBC 3QIWB 5DD6B 1EJ6A 2ZKHH 2JB6A 2XY1A 4GAJL 5CZVH 2QADB 3K4ZA 3QNYA 3CLFL 2NQCA 3DV6B 3PWJA 5F96L 3L5IA 1KCRL 5EBMB 4HEME 2N4IA 3GKZA 4XP5H 2Q86A 1A7OH 1NGZA 1S7TB 1NEUA 4HF5H 2EE6A 5AYUH 1RU9H 5JQHC 1BZQK 1G7HB 1KOAA 5CZVL 5DJDA 1XFPA 1BF2A 1EHXA 5DEGA 3D18A 1Q9KA 1PKQA 1C08A 3PQYB 3FRUA 1HXMB 3DGGB 3MR9B 1BJ8A 1A7OL 4ZOBA 4RQQB 2HRLA 4YFDB 3FN0H 3RTQA 4OCYH 1AI1L 2IAMB 3CK0L 4L4JA 5IBTH 3FO9A 4I4WA 3L95B 3N06B 1KJMB 1RZKH 2QQLH 5D1QD 2XN9E 4OGZA 3QDJB 1O0VA 4RGND 4S1DC 3FN0L 4WFGD 4XB7A 1ZLUK 4OCYL 5TJWK 2OR9H 3TC9A 1GZPB 5ANME 1WIOA 4HXAL 5JOFA 1PFCA 5E6ZA 3F7YB 4GW1A 3VFVA 4AMKH 4MNQE 1QSED 3TBVA 4J23A 1RZKL 2QQLL 4XCFH 1CVSC 4F33B 4JPIB 1IARB 2OR9L 4C59B 3CCHB 1I7TA 1CICB 2O5XL 3QWRA 3FQWB 1JI1A 3E3QE 4BSWA 1MH5A 3L5WB 1GGCL 1OSZA 4R0LB 1U8HA 5B4MC 5C0FB 1NBYA 5FO7A 5MEOB 4XCFL 4XNUH 1A9BB 3GEWB 4J1UB 4HUWA 4KUCF 4TNVK 5LKNA 1T89A 4I18C 2H45A 3NIGF 4IBLT 4KU1A 1ZLSH 4U0RC 4P46D 1GIGH 4Q0XH 3TBWA 4HX1A 1A4KB 3I6KB 1RD6A 2Z91A 5C0BA 4HFWB 5F7NC 2NPLX 3JXAA 1KN2H 2AEQH 1U2HA 3C6LA 4AENB 5I1JL 4M43H 5FKAA 2CDGA 4Q0XL 4I5BB 4YHPA 4YBQD 4HDIB 1LEIA 1T7ZA 1ZVSA 1NC4B 1YNKH 3QUZD 2N56A 4TPRH 3F5WA 5I1GH 3AS3A 5CJOL 3CDGB 2AEQL 1K6QH 4AY0A 4S10A 3GSQB 4F9LA 3PV6B 43C9B 1A7PL 4G8GA 3QIUB 1X9QA 4UI2A 1NH6A 4G80A 3P0VH 4GRLD 3MV9D 4TPRL 4XZUB 1C16A 1MQKH 1IQDB 5I1GL 4QLRA 1YDPA 1UM5H 5DO2D 2VISB 2XA8L 3FQUA 3S96B 1A6UL 5I1EH 1QBLH 1AD0B 3JZ7A 4MNGE 2OXHA 5HGGS 3P0VL 3KPNA 2DAVA 4GSDL 2Y07H 4LHUG 4L1HA 4K55A 4L8SC 3EOBB 4F9PA 1W72L 2X09A 3AROA 3GMNA 3WIHL 3RI5F 3VW3H 1OTUC 2P43B 3IJYB 3CU1A 1QPPA 4LLQA 1QBLL 2XZAH 1IKNA 5T1DH 1ZE3C 2Y07L 1BZ7B 3N1QC 1EO7A 3VW3L 1EAPA 4RAVB 1A2YA 4TSAH 2V9RA 3T0EB 2DRUA 1QLEH 4MXWH 3VXUA 1I85A 5T1DL 2XRAL 1P9MA 2CGRH 4LGRB 5HHNA 2Q8AL 1S9WB 3P4OB 4WTZG 2N7BA 5I0ZA 5DMKA 1BBJB 4LL9A 1RY7B 3DRTA 2EC8A 2DTML 3MUGA 4KQ4H 5T3ZE 2ARJB 3O3AB 3JTSB 5KZCB 4EIZC 1KCLA 1QLEL 5F6IB 5EIVA 2LV4A 4PRHE 4XMKH 1D9KA 5H37G 2BRRL 1ND0B 1BF8A 1A7NH 4XT1C 3CSYA 2O5ZH 1OAQH 2EDBA 5HYJB 2A73B 1NMCB 4UB0H 3JWDL 4L4TB 1FBIH 1TVBA 4RX4D 3WDJA 3HMXH 1LK3H 4N1HB 2CDEB 1AR2A 2M2DA 1ZHLA 4ZFOA 3Q0HA 2AJXH 1A7NL 4YXKL 2O5ZL 4Z77B 4NUJB 3PXHA 1JN6A 1NFDF 4M93C 2RHEA 5CWSA 4KI5D 4OI9A 3ULSA 4XTRD 1TTFA 2XN9B 1FBIL 3RWHB 3STZB 5CSBA 4NQDA 2CSPA 3HMXL 4XXDA 3V9FA 4MQXC 3L3DB 2X4RB 3VD7A 2HT4C 4Y19D 4L8SB 1JYNA 1XZ0B 2AJXL 5C0CD 5DMJB 1NCCH 9CGTA 5H94A 3KDMA 3QBTB 1EEZA 5BVPL 3LD8B 3RKPA 4M4PA 4X5XB 2UV3A 4OD1L 1CDGA 2MHAA 5D2LF 3NTCH 5FV2A 3KXFB 3SE8L 4DGIH 4LP5A 3HLAB 3QWOA 5DF0A 1NCCL 2YN3A 1EO5A 3RIAF 2VITA 1R3IH 5C08A 5ICZB 1AD9B 3K74B 4KJWD 1CFTB 3MRPA 4Y16B 2H8PB 2GJJA 5LWYH 4PJ9B 5D8JH 5FGCB 4NKIH 1HDMB 3MRLA 1UJTA 3DUUA 1HNFA 4CDHA 1EXUB 3LQZB 1RIUH 3IRPX 