3LQZB

Crystal structure of hla-dp2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
212
structure length
198
Chain Sequence
RKFHYLPFLPSTGGSSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Crystal structure of HLA-DP2 and implications for chronic beryllium disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 198
sequence length 212
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqzB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3lqzB01
4PJXF 4GBXC 1F90L 1VEOA 4A2MA 1FC1A 4JR9H 4QRSB 4I77H 3I2CH 2H32H 3B5HA 2IFFH 2BNQD 3NGBC 4CKVX 5H94B 5JORB 1Z5LA 1FNEA 4IRSB 1EGJL 4QHMB 4WI9A 5DHVA 2P8LB 1EJ6A 4EI5D 1U8PB 5DWUL 1O7SA 4JHWH 4UNTA 4Y5YA 1ZSDB 5E00B 4PG9B 1T1ZA 3B2UC 5EFIB 5I1GH 5KSUA 3DGGB 7FABL 4XNZC 3BWAB 3WHXB 4W70A 4YHLL 3U0TB 5DJZB 3U4BL 4OAWB 3GMRB 3JXAA 5L8LB 4MDJA 5HD8D 5IMOA 3IYLW 3ALWA 4YEEA 3C08H 3QDGD 4XMPL 3D25B 4D3CH 2HLAB 1J05B 3HI5H 1OAUL 3PIQB 2QQNL 4JN2B 3HLAB 2UZYB 5F3HB 4KROD 3R8QA 3GSVA 5AUMA 2C4FT 2IPUG 3LEVL 2WK2A 4Q9CA 5IVZB 3L3OB 3OTTA 1CE1H 2QEJA 2FR4A 5DJ6B 2DWDA 3SE3C 1U8NB 2W9LA 5CSBA 3ALPA 3PWPB 4CRPA 5GGSB 1SY6H 1DP0A 1P53A 2RAMA 3TN0D 4ZUUA 4G5ZL 4PJ5A 1ACZA 5KVFL 1HSAA 3MJ9A 1HIMH 2E9JA 3KPNB 3IRZA 4HJGA 3L3DA 3FFCB 2ZCHL 1BQHB 3GSNA 3QXDB 2YD7A 1UEYA 4HX1B 3AXLA 3ELAT 3TBYA 2VDNH 2Y5EA 5EC1A 3FRPG 3V95A 5INCA 3CZFB 3M17B 4QXUL 2X4TB 1S8DB 4NC1C 1UM6L 1X9QA 3LQAL 1N59B 4H25A 4NNPL 3AY4A 4G9DB 1DN0B 1HEZA 3WNNA 4U1LB 3MUY1 4P59H 2NXYD 4OGYL 3N06B 3QI9D 1U9KA 4OZFG 2XTLA 4N0YH 1CLYL 3NBNA 3ZTNL 2VZTA 3MOBL 3UTTD 5L2KE 3TT1H 4OKVA 3CFBA 4DUXA 5DT1H 4B50A 1A47A 3RWIA 4GBXB 1FZKA 1JNHB 2VC2L 3UJIL 1JZ4A 4Z7UE 1RJLB 3EOTL 3AU1A 1TJIL 1KIUA 4L4VA 1JGVH 3NGBB 5E2JA 4XBPA 4LCUA 2JELL 1N0LA 4N9GA 4ONHA 1EHLH 2H3NA 1UXSA 1I8IB 4R6UA 5EH1A 1KNOA 2GW5A 3DUUB 1LEIA 3K7UA 3LS5H 4L4TE 3C87A 5DMJB 2P24B 2VLLA 2X89D 4DCQB 4XVJL 4L8BB 3C6SA 2MJWA 4H88L 2FATH 3PNWB 