3LQZB

Crystal structure of hla-dp2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
212
structure length
198
Chain Sequence
RKFHYLPFLPSTGGSSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Crystal structure of HLA-DP2 and implications for chronic beryllium disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 198
sequence length 212
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqzB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3lqzB01
3MGTB 4RMSA 2YPLD 3FO1B 3ARZA 4RDQG 1A21A 5SX5H 5HXMA 3LN5A 3TO2B 8CGTA 4OQTH 4I3RL 2VDPL 4AQOA 2FX8H 5H94A 2IBZY 2KZWA 2WWMC 4MZ2A 2GCYA 4QEGA 5AG9A 2F53D 3IKKA 2APFA 3OXSB 1BQHG 4HKJA 4OFKA 5AD0A 1H3GA 1DBML 1K6QH 1UB6B 1WWAX 2X4RB 2YPLA 1YEKH 1EGJH 3QUZC 4HF5H 4G7VL 4HUUB 1XIWB 2I5YH 3TO4D 4L8CB 1UH2A 3VFPB 4OLWH 3AB0B 3EDDA 2F53A 4PJCE 2X9WA 1GYAA 4FQ1L 3ARFC 5GJSH 4ODHH 5K9QG 1T1XB 4P2OD 5FGSA 4UTBL 4FG6C 3CZJA 3CFJB 2L0DA 4XP5H 4MQ7B 5I1GL 4Z78A 4PRDA 1S9YA 3TO4A 1PQZB 2DIJA 3N06B 2DQEL 4ONFL 4WHCA 3PWVA 4J3OC 2EXYD 2MKLC 5TDOA 5D1ZC 2DF3A 3O2DA 2MWCA 4OZ4B 3S88L 4XAKD 2B39A 5C08E 2HMIC 3GMLB 5KSUB 3DSNA 1A6ZB 1ES0A 4NKMA 1MNUL 3PP3H 4LSSH 4RWYL 5ITBL 1NGPH 2A6IA 5EBGA 1VKXB 2FWOA 3TNNB 3I3DA 2MTPA 5BCAA 2XNAA 2JE8A 1CD9B 4UQ3B 2VE6A 3T77B 3DWTA 4OD3L 1KTLB 4RISH 4TNWK 1DP0A 4Y4KD 1FNFA 5JZ7C 3O3BB 2W0KA 5HYSA 3LKQB 3E8UL 1MH5A 4W68A 5A16B 1QSFE 3NCFB 1F00I 3BDYL 3RGVC 2X1XR 4Z76A 3CXDL 4Y5VC 4NQCE 1P53A 1MCWW 2NQCA 4MA1C 4LFHD 3RVTC 5DS8B 3B3IB 4OV5B 2BRRL 3JWNC 3E1F1 2AGJH 1Y6MR 2X4QB 5J1TC 5KTEL 5JUEL 2QADD 3N50A 5JQ6H 2YUZA 2IANE 2KZ1B 3VWJB 1CXHA 4QRUB 3BH8B 2V2XB 3QDHA 1WUNT 3VXUB 2BNUA 4ENED 1KCVL 1NMCB 2EDKA 3WFZA 4P9HL 5IFAH 1S7VA 4NQTA 2CDFA 1PX4A 4M43L 1I9RL 3JTTB 4P46B 4IS6A 4X6EB 3SDXF 4GAYA 4K07A 3BH9B 4QRQB 3P9MB 2YRPA 1H3VA 3RY4A 4YHKH 5JW5A 2BZDA 2I9TB 4JJHA 3TT3H 4Q97A 3FJTA 4OM1L 2VDKL 3BKCL 5IKCB 1S9VB 4X7FC 2VXQL 3VH8G 4QXGL 3NZHL 4N8VA 4L4TE 4S2SB 3P11H 1LP9A 1WJ3A 4O9HH 3I75B 3LV3A 1QZ1A 1TJHL 3NPSB 1I7UA 1BD2B 1J0KA 3PXJA 1T04A 2XRAL 4X4MA 4O2FA 1F4AA 5FCUL 1K8IB 1TLKA 4IJ3C 5DJ2A 5FYLD 4E41D 5HI3C 4M5YL 2VKWA 4M1DH 3EHBD 4N0FA 3LKOA 4LEOB 1PGRB 4NNXB 2R29H 2ITCA 1B4JH 1GC1C 1I7ZB 1ZHBB 4ODXA 4ZFZA 2J8UE 1VGKA 1ONQA 3QDMD 3BVNA 3CUPB 3D69A 3QWOB 4NBXB 1TZHB 2XQYG 3DYPA 3TBWB 4R6UA 3I3EA 4E41A 1D6VH 3V95A 1OARH 1L0YA 4PRPB 4MJ4A 1I1AC 3ZYIA 4ZAKD 4NZRL 5CZKA 4QHKI 1I75A 5HDBF 1ZK9A 3QXAB 1EEQA 1OSPH 4NBYB 4N90D 2ZCKL 4NNPL 3HUJE 1INEH 2SEBA 4KRPD 3WCYA 4JFDB 1UB5B 1JZ6A 5CIPH 1J87A 3MJ9L 4P3DB 4ZAKA 2NY5L 5D71L 5GRVK 3DO7B 2WMPA 4BUHA 1I1YA 5EPMB 2NNAA 4X7DC 2FEEI 1ZS8B 4LLUA 5EOCL 2NY1D 1AO7D 2MQ3A 2J88L 3V52H 1H15B 4R2GC 3EO9H 4PRPE 1FE8H 5HDQH 4BKLB 2CPCA 1W72L 3FQNA 1TCRB 3MRPB 5LXGH 2AEQH 4WUUD 4FFYH 4J12A 5GGTH 4EI5C 2IAMB 4PJ8D 2PYFB 2QQLH 2D0FA 4XNQA 5FUOL 3KPQA 5EZIL 3KAAA 1KENL 1MJUL 3MRJB 3TBTB 5HVFB 3C9NB 3L7EA 3VRJA 1ED3B 1SVZA 2ZUQB 3VGFA 1AGFA 4WUUA 3ZT6A 4PP2A 4LSUH 5DD3L 4J3WA 4PJ8A 5E9DD 5ID0A 4K71C 2QV2A 1EHLL 3GMOA 4WCYL 4TULH 5IB2A 1L6ZA 1MWAA 4R97B 4YE4L 3K1KC 1UWEL 4JHZA 4BQCA 4Y1AB 3U1SH 4OM0L 1Z2KA 4WV1C 2P24A 2X4UB 1EJOL 5HHQB 4GRWF 4Z5RA 1JNLL 1Z0MA 1QFUH 3MV8A 2EE3A 4HX1A 3V4UL 1VERA 3KLHD 3FQWB 1LD9A 1MFDL 1OF2A 1RZFH 5FYJE 3QIUD 2XACC 1CYGA 1KFAL 2CJUH 2Y72A 5EWIL 1XR8B 3OKOB 5C0BB 2F54E 3U82B 5DTFA 4ETYA 3BAEL 2GITA 1MCPL 1IZKA 2DL9A 2GJZB 3S3JA 1ZV5A 4UIMA 5C0GA 1FL3B 3BEVA 4MCZA 2CLZA 2P7TB 5JPMA 4ZFGL 3MRIA 4GKSB 5FYKE 3VI4F 2DD8L 5EC1B 1MJ8L 1RK0B 1EX0A 4JANB 5GXBB 3HNTL 4NFDA 4KI5F 5FGCB 2BNRE 1MFEL 4NKDA 2ORBL 1J10A 2YD5A 1A1OB 2AQ2A 3RBSA 2HJKA 5JR1H 1AQKL 4IRSC 1YY8A 5D7IE 3G5VB 1PFCA 5IEKA 3OZ9L 1NKOA 1KN4H 1ZTXH 3RA7H 2ERJC 1U2HA 4QRPE 2FIRT 1RIHH 4J3UA 5IEHB 3TBSB 1CE1H 2X9YA 2Y6SC 3GJFB 4HUXA 1EBAA 1DL7H 5E95B 3MCKA 1ZLVK 2Y9RT 1S7QA 3ARYA 3G6JF 2JB6A 2MCG1 3OAYK 4OTXL 5B38G 4PJIA 1Z5LB 5LBSH 2ZUTA 1K5NB 2UWEA 1KCUH 2Z4QB 1I9JH 3FRUA 4AYFA 4WUKH 5D7JA 2XZZA 5EO0B 1FQ9C 4Y4HC 3DROB 5MEOB 1DSFH 1PDKA 3H9SA 4HPOL 2JJSC 5ACMA 4JKPL 5IR1B 5D96B 1T5XA 3EDKA 5L2JB 3MFGB 4GRMA 4AEIL 4L8SB 4OIAA 2FJGB 5EBWA 2VL4A 3MLVL 1EO8H 4W4OC 4XRCB 1JGLH 2OQJA 3RI5K 5GGVL 3PNWB 4DN4L 2QEJA 3QZWA 2Z31B 2UZXB 4K3EH 4GO6B 2PW2B 1U8MB 3WNKA 3UTSB 1NAKH 2A77L 3LQZA 2IGFL 4XNZC 1SEQL 4OJFL 2F74A 3VGDA 3EYFB 1NEZA 3BYYA 1RUQH 5T1KD 3CMGA 3DUUB 1PKQE 1KBGH 1A1NA 3C5SB 2PYED 2Y36H 4PJGA 5IB1B 3QUYC 4K3DL 4OT1H 4Q6IB 3U6RB 4C56D 3OKNB 5BW7A 5CJXC 5AG8A 1CDJA 4S0SD 2W60A 5D8JL 2EDFA 4QT5A 3MLWH 4MD4A 4XMKL 1REIA 1I8IA 2PTUA 3B2UC 4NZJA 1CIDA 5T1KA 4Q58C 4X5WB 2LV4A 1AP2B 2YPVL 1LDSA 1ADQA 3ZHLA 4M5ZH 3WLWD 3ULSA 4LVOC 5EB9A 4HS6A 4JPIB 4C56A 1U8HA 2W0PA 3DYOA 3IDGB 5CBEA 3K4DA 5GISL 1UACL 3GEWB 2QQNL 4K8RH 1I7RA 3KPLA 3EO0A 2IPUG 4GBXB 1G9NC 2BOBA 1PAMA 3QRFM 1WFTA 1N26A 1ORSB 4BYHA 1S9XA 1F3JB 5D9SB 4R4BB 3AM8A 3HAEA 1HHJB 2Y5TA 3V4PH 5FO7A 1HILB 2P5EE 4MNHA 2ZKHH 4MGXA 3RHWK 1JE6A 5DR5L 3W9DB 4TVSa 4X83A 2HFTA 3QA3B 1FH5L 3L5JA 4WWKC 5HDLA 2DLFH 3BPLB 1JFQL 4JZOB 1NCTA 4YX2H 2W0LA 1I1FA 5I8EA 3IU4L 2OTUB 4XNUL 3DXAE 