5KVGH 1P2CA 5TDOA 2X4PB 4LMQI 2O61A 4HUVB 4LSUL 3PGCB 4PRAA 3JV6A 3EDKA 1AC0A 3NCMA 4HFUH 5DHVH 2VXQL 4MS8D 5KVGL 3LKRB 4ALAH 1WBZA 5IJKC 2HJKA 3RVVC 3GMOA 4OQTA 1AXTL 4K3DL 1DN0A 3D0LA 5JPMA 1WV7T 4QRRB 5BO1H 3ZYIA 2C3VA 3QG7H 2DLTA 3SPVB 1T66C 4NKMB 4JRYD 5DZOA 3V4VL 3EGSA 3HR6A 1ZVHA 1BREA 1XEDA 4AH2B 3EJYD 1F3DH 5E8EB 5GS1B 2MQ0A 4BKLA 4EN3A 1FVEA 2Q20A 1QLFB 3G6AB 4LDLB 4TSBH 1WZKA 5BO1L 5JHLH 1JPTH 1RPQA 2N7AA 3RHWF 3SE3C 4GRWF 5E8OA 3QG7L 3BJLA 4OIBA 4U3HA 3UYOD 4GQ9H 4HH8A 4GBXC 5FYKH 4Y4FB 3M17B 3BO8A 4P23A 1U92B 4IRSB 4Y8AA 3BIBX 5JHLL 3I02A 2O5YH 4F7PB 4BYHA 4NO2A 1WIPA 1WC7A 1I9EA 4NBZB 4GQ9L 4KC3B 2XT1B 4XHQA 1NAKL 3ARGA 1KLUA 5I17A 4P2RA 5JPNB 3GNMH 1YEKL 3L3HA 4NNXB 3X13A 3REWA 2O5YL 5D1ZD 2R2BB 3BJ91 4MJ5B 5E70A 2KL6A 4M7JH 3VD3A 2OTWB 1BMGA 5B39A 3RBSA 2P8PA 3MBEA 3H0TA 5IBLC 3OPZH 1XIWD 2YUWA 2VXVL 1ZHNB 1GPOH 3GNML 3C8HA 1FN4A 3NPZB 4JLRA 5MENA 1JP5A 3TZVC 2V6HA 2HMIC 5DUMH 4M7JL 1J05A 5ETUB 1URLA 3CSGA 3QIBD 1IILE 4WW2C 1QHPA 1IL1B 1FLTX 2JELL 1N3NB 3CVIL 4NCC2 5ACZA 3OPZL 4PRDA 1CIDA 4MJ6A 3MRGA 4OM0H 3O8XB 1G6RB 1MCNA 2R23B 4U7KA 5DUML 2DQEL 4YQXL 5B38A 2ZCLL 2WK2A 1YJDH 3OKNB 1T03L 3VWKD 4LRNH 2DM3A 2WW8A 3WUWG 2PTTB 5DVMA 5GGSB 1SVZA 4C83A 2BY1A 5DFVD 4CMMA 3T1WA 2DL9A 3KPSE 4I48B 2BNUA 1T0PB 3QEQE 3O4OC 1YJDL 5IVNA 1VB9A 2ESVA 1CCZA 1II4E 1JZ8A 3V0VB 4OLYL 1X5AA 4J2XA 4U3XA 4CL7A 1RFDL 4AIZA 1A0QL 1UCBL 2H2SD 3VXPB 3OHXB 5DI8A 1NCWH 1J0ZA 3DXAA 4IRZL 5SWSD 3ZSTA 2VRAA 1KLGA 2FJFA 4AL8L 3WDHA 5IGXH 5DUPH 3W0WB 4ZDHB 3HTLX 5LGJB 4NN7C 1EVUA 4JFEA 2Z8WC 5FYKU 1NCWL 4QNPE 1AHWC 3MRKA 1G7LA 4NC2B 5CJBA 2EDWA 3UO1H 5IF0A 2IEPA 2SEBA 4KKBD 2F5BL 4YIQA 4RMQA 5D93B 3V5DA 5IGXL 4HS8L 3TZVB 1JCKA 5E03A 1MAKA 5CIPH 1TQBC 3U36B 3HZKB 4JB9H 3AS2A 1CI5A 1D5XB 4RMRA 4NBXB 1BWWA 2MKWA 3V6FA 2VZUA 3MLTA 4XNZB 4L5FH 3MRDA 43CAA 4XHJC 3VA2C 3OKLB 1C5CH 2HT2C 4GAFB 3ARBA 3FONA 3SDXE 3KPOA 4HIHB 5CCKH 5ILTH 2NXYD 4JB9L 2HJLA 4UU9B 4Y2DB 2VDPH 1SJHA 2VR5A 2NY4C 5FB8A 4OZGA 3UEZA 5I1DB 1ZT7B 5CP7B 2XIDA 3SDDB 1JL8A 2FSEA 2WAHA 2VLJD 3NIFE 2BOCB 4W6WB 4GXUN 5ILTL 4XBPB 3ARQA 3KYOB 3A67L 4ODUA 4H20H 4RFNC 4BK5A 1LE5B 2C3HA 2R0LH 4A6YH 3BP5A 3R1GL 4F37K 2Q6WA 2X89A 3ZTNL 4DUXA 2VDMH 4DGYH 3RU8H 2X05A 2VN7A 2R0KH 1FC1A 4TRPH 4YPJA 3RDTC 2AXHA 4H20L 3EZ8A 4R8WH 5FA3A 5A16B 2BY0A 4R90L 3TO4C 4BFEA 2PO6C 2VL5A 1AHWB 4QO1A 2VDML 3OXRA 4DGYL 4UTBL 3RU8L 4N90D 5DURD 3SCMA 2QHRL 3L3GA 2R0KL 3W11D 1YNTB 5MEQB 5HHMD 5F44A 3DX9B 1BBDH 2Y5TA 4K71C 2FYYB 3GDBA 1T7VA 2WM0A 4WEBL 1I7UB 5BV7H 1XF2B 2GW5A 1T2JA 4HBQA 3GI8H 1TQBB 2E6JA 1V5JA 3LRSB 4JFFD 1EX0A 1F6FB 1KIQB 5D9SB 1QKZL 2M1KA 2Q1EA 2DWDB 4Y1AE 3BZFA 2RIKA 2WQ8A 3MJ9H 5DD0H 5BV7L 1AKJB 1Q38A 3GI8L 4FNLH 4Q6YA 4K7PY 