3ZYIA 4KY1L 1EGJA 1M4KA 3W9EA 4MJ2A 1GHFL 1G7MB 3OHXB 3MODL 4UAOC 1H3WM 4YDJB 1MFDL 3ZE2F 4YE4L 4IOIA 1FFPB 1F3DJ 5ICZB 2FD6L 3LN5B 1TJGH 5AG8A 5M94B 2APXA 4U1NA 2NY6D 2PW2B 4QNPE 1A22B 4AY0A 3O2DL 3O3EB 1URLA 1WQVT 1M7IB 2ZKHL 5ANMA 1NGQH 1P2CB 1EAPA 1YEKH 1T1WA 5FV1L 2HRPL 3DHJA 3WJJC 4PB9H 5AD0A 4RGND 5D7LA 4FQCL 1VSCA 1J87A 2QR0B 2AABL 1CFVH 4YHNA 4XGZA 2FECI 1U95A 4EZMA 3KXFA 5IVXA 5IWLC 4WO4C 2NNAA 1IAOA 5I71C 3GIZH 5C0GB 4U6XB 5IV2A 3ZE0F 1IGJB 4YDIH 4HEME 1RZ8B 3O8XC 2I25N 4G6FB 2KZ1B 3GHBL 2YA2A 4OI9A 4HWZB 4K07A 3N9GL 3U30C 1HQRB 4BM7A 5I2IA 4BH7B 4OCRL 4G8IB 1U8JA 2ADGA 1FORL 5CHNB 1GH7A 1OSPL 1OTSC 4CAGA 2VDLH 3FHQA 3RTQB 2DQJL 4NQED 3HNVL 4U2YA 4C58B 5IB1A 5JHDE 4HULB 1KULA 2NY5C 3CXDH 5F93C 5B38B 4EUPG 4XPFH 4HS6A 1HINH 4DWHA 3WFZA 2XV6B 5JIHA 3LMJL 3KR3L 3WFHB 1ZLUH 4F58L 1CGSH 1RZIA 4FQXD 5FYKU 4OGXH 1IEHA 3WD5L 4MXWH 3FL7A 4TNWF 5GS0H 3TPUA 3QCUL 3IF1A 1YYMH 4U31A 4NWUL 2FBJH 4Z95H 1NJ9A 3CJJA 1S7RB 1J18A 2YA0A 2YK1H 3TFKD 2V5TA 2JTDA 1MCDA 5KANG 5BO1L 4PS4H 3RPKA 3HE6A 1BWWA 2BSSA 2X7LB 2X05A 5F1OB 5HBBA 3V9FA 3JUYA 4LCWA 2X4OA 4FFZH 5IQ7L 5DD5L 4M00A 1N64L 5EBMA 5IB2A 1CFTB 2MCPL 1KFAL 4TPRL 3WKML 5L6YL 1INEH 4RBPH 4HIIA 3REWB 5LWYH 1ZANH 4NOFA 1D5BA 2R0KL 1RURL 5CEXA 1WWWX 5HYJA 3M8OL 1DL7H 3GMLA 5DI8B 4U6TA 1PFCA 3BJLA 4S0SD 4C57C 4HG4J 4ZO7A 4HXAH 1MJUH 2W38A 4PGJA 2I26N 4YDVA 3P9LB 3O2DA 2HKFH 2JF1A 3BKYL 3HNTL 5F9OH 5JW5A 1K2DA 4TTDC 1JBJA 1RJZA 1MCCA 4WO4B 3WE6B 3VXOA 4N68A 4FABL 5T5FH 5I71B 4ODXA 3H9HA 2WBWB 1DQDL 4U1HA 2IANB 4I0PD 4JZOB 3WL9B 1S9WB 4J1UA 3U2SA 1XZ0A 4AEHH 5F3BB 5EUOF 3CU7A 4X5LA 1BPVA 5IKCA 3T04D 1FNGA 4XTRC 3OKNB 4M1GH 1IGFH 2VO5A 4L4VE 3BHBB 1FNAA 3MRBB 3MRNB 1K4CB 1ZHBB 3T3PF 3HG1A 1OQOA 3IGAB 3OSKA 3VG9C 2LAGB 2I27N 4F7TA 1MWAH 2CD0A 3V0VA 5JPNA 4J8RB 4HLZH 3MLTA 3W9DB 4HHAA 5T1DL 3MNZA 3AGVA 1B0WA 3MRKA 1A7OL 4ZTPL 3UJJL 3MRIB 5IBTL 1RJCA 1C16A 