4F37K 3W0WE 1MOEA 1QRND 1P1ZB 5FECA 3BZFB 3QUXD 1J8HB 3PHSA 1NAMH 2ESVA 3OXRB 5T5NG 5IB4B 1KC5H 3O6LH 5E5MB 1OTTD 3P3YA 3MRFB 5CEZL 3OSKA 4LARH 2HWZH 1HCFX 2HVKB 1D3CA 5B21A 3TNMB 3PABA 4QHMB 4Z95L 1QRNA 3V5KA 4FABH 3QUXA 3MRDB 3BRGC 1CXIA 1BVZA 5MEQA 1D5XB 3WO4B 1JHKH 3NIGE 4XP9L 2FEEL 1EXUA 1J8KA 2MCPH 3ARVA 1QSVA 1WZ1H 5BVPL 1E0OB 4UDUA 3U7AA 3RWEB 1YEHL 3GO1H 3VG0H 5IQ7L 1XGTB 2OSLA 3MMEB 2WWKT 1DLHA 3M1BA 4GS7B 5IMLA 3SDYL 1T6VN 4WU5A 1CT8B 2JCCF 3U0TA 1EHXA 1B6UA 4X6CA 3CLEL 4F9LC 3MBXL 2C3WA 3IAGC 1Z0NA 1RUPL 3B83A 4P2RD 2F5AH 4LVHB 5CLTA 4LCIL 2Q6WB 1MFBL 5C86A 3VD9A 5GS0C 3T09A 3BD3A 2H9GB 1G9MH 4U1IB 2W9EL 1F11B 3QDGE 4UI2A 4HW6A 3K8MA 1I8MB 1NEUA 3LEXA 1PZ5B 1B0RA 2EYSB 5DEFB 1DLFH 5MEPA 4HC1H 3MACH 4YHLH 5LKNA 1MCDA 3KPPB 1IGJA 1A1MA 3AREB 4NZUH 3WUWA 3C09B 3ZDXF 1S7WA 1OP3K 5KAQF 3PHOA 3D2UD 3VD5A 4F8TA 1MFAH 1T7YA 5F1IB 1U3YA 5HHNA 4PV8B 3CX2A 4LEXL 5GGSA 4Z7WA 3NAAL 3OAUH 3DARA 3LD8C 3NFPB 1IKFL 2AJUL 3U0WL 2VDMH 2VQTA 1UQSA 1T1YB 1MIMH 2R0WL 4UIKH 3U9UB 3DURB 1I3UA 1TVBB 4PIRF 5FV2A 2HYMA 3MXVH 3VGAC 2VITB 5E4EC 4U2ZA 1FFRA 1FGVH 1R5WB 5L7XL 3NPZB 5EOQH 3HI5H 1KYOK 4QXUL 5AUMB 2BVUA 1DVFD 1KIQB 4E42A 4ZS6D 4GAJL 3OKLA 5E08L 4ORGA 3U30C 3ULUE 2V2TB 4LSRL 3CH1A 4ODUB 25C8L 4LQ1A 4OD1L 2OR9L 5H37G 1N2RA 5IMKB 3SKNA 1HXYA 4QY8A 3B5GA 1XR9B 4KGJA 1YPZA 4UILH 3O4LE 3RZCC 2VLLA 5CLWA 4OD2B 1MPAL 1TQBB 3CPLA 4B53A 2BVOA 1UFUA 2V7NA 4HS8L 4HH9B 2VH5L 4P99A 3MRNA 4ONGL 1AGDB 4JDZA 5I8CB 4O58L 1DE4A 4X7SH 1IM9B 2VZ3A 5EBLB 4RGND 2A38A 1V5JA 1OCWL 3NIDF 4JRYE 1AFVL 3PQYE 4JO3H 5FA4B 4ZUTA 1FCCA 3OB0H 4IOIB 1LO4H 4NKIL 3S37H 1HHKB 3VFNA 4LLVA 3CC5A 5DJXB 1ND0A 4KTEH 4PJ7F 4X80H 3HRZB 1W0VB 3HNVL 3L3HB 3WSQL 5HGGS 3GM8A 5DRZB 4XTRD 2GEEA 2VZUA 3O4OC 4PLNC 3PDDA 3RDTB 3GIZL 4ZOBA 3RKDD 4ZFFA 3GSQA 3QH3A 4DQOH 2VXUH 5GRVL 2NW3B 1GGBH 4PRIB 5IBTH 1JWSA 4F7EA 5D93B 1JYVA 5CSZA 1H0DA 3H7BA 4AEEA 1GGCL 3BO8A 5I0DA 3MV11 4QKXB 3RUGA 5F89B 4OCRH 3WE6B 4HLZH 1CBVH 1KXVC 4PP1C 4EUPG 3TVMA 5TGBB 1CICC 2MMXA 1YEIH 4WW2F 5B38B 5F72S 1BX2A 4KVNH 4OCSH 3RWIA 3BP5A 5K33A 3CSPA 3VXME 1D9KD 2D31B 4H1LA 4NSKA 4P49A 5SWZB 1NBZB 2XWBA 1SYSB 3LH2H 1QSEE 1QOKA 3AY4C 4DZ8A 1BJ1J 3IKCB 4U1LA 1O7VA 1E27B 1GHFL 2ATKA 4P3CL 5I1DB 1NBYB 4HG4K 5JW3L 4WI5A 3P4MA 5HHOD 4CL7A 4JKMA 4TVPE 5GZND 3T0WA 3DRTB 5LGHH 1E6OL 3SDCD 1A6AB 4NWTH 5FYJU 2V17H 1D9KA 5A2IH 1FVEB 2NY0C 5HHVH 4EDXA 1A4JA 1NGYA 4HS3B 1QBBA 1FNEA 4XCYA 4DKFH 1CTOA 1CGVA 1LVEA 4DUWA 1MRCL 4LRNL 4KMLB 2Z0BA 4AENB 4DGVL 5MHSE 1SY6L 4U7SA 2AQ3A 2DQUH 4RIRB 3L3DB 1G7JA 1ZGLA 1U92B 3ULVD 4FQXB 4P2QB 3BKMH 1HQ4A 3P4NA 4MA8H 2H2PC 3SDCA 3OBAA 1LEIB 3EDFA 1GPOL 1RZIA 4LHUD 2CKBL 1BWWA 4L9LA 3ZYOA 4LIQL 3GSUA 3ZSTA 1RIVL 3SGEH 4AG4L 1PLGL 4O2CA 2ADJA 2BSRA 4D9QD 1LO3L 4JGJA 4QRSB 3K4AA 4HV8B 5DHYB 2QSQA 3VG9B 2DQGH 2H8PA 2FJHB 5MENE 1F4YH 4A6YL 4LHUA 5IVXB 2CUMA 4FFVC 4Y16B 3R0NA 2XYCA 3OKMB 4KKBD 5HGHB 3DVNA 4WTXA 5J57B 4APQD 1DBMH 2OZ4L 4V2BA 4IMKC 1A9BB 2Z8VC 5DFVD 4U1KB 5DYOA 2PTTA 3BWAB 1JF6A 2GAZA 4G7VH 1W0WB 4Z18A 3HHRB 2R23B 2V6HA 3FN0H 3HS0A 4RNRA 5KVMC 4HWBH 4FQ1H 4JREC 2Q8AH 4APQA 4HZLB 1C16A 1KTDB 3AUVA 2R0KH 4HIHB 4TUJA 5CMAB 4YIQB 5DSCA 3T65A 4OZFA 4PJFA 3VFSA 5I1GH 2IPTH 1WAAF 1B90A 4O2EA 4EOWH 4LSQH 3OPZH 5J6HB 2OTWA 5IVXE 1FYHB 4IHOB 4ONFH 1IMHC 1U58A 1FNSH 4L29B 1HHHB 5CS7A 1MLBA 5HI5C 1NFDB 3J7HA 4NO0D 1TETH 1IQDB 1YECL 4U33A 1ZEAL 4DGYL 4JFYA 1X7QA 4G9FD 1MNUH 2WBJB 4RWYH 3EYOB 3IYLW 2PN5A 3OJMB 3I6GB 5ITBH 1IC4L 2NR6C 3P77B 5DD5L 1INQB 1B4RA 4M1CC 4OCYL 3HPLB 5K9KA 1R3JB 3AS3A 4J6RL 1NKRA 4OZGE 3GGWB 4G9FA 4BH7B 3FFDA 4I2XE 3H0TA 5ANMB 3E8UH 4HJGB 3QHFL 3BDYH 3MV7A 2DTSA 4HH8A 2VN4A 3TEUA 5BV7H 3KXFD 1PZUB 2YD4A 5FB8A 5D5MF 1RSFA 4AEHH 2BRRH 3FRPG 4RBPK 2APXA 2FGWH 3C6LD 3REVB 3P73B 5I1HH 3JV4A 3BZEA 3UTOA 2R8SL 4URTB 3BISA 1WBYB 2WP3O 2UVEA 1ZSDB 3QR2A 3M07A 1C08B 2Y5EA 1FAIL 4ZO6A 2MJWA 1EH9A 3ES6B 3RPKA 3C6LA 4N0RA 4AK1A 1NL0L 2AXGA 4M43H 4ELMB 1JTTA 1AGBB 3SDAC 2FECI 5IGXH 4LCWD 1S7RA 3MUGB 5EUOB 4F8QA 3BUYB 1N3NA 1P4LB 3B9VA 3DV6A 1DN0A 2AS5M 3VCLA 3LDBC 4NQVA 3G6JB 4MNQB 4O5LL 1JZ2A 2EDNA 3BKCH 2IF7A 2VXQH 3BP7A 3NZHH 4QXGH 2J6EL 2VUYA 3BP6A 4JZNA 1MJ7L 5IHZB 1QEWA 2ZOLB 4GSDL 4LCWA 2C26A 4XI5D 1XF2B 2VR4A 2X9XA 1RJLB 1JGUL 1BVKA 2O5ZL 3CH8A 3MREA 4NC1C 5FM5M 3WMSA 3B2VL 4HLZG 2BOCA 3OAZH 3WIHL 5I75B 3GMNB 5JHDA 2XRAH 2WINA 2Y4SA 4LGRB 3I02B 1YQVH 3NIFF 4K9EC 4ELME 3RTQA 3C6SA 1AQDA 5EUOE 5D6DC 4M5YH 5T33L 2MNUA 5ESAA 4YEFA 1KJ3L 4YGVA 4DVRL 1TTGA 3CDCA 1QQDB 3L3GB 4EN3C 1YDPA 4H0IA 2YR3A 4R8WL 4HK0B 3MNWA 1GZQB 2AJYL 1IKNA 1CLYL 4Y0GA 4C83B 2G5RA 3BOVA 2WM0A 2A6KB 2MSPA 3VRLE 3DO3A 1H3WM 5DQJB 1EEYA 3KLSA 4YDVB 1G7MB 1LDPH 3E6HB 1YNKH 4OGZA 3D1MC 2ICWA 4NZRH 5J06A 1KJ2L 3UBXA 5BZDB 3C5ZA 2XA8L 4DW2L 1F4HA 3B4NA 1Y18A 4FQQA 4HGWB 1CZ8L 5I1CL 1FAKT 4WNQB 2L4OA 3RX7A 2X05A 3KPRD 3PHQA 4YDJA 4R96A 2ZCKH 4NNPH 4ZO7A 3BYTA 3MO1B 5E94A 1DANT 2BC4B 1S78C 4PYHA 3DX9A 3MJ9H 5DI8B 5D71H 4RGMB 4DOHB 4G5ZL 2NMSA 3MV01 4YPGA 1HDMB 3A6CL 3SY0B 4LCCA 3WNOA 4UAOB 3KPRA 