2BOBB 2COQA 4NQSB 4JKPH 5GRUL 5KVMC 1WT5A 3QIWD 2B5IC 4ZUSB 3LZFH 1U8OB 1IM9B 4IRJA 3MJ9L 2BVPB 5DD0L 2UWEA 2G9HA 3E8UH 3N9GL 4RNRA 2HN7A 2Y6SC 4EI5A 3QUMA 5A2IH 5L0QC 4JKPL 2DQUH 4YHKH 3RWEB 1M4KA 2FHFA 3TA3D 2IADA 3MV7D 3BESR 1RV6X 1KJVA 5ALBL 4ENEC 3MRFB 3KPSB 4U1MA 3VRLF 5SWZE 4X6CF 1INQB 2ZOLB 1HHGB 1TVHA 1H9VA 3QEQB 2DQUL 4YHKL 5EULV 4X6FB 5C8JB 1LEKB 5ESVB 3MOAL 5EU6D 1AXIB 2WBKA 2ID5A 3O9WA 1YMMB 2P8LA 2PO6B 4XNYH 5FUOH 3NZHL 1CDBA 4OLXH 4HJGA 1HE7A 3X11B 3DVIA 2VLRA 2KBGA 5HD8D 5HGHB 2X4TB 2UY6A 3V6ZA 5K59F 4AM0A 3SKMA 3OKKB 4OZHA 3IXTA 3PE9A 1CFVL 1CS6A 4QRUA 1QR1A 3FQRA 2OK0L 2N1KA 3CFDA 4XNYL 1ACZA 5FUOL 3VH8A 3QDHA 3O3BA 3HN3A 2JF1A 4OLXL 4KK5D 3HI1A 5T1KA 3KYMA 5LBSH 2FJGA 1XT5A 2AI0H 4Z7VA 2W07A 3UJTL 3WYRA 1CFQB 3AU1A 3QXTA 4F57H 3WUZA 3BPLB 5EZLB 2DYPA 5FA4A 3TPUA 2YPLE 5IJVB 5LBSL 2ZWLT 1DUZB 2AI0L 5CZXD 3UTPD 4EUPB 4F57L 1C12B 4XP4L 5DJZA 3VXSE 3VFPB 3H6JA 5T33H 8FABA 2BZDA 5E8PB 4K7PH 3U1SH 1JIBA 3GJFH 3VE0A 2NY3C 4HJJH 5L0QB 4OFKA 3RVXC 4E0RB 3L7FB 4O02H 1JRHL 1GGIH 4TTDD 3RWDA 4Y4KB 4B0MM 4N1CA 2JJTC 5DC4B 1BIIB 4F7CB 3BIAX 1HKFA 4PJFA 4OCWH 1DLHA 4JFDB 5DA4A 5BQ7B 3OF6D 5L8KB 5T33L 5EUOB 3IDGB 3DO3A 4K7PL 1ED3A 3U1SL 4CW1B 4HJJL 3EBAA 1FYHB 1HOCB 1QNZH 1TZIB 4Y5VC 1XCQA 5H37H 1NC4D 5IQ9B 5K93A 2HLFD 3TEUA 4YDKH 5GXBB 5BS0D 3IKKA 4BSJA 3U9UA 3MLRH 1K4DA 1ZHKB 1W0WB 2AK1H 4G3YH 3LKOA 1HCFX 4YLQT 1KGCE 3VXRE 3QIUD 5D1XD 5HHOA 5HY9A 1F42A 2H2PC 4OKVB 1AGDA 2BXYA 3A6BH 1J0KA 1I1FB 5FM5O 2AK1L 4DUWA 3IDUA 5EB9A 4Z0XA 4Z7UF 5JA8B 4KROD 4N5ED 2NXZB 2IWGA 3TNMA 1NJ9A 4F7MA 2W60B 4W6YB 4HLZG 2HFFB 3A6BL 2OR7A 3CVHB 4KVCH 3BP6A 3HE7A 2W9EH 2BX5A 4KJPD 4FQQA 4QCIB 4QWWC 1VADB 4O2EA 1E6JL 4JZJC 4TUOA 2EDFA 4J4PD 1OGAD 5I76B 3FB5B 5KSBA 3TO2B 1T5XB 1T20B 2XACC 5FM4A 2W9EL 5BOPA 5I74C 2X42A 1A1NA 4LBEB 2CLZB 4XCCH 4G6FB 3HZYB 1T1WB 4MCYA 2A0LD 4OTXL 4ZXBB 1UKTA 1EV2E 4HIJB 4G5ZH 1F3JA 2XXMB 3VDCA 4HK3J 1XGQA 4OSUH 4P5MA 3QCTL 1KB5A 3VD4A 2EXYC 2V2TA 2H32B 4GG6E 4DZBA 3E6FA 3SDCD 4KDTA 1JPGB 5E8NA 1FH5L 3BHBA 1U91A 2C4FT 2P5WB 4NQEA 3WNOA 3KGRA 5F3HA 5LGKA 4G5ZL 2OTUA 5DGQA 4PGDB 1NGWA 2CLRA 4TUKH 5C0AE 3QISA 2M26A 3MNWB 2DWEA 2D7TH 2FIRT 2CD0A 1JZ5A 4DJMA 3U7WL 4M3JA 1A6ZB 3P4NA 3FB6B 1S5IH 2EDTA 2IALB 5HI3C 1EHLH 3U0WH 1N2RA 2IGFH 1FIGH 2XN9D 1C5DB 2F8VA 2D7TL 5I73B 4HUXA 5J7CC 4NRYA 5IVZA 3QEUB 1MWAB 2X6MA 1NKOA 3K8MA 1QFOA 1EZVX 5JOPE 3HI6H 1EO8H 3EHBC 3QG6B 1H8SA 2ORBL 5KSAC 4MNQD 1QFWI 3U0WL 1EHLL 3WLBA 4NC0B 1FIGL 3HZVB 3GSNB 3MGOA 4JZJB 1T22B 1HYSC 1I3GH 1P7QA 1V3KA 1EO8L 4EI6B 1A4JB 4XPHH 4PJHA 3LEXB 2YBRA 3MRQB 4LEXH 4U6XB 2UYLB 5J1AA 5MERA 3RWCB 5E9DE 5INDA 1I3GL 4PJ9D 5EO9B 4XPHL 5LVEA 3IETA 4ZUVB 5I1AA 5IHBA 5GGTH 4QYOA 4DOHE 3BPCB 