3VCLA 4NT6B 2AJSH 3X3GL 5HYQA 4F7MB 5JW3H 3PGFL 4IRJB 3EO9L 2ERJC 3MCLH 5F7EH 5DHYA 4QTHB 5LAXA 5MEPA 5FYJH 3NA9H 3O41B 5HDOA 1MSPA 2PKDA 1QFWL 2HG5A 3U4EB 5J13C 3DO7B 5ANME 2BERA 2WBJC 3F7YA 4K3EH 3S4SG 3KLDA 1T2XA 1MJ7H 1MRDL 3MACH 2ZUXA 4QRQB 3NZ8A 3MRQA 4JO2L 4M03A 5D7LE 5J0BA 2BDNH 3M1BB 1LDSA 4YHKL 3RGVC 3V0AC 2FYYA 1FL5A 4IHOA 1A6UL 5IVXE 5IR1B 2VRAA 1MI5A 4MB3A 4I3SL 1QBML 1EZVX 2C3WA 4XCEA 5F21B 4DN4H 1CVRA 4QRPA 3BH9A 3VRLF 4MAUL 4F9LC 3SDYL 4YHYC 5E2VH 5B21A 5JOFB 2XZCH 1MLCB 5CUSH 4OLXL 1J1OL 1EFXD 2NY4B 1U3HC 1AIFB 3DXAB 3EIFA 3EKCA 1P4LA 3LSOB 3OJDA 4QCIB 1AGDB 5E99H 3SDAD 3DMMB 2BY3A 2W1NA 1NMBL 3MOAL 2I5YL 4LLYA 4UU9B 5IW6A 1CD0A 3OL2A 1L6ZA 1V7NL 2NPLX 2X9XA 3VXRB 4MJID 2GSIA 5DD1L 2VZ3A 5GIRB 1LMKA 2H45A 4ODHH 1Q94A 1AGBA 3SOBL 3KWWB 5DEZA 1CQKA 4NKOB 2BNQA 2VXTH 4DGIL 1I1CA 5SX4H 1MVUB 2D9CA 4IJ3C 4FG6C 4JRYB 4LHUB 3K1DA 4NJ9H 2JB6B 4ONOA 3VGEA 1F11A 4L9LC 1JRHI 3V6BR 3NIFF 3LAFA 3O6FC 4Z7QE 3I6LD 3VWJC 4ZXBC 1YEHH 4D8PB 4WGWB 4KFZC 1MF2H 3GHEL 4EXPX 4P5MA 4RWHA 1A9EA 2R23B 2HTKD 4UILL 3MFFB 2DQDH 3B9KB 3VG9B 1B2WH 3QNZB 5DO2C 5IG7B 1CU4L 1L7TH 2CKBA 1N5YH 1H9VA 4NO5A 4PJXB 4R0LA 5DSCA 3W2DH 3FQUB 4ZPVB 4LCWE 3WFEH 5GRUL 4LF3B 4QXGH 3RWFB 2P42B 1Q0YL 4M93C 5GGVY 3QUZC 1J10A 3MBEC 2DL2A 1BLNA 2DQIL 4CVXA 2I07A 1ITCA 1HN1A 3MMEA 5MEND 1GSMA 4OFPA 3ZDXE 4JQVA 1WT5A 5E9DB 3LEXA 4MMZC 2J6EA 5HYJE 2WBJB 2LE9A 2B4CL 4M8QB 5IBLC 5I15L 1CLZH 1EK3A 2ARJB 1PJ9A 3TN0A 2WMPA 2R8SH 1N0XL 4U1JA 3FT3B 3F62A 2EYTB 2FGWL 2ADJA 5DMKA 3UJTL 3H9SB 3U9PL 1JGDA 4HIXL 4PJEE 3DSFL 1JNLL 5FYLL 2PO6B 3TO4C 3CFIC 2KPNA 4YHYB 1XCTA 4LSQL 4D0CB 1VGKB 4ELKA 3BPLB 4UB0H 1TCRA 1WFUA 2VLKE 1QR1A 5HVFB 1LK2A 1LEGB 3ORJA 4RA0C 5KVMC 4F33A 1I7UB 1NGYA 3NCBB 1W2KT 1FG2A 3HG1E 4RFOH 5JIKA 1IFHH 4LAQH 4BELD 2AGJH 3EFDL 4JGUA 5J57B 1DBBH 3K8KA 1F5WA 3IDYB 2G75A 5CEYA 3HCVB 5DJ0B 3TBWB 1N6QL 2DD8H 1NLDH 2WQRA 2Q1EA 1F4WL 