4OZHF 2J88H 4IMLA 2MPAH 5GS0L 2IQ9L 2PXYB 3I50L 3O41A 5F6IB 2O61A 4JFFE 3TN0C 5J11B 4JPWL 4XVJL 4OZIA 1E6JL 2XN9B 5JOEA 2J4WH 5DUML 4XX1G 3HG1D 4PY7A 2VO5A 3MRRA 4P5KB 1UM5H 3KS0J 1RK1B 3F7YA 5E8OA 1NJ9A 2XWTA 1GOGA 4Y19B 5LQBH 2QL1A 4YPJA 1IGFL 4ODWB 2C4FU 2DJUA 4GUPB 1KENH 3BZ4B 4MSWA 1A7OL 3EJZD 4JDVA 4Y88A 5D7LD 3SCMD 4MAYB 3WDJA 1VPOL 3KPOB 1NQBA 1ZWIB 5D6CA 2ZCHL 1R0AL 2OL3A 1N0LA 2WANA 3VXRD 4PJ5B 3RVXD 1S7UB 1WIUA 2QSTA 5D1QD 4XC1L 1F6AB 2XN9E 1DN2A 4YE4H 1IAKB 4KJQD 3W82A 4BELD 1G7IB 1UWEH 2QQKL 4PJAE 5D7LA 3S4SB 2NYYD 1BREA 4YFLI 4OM0H 3T3PF 3L3OA 1CXEA 3T0BA 1EJOH 5DVKA 5DMKA 1YZZA 3QO0A 4JG0H 3V4UH 1NAMB 3P0VH 4ELKB 1R3KA 5IWLA 5D1QA 1HE7A 5C0RL 1NGQL 3RWJB 1MFDH 4DKDC 1EHAA 5TH2B 3IDXL 5F88A 3MX0A 3S3SA 3T2NL 1KFAH 5ENWA 1KN2H 3EYQC 1VA9A 1S8DA 4UMGA 5ISZE 4X9BA 1EVTC 5E2UH 2BSTB 2OS7A 1Z9LA 4PJ5E 1DQLL 3VFRA 5JOFB 4RFOH 1MCPH 2M26A 2EE9A 1T22A 3JV6A 3SE3C 4X6DA 4Z6AT 4OLZL 2CGRL 2YSSA 3LS4H 1BOGA 4N0UE 3MPCA 1LO2L 1QSZA 1T66D 4L4VE 1MJ8H 4NRXA 1MI5B 3GHEL 5ICZB 3PGCA 4WDIB 3PDOB 5GRXG 2YMXH 3OR7B 1MFEH 4HSQA 2ORBH 2VZSA 4PJHF 3SJVD 4PJDE 2P48B 1AQKH 1Q9KA 3DRQA 4C54A 1OAQL 2IH3A 3OZ9H 1DDHB 3U4EA 5EOTB 2CMRL 3TP4A 5DDHA 1U93A 3FT3A 2P5WB 1FYTE 2BXZA 3SJVA 1IAOB 3LZFL 3W2DL 1UXWA 4Z7OE 1T7ZA 5ESQA 2BVYA 3P9WB 3C87A 2P8MA 1UKSA 5ICYB 1W2KT 3D85B 4PG2A 4Y5YA 1MI5E 1RHHB 3CCHA 2APVA 1A6TA 2FIKA 3ZKMC 5T3ZH 4HGMA 3QJFB 5D7JC 4OB5L 5J9PA 1QPXA 4PRHD 3DI2B 4V1DB 3W11D 3JV5A 2X4SB 3LN4A 4J3SA 5DVLA 2O5XH 4JKPH 2XTJB 3EJYD 5I1LB 4PGBB 2V5RA 1M71A 4AEIH 2X4TA 4H26A 5I73C 1NLBL 3MLVH 2JKXA 4PRHA 5J1AB 1JWUB 4PJCA 2ZCLH 5GIRB 2YD7A 1ZVHA 1P7QB 3MGTA 2GJJA 4DN4H 3FO1A 5IVZB 1YEFL 3TO2A 2A77H 3Q6FB 1XIWD 4MXVF 4N5UA 1DR9A 2EH7L 2IGFH 3WIIH 2HN7A 1SEQH 3TCXA 1MCOL 4OJFH 4HMCA 4F7CB 1BM3L 3GSOB 5IW6B 1JPGB 2B8OT 4X7CC 5C3LD 1UB6A 5GRJL 1HWGB 5FGBC 4GXUN 1JZ7A 2FECL 2X4RA 5HI4C 1FIGL 4K3DH 4XVTL 5B39A 3V0WH 4HUUA 1XIWA 4L8CA 1Q9LB 2BY0A 4NN5C 1CN4A 3QPXH 1D5ZB 4KV5E 4PLJC 2Q86B 3V0AC 3VXOB 4CU6A 1JPSL 4ODSH 2ZUYA 3OWEA 1ETZB 4NPYB 1DZBA 1T1XA 1KCLA 2EDLA 5E6IB 3SGDI 3CFJA 4NHCL 4MQ7A 4JM2B 3EO1B 1RZKH 1N59B 1XGYH 5F3HB 1UACH 4RWHA 2QQNH 1N5AB 1TENA 4KHXL 4OZ4A 3PF2A 3GMLA 2DTML 5KSUA 1A6ZA 3B6SB 4ODVL 1L7TH 4JR9L 4YFEA 2EEAA 1VKXA 5I17B 2A6JB 4Z9KB 2DICA 2CUIA 2EIZB 4N1CA 4ODTH 3TNNA 5DR5H 4UQ3A 3T77A 1KTLA 1OQXA 1FH5H 2AK1L 2R0ZH 5DT1H 3THMH 1M4KA 1JFQH 3FFCE 3LVEA 3O3BA 4IOFC 2YPKB 3L3KA 5JW4R 3LKQA 5KSBE 4XNUH 2AQ1A 5A16A 3IRZA 4LKCB 4KZEH 2YZ8A 3MRQB 4LNRB 5F44A 3PXHA 1UKTA 3KDMB 2WQ8A 3UPRB 4O51B 1S7XB 3VXUD 1MHPL 5DS8A 3WLBB 3B3IA 1FP5A 2IH1B 4OV5A 5I1IL 3EAKA 5F1NB 1VGEL 4QRTB 2X4QA 4P46D 5BO1L 4Z7VB 4Z0XB 3VWJA 3GBML 4Z95H 5GS1C 1FL6B 4R7NB 4QRUA 3KYKL 2P43B 1YEEH 3BH8A 2V2XA 3VXUA 4CW1B 3HZVB 4Y8DC 1NDMB 4CVZB 1A2YB 1OVZA 3JTTA 4G7YL 4P46A 4X6EA 2NLJB 4HPYL 3BHBB 1HKFA 5BVPH 3BH9A 4QRQA 3EYSH 3UCRA 3P9MA 1FVCB 1YEHH 1JVKA 2EDBA 3H3KA 4Y89A 1UM6L 2I9TA 4TQEL 5IKCA 5IQ7H 1S9VA 2GSGB 1T0PB 3BQUC 4XBGB 4HWEL 3BIBX 4S2SA 4MWFA 2KPNA 1KXQE 4Z7VE 3TJHD 4M7LH 4PJIF 5IF0B 2AI0L 4WFHD 3I75A 3VXTB 2VKXA 3L5WB 1PVHA 3CLEH 4MXWL 3MBXH 3GRWA 1BD2A 1RUPH 1NUGA 3ECBA 1MFBH 1JGDB 5CKGA 2VQ1B 1K8IA 5J12B 4W70A 1NC4A 3FT2B 1GGUA 4LEOA 2PKDA 2JK5B 2PW1B 4O00A 4NNXA 1E28B 4PRPD 3MV9A 4H25B 4GRLB 3NACL 1I7ZA 1ZHBA 3G9VA 4LGSB 1DBJL 3CUPA 1NH6A 4GG8B 3QWOA 5A3ID 3KJ4C 3VJ6B 1TZHA 3TBWA 3ARBC 3ET9F 4JB9L 4QOKE 5D1XC 2QKIB 1K4DB 4JFDD 4LEXH 1UCTA 4PRPA 3V5DB 3DX6B 5JIKA 5K59F 3X12B 1IKFH 2W1NA 4N8PA 7FABL 1JI2A 3QXAA 4K9EL 3U0WH 4ISVB 4OF6A 3ARGB 3TFKD 1HK6A 5CJOH 4U7MA 3V6FB 2R0WH 1EZVY 4PJGF 1OM3L 3UYPA 5HJ3B 3QFJB 4BSJA 5C0NC 4JFDA 2ZNXA 3QQNA 1UB5A 5L7XH 1GC1H 1F8TL 4EIZC 5JOPD 4P3DA 4QXUH 3DO7A 4U3HA 5EPMA 3UXFA 1ZS8A 4GAJH 3OG6B 4EJ1C 4XX1E 4Z7NF 4X7EC 2AK4B 3S96B 2IAMD 1EMTL 1H15A 1WT5A 3W81A 4FXKB 1VCAA 3OKYA 4OD1H 2X4OA 3TPUB 2Y25A 5IIEB 2FYYB 2OXGA 3RGHA 2VDRL 1TCRA 3MRPA 4M8QB 4KVCL 3X13B 4U4BA 2F54D 3FN3A 3EIFA 2B20A 2IAMA 3QRGL 4GKNB 1OW0C 2PYFA 2P8PB 3QFJE 1MPAH 4JKWA 5D2LF 1OAKL 5CJBA 3N9GL 5D72H 4HS8H 1A7RL 2LQRA 1MAML 3MRJA 1PY4A 4PJ9C 5BV7B 1MEXL 3PJSB 3QQ9D 3C9NA 1JRHL 5JLZB 4Y1AD 1ED3A 2C3GA 4O4YH 5EU6E 1WQVT 1T03L 5FYKD 1OCWH 2EH8L 1BP3B 1AFVH 3BPOB 4XNXL 1INDL 1N6VA 3BSZL 3KPSB 4OGAD 1AR1C 4OI7A 1FSKC 5E1HB 3WSQH 3SGJC 4Y1AA 3B43A 4D94A 4ZD3H 2X4UA 4ZUUB 1HCVA 5C0BD 1V8HA 2IBZX 5HHQA 3GIZH 4WTWA 4QRPD 4R4NC 3PWNB 3PUCA 3MLXL 3DIFB 4JFEB 4JVWA 5E24E 3FQWA 1HXMB 4N0CD 2HH0L 1J12A 1HI6B 1JCKA 1GGCH 4WFED 1CDBA 4XTRC 3C08L 3LRSB 1BECA 4NQXB 3V2AR 1XR8A 3OKOA 4NZTH 5C0BA 4MJ6B 3N85L 2DOCA 1AIFB 4FQHB 4HJ0D 3TVMC 1Z9MA 2GJZA 2NXYB 4J23A 2D0GA 1MWAL 1FL3A 2VXSH 2P7TA 1V7NL 1G6RL 3O6KL 5C6TH 3D18B 2FR4B 2FEDD 2A1WL 4GKSA 3GSVB 1G0YR 5EC1A 1YEGL 1RK0A 1GHFH 4P3CH 5B3JE 4JANA 5ICXB 3A6BH 3GI9L 5IBLC 4D0BB 1A1OA 2WBKA 4X6FB 3JUZA 5IMOB 3IDYB 5IUSA 4NJ9L 3OMZA 5INDB 1RIUH 3G5VA 3B9KB 3DVGB 1MRCH 3G5YB 5E1AB 5C9JB 5IEHA 2X4NB 2HKFH 3TBSA 2YA2A 4DGVH 1SY6H 3GJFA 5M95B 4F80A 4KDWA 4E5XB 4ZXBD 1RVFL 3Q2CA 4PTTB 1GPOH 4KU1A 