3ECBB 3MNZB 4JDZA 2G2RA 5EU7E 3QH3B 4PGEA 3L1OH 3OV6A 3NIDF 1A7BA 3RWFA 3HE6D 3QULB 1MRCH 2R1WB 4P5TA 2R2HA 4FFWC 1N0XL 2PW2A 3CIQA 4YZFE 5D1QA 5TF1H 5HVFB 5LXGL 3TBSA 3DLQR 1OB1B 2HRPH 3PHOB 1AGBB 4H0IA 1NFIA 4RFEA 2BMKA 3MRHB 1FLRL 1WWCA 2EE3A 4G43A 1YN7A 4L9LB 5C6WH 5FDWA 2XTJE 1LMKA 1YEJH 2NY2C 3IFPA 4KRNA 2HRPL 4RA3A 3BN9D 4LQFH 3B83A 3T1FB 3TFKD 4C56B 2ZSWA 3ROLB 4PRIA 5E2TH 3ARFD 4NUGH 5GSRB 2VERN 1YEJL 1CLOL 3I84A 4R7DA 2APBA 4Z7NE 1L4IA 3PDGA 4LQFL 1JNNL 3G5YA 2GITA 3X12B 1I7ZA 5E2TL 5I1KH 4NUGL 4NZTH 1F8TL 4WWKC 2NZ9C 1EHNA 1G9NH 3HR5B 2D3VA 4P46A 3FOMA 3KYKL 3TJEH 3QUYB 2V5YA 2ICWB 2NMSA 1IAIM 3ET9F 4OGXH 5I1KL 1FVDA 4OUUB 4NZTL 3MROA 2YD3A 2ZUXA 3X14B 1S9VB 3T2QA 2AJSL 4PG9A 1G7MB 3UTQB 2DD8L 1DUYB 4YDVB 4KTEH 5T3ZH 2DM2A 1VPOL 5F9OH 4N8VB 5D7SL 1WCBB 3PL6C 5GGRB 3FHAA 3T08A 2W1NA 3C60C 4OGXL 4XC1L 4IHOB 4QRPB 4GG6B 5F8QC 4CJ1A 2V7HB 4PRHD 4KTEL 5KAQG 4GKNA 5HYIA 4XP1H 1H3TA 3MV9A 1O7VA 2ATPA 5F9OL 2NW3B 3F7VA 4YFLF 1RZFH 4FZEH 2C1OA 2BNQB 4K2UH 1X5LA 4H8WC 1GZQB 5C0AB 5IVXE 2P8MB 3P9MA 4D9LH 2GAZB 2NY2B 1QEWA 1KCUH 3EDJA 2VLKB 3EJZD 4R2GB 4FG6D 4XPGH 3S7GA 3WLWC 4ZODA 3RL1A 4CAGA 3FT4B 2DBLL 1FGVH 4WJ5B 2A2QT 1L0YA 4FZEL 3OAUH 4K2UL 4PJAE 5FUCC 1QYGH 3ROOA 4YHZL 2HFEB 1AIFB 4LLVA 4U1HA 4D9LL 1G0YR 4EDXB 1XMWA 4G9DB 4AEHH 4G6KH 1JZ4A 5LGHH 5CD5C 4ZS7L 2I60H 1U42A 1A6WL 2P7TB 4WWKB 4YXLL 1EPFA 2IH1B 1ACYH 4FRWA 1WTLA 4AEHL 4G6KL 3GMQB 1RUMH 5EIIA 4EQ3A 5EUOF 4UAOB 1G6VK 3OG6B 4X80H 1K3ZA 5DQDL 3QZWB 5A3IC 3PWPB 5D7IA 2P49B 2AABH 3TIEA 1M7IB 5CJXA 2KKQA 1AGFB 5I8KL 3DO7B 4P4RA 3TBTB 4G9FE 4KQ3H 2GUOB 1JNHA 3PL6B 5E9DB 3WL9B 3VWJC 1BVKA 4X80L 3G6JB 3PJSA 5HDQH 1UADC 3V52L 4FOMA 3GMLB 1BOGA 2VLME 3S3SA 1GJIA 2XG4A 3WN5B 1IC7L 4K8RH 1OW0C 4S1SH 1P7KA 1VEOA 3TVMC 2CDFA 4NJAH 4RMUA 2L7UA 1KIPA 4QRSA 2IPUK 4NHUA 1FZMB 2C5DC 4HIIB 2OM5A 2BSSB 2P5EB 1U8LA 2OL3B 2E3VA 5HDQL 4NQCB 2HKFH 3HMXA 2B4CC 4J3OC 5FO8B 1DQQA 5C0JA 5T1LB 4NJAL 1J8HE 2DLHA 2FL5A 3UROR 1NGYB 2C3XA 4N0CD 5F7EH 2BHUA 5EC1B 4Z7WA 5C0CA 1S3KH 4GS7C 2DQJL 2HKFL 3SDDD 4PJDA 3T3ME 1DVFA 1N6QH 1UWGH 4GUPA 5EN2A 3NAAH 4R3SA 1S9XA 5C07B 4WI6A 4AJ0A 1IGYB 4U7MA 1GYAA 4WENB 5ERWB 2ZSVA 1EA9C 2FLBT 4RMSA 1S3KL 1JHTA 3MPCA 1PQZA 1NUDA 3KJ4B 4N0UB 2A6IB 4O9HL 1N6QL 2CXGA 3AB0C 4K94C 5I8EB 5EIQA 2R29H 2FCBA 3T0BA 1OVZA 4XVJL 3KS0H 3DX8A 3LMJH 1KJ3H 3EO1B 2C4FU 4NZUH 3SDAA 4X4YB 1B9ZA 2D7OA 4Q6IC 2PF6A 2YMXH 3GIVB 4P2OD 3K7UA 3RKDC 1ZA3B 4TUJB 5CJQL 4UILH 3GGWA 4GW4A 1Q0YH 1ORSA 2WINA 2EXWC 2KQNA 3U79A 3FAWA 4HEPG 3LMJL 1KJ3L 3VXTB 3V4PH 3WHE1 1FNHA 2DLIA 4PLJD 4JY6A 2CR3A 1I75A 1QRNE 2DLGA 2YMXL 4XMLL 2D03L 3IDYC 1UENA 1FL5A 4WIQA 3TVMB 3U2SA 3Q6FB 4Z76B 2CKBB 1ZEAH 4LSRL 4Z95H 4R4FH 2AQ1A 5DHVA 4M7LH 