4LIQH 1XEDA 2NTFA 1Z5LA 1PLGH 4OZHB 1K5NA 1WBXB 4OLUL 2Z4QA 4PRAB 4JY5L 1LO3H 5AEAA 1CDIA 1VSCA 3K46A 1D7FA 4U6VL 2VB5A 3TM6A 4CAGA 3KG5A 5EO0A 2ZOKB 4Z7WF 4QXTB 2YZ1A 5MEOA 3DROA 4OFYD 2X1OA 4IM8A 1J0HA 3V6OA 1ZHKB 5DMGD 2Z31D 4ODBD 1X3DA 5IR1A 5D2NE 1W8NA 3UTSD 4P2OB 5L2JA 4N1EA 2ZG1A 3RKPA 2RHEA 4L8SA 2FJGA 5FDWB 4KKLD 1RAMA 2WNGA 4HBCL 5T1MB 2WWKO 4XRCA 3JWDC 5IW1B 1H3TA 4OFYA 1G1YA 2XQBL 3FQRB 3QIBC 3PNWA 2Z31A 3MBEB 2PW2A 1EK3A 1U8MA 3UTTE 3UTSA 4LRIC 4QRRB 5C0FB 2LAGB 3NCJL 5DFVC 1J11A 1XCQB 3EYFA 3D0LB 4PJEE 3DUUA 5FYJL 1A6VL 3C5SA 3T0EC 1A8JH 1LQSR 2R56H 2NXZB 5IB1A 4XXDA 5I76B 2VWEE 4Q6IA 3U6RA 1RURH 3OKNA 1ZEAH 4KUZL 1ZLVH 4TTDD 1RY7B 1QNZH 2XZQL 3L5IA 3LPWA 4N9OB 2IFFL 4GBXD 1IC4H 1HNFA 1KLFA 3OAYH 4X5WA 5HVWA 1AP2A 4HLJA 5CHNB 4OCYH 4Z7UB 5F96L 2GUOB 4JPIA 4XHJC 5B22A 2EZ0D 4MVBD 5EU5A 3IDGA 3G04B 2NY4B 5D4QA 1YMHB 1U3ZA 1UZ6E 1A6PA 4GBXA 4U1MB 1CL7I 3SBWC 2HFEB 2VDOL 1ORSA 1F3JA 1K2DB 5D9SA 4JKKA 4R4BA 5CINH 2AP2A 3QG7H 4ONHB 1HHJA 2BDNL 3ARXA 4S0TD 1HILA 4M6AA 3X17A 3IDMB 4FP8L 4KK5D 1J8HD 3R1GL 4JQVC 4PJHB 3W9DA 1SVCP 5ID1B 2R8SH 1KLGB 2XZAL 3QA3A 1RMFL 2HA1A 3X3GL 1N5YL 3MROB 1ADQL 3RUGF 4ZNEA 4Z7UE 4JZOA 5BQ7B 1FAIH 2OTUA 3FQUB 1OGAB 4NQUA 2A73B 5JNYB 3O2VL 5E8DL 3LCYA 1P1ZA 1NL0H 3BZFA 3K74B 1N0XL 4J4PD 1J8HA 2F8OA 2XKSA 1KIRB 3FQTB 1R5VB 3OXRA 1G9NH 3S5LG 5IB4A 4YQXL 5E5MA 1NFKA 3MRFA 1GH7A 1GGTA 4KK9D 1F90H 2DIBA 2E7BA 3TNMA 5HSFA 3PL6C 4G80B 4O5LH 4QHMA 1Q94B 3ME0A 4NOFA 3C8HA 2X44D 3BRDA 3MRDA 1X5XA 2APTA 4GSDH 3NVQA 2UY7A 1FFOB 1BFSA 4MJIB 4TSBL 1D5XA 4LBEB 4LLDB 1JGUH 2O5ZH 4X98B 3ZTJH 1YNTB 2GKIA 4YZFF 4IRZL 4POZC 2FH8A 5MI0B 3WIHH 4H5SB 5C09B 3FB8B 1JZ8A 4Z7QF 1T83A 1YN7B 3RTQC 3RWEA 1XGTA 3MMEA 1KJ3H 4DVRH 1J0IA 1CT8A 1U8IB 2P45B 4R8WH 3VA6A 2AJYH 3ULVF 1IKNC 3INUH 1GL4B 4MJIE 1CLYH 1UJ3A 2Q6WA 4L1DA 2A0LC 4BUGA 4U1IA 3ARED 3WKML 1F11A 4D9LH 5TPWL 2OK0L 1I8MA 1KPUB 3ETBF 1PZ5A 2EYSA 3RIAK 1KJ2H 3QPQD 4GH7B 4KZDH 5I9QB 3C5ZC 4DW2H 4MA3B 5DURB 4XCCH 4GG6E 1CZ8H 5I1CH 3RWHB 4OQTA 4E0RB 4I4WB 3KPPA 2W07A 5GRUL 4POUB 3MRGB 4PYGA 2ZSWB 1KTKE 2D7PA 3SDXE 3QIWC 2N4IA 4L3EB 5F1IA 1I8KB 3VD3A 1EGJA 4HEPG 4PV8A 1R3LB 1DBBL 3BKJL 4PJFF 5GS0H 4WTZG 4XVSL 3NFPA 2IQ9H 4U05A 1BJMA 3I50H 2EEDA 4HULB 3M8OL 4XNYH 1T1YA 3H3BC 3U9UA 4XVJH 3DURA 2CUHA 2WAHA 3RRQA 1TVBA 4YDIL 1Z9SA 2VITA 1UADC 1G84A 2QJDA 3OKDB 1JHTB 1R5WA 5GHWL 3IJSB 5CBAB 1U8JB 4CN1A 2NZ9C 5AUMA 1R3HB 1KIQA 1IGFH 2IG2L 2V2TA 4K3JH 4ODUA 3QUZB 1IGCL 3QWRD 3X3FL 2GT9B 5IMKA 2IBBA 2ZCHH 3DMMC 1R0AH 4JGMA 4YC2C 2R1WB 4KQ3L 1XR9A 1IM9D 1MLCB 5LG1A 3ARFB 1SQ2N 4O02L 1YYLL 3QIUB 2Y7QB 4OD2A 2QQKH 5HGAB 3QWRA 1P9MC 4HH9A 3GMPB 5AWNL 1BIHA 5BXFB 5I8CA 5HDBE 3VXMD 5LWYH 5GJTL 1IM9A 4YK4C 5IWLC 5EBLA 2FLRT 3RDTD 3C2AL 4GMSH 1NGQH 1T2QH 5FA4A 1TTUA 2DI9A 2XIDA 4IOIA 3P2TA 1HHKA 3T2NH 2ENYA 3HE6C 5DJXA 4TVPD 4PRID 5FF6B 3HRZA 4GT7A 4X4ZA 5C0AB 1W0VA 4CVWA 1KELL 3L3HA 1DQLH 3MLSL 5DRZA 5TF1L 2N7BA 2YS4A 1IL1B 1A7NL 3RDTA 2DQTL 4OLZH 2JJWA 2X1PA 2CGRH 4RA3A 1DQQB 5ADPL 5ACZB 5MHSD 2R69L 3WFHA 4KDTC 3RGVB 2NW3A 3QI9C 4M61B 4LKXB 1X4YA 4PRIA 4Y5VB 5TQ0L 5IM7B 4MA1B 4GW4B 1XAUA 1ACYH 1A7QL 3ALPA 4JFZH 5F89A 5SWZD 1WTLA 3RL2B 2R0LL 3WE6A 2GTZB 5CEZE 3GB7B 3LEYL 2HTLC 3NABL 2ICWI 4J8RB 2KQNA 4UINL 3NCYP 5TGBA 5C0EB 4YBQD 1C7TA 1OAQH 3FCTB 3MJGX 5B38A 1IQWH 4G8FB 3OF6D 4WI2A 3QHTC 5C07E 3UZQA 5BS0B 3I9GL 4FZEL 2D31A 3P30L 2EDQA 2CMRH 3EOBB 1MCFA 5SWZA 1NBZA 3IKCA 4RAUB 1E27A 4S1SH 1BZ7B 5I1DA 4R3SB 3W2DH 1NBYA 3WS6C 5HVHC 2FRGP 2COQA 3S98A 4FQXD 4P2QD 3OF6A 4EXKA 3DRTA 4NKQB 1I9EA 1A6AA 1FVEA 2W91A 2XV6B 5TJWK 4LMQI 3UPAA 4HS3A 2VLMD 4PGJA 4AENA 1FO0H 4CDGC 1WEJL 5JXEA 4RIRA 4MQXD 3L3DA 3PP4H 1F6LL 3VXSB 1U92A 4X99B 4FQXA 3EOTL 4P2QA 4HAGA 1FC1A 4MB5A 1LK3H 1LEIA 2VLKE 1IE5A 2BY3A 1VEMA 1CL7L 4Y16D 1NLBH 2CK2A 1AJ7L 5JHLL 2RCSH 4IJ3B 1JTOA 4R9HA 4FTVB 3MUY1 2HG5B 2HT3D 5C0CB 4F15C 4QRSA 2E3VA 1GJIA 1TMCB 4HV8A 5DHYA 4U6HA 3QG6B 4DZBB 2I26N 2VZ1A 4OCNC 1YEFH 3VU2A 4U1JB 5IVXA 2EH7H 4Y16A 3OKMA 4WO4C 5HGHA 3IGAB 5DMYA 3TYGH 4OZIF 1NGWB 1EO5A 3VXSE 4HIEB 5FM5O 1A9BA 1N8ZB 5GRJH 32C2B 4U1KA 1JPFB 1FIGH 3BWAA 3SO3C 4XVTH 5KVGH 4ZS7L 2V5TA 1XIWC 1W0WA 5CKAA 5EBMB 4QTIL 5FK9B 4ACPA 2R23A 5I74C 3GHBL 4EBQL 1JPSH 4KJWC 5C0CE 3SHSA 5GGTA 1KTDA 3GSNL 3ULVL 4HIHA 4YIQA 1TZGL 5CMAA 3QCVH 2WBJD 5FAAA 4NHCH 2E7LA 5J6HA 4WHYH 4IHOA 4PGDB 3MRMB 2RBLA 1HHHA 3GUTB 4WEBL 3ZKSD 2YD2A 4X4XB 4KHXH 1NFDA 4YAQB 3RWGB 1IQDA 2DTMH 2JIXB 1ZLUK 3TA3C 4R2GB 4LNVA 3R4DA 4ODVH 4JR9H 3OHXB 2WBJA 4M6ML 3JVGC 3EYOA 1RUML 3JWDL 3I6GA 5DA0B 4AM0B 1ITBB 3RVVC 1FZMB 3P77A 1QLFB 5GGQH 3S5LB 4R0LB 4WRLA 1CFSB 3HPLA 3TYFB 1R3JA 4OKVB 4UU9A 4EI5B 2AK1H 4LDOB 1Q9OB 3GGWA 4RRPG 4BH7A 5KVFL 4G3YL 3T4YB 4P4KA 5CWSB 5ANMA 4YXLL 4HJGA 4L4JA 3G9AB 3WN5C 2EC9T 3V79C 4XGZB 3S7GA 1FN4B 5FO8B 5GGRY 4DAGH 2VZTA 4HUNB 5E2TL 4X6DF 1MHPH 3VXNB 5FA3B 2E8YA 2DQCL 3K8KA 5I1IH 1HOCA 3REVA 3P73A 4HT1H 4K71B 3HMXA 1EEUA 4LCYB 4KTYA 2VAJA 1H5BC 3PDGA 1WBYA 3GBMH 3VWJC 1J1XH 5BRZE 1ZSDA 5J6GA 1C08A 4ZQKA 1VESA 4MNQD 4Z8FL 2HT2D 3WBDA 1MUJB 3ES6A 3OGCA 4ELMA 1AGBA 4G7YH 2DN7A 3VXPB 4I5BB 5EUOA 3MUGA 4HPYH 3V9FA 3BUYA 5AZ2L 4P2RB 1FZJB 1P4LA 4FQIL 2VLRB 4G6MH 3G6JA 4MNQA 1UM6H 3FZUD 1ZT7B 4MD0B 4OBRA 5CD5D 3AMKA 3DJ9A 2M8XA 1T0NB 4HWEH 5IHZA 5E99L 2ZOLA 2EIEA 1M7DB 4PJBB 5DLML 5I71B 1XF2A 5KS9B 2AI0H 4XC3L 1RJLA 3V4VL 1JF1B 4XPFH 4AY0A 1HN1A 3NPSC 4MXWH 4RGOL 3GMNA 4FXGB 2QLVB 2DBLL 4X9FA 3KYMB 3D2UB 3I02A 3AAZB 1UYWL 1SM3L 3IDJB 4OFIA 2AJSL 2B4CC 1KIUA 4A2MA 2LAAA 4YHIB 1QPPA 1OPGL 3WHXB 4HEME 1QQDA 4L5FH 2PR4H 4RA0C 3GK8L 4HUVB 1NCBL 1KB5L 2ERJB 3L3GA 3CU7A 5HTSA 2YD3A 5IBUB 3UDWA 3SKJL 5A1AA 2HTKD 4NBZB 4PJCF 1K9TA 4HK0A 1DBJH 1GZQA 2H3NA 4L8BB 4C83A 1DANU 3TPKA 4P2CG 2A6KA 1LEGB 5DK0B 4NO3B 4R90H 5F3BB 4YDVA 1MIEH 1DVFB 1G7MA 3E6HA 3O3EB 5IK3B 4DJMA 1BQLL 4LIQE 5D7SL 5BZDA 5DHVH 5T1DL 4K9EH 4HGWA 5DVMA 4WNQA 3Q5OA 3SKOB 2CO7B 2CXGA 4NZDA 3WJJA 3VGEA 5FUCC 2AABL 4N5ED 2ZSVB 4Y4HB 1DQTA 3MO1A 2LU4A 5C6PB 1RZ7L 1QBMH 1G7LB 3IU3B 1M7XA 2BC4A 1KEML 2HLFC 3L7FA 1F8TH 1MVUA 4ORZC 2XN9D 5DI8A 1F58L 4QXWA 1DQML 3SY0A 5HD8D 5HYJE 2EICA 3VGGA 4FQ2L 4NUGL 1BFVL 2PXYA 1EMTH 2D9QB 3SQOH 3KPTA 4K8RD 4Y19D 3RU8L 3H6JA 1G0XA 2VDQH 3K4ZA 1L9MA 2RFXB 1CI5A 2H32H 2QR0B 2JCCE 4P4RB 2VDRH 4MAYD 4G8GB 4XPAL 2EO9A 4P5KA 1H8OA 4OV6F 4XNZB 1RK1A 4LLWB 3QRGH 1A64A 4I77L 4PJ5D 4Y19A 3OJDB 3RL1B 4ODWA 3N9GH 2GQHA 2YXMA 1A7RH 4GUPA 4P2YA 3BZ4A 1MEXH 2CXKA 4UNVA 1PJ9A 3SOBL 5DK2B 3QUYB 1MCIA 4JRXE 5IT2L 5JA8B 4MAYA 1CIUA 1N7ML 3KPOA 4KK6D 1KEGL 1ZWIA 4ZUSB 2YEZB 3SKMB 2HRLA 3GMRB 4XHQA 1INDH 1UXSB 2BVEA 2ILLA 4PJ5A 4WHYG 1X5HA 1FBIL 2DYPD 1F6AA 3JUYA 1YYML 3IJYB 4JFPB 3QQ9C 1G7IA 4X6BB 3S4SA 4G8GE 2EXWD 5JIPA 3CVHL 4FFWC 1N6QH 2HRPL 3QXDB 1EBPA 1CQKA 1QTYT 3GSRB 3KNBB 4UDTB 1P6FA 3MLXH 5HPMA 3FMGL 3BWUC 3CZFB 4ELKA 5IESH 4K7PL 2HH0H 2FH6A 3LMJL 1TNNA 3Q1SH 5I1JH 3RWJA 4DGIL 1SJXA 5TH2A 4LQFL 4EVNB 1A0QL 3VE0B 3OX8B 1OP5K 3RY6A 4WFGD 3C08H 2CO6B 3O45B 5HHOB 3N85H 4MS8C 5FFLA 3OQ3B 3ZHKA 1MI5D 2BSTA 2KDGA 5JOFA 4OSUL 3RVUD 1GGYA 4IBLT 1AXIB 1X5KA 2BMKB 3QXWA 4Y2DC 4WWKB 3GJFK 3AROA 1G6RH 3MA7B 3O6KH 3TCLB 1YJDC 4I3SH 4Y2OA 2J8UF 1S7TB 1S9WA 3T3ME 4M7LT 1YEGH 4OF8A 5EC2B 4P3WA 2UUDK 12E8L 1MI5A 4G8EB 5ICZA 1VFUA 4WDIA 3PDOA 4YHML 3OR7A 2P47B 4KY1L 1OAXL 3QJHB 3GI9H 1GZPA 4WFFD 4L3CB 2N7AA 1SYVB 4ZOCA 3MOBH 4BJLA 1ZHNB 2EDXA 4I9WE 4NJ9H 5DMIH 1HSAB 4K7FB 5D7KE 5HYSG 3JZ7A 1NBQA 3D85D 1G1CA 1DDHA 1TTFA 1KXTB 5CEXB 5B4MD 1IFHL 1KGCE 1OLLA 2B0SL 2P5WA 1IAOA 4V1DD 4XVUC 5HHMB 2BK8A 3T4AB 2DMCA 1D5IL 3WFCL 1KJ2B 1X9QA 3HFMH 4PJ7E 5ICYA 3D85A 2XTJD 1RHHA 1CXFA 1OT1A 4JY5H 5C7XH 2H2SD 4U6VH 1KNOB 3QJFA 1I9IH 3PWJB 2ZUXA 4V1DA 4HAFA 1YUHB 3T0VA 3I3BA 4QHUB 1E4KA 2X4SA 3V6OC 1RJCA 2D0HA 1QYGL 1XCTB 3U4BH 5I1LA 2ID5A 4PGBA 5KSVB 3D9AL 1MRFH 1YY9D 2GW5A 4JE4B 3GI8L 2FZ3B 4L8SC 2FX7H 5CUSL 4KROC 1Y0LB 5T3XE 1ROWA 5HHME 5J1AA 3AS1A 1JWUA 2FSEB 5GIRA 2YRLA 1NCAH 2VL5B 3HR5B 1P7QA 3MQIA 2XQBH 3I84A 4J1UB 4RZCB 4P9HC 5IVZA 2DQHL 3H9HB 1CDYA 4LAQH 1KJMB 1BJ8A 1TVHB 3NCJH 4PY8I 4KKLC 4F7CA 3D5OF 3GSOA 4P9ML 3MFFB 4LLYB 5FYJH 1JPGA 1WC7B 2E7HA 5E6ID 1I1RA 3FFCD 2E9BA 2BHUA 1EAPB 1RJZB 2AJVL 4JM2D 4Q6IC 3LD8B 1Q9LA 4HFWB 4KUZH 1BWMA 1D5ZA 2O5YH 2Q86A 2CRIA 3QEHB 4HK3N 4DKEL 1IEAB 3KXFB 3VFMB 2NX5B 5IW3A 3CFCH 5FXCH 1ETZA 4JJ5B 4NPYA 4OI8A 5E4EB 3MA9L 3FRPA 5E6IA 2ADGB 3SE8H 3WFDH 5F96H 1FORL 4JM2A 3EO1A 3QXVA 4U6YB 1N59A 5F3HA 4EDWH 4ZYKB 1N5AA 4M93B 2LU3A 3S35H 3U30B 1CWVA 5E7BA 3D39E 3CDGB 4RX4A 4PBVC 1NLDL 2VDOH 3RVWC 4Q7DA 3TWCL 5D2NC 2FHFA 2BDNH 2A6JA 2LTQC 5HGDB 2EIZA 1AI1L 4X9HA 4PREA 3WXVL 4MCYB 3R1GH 5F7YC 3G6DL 1VFBB 2CIIB 4NQDE 3AMLA 3RZCB 4PB9H 2XZAH 1RMFH 3X3GH 3O8XD 1ADQH 5B3NA 1NC2B 1IZJA 2F5BL 3CD4A 3BPLC 5D7IF 1BEYL 5F7FA 4NQEE 5HGBB 1ZGLP 2RR3A 2YPKA 4LKCA 4LVNC 3O2VH 3MRQA 4LNRA 3KDMA 4C57C 4O51A 1IM3B 3O6FC 3S34L 2H1PL 3WLBA 3CJJA 2IH1A 3MXWL 5F1NA 3BD4A 5JXAL 3HZYB 2NY5C 4QRTA 5LVEA 1WAAE 4Z0XA 4U3CA 1FL6A 4R7NA 4TPRL 3FO0H 4P5TC 3O4OB 2IWGA 2K3TA 2ZG2A 4JZJC 4CW1A 4TSBH 1EIBA 2JJTA 1BHGA 3HZVA 1NDMA 4CVZA 1A2YA 5L2KE 2NLJA 4UT7H 3BHBA 1DFBL 1BBJB 3O2WH 4W81A 1FVCA 4GQ9H 4RDQF 4QYOA 5TQ2L 2WLZA 3T2PA 5CZXD 2GSGA 1D6EB 1FO0B 4XBGA 1CICB 2OJEB 3WV0A 1HHIB 1G7HB 5IF0A 4LLQB 5GZOD 2W9DL 4KRNA 3QQ3B 3VXTA 3WJLA 3L5WA 2VUOA 2BY2A 4IDLA 4WGWB 5D5ME 4BFEA 1UJ3C 1JGDA 5E8EB 4M7KL 3WKMH 1NFIB 1WIOA 2VQ1A 4MDJB 5TPWH 2OK0H 1T1ZB 3M45A 1FLRH 4G6FB 3FT2A 5JMRA 2DQIL 1CQYA 1IC7L 5E6ZA 4FQJL 2NY0B 2JK5A 2PW1A 1E28A 4J3TA 5BJTB 4H25A 3SE4A 4GRLA 1KV3A 5GRUH 4YHPB 5KJRL 2AERT 2M2DA 3ILQC 3C09C 3NZ8B 4GG8A 5SWQB 3VJ6A 4GAGL 3O3UN 5DO2C 2JF1A 3QFJD 1J5OH 2QKIA 1K4DA 3GRWL 1DBBH 3H9ZA 3DX6A 3V5DA 5DWUL 3BKJH 3X12A 1RI8A 3M8OH 5EU6D 4ISVA 2QBWA 3ARGA 4HWBA 3S37X 2B4CL 3UZVB 1RHFA 3SCMB 3V6FA 2AK4D 1PG7L 1WWBX 2CK0H 4IRJC 5HJ3A 4YDIH 3QFJA 3HZMA 4XCEB 3VXRB 3H42L 2VTFA 4R4FL 5GHWH 4NN7C 4X9IA 1S5HB 1DJSA 2AVGA 4JVUA 2EIDA 4CMHC 1X4XA 5I1EL 2AK4A 2IG2H 3S96A 5F7EL 4GLRI 3RWFB 2G75B 2LVCA 1I8LC 1BAFH 5CGYD 1IEHA 4FQLL 3BDBA 4FXKA 3TPUA 3UAJD 1HINH 1A6UL 5IIEA 3P4OB 2FHBA 2FYYA 4PD4J 