4PRNA 3QFDB 1T0MA 3CPLB 3FCTB 4Y4HC 1W0VB 1MLCB 1OQXA 1AKJD 1YEDA 3V0WH 5IIEB 5DQ9B 3H7BA 1YEGH 1BLNB 1U8MA 4O2FB 4Z95L 5ICYB 5JXED 4M7LL 5DRXB 4JRYA 5FXCH 4MAYC 3SKNB 4GS7B 1IM9D 4KWUA 1K8IB 3CNKA 1VKXB 1FFPB 4UQ3B 5KJRL 4WY7H 1XGRA 4LIQE 1FG2B 4PJEB 1ES0A 1BQHA 5D7JC 3V8OA 4S1RH 1CWVA 4HWNA 5C0BE 3IJHB 2CKNA 5GGQH 3GSXB 1HINH 1B0RA 3KPSD 1NC2D 3QEQD 1Q9OA 1U3HC 4YK4C 4WU7A 3TN0B 3PDDA 3DIFB 5HDBE 4Y2OA 4LLMB 5FF6A 1BOYA 3BPOC 4YXHL 1HINL 1YECH 3W82A 2NLJA 4X6EB 5D1ZA 5I71C 1JGEA 1BJ1J 2VLLB 4APQC 4G8IA 4JFOB 2L7JA 2G75A 5CEYB 1X3DA 1XIWA 5KS9F 3O11B 2J8UA 4X0KB 2RGSA 4HXBH 5TDNB 3RTQC 1YECL 1G0DA 1HEZB 4ZUWB 4ZUUB 5T5NF 4JY5H 2APWA 5KAQF 2D4DA 3RJQB 4HLZH 5EC2B 4WV1C 1OGTB 3ZKMC 4KK6C 4Y4HB 4IIQB 1S8DB 2WWMD 4HXBL 3HPJA 4ACPA 3WS3A 5I15L 1DQTA 4F80A 4FTVE 3SHSA 4JY5L 3STLB 2PKDA 5E2UH 2HVJA 1AP2A 3HG1B 4CUCA 3DURB 4LPTA 1UM6H 1R0AH 4FP8L 1L7IH 2X9XA 2OXGA 1VDGA 1BQUA 2E8ZA 2JJUA 3BKCL 4X4MA 4XPFH 2ZUTA 3K2MC 3KPPB 5E2UL 5D7JB 5GS0D 1V8HA 3RY6A 4XAKE 2QR0B 3LKNA 3VXUE 3ZE2E 2VAJA 4LFHG 2JB6B 4P99A 1X5KA 2DJ4A 3K2UH 5GS0L 3QNYB 5JIKA 3PWJB 2EICA 4S2SB 1YEFH 1U3HB 5C7XL 3ULVF 4XPFL 1BZ9A 3PF2A 5BXFA 2I25N 1IGJB 1JPST 2Q86B 1NGZB 5SWSA 1JUFA 2YC1B 2GYSA 1JE6A 3IDNA 1TENA 3EYOA 4XPBH 4DUVA 3VI4E 3NGBB 1U8KA 5DJDB 1WZ1H 3KPRE 3RVUC 1NCAH 3PABA 3DUSA 3OB0H 5DEGB 3NPSC 1Q9KB 5FHAH 4KVNH 1PKQB 1C08B 1B4JH 3FRUB 2F74A 5GRWA 3VD9A 2HFTA 4I0PC 5EOCJ 3RTQB 4U1KA 3ULUC 4TYUA 4PBVC 5DLMH 2EYRA 1LK2A 3FO9B 3SE9H 4I4WB 5CD3A 1TJIL 1FV1B 3MGTA 5BZWA 5FHAL 4QHKI 1B4JL 4NP4H 2QQNH 5H35A 1XGTA 4H25A 4K7PX 2PNDA 2NXZD 2AXGA 4K9EC 5CIPA 4LCWE 2F19L 5DLML 4YBHA 2PW1A 1KSRA 5JOFB 4GW1B 4GFTB 3CVHL 2VWEE 5D7KE 4HV8A 3AREC 4KK8C 1JHKH 3L3IA 4Y1AD 3W9EA 4XXCC 5GIRA 4W4NA 2QV2A 5D2NA 1JGUH 4HWEL 1HQ4A 4WHYG 3SGEH 4BSWB 1X5IA 2YK1H 1OSZB 4JKWA 1U8HB 4HD9A 1JYVA 1NBYB 4ZXBD 5C08E 1JHKL 5DVOA 1BQLL 2E7LA 4HUWB 1FE8L 1JGUL 3UYPA 4A6YA 1SJEA 1YUHA 2YK1L 5DRZA 3TBWB 4HX1B 5HHPA 3FQTA 2Z91B 3VRJA 5C0BB 2X4QA 2E7MA 1I1AD 2JCCE 4L3EB 1MFBL 2DOCA 5SWZD 5HI5C 1R3HA 2RBLA 4JQXA 1T6VN 4UT7H 3O41A 5IG7A 4UIMB 3G6JF 1MFCL 5FKAB 1TTUA 1CG9A 3WJJC 1LEIB 1P84K 1Q8MA 2CIIA 1ZVSB 4D9QE 5TFSH 5IFJA 4P2QE 3F5WB 4KKLD 1IKFH 4FXGA 1D9KC 4PGCA 4NWUH 1SBSH 2FNBA 2VR4A 4M6NL 4JFFA 5J9PA 1ZXQA 3UXFA 4G8GB 4G80B 1MOEA 5TFSL 5FCUH 1IAMA 4YAQA 1C16B 2C3GA 3SDYH 1DR9A 1IKFL 1HHHA 1MWAL 1JGDA 4G6AC 4KRLB 4MB3A 3IU3A 1C8PA 3VCLA 4NWUL 1SBSL 2PXYC 1KJ2L 3AREB 3FQUB 3MJ9A 5IBUG 5FCUL 3UPCA 3KPNB 4LKCA 2BP3A 4WO4C 1ZLWH 1EJOH 3C6SA 3QDGE 2YPLD 2APVA 4R4BA 1T6WA 1RIHL 2HKHL 3GMNB 3LCYA 1PJ9A 3W5MA 4NNYA 5IESH 1RUPH 3TA3A 4ORZC 3MV7A 3BRDA 2NYYD 1EJOL 3WD5L 3E0GA 1K4CA 3MX0A 1PZ5A 4X9BA 2X4UA 4U4BA 5IV2A 5EBLA 1NDGA 