3ABZA 1OTSD 3DYMA 1BZQK 1J1PL 4ZDHB 4F3FB 4KQ3H 4XWOD 4JREB 1LO5B 3ZT7A 4M8QA 4O02H 1YYLH 3X13A 3TBVB 3ROOB 4GKNA 2P8PA 3DETC 4ETQB 1TQBC 5MP6L 4Z78B 3TC9A 4M6NL 2ZPKL 1F4XH 2NY3B 3PJSA 2X7LB 5DUBB 1JBJA 5JLZA 2EE2A 3LKNB 2ZUVA 3QZWG 3NIGF 2QHRH 4F33B 3C2AH 1AKJD 3MCLL 2YD1A 1CLZL 1DBKH 4TUOB 3KPSA 4JFED 5F9WB 3I6KB 1CFTB 1ZGLM 5SWSA 1KELH 4YUEL 1U8OB 2F53E 3DUSB 3MLSH 5TF1H 3F7PC 4Q9CA 3QEUB 3JTSB 1A7NH 3PIQB 4ZUUA 1RULL 1IEBB 2CLRB 2K7PA 4YFDB 3VDBA 5IJKA 3PWNA 3VA2C 4I18C 5ADPH 3AC0A 5DJZB 4PUBL 2XTLA 2R69H 2NXYD 3HMWL 3DIFA 4JFEA 4TOYL 1HXMA 5D93C 5TQ0H 1HI6A 1JNNL 4Y4FC 4XB8A 4LK4A 1L7IH 3BW9B 3LRSA 4NQXA 2R0LH 4AT6A 1RUKL 4MJ6A 3DECA 4H0GA 3LEYH 1K3ZA 3IFNL 3NABH 2Q76B 2D7OA 1AIFA 1H8NA 4FQHA 4H88L 3QB7C 1RFDL 3U46B 3Q0HA 1QLRB 4YDKL 5EORL 4ZTPH 4FZEH 4HXBL 2XXMB 3P30H 3OR6B 1NCNA 2FR4A 4XAKE 3B9KD 4TSAL 1S7VB 3GSVA 3ESUF 2MHAB 3CDFA 2QSVA 3SDAB 2Q20A 1FG9C 5ICXA 4WI7A 4EI6B 2DQJH 4LPVA 2VOTA 4D0BA 4X6FA 4XPGH 4NHUB 3KPMB 2BY1A 4NM8L 1QBAA 1HKLH 5IMOA 3KJ6L 4F58L 5INDA 1XFPA 5EUKB 1BIIB 2YOCA 3B9KA 3T3PE 5E2JA 5KW9H 3ZKNC 3DVGA 3HN3A 5C08B 3ULUH 3G5YA 5E1AA 5C9JA 2X4NA 1CR9H 3UTTD 1WEJH 5JXEC 5I15L 1I3RB 1KG0B 5I8OL 1UG9A 3EOTH 4FQXC 4E5XA 3HB3C 1M7IB 1YJDL 3QNXB 4PTTA 4MD5B 1H3PL 4XPBL 3CSYB 4Q74A 5DHVB 4JPKL 1WCQA 3EOAB 5JHLH 5LJYH 4OZHA 3ULUF 2IPUK 1WBXA 4PRAA 5I19L 2YC1B 2DMBA 4OLVL 4F7MB 2EECA 2EDYA 1QSFB 4TRPL 2ZOKA 3VDAA 4QXTA 4FZ8L 4HFUL 2DLEA 4NQCB 3O0RH 4NOBA 3MJ9A 4EN3B 4NYLB 1ZHKA 3MLYL 2WIMA 3EBAA 5HYQB 3MBED 1SMOA 1FZOB 1LP9E 4P2OA 4QRRD 1AD0B 2VXVH 4NC1E 2IANB 5FDWA 1DEEB 5T1MA 2J7LA 4NWUH 2O26U 5I30L 5IW1A 4ZS7H 2H32B 3BE1L 3QEGL 4LL9A 2AXJA 3FQRA 4LLAA 4OKDA 4QTIH 3ZMRA 2NXZD 2W0FB 4LSVL 3GHBH 2BNQB 1JN6B 4R7DB 4QRRA 5C0FA 1HH6B 3GSNH 5CD3B 1AC6A 3L3JB 3PWUA 1XCQA 3FONB 1BZ9B 5SV4A 3D0LA 2CDGB 3BXNB 4KWUA 1V3LA 3GSXA 4OIIL 1S5IL 2VAAA 3QULB 4Y4KA 5E2VH 3LPGA 4WEBH 5I76A 4L4TB 1BFTA 2ZZUT 4X0KB 2DMKA 2NY4D 1U8NB 1NCCL 3TN0B 5K9OB 2B5IC 3MLTB 2OMBA 1RUMH 3JWDH 2DKMA 1FG2B 3WUWG 4JM4L 4HMDA 1E4WH 5CHNA 2NY2C 3V5HB 5L0QC 2BNQE 3D25B 2GUOA 4XBEL 4G6JL 1FV1B 4TVPH 5KVFH 5EO1B 4G3YH 4IIQB 4P4KC 1P4IL 1YMHA 5IFJB 4YXLH 3AU1B 4U1MA 1JZ3A 1JTPA 4P23C 3PV6B 4JO4L 2HFEA 4JDTL 2J8UB 4EKXA 1K2DA 1U95B 4XMPL 5JW4N 1OGAD 1A14L 1VB9A 4ONHA 1A7PL 4MXVE 4KI5C 1V7ML 2W65B 3IDMA 3EGSB 4PJHA 4Q6YA 3EDEA 1EZVX 5ID1A 1KLGA 1T7XA 5E8NB 4GKZB 4I0PB 4FNLL 4NT6B 1G6RB 4CNIB 4JKLA 2XWJB 4N8CL 3HE7C 1KCRL 3VD7A 3QXTA 5BQ7A 2J5LC 3NCYS 4Z8FH 3FQUA 1OGAA 5JNYA 2A73A 4G6AC 3LS5L 3HUJB 4NN6C 4IDJL 3PWPB 5ERWB 2ZUUA 4AIZB 1KIRA 3FQTA 1R5VA 4MJID 4NGHL 4PS4H 4Z77B 4UBDD 4UT9L 3TZVC 1LD9B 2A6DB 43C9B 1ZHLB 5FIEA 2EDRA 4FQIH 3WDIA 1MJJA 4WUUE 2JELL 5C09D 4JG1L 2BFVH 2BHYA 4G80A 4OFDA 1Q94A 2IC2A 2GITB 4PR5B 4C58B 5T3ZD 1FFOA 4MJIA 5DLMH 4LBEA 1FVDB 2HFFB 4LLDA 4X98A 5F1KC 1IAIM 2I60L 1YNTA 3MSPA 3QDMA 3MRBA 1V3MA 4RGOH 2GFBB 4H5SA 5C09A 3FB8A 2IPKB 3MV8E 3V6ZB 3PWPE 1YN7A 1SM3H 3B8SA 4OCXL 2AJSH 6CGTA 1DBAL 1IARB 2E27H 1NMAH 1FRGL 1SJEB 2DWEB 5HPOA 1OPGH 3SDDC 3ALWA 1NCBH 1KB5H 5F6HI 1U8IA 2NY7L 5F97E 2ICCA 4FA8A 1Z3GL 5DURD 1B2WH 4OI9A 2EYRB 5H2BB 1PEWA 4UOJA 1NCWL 1SBSL 5GRYA 1S3KL 1NUFA 4KK8C 3BKYL 2GYSA 2EDJA 3L1OH 5IVXF 2CKNA 1KPUA 3BPCB 1QVOB 1MQKL 1F3DH 4WHDA 4U1GC 3OTTA 1MSPA 1AO7A 1HH9B 4UV4L 5D7SH 4L3ED 1LWRA 2BJML 5T1DH 4N9GB 4MA3A 5TDNB 1DQDL 3ZTNL 5DZOA 3RWHA 4PFEA 2HFGL 4E0RA 4I4WA 2DJ4A 4H1LG 4RFEB 4HHAB 1T3FB 5I0ZA 2AABH 4KQ4L 3MRGA 1WITA 4KXZI 1RZ7H 4OCMC 2ZSWA 5IMMB 5FCSH 2YUVA 2FD6L 2IBGA 1F58H 3FB7B 2F54B 4L3EA 1I8KA 1DQMH 2BSED 1HYRC 3MNVB 3DSFL 1R3LA 4FQ2H 5A43C 2R4SL 5I73B 1BFVH 2WWMD 2PXYC 3UC0H 3BN9C 4DEPB 2OQJB 5J11C 3WFEH 4MXQC 4CGTA 1Q1JL 1KB9K 1NFDF 3QUZD 2UWEE 3U83A 5E9DA 4OQTL 3OKDA 1JHTA 1VEOA 1P4BH 2R4RL 4XPAH 3IJSA 5CBAA 2BNRB 2FX8L 3VRIA 4TNVK 1U8JA 5I1KL 5DQDL 4MDIB 1FFQA 1R3HA 4RSVA 1WK0A 3LB6C 5ETUA 3NTCH 3ARFD 1K6QL 3NA4A 3H9SE 2F58L 3P4LA 5CEYB 5T5NF 1JJUA 5D7IB 3SN6N 3TJEH 1VACB 4HCRL 4FG6D 3ZDZE 2X4PB 1CD1B 4QRPB 4HF5L 3MZTA 4NN5B 2GT9A 2DRUA 1D5MB 2R1WA 4KH2A 1XF5B 3VMOA 9CGTA 2HMID 1MLCA 3ARFA 2FX9H 3S97C 5GJSL 3QIUA 4ODHL 1YYMH 2Y7QA 3WL9B 1OB1B 1QO3B 5HGAA 5EU3B 1Q0YL 4FQPA 3CVHH 1XT5A 3TT1H 3GMPA 2HRPH 3KHQA 1N6UA 5C0AD 5BXFA 3LIZL 3D87B 2UYLB 5GRZA 3FMGH 4M6OL 1ZLSH 3EDJA 4K7PH 5JZ7D 1X5ZA 4NJAL 1X5FA 2B1HL 4DGIH 3T1FB 4LQFH 1A0QH 1FNGB 1NGPL 3RGVD 5J13C 4FQCH 4ELMF 5FF6A 2I25N 5C0AA 3MTRA 5EUOF 3RVTD 2PO6C 3C60C 4RISL 1IL1A 1N4XL 4YHOL 3HC4L 3HPJA 4Z7NE 1OAZH 1DQQA 5ACZA 1BQHB 2F15A 4C56E 5C92A 5IG7B 1NGZB 3RGVA 1HEZB 4M61A 4LKXA 2XG5A 5IOPB 4Y5VA 5BS0D 5DUPL 5IM7A 12E8H 4GW4A 4ZXBB 4YHMH 4LOUC 4KY1H 3VRLF 5AYUL 2AGJL 4XMLH 3DHJA 1PKQB 3GB7A 1T7WA 4J8RA 5C0EA 1XGQA 3HNSH 5JQ6L 3H9YA 3FCTA 5GS1B 4CJ1A 4G8FA 5BS0A 4NO5B 4ZODA 4D8PB 3EOBA 1IFHH 2J2ZA 5DJ6B 5MEQB 4BK5A 4QWWC 4JN1L 2B0SH 4RAUA 3QUMH 1G9MC 5DZLA 1BZ7A 1EVUA 1D5IH 3WFCH 3VXSD 5DRXA 3ZDYF 3IAQA 1TITA 3CFDB 3ESVF 4AH2B 4PGEB 3QAZB 1ZT4B 3W39B 2ESVE 5H37H 3HLAB 1XGPB 3R0MA 3O3AA 1NPUA 1AHWC 3BQUB 2FHCA 4XP4L 1O5DT 4CU7A 4FTVD 2VDLL 2OM5A 5HI3D 5C0CD 4BZ1L 5EO9B 1A3QA 3VXSA 2X10A 1E4KC 4X99A 1QRNE 4X6CB 1WZMA 5FGRA 3FOMB 1QYGH 5JORB 2P5EB 4XPTH 4KKCD 3MGOB 4AQ1B 3B9EA 2H2SC 3CFKB 3CVIL 1AE6L 5CUSH 2JJUA 2PYEA 4FTVA 4MA7H 2HG5A 4S10A 1A3LL 5C0CA 1U8KB 1KSRA 3Q5YA 1HIML 3DXAB 1A6WH 3I2CH 1A4KB 2R29L 3QG6A 3W0WB 2W59A 3ZYZA 4DZBA 1B4JL 2R15A 4HUMB 1CXKA 4U1JA 5EZJB 1BPVA 3QUKB 4MLSA 1U91B 4ZUWB 2MQCA 3LKPB 5K9JH 5HYIA 3IGAA 3ZLQC 1D6VL 3ARBB 2V5MA 1IILE 1FFNB 1NGWA 1A47A 2HJFB 3B8YA 5D1XB 4HIEA 1N8ZA 2GK2A 3MLRL 4PJAF 32C2A 2FBOJ 3KYNA 4X6CE 5D2LA 1OGTB 1JPFA 3L3IA 4ZFOB 2AJVH 2NCMA 1QLEH 2AXHA 3U9PH 5EBMA 1CGUA 5FK9A 4DKEH 1LEKB 1B0GB 3JBG7 1OTUD 3VH8B 2JIXD 3F12B 4R2GD 2LFGA 1T6WA 2VISB 4EUPH 3MA9H 1B3JA 1FORH 3QP3A 2O93L 4JN2B 5IVNA 4PGDA 3MRMA 4LSTL 3GUTA 5ESVB 4WWID 4YAQA 3RWGA 4EI5D 3V52L 1P7HL 2JIXA 4KRMB 2YHGA 1CDUA 2BRQA 2EC9U 3EO9L 4TNVF 3OHXA 4Z7WE 1MFCL 1JMZA 2X89D 4HWUA 4QTHB 3TWCH 4AM0A 1FE8L 1FZMA 5HDQL 1LK2B 1AI1H 3S5LA 3WXVH 4R0LA 5E5UB 1CFSA 4RMRA 3QDGB 3G6DH 1MCQA 2ARJB 3TYFA 4FFYL 4PJDF 4OKVA 5GGTL 4EI5A 3N0PB 1LMKA 4S1DD 1Q9OA 4WW2C 3CPLB 2K9UA 3NMEA 2GSIB 2F5BH 4F9PC 3T4YA 4ZTOH 2V7NB 5CWSA 5F9OL 1RUAL 2E6PA 2D9CA 4PJ9B 1OAYH 4XGZA 4HKXB 2YUWA 1FN4A 2Y1VA 5FO8A 1WICA 4P5MB 3VXNA 3S34H 5FA3A 4DK3A 4I3GA 4LSUL 5J89A 3ISWA 3DX7B 2OLDA 3EFFB 4LCYA 4TULL 2BP3A 2VJXA 1FSKB 5J4MA 1VENA 2NTSP 3STZB 2VLRD 3U1SL 1RD6A 1YPZE 3OKKB 4DVBB 1MVFA 2BX5A 3ZL4L 1MUJA 3GSQB 4NM4L 5J3HC 3EYUL 2I07B 4NCC2 5CILL 3VXPA 4I5BA 3FL7A 1MCJA 4YH6A 4P2RA 1H0DB 2YD9A 1TPXC 1FZJA 2G2RB 1CFNB 1T89C 1MRDL 2VLRA 1U3HB 2A83B 5TQ2H 2YN3A 4JGUA 1ZT7A 2IMNA 4MD0A 3VXQB 1XF4B 3CMOH 3HMXL 4D9RE 1SY6A 1EFQA 1T0NA 1MCWM 3S36L 1OQOA 1M7DA 4PJBA 3KLAB 5KS9A 2W9DH 3GMQB 4DKAA 1W8OA 1JF1A 4IRSD 4UT6L 1VFMA 2BXYA 4RGNE 4FXGA 3KYMA 3O4LB 2I9LA 3D2UA 4HZAA 3AAZA 2Y6SD 1T21B 3IDJA 3QEQB 1J0JA 1T2JA 5J7CC 4OCWL 4HWZB 5JR1L 3L95B 3B5HA 3QO1B 4M1GH 4FQJH 4YHIA 1JHLL 3RUGE 1UKQA 2AJZB 4S1RL 1A4JB 3WHXA 2WSKA 4CKVX 3SE4C 1F3RB 4GRLC 3RA7L 4KV5F 3T2OA 4HUVA 3C2SA 1RIHL 4U7KA 5KJRH 2P8LB 4JRYB 3PQYB 4K23H 4L8BA 1G7JB 1DL7L 3F8UB 3F6IA 1LEGA 5DK0A 1KCSL 4NO3A 2NW2B 4Y4HD 4BFIB 3MYJB 3GRWH 5F3BA 1DVFA 2UZIH 4DCQB 5IK3A 5DWUH 1XZ0B 5LBSL 1UC6A 3QEQE 3ARGC 5SV3A 2B4CH 1WWCA 2IMMA 2R2HB 3SKOA 1MCKA 3GSNB 1PG7H 1HQRA 2DS4A 35C8L 5INCB 1JYNA 1ZVSB 2XKUA 3FT4B 2ZSVA 4Y4HA 2QSCH 3HI6H 4YXHL 2B7DT 3H42H 1G7LA 3IU3A 4R4FH 4YZFE 2JJSA 5EZOL 1I1CA 4U6XB 2R2CA 1HYSC 3R8QA 1MFNA 2KBGA 4YWGH 3BP4B 3ZSSA 4G8GD 1IGIH 4L8DB 5ADOH 5I1EH 3WEXB 3ORJA 5F7EH 1AXSB 2ZUSA 2WQRA 5GGRA 4W4OA 1OWRM 2MQ0A 2HT4C 4JM2F 5JQHC 2R9HC 3MJ7B 1JGLL 4R26L 3RNKB 3VXMB 4D3CH 1A6UH 2RFXA 3QIBB 2QR0A 3ZYJA 1QSEB 4K3EL 1J1PH 3QUYD 2X70B 1NUDA 4P4RA 2R1YB 5TF0A 1NAKL 5JW4M 3FN9A 3ULVE 2Q1EA 4LLWA 2PETA 3B2UD 4PB0L 3OJDA 4WI3A 3OJ2C 3UAJC 2Q3ZA 3BPNC 3RL1A 1KBGL 4M6NH 2ZPKH 4D0CB 3T0EB 5DK2A 4OT1L 2AJ3B 3UJTH 1H9VA 3UTQB 5CJXA 4XWOC 4ZUSA 4A2LA 1WVZA 2YEZA 3SKMA 3GMRA 1F2QA 1UXSA 3L9RB 3V8CA 4I1NB 1KUMA 5FKPB 1UT9A 3IJYA 2Z8SA 5B8CC 4JFPA 4X9GA 4X6BA 2OI9C 2UZYB 3OAZK 3MLPA 1RULH 5D7KD 3QXDA 5B39G 5DD1H 4PJFE 3GSRA 3KNBA 4UDTA 4K8RL 4X5XB 4OGXH 4Z7VF 3CZFA 1KGCD 3ARDC 3HMWH 1CTNA 5GS2H 5IV2B 1E4JA 3TV3H 5MENB 4WWKD 3T0EE 2WK2A 2QQQA 1JNNH 1GAFL 3SGEI 4EVNA 1UGNA 2KKQA 3OX8A 3VE0A 1F2XK 2GY5A 3G5ZB 5EDXA 3V4PL 1RUKH 3O45A 5HHOA 1NANI 2ADIB 2GHWB 4U0QB 4KHTL 4V2CB 4UNTA 5KSAC 2Z91B 1RFDH 4LPXA 4KKAC 5KVEH 2BMKA 3O9WC 3H3PL 4FHBD 4K2UH 4WWKA 3T8XB 4MAUH 3MA7A 3STLB 1GGIL 4JQXC 3D48R 4FRWA 3WIHA 3TCLA 3VFGL 1CDGA 1K8DB 4TSAH 1S7TA 1VFAB 4GMTL 4G9FE 5EC2A 2DI8A 4G8EA 4NQSB 5I16A 2FB4L 2C9AA 1CE6B 1S7RB 4U0RC 3O6LL 3MV7E 3QJHA 4PLKC 4CMMB 4HIIB 5CIPB 5DJAB 1KT2B 4I3RH 4L3CA 2VDPH 1SYVA 2HWZL 3HI1B 3KYAA 4NM8H 5HHMD 3KJ6H 1CGSL 1ZHNA 3IDYC 3LKSB 1KB5B 3PL6B 3DGCR 2JLLA 1HSAA 4K7FA 1GVIA 4YDLC 5CEXA 4JFQB 2C3HA 5I15H 5I8OH 4QHNB 2IQAB 2OR7A 1ZXQA 3T4AA 4XZUA 1IJ9A 1YJDH 1H3PH 4XPBH 4JPKH 4OZGB 4JAMB 2W9LA 3PGFL 4NUJA 4UTBH 5GS0D 4I2XB 3AGVA 4OLVH 1KNOA 5DGQA 3TH4T 4JY6B 3TO4C 2DQEH 3PWJA 4AL8L 3FHQA 4FZ8H 4QHUA 3MCG1 3S88H 4ZO8A 4NO2B 3MLYH 2DJSA 4AEFA 2DLGA 3VFOB 3HRPA 1XCTA 1QFWM 2F5AL 4P2OC 5KSVA 1F13A 2FZ3A 1G9ML 4U2YA 1FLTX 2BCKB 1Y0LA 2APBA 1J7VR 2EXYC 2FSEA 2GY7B 5GGUB 5JHDE 2ZJSL 3IDNB 2VL5A 3BE1H 3HR5A 3VWKB 4J1UA 4OD3H 3MACL 4RZCA 4NO0A 4YHLL 4LSVH 4XAWL 2VLJB 1KYOJ 3H9HA 2LABA 1CFVL 1KJMA 3MRHB 3BGFB 1TVHA 3TH3T 3AVEA 3CXDH 2NX5D 3QIWB 3MFFA 4LLYA 1G7QB 1ZOXA 1WC7A 1ZA6B 3V7AG 1MHHB 4OIIH 4Y4KC 2PCPB 3MC0A 2R1XB 4NQED 1OD9A 5EZLB 1EAPA 1RJZA 3RY5A 3VFWB 1IGTB 4QF1B 5KTEH 5JUEH 4WU7B 3LN9A 4HFWA 2X2YA 2VDML 1FHGA 1TQCB 1NCCH 3QEHA 1IEAA 3KXFA 3VFMA 4OFPA 2NX5A 3G5XB 1LE9B 5KANI 4S1QL 4JM4H 5J1SC 4HKBB 1KCVH 4JJ5A 3AXLB 5AYQA 4P9HH 5ACLA 2ADGA 2C1OB 2VLJE 1FGVL 3CVHB 3T0AA 1I9RH 5EOQL 4U6YA 4HBQA 2QADC 4XBEH 3GKZA 4ZYKA 3JV0A 5C0JB 1OY3B 3RZCD 2WLYA 4ENEC 3CDGA 1U0QA 4OM1H 1NC2D 2VDKH 2DM4A 3KPRE 2IALB 1BLNB 5B3JF 1A14H 5T1LB 3DMMB 4RMWA 5HGDA 1A7PH 4YC2B 1P6AB 2ENSA 1V7MH 4MCYA 4LMQE 5M7QA 4UILL 1TJHH 1VFBA 