3WE6A 4NJ9H 2NW2B 5K9OA 1EAPB 5DJXB 1A2YB 5EU6A 1RUPL 4P3CH 3VXUB 1NUGA 1FGNH 4HZAA 5HHNB 1F6AA 5IMKA 5DMKB 1KPUB 5F88A 2IG2H 1RK1A 4NJ9L 3MUGB 1OAZH 5MENE 3SQBA 4P3CL 5DK2A 4F15B 4FQCH 3JVGA 3BQUC 2X7LA 1H5BC 2C3WA 1D9KB 5CSGA 1QSVA 5E08L 3CSYB 2GJ6A 1KGCD 3VXRD 3VMPA 1N59A 1OAZL 3NVQA 1TVBB 4EVNB 4FQCL 4NM8H 4NHCL 1RUAH 4PJXA 4PJ7E 4NO0D 2PR4H 4ZFOB 4LHUA 5IW6A 3W9DB 1JN6B 4PJCF 5IKCB 1LP9A 5CWSB 1F6LL 3ULSB 1U41A 2BSTA 4NQDB 4NM8L 1ZHBA 3MXVH 4RISH 5FOJA 5E94A 4YUEL 1JPSL 5C0IA 1ZMYA 2DKMA 4PJEF 3OJVC 3QCUH 4MVBC 4WHTA 5BMFL 3QUYD 5H94B 3ULVD 4K7FB 3KDMB 3MLZH 3UJJL 5L2KA 4LAJH 3DXAE 1EEZB 3GRWL 3MV8B 4RISL 4WDIA 5M94B 3BGFB 3ULVL 2MHAB 4WTZA 3QWOB 2EIZA 3TH4T 5LQBH 3B9DA 5I1HL 2EIBA 2VITB 5E4EC 5IQ7H 5C08B 3DPBA 3G5VA 3JWOH 5CBAA 3MRPB 5TF0A 5BS0A 1DFBH 3WKML 4JFYA 4QRPD 3JV4A 3BE1L 4EOWL 3MRLB 4WWID 4FA8A 3DUUB 4WGWB 1IGMH 32C2A 4LSSH 5LQBL 5D1XA 4OLVH 1SEQL 3T3PF 1P2CB 2J7LA 5IQ7L 5TDOB 3M8OH 4J8RA 4GT7A 2X4OA 3JWOL 5IUSA 2O61B 4DKDC 2OI9C 1DFBL 5C0AD 2DLFH 4PRAB 3JV6B 3WSQL 3EYQD 2WBWB 1IGML 5KOMC 3IXAA 2H3NA 4OFVA 4P9MH 1UH2A 3SGEI 3VMOA 5JOEA 3MREA 4R2GD 3SY0A 2AVGA 1WBZB 4H88H 2HJKB 3EKCA 3G04A 3D9AH 4I3GA 4OCRH 5AUMA 3AXLA 3TYFA 3D3VA 3GUTA 2DLFL 2YXFA 4OZGE 2R39A 1DN0B 2FEDC 5GJSH 3D0LB 5JPMB 5DR5H 5KSUB 2YPVL 1ZOXA 2C3VB 3BIKA 3O4LA 5JOPD 4J4PA 1QRKA 3L6FA 4OCRL 1MCCA 1OGAA 3CDFA 3HNSL 2E9WA 5GJSL 1JZ2A 1WUNT 5IHUH 4PJBE 5GGVH 4KK9D 4BKLB 4EN3B 1FVEB 5IR1A 5DR5L 1OD9A 2YD8A 4LCCA 2GK0A 3ILQC 2OZ4H 5E8OB 3NH7L 5K9QG 3DYMA 2HTLC 2FD6H 5CGYC 2LAGB 1G7PA 3FO2A 2NY1D 3BO8B 4P23B 1T1XA 5IHUL 1IGCH 4UDTA 1U3ZA 3SDCA 3MRRA 2G60L 4FQ2L 5E9DD 2ADFH 4NO2B 1CDJA 4FQXA 1WC7B 1EEYA 1NLBH 2FD6L 4LPWA 1DBBH 3O3EB 2AP2A 4GRWH 1KLUB 5I17B 1IGCL 4PJGE 4P2RB 1A3LL 3L3HB 3X13B 3REWB 1NEZA 4UV4H 4RWYL 5K9KA 1R3JA 2ADFL 3QDAA 4LVOB 5EU3A 5MP6L 1NLBL 5B39B 2XA3A 1OQOA 1DBBL 1Z5LA 3FN3A 2P8PB 3MBEB 2P47B 3H0TB 3P4MA 4LVHC 1PDKA 3FAXA 3V7AG 2WUCH 1TETL 1CXLA 2Z8SA 1FN4B 4JLRB 4UV4L 5MENB 1ZSDA 4F7TA 4KMLB 1J05B 1F2QA 1MREH 4ZUTA 5ANMA 1JWMA 4M5YL 5ACZB 4XWOC 4MNQA 2XTJD 4PRDB 4MJ6B 3MRGB 4HGWA 2GT9A 4HKJA 1EK3A 5HPOA 1AE6H 3H8NA 4FFVC 5C09A 2HLAA 3QCVL 2R4RH 3RGHA 1MREL 3CH1B 3T2NH 2NY5C 3ARBC 1F90L 4W4OA 2Z31D 1TJGH 3FB7B 4TQEL 4F3FA 4PGJA 5C3TA 1QBMH 4C83B 1AE6L 2Z93B 4GMTH 5INCA 1A6PA 1LO3L 3GHEL 1SJXA 2BSED 4HSQA 3RWJA 2ESVB 2EEAA 4OD3H 2FH8A 1NPUA 3SE4A 4BQ6A 5ISZA 1HKLH 1I8IA 1U8JA 4PJIE 4HWUA 4AIZB 4ERSH 4H5SB 5DI8B 1PG7W 2VLRE 2NY7H 4GMTL 3N1FC 3SKOB 4GQPH 5GGTA 3DXAB 1JF1A 5F9DC 3WBDA 3ZE1F 1RVFH 5D7LE 2V5RA 1DP0A 4IMKC 4S0TD 5CZKA 1KLGB 3N0PB 5MI0B 2FJFB 3HE6A 1HKLL 2ERJB 1MIMH 4M9PA 4ERSL 4OF0A 4JFEB 3FO0H 2NY7L 3MRKB 4Q9RH 1MLBA 5B39G 1G7LB 3Q5OA 4K3EL 3DUHA 