2CIIA 3VFVB 1MAJA 5HYEA 3RZCA 3ZKXB 4FNLH 1K3IA 1C5CL 1NC2A 4N8CH 1KCRH 5FCUH 5GQBA 1Z6JT 2GK0B 1ZMYA 2G5BB 3K2MC 5EA0L 1RV6X 4IDJH 4J2XA 1IM3A 1CDCA 4RFNB 5FM4A 3A6OA 4NGHH 4EQ2A 5DXWA 2OJZL 4NCC1 3HZYA 2VABB 3S37L 1RU9L 1A02N 3HE6B 4KRLB 1MELA 1S8DB 4JG1H 4X80L 3WDHA 1U8LB 4GW5B 1AH1A 3EHBC 5T3XL 4JFFB 4XB7A 2ZWLT 1AGCB 3QUMB 4MYWB 1NDGB 2I60H 1PX3A 1CICD 2VXUL 3QI9B 5IBTL 1BBJA 3LEVL 4HK3J 4OCRL 3C8KB 1DBAH 1PBYA 1Q9WA 2V7HA 1TZIB 1D6EA 1FRGH 4ZAKC 2J3SA 1FO0A 2NY5H 3K3QA 1CICA 4XH2B 4JFOB 2OJEA 2PNDA 1KIPB 4G6FD 1HHIA 3ZT5A 5EOCH 1G7HA 4LLQA 1JF5A 2NY0D 3QQ3A 5M94B 5KZCB 3AY4A 4KRPC 1MCCA 4X6DE 1NCWH 1S3KH 5E8EA 4OF7A 1NFIA 2AAVA 3FO2B 4PJEF 4MDJA 1QHPA 2Q7YB 5HVHB 4MNGA 1T1ZA 1W72H 4PJAB 4B7IA 1MQKH 2P8MB 1JK8B 4TYUA 2NY1C 4UV4H 4MX7B 3HZKB 5FOBB 4M7ZB 1I7TB 2BJMH 2V17L 2EC8A 2JB5L 5FUOH 4YO0B 4GOSA 2HFGH 4PJXB 3U2SB 5EZIH 4FS0A 4DKFL 2CR3A 3MJ6A 2L7JA 4YHPA 1MJUH 1HSBB 3TESA 3E2HC 4KQ4H 5A40E 3NZ8A 3HG1A 5SWQA 5JIIA 2FD6H 5J8OA 5FHAL 3GSWB 3BT2L 4MA8L 1IAMA 5DD3H 5ISZB 4PJ8C 1TJIL 3DSFH 5FO9A 1EHLH 3UYOD 4WCYH 3SJVE 2R4SH 2Q87A 4YXKL 5CP7B 5C6WH 4MHHI 1JPTL 3SCMA 2YRZA 4N0UB 4QNPF 4KI1A 4FOMA 1Q1JH 4EUPB 1F97A 2DQGL 5GSVB 4L4VB 1JNLH 3IFPB 1NBVL 4YNYB 1F4YL 1NCDL 4XCEA 3VXRA 4PJXE 2R4RH 5KG9B 1RZKC 3AFLA 3FAWA 1S5HA 3GMMB 2HN7B 4WO4B 3SQBA 5I1KH 5DQDH 1S7SA 2DYPB 5IB5B 4PJDB 3HA0A 4ZPVB 2DQFB 1U6AL 4IMKA 2F58H 5F7LB 4Z7UF 5EWIH 3RWFA 2G75A 3WD5L 4HCRH 3IVKB 3MYZA 4JO2L 3SO3B 5B39B 3BAEH 2W38A 3P4OA 1UA6L 2FATL 2NY3D 3KLHC 5I74B 3FN0L 1FYTB 4PRHE 4ZDHA 3MLUL 4F3FA 5HI5D 4HWBL 4ZFGH 2C7UB 1LO5A 2Q8AL 1PG7W 2FCBA 4G43B 2R0KL 1T4KB 3QIUC 3ROOA 3TBVA 3VI3F 2BVTA 4YHNB 2DD8H 2IPTL 4ETQA 5E00B 4EOWL 2NR6D 4LSQL 3HNTH 1Q0YH 3A0OA 3OPZL 3W9EB 2R2EB 1FJ1B 4M1CD 2CIKB 1FNSL 3P9LB 1LE5B 2X7LA 3LIZH 5DUBA 3SKUD 4M6OH 1KLUB 3LKNA 2R39A 1TETL 4Y7MA 4F33A 4JFXB 4LCUB 3TA3B 1BVLB 3I85A 3RNQB 4NJAH 2B1HH 1B6DA 5BVJB 1A5FL 4TUOA 3I6LE 2FO1A 1I4FB 3DPBA 3I6KA 1CFTA 2GTWB 4XPHL 5F7KC 2EDDA 5AAMA 5JMOC 1U8OA 3DUSA 3QEUA 3DBXB 1N4XH 3JTSA 3PIQA 1JRHI 4YHOH 1IEBA 3HC4H 2CLRA 1CCZA 4BQ8A 1CG9B 5DJZA 3L3KB 4OTXH 3WN5B 1P5VA 1FCGA 5CP3A 5BV7L 4D2NA 5DUPH 4AEHL 3PGDB 3ZE1E 3BW9A 1V05A 4YBHA 2FGWL 5AYUH 5H35B 1AY1L 2YD6A 5I1HL 2Q76A 3SDAD 4HPOH 1JNHB 1H5BB 5LGJB 3U46A 1QLRA 4KC3B 4U3XA 4GG6F 2DQDL 3OR6A 3JXAA 2D03L 2KL6A 2C3VB 2VN7A 5EN2B 4JN1H 2Z92B 5DJCB 1J05B 3U0PB 4KUCD 5ILTL 5C08D 4J3XA 5SX4I 3HCVB 2MHAA 4X7TB 3SDAA 5GGVH 5IGXL 3RIFF 2WV3A 2YXFA 4EI6A 4NHUA 3KPMA 3LRHA 2BVPB 3UEZA 1R24B 2FBJL 5EUKA 1BIIA 3OXSA 5TDPB 5C08A 4XP4H 5I66B 2FL5B 2ED8A 5JDSB 2VDLH 5TE7L 4MWFB 2A9ML 2XPGB 1SEBB 4BZ1H 1I3RA 1KG0A 5BW7C 1QSFD 2EKSB 5D8JH 3VFPA 3VXUE 4XMKH 4NQCD 4YBLC 1M7IA 3ECBB 3QNXA 4I48B 5DJYB 4MD5A 2AEWA 4EN3D 1AD9B 3R06B 3CSYA 5DHVA 1YQVL 3CVIH 1AE6H 3EOAA 2YPVH 4F7TB 1NC4B 5D6DA 5CCKL 1A3LH 3FFCB 2YC1A 4EZMA 4F7MA 5KSBB 1HIMH 2IAND 1QSFA 4XNMB 2EE6A 1PQZA 4EQ3A 3MV9B 5GISH 4NQCA 2H6PB 4EN3A 5A2JH 4KKCC 4NYLA 4M7JL 1JNJA 4KJPD 4HIJB 4D0DB 5HYQA 3BDXA 2BNQD 1FZOA 5DJ0B 1VHPA 2Y07L 4HIXL 3WLWC 3Q3GB 3TBYB 3V7MA 1AD0A 4BSVB 2HAZA 2IANA 3MLRH 3AM8C 1DEEA 1BD2E 1LDPL 1S78D 3RPIB 1LGVA 1YNKL 2H32A 2XFXB 2WZPD 3ROLB 2Z35B 3UO1L 2W0FA 3OG4B 3V7AE 2BNQA 4MMXC 2VYRE 1JN6A 2MKWA 1HNGA 4L4TD 4R7DA 3ZHDA 4WFHE 1HH6A 2N56A 3IU4H 5CD3A 4KTDL 5A2LH 3L3JA 3TN0D 3FONA 1BZ9A 3MV9E 3IDIB 4PBWD 5C2BL 2CDGA 3BXNA 3KLDA 3O2DL 3OV6A 4H20L 3F58L 5KN5B 3QULA 4LSTH 5CEZH 3O8XB 2E7MA 2MOVA 2MPAL 4L4TA 2RJMA 5A2FA 1NUNB 1OTUC 4X0KA 1MCSA 3ARSA 1U8NA 2VR5A 2X4OB 3TN0A 2NY6B 5GPRA 3IFLL 3MLTA 5K9OA 1FG2A 1MFCH 5BOZG 3QUXC 3DGGB 4HUWB 4F57L 2J4WL 2DM2A 1OTTC 3GIVB 2B2XL 4R0LC 3V5HA 4XP9H 3D25A 4LSPL 1WISA 2WW8A 1UM5L 2P44B 5FUCE 5LQBL 3IXAB 1FV1A 4JFDE 2VSCA 5EO1A 3ZE2F 3NCEB 4IIQA 5F9OH 1RUAH 5IFJA 5ALCL 1H3UA 3AU1A 4I0PD 4QO1A 2E7CA 3PV6A 2J8UA 1AR2A 4GRWH 5FEBA 1U95A 4W4NA 1UZ8B 3SDYH 1QACA 3MV8D 2NPLX 4QOKB 4S1DC 3PWPD 5FUZL 2W65A 4DUVA 1KJVB 3EGSA 5JOPE 1HWHB 5E8NA 4GKZA 4I0PA 2F8XC 4NT6A 4LCIH 1G6RA 4CNIA 1RZGB 1FDLL 4KXZH 1OSZB 2XWJA 3EYQD 2W9EH 2OX5A 2E9JA 5F7NC 3ZL4H 3HUJA 2OTPA 4OUUB 4BH8B 1FL5B 1QFHA 4JG0L 3PWPA 4NM4H 3P0VL 3K8LA 3RAJL 3EYUH 5ERWA 5CILH 4AIZA 1C8PA 3ZE0F 3TIEB 4Z77A 2A6DA 4TNWF 43C9A 3EW3B 5F7DB 1ZHLA 4QGYA 3N1QC 5BOPA 1Q0XL 1MRDH 1X5GA 5DVOA 3E6FB 1KN2L 4LPWA 1JI1A 5E2UL 3ZZ1A 2C1PB 4PR5A 3HMXH 4RFOL 4BSWB 3S36H 4Y2DB 3SE3A 3F7VB 5I71C 3FB5B 4B0MM 1FVDA 2HFFA 3NAAH 3LS4L 4Y1AE 3EOYG 2BSSB 4UT6H 5LCVL 2AJUH 4UV7L 3CFIC 1LO0L 2GFBA 2IPKA 5KOMC 3V6ZA 4I0KA 2XOTA 2YMXL 4OIBA 3BN3B 1G7PB 3IF1B 4OCWH 4M03A 4K3GA 1SJEA 1U8PB 1JHLH 2DWEA 4S1RH 3MR9B 5EU6B 5C0BE 5FYLL 5E08H 3VGHA 4JLRB 4LSRH 2AV7B 3ZKMD 4WI9A 4E9LA 25C8H 1CGXA 2EYRA 5H2BA 2OR9H 5D7JD 1KCSH 1PYWB 2VMFA 4WFEE 2AKRB 4BKLA 3BPCA 1DVFC 1QVOA 5FYJD 3H9SD 4ZS6C 5F9AC 1WFOA 1HH9A 3UTPE 2NTFB 4N9GA 5TDNA 1BFOB 5FGCE 1EFXB 5T3ZL 3RX8A 4RFEA 4LPUA 2Z9TA 4HHAA 5EH1A 1T3FA 35C8H 3TBTA 2VH5H 2Z93B 4ONGH 4MJ5B 4M48L 4YXHH 3LAFA 4O58H 5IMMA 3HC0B 5HHPB 4PV9B 1SJHB 2O5XL 2YUXA 5EZOH 3LKRB 3FB7A