4O2CA 4OLZL 4Z7VE 3FQNA 5IF0B 2FZ3A 4ELMA 2SEBB 4YIQB 3V5DB 3Q1SH 1NFKA 2XPGA 3DBXA 4Z5RB 5JW4M 3FO0L 5I66B 4Q9RL 5C2BH 5JIIA 3BT2H 1NLDH 3BXNA 1MRFL 3ARFA 3WUWA 1PG7H 3V6FB 5I30H 3MLTB 3Q1SL 3VG9B 3MRDB 3WFHA 2VDKH 5B38G 4MNGA 43CAB 1OL0A 3HHRB 4ZO8A 4MQ7A 3T0DA 1GXEA 4GRMA 3ARBB 1L6XA 3FONB 3KPOB 2LU7A 3RX7A 4L8BB 5BRZE 5C2BL 3BT2L 1EUTA 1SJHB 5FB8B 5I30L 4LFHD 1JV5A 2H41A 5A2JH 2QKIA 1WFNA 4ZOCA 4AG4L 2FSEB 5EBWA 3TN0D 35C8H 4PBXA 2W0FA 4ODUB 1IFHH 2BVQA 4NNPH 2BVYA 2JB5H 3DX6A 3IDMA 4WUUB 1ZGLA 3GK8H 2Q6WB 3MRIB 5BVJA 3MCKA 5E00A 3CZFA 3C87A 3I85A 1VERA 1UWEH 3WFDH 5FA3B 5B4MD 3SGKC 3O9WC 2JB5L 3ZDZE 1VGEH 2VL5B 3GK8L 1FNGA 4G9FD 2PCPA 4PRHA 2WP3O 3SCMB 3DNKA 3L3GB 5B21A 3O0RH 5HTSA 1OSPH 4TULL 2Z35A 3WFDL 2VLMD 1YEHL 5DRNA 3S37X 2XQBH 5HI4C 3UAJD 2E27L 4M7KL 1CVRA 3K1DA 2PTVA 1OWWA 3O0RL 1IAKA 1Z2KA 3B3IA 4WHYH 3BZFB 3B2VL 1YPZE 4ZQKA 1JNJA 1O7SA 1QQDA 4X6DB 4LSPH 5KSBE 4HHAA 1J8HD 3FT3A 1OAUH 3G5XA 4RZCA 5B22A 1E0OB 4XVUC 2HTKD 3H3BC 3VFWA 1VHPA 3ZKSD 4IRJB 1QLRA 2UWEB 2G9HB 4LSPL 1I9IL 4P4KC 2BRQA 3DMMC 1OAUL 4JM4H 4RNRB 2HN7B 4EI5B 3QUMB 4PYGA 4PPTA 5DA0B 4NQEE 2IADB 2LU4A 1FZKB 1KJVB 4Z7QE 5IFHH 1SM3H 5E6IA 1KELH 5C0RH 4AQOA 4U1MB 4IDJH 1CL7I 4JM4L 3WS6A 1TVHB 2UVFA 4LEOA 3WNPA 4C55A 5I18L 3B5TA 2F53B 4ZTPL 3O9WB 2P8LB 3O3DA 3PP4H 4KRPD 5IFHL 2W0KA 1SM3L 5C0ND 4MQTB 1KELL 4L8DA 5C0RL 4HJGB 5L8JB 4IDJL 2VLRB 5F1OB 2YD5A 3V6ZB 4KPHH 4AM0B 1S7WA 1Z9LA 4OZHB 2J8HA 5DVKA 5L2JB 1A1OB 1V05A 1R3KA 3RGVD 2AERT 3FQRB 1QR1B 1U3JA 1QRND 3CFDB 4HUUA 3FMGL 3C2AH 3VH8B 3O3BB 2WIIA 3T0WA 3HI1B 5CINL 5T1KB 4OKDA 4ZS6C 3KYMB 4KPHL 2FJGB 1MCSA 2IQ9L 4Z7VB 1B3JA 3L3JA 5FO9A 3AU1B 2DMKA 5DJCA 3QWRD 3C2AL 5TPWH 1SYVA 4AEEA 4PJHE 2OP4H 2B1HL 3TPUB 2GKIA 4LIQH 1BD2E 2W9LA 1RUKL 4OI8A 4Q58C 5B3NA 3K46A 3C8KB 5TPWL 6CGTA 4WCYH 5DJZB 3DX7B 3H3PH 4UZGA 8FABB 4ZYKA 2AK4E 4JJ5A 1LO5A 4NOBA 4I3SH 3VE0B 1OLLA 3LPGA 1ZK9A 4LIQL 2OSLA 1ZLUH 4KZDL 2KDGA 3RWDB 3VFMA 5C0BD 5FUCE 5E2VH 1BVZA 3PGFH 4WTWA 4PJFB 4U1GB 1DLHB 1MCBA 1XF1A 4JM2C 5IMMB 4P2OA 4BH8B 5ABDE 4WCYL 3C6LD 4Z7OE 4LPXA 2ZUQC 1HQRB 4AEIH 1ED3B 4I3SL 3MLWH 1OP9A 2HT4D 1KG0A 3WEXA 1XCQB 3ARZA 3MRCB 3EYSL 5E2VL 1KUMA 2A74A 1MJ8H 3QXVA 2AQ2A 4ONHA 1CGYA 4AEIL 3U9UB 1K4DB 3ZT7A 1HK6A 3TGXA 4GKSA 1LNUA 4Y89A 4FXKA 4FQ1H 4F58L 4DN3L 4D8PA 3LKPA 1I1YA 1MFEL 1J88A 5HHOB 5HY9B 1KPRA 1MJ8L 3S34H 3RX5A 1AGDB 1MHHB 1VFBA 2DQTH 1WVZA 3VFRA 3QHFH 4XNQA 3KLDA 4ORGB 4FQ1L 4Z0XB 2YWYA 1YYMH 2ZOKA 1VFAA 4M7ZC 4F2MA 2V5SA 3LPFA 4FABL 3TNMB 1NJ9B 4F7MB 4LVNC 4FTVD 1S78C 1RZJC 3BP6B 3HE7B 4KKCC 3LHPH 3MTRA 4YWGH 5DYOA 3D2UA 3OKMA 4O2EB 3H9SE 3VFOA 1S7RA 1J0HA 1AGCB 3IFLH 1NC2A 5KSBB 1G6RH 1G0XA 4YWGL 5BJTA 2X9WA 2XZQH 1A1NB 3S8WA 1DN2A 4XAKD 5JHDE 3VXUD 1EEUA 4MCYB 3HMWH 2LQRA 5AZEH 3ZE0E 2ZUQB 3K80A 1F3JB 2NX5A 3LS4H 4P2CG 4DN4L 4ZG1A 1HI6A 1XGQB 4P5MB 1KB5B 1HSBB 4JG0H 4XGZA 2V2TB 1H3WM 1D5MA 3E6FB 4KJQC 5E8NB 2R56H 3BHBB 1OWRM 1U91B 1IMHC 1I1CA 4NQEB 4ONFH 2OJEA 2LAAA 3KPRD 3I50H 4PS4H 2OTUB 3LS4L 1N8ZA 1MCKA 2CR6A 1NGWB 1MNUL 3AAZA 3QEGH 4MDIA 5H8DA 4JGMA 2CLRB 4ZAKA 2DWEB 2R56L 4UMGA 4ONFL 1CT8A 3I50L 5EOQL 4URTB 12E8L 1CF8L 1CLZH 2VOTA 4NQUA 1I8LA 5C2UB 1N2RB 4ZFOL 5EFIA 1S7XA 3VFUA 1ZA6A 4HUXB 1WF5A 5ALCH 4NRYB 4F8QA 3HUJE 4M1GH 4X5LA 5IVZB 1I3RA 2BHYA 4WI4A 3INUH 5T5FH 2LTQC 2AJZA 3SDXA 2BC4A 3WLBB 5IBLD 4YDIH 3MGOB 1ZKAA 4M1GL 1CZ8H 3QO1A 1PEZA 4QHMA 3MZGB 5GGUB 5T5FL 3Q5TA 3EFDH 5D7IE 2AKRA 2YBRB 1YQVL 4M62H 2YEZA 4BZ2H 3U0TA 5C08D 5J1AB 5MERB 4YDIL 4P46C 1CZ8L 5INDB 1MJ7H 3CFIC 4Q9CA 1RIVL 2EDJA 3IETB 3EFDL 5I1AB 3KYAA 4QYOB 3VFNA 3OG4B 4BZ2L 4GKOA 3RY5A 2A1WL 1YEIH 2AJUH 3PP3K 4YBQC 4JDZB 2XZCH 2G2RB 4YHLH 1MJ7L 4U33A 2VIRA 3QUZC 4PGEB 1NGPL 2E7CA 3RWFB 4OIIH 3KVQA 1UJ3A 2R2HB 4LPYA 2PW2B 5D1QB 4ZFZA 4XPTL 4D9QD 3EJJX 1YEIL 4P48A 2AJUL 5ADPH 1IC4H 2XZCL 1XH3B 4RGNB 3V6OC 3MRJA 2BJML 4GRLC 3GI9L 1NFIB 2BVTA 4RFEB 2BMKB 2E9BA 4MMXC 4Z7WE 2P44B 4G43B 1YN7B 4OIIL 4PJDE 1BM3H 4OQTL 1R5WA 2EYTA 1RMFH 5FDWB 1I4FA 2Z4QA 4JY4A 1S9YA 1H0DA 4OZFG 4QF1A 3IFPB 2A38A 1IC5H 1TIUA 4Y1AA 2ZSWB 4X6DF 5LG1A 1N4XH 4PRIB 3O6LL 1TDQA 3ARYA 3U9PH 1RMFL 4M48L 2X4SA 4R7DB 1CGSH 4CNIA 3G5YB 4HC1H 2F9BT 2GITB 2GSGA 2UWEF 1OF2A 4MHHG 4P23D 1I7ZB 3AMLA 2E8YA 4LASH 3VXMA 3EYUH 4DEPC 4P46B 1A64A 3BEVB 1FRGL 3FOMB 3PHQA 2VAAB 4WVRA 4QTHA 1U36A 4ISVA 2J6EH 4HC1L 1IAIH 1KIRA 4HPYH 3ARGD 2HYMA 3MJ6A 3HCVB 1NQBA 5SWZA 4X6BB 3CFCL 1RUQH 1RZ7H 1FVDB 2FIKA 3MROB 3EYUL 5JW5A 1QVOA 3UC0H 4PG9B 1CGUA 1OHQA 1MAJA 3LKSA 3PDOA 2NY0C 4MJ2A 3ALXA 3QQ3A 3QPQD 1CR9H 3NCBB 1RUQL 1BX2A 1RZ7L 3NFNA 3JWDC 4M1DH 5MEND 3ZDYF 3OGCA 4OZHF 3RIFF 3B8SA 2X1XR 4PTTA 3QJHA 2AJVH 4GKNB 3R0MA 2ATPB 3MV9B 3RL2A 3F7VB 3RI5K 1CR9L 1CE6A 4PRPE 15C8L 1ZT1B 4MJIA 3W2DL 3P9MB 4M1DL 1CBVL 1QEWB 3KPQA 3MNVA 4Z7VF 4KI5C 5D6DC 3TO4D 2AJVL 4LSTL 4XTRC 4M5ZL 3RL1B 2YPLA 4BUHA 4HIXH 3ROOB 5GSVA 4RFOH 4X7FC 4LLVB 1G7IA 3H42L 2VC2H 5GRZA 3MLSH 1IZJA 1I9RH 3VXSA 2D7MA 2X10A 2D4FA 5CLWA 5JW4Q 5ESAB 4HIXL 3DECA 1U8NB 1CE1H 4RMWA 4RFOL 1VACA 1HNGA 5KW9H 5C9JA 1YY9C 2VC2L 3O2VL 3DXAD 2VDQH 4OF6A 4PJFF 4KY1H 1G9EA 3QRFM 4J3XA 2E5EA 4KJWC 1M05A 1CE1L 3TIEB 3O6FA 1FZJA 2I9LB 1CN4A 2VDQL 4P4RB 4R7NA 1JNHB 5JIPA 3OJ2C 1BVKB 4KRMB 3PJSB 1F3RB 2J88H 4HWBH 1QHOA 5D6CA 3VXRA 1TQCB 1BOGB 1AO7A 3ARUA 2GK2A 4JG1H 5K9QI 3KJ6H 1LO0H 4HAGA 1P7KB 2CDFB 1FSKB 4N8PA 1KIPB 4Y5XA 4QRSB 4NHUB 3FFCE 5DS8A 3QFJE 4NO0A 1U8LB 2J88L 4HWBL 2VXSL 3DHJA 1DQQB 5C0JB 3RZCA 2UZXB 4WFEE 2EE2A