5IIEA 4TTGA 1C5BH 1LK3H 2AJXH 5JPMB 4Y2DD 5B8CB 3QO1B 5HJ3A 3MV01 4KC3B 3BO8A 3STLB 4LKCA 4NSKB 1OB1B 4R2GC 1Q9OA 2XA8H 4LEOB 5FUZL 4BQBA 2GJ6D 1HCFX 1KJ3H 4XP1L 5L0QB 4L9LB 4G42B 3O6FB 2X89A 2E3VA 4JFED 5EA0H 4WCYH 3ZHKA 2Q6WB 4ZAKC 4N0UA 1KCSH 5FM5M 2J88L 4ZQKB 1J0KA 1VPOH 1E28B 3D39E 4X0KA 1E4KA 1RUMH 1F3JB 4X4YA 5I19L 1A6AA 2AXGB 1FZMA 1ZT7A 1MI5E 4HUUB 5E8EA 4AEFA 3B3IA 4OFKA 4XAWH 3WYRA 4HUVA 2X1QA 1G0YR 4QRPE 1DQLH 2OS7A 3LH2L 4NCDA 1U8HB 1SBBA 1HDMA 4OCNC 3VJ6B 2Z8RA 1OHQA 3MR9A 3PP4H 5AYUL 4XCYA 4JO4L 4P2QD 1H8OA 3GMPA 2Z8SA 3S36L 3QZWA 4AENA 4BFIA 5IGXL 3U79A 1CDCA 1BAFL 3L7FB 5HPOA 4F7EA 3GMMB 4OLUL 4OUOA 1J11A 3FT2B 4OFYD 1JGEB 1NC4A 5DQDL 5EZLA 3NIGE 4BZ2L 1MAKA 3GM0A 2OZ4A 5FXCH 2BNQE 1QG3A 1SQ2N 3TO4B 1VKXA 4DZBB 5GRVL 1CK0L 2H2PC 3C2AH 3Q2CA 4QXWA 1D6VL 3GJFH 1MCBA 5E08H 2WP3O 5D6DA 3IJSB 4UV4L 1ERNA 1A7PL 1P4IH 4QHLB 4RX4D 5DURB 4HS3B 2FSEB 3MGAA 3MYJA 1DN2A 2EEAA 3CXHJ 3O2WL 1IZJA 4PGCA 3HAEG 1OW0C 3BYTA 4XZUA 3T2OA 1XF2A 1CDHA 1Q72H 1U91B 2EYSB 3ILQC 3VW3H 1AKJB 4CMMA 5I1LB 5C8JA 3TP4A 5ICYB 1BHGA 3P0VL 3RWDA 3HR6A 1IT9H 1A6ZB 1GL4B 3QHFL 1SYSB 4RAUB 4U0RC 3BEWB 3DVIA 3Q5OA 5HGGS 2AJZA 4IRZL 1KCLA 1A64A 4HLJA 4LASL 5T1KD 2WLZA 4Y4KC 3IXAA 3X12B 4P46D 1I4FA 2HAZA 4PLJC 3INUH 4R2GB 5CJOH 4UT9L 4HKZA 5DA4A 1CDGA 4EOWL 1FLRL 2UVEA 3J7HA 1OCWL 5E8PB 3CSBA 4DW2H 2EKJA 1U2HA 5IT2L 4ZAKB 3Q6GL 4WFGD 2WM0A 1X6NA 4LDOB 5JLZB 1DUYA 4V2CB 1EX0A 4DTGH 1GPOL 1RZKH 3H2WA 2OJZH 5A40E 3GFUA 2XTJC 3QWQB 5ITFB 4HZAA 4I2XA 3ULVC 2IBBA 2Q86A 3BI9X 5DEGA 2B1HL 2N1KA 1BOGA 3QXAA 1HYSD 3K4AA 1H3VA 4C56D 4LLQA 2P5WB 3D48R 5K59E 3EDFA 5T1LA 1Z9LA 1J86A 3DIFA 4N5UA 4EEEA 1KJ2L 2Y7QB 5LBSL 3MROA 1G7QA 3T4AB 3RDTC 3TCXA 5IMKB 2HT3C 1PKQB 4Q74A 1T5XB 2HJFB 3FO2B 2P5EB 4OZ4A 5DYOB 5AG9A 3WNMA 1RVFL 2R29H 4J3VA 4I0PA 2V9TA 3BQUC 1TZGH 3C60C 4OCSH 3VH8A 3V5HA 5HPMA 3MLXL 4U7MA 4HUMB 4W4OC 4OV5B 3E3QC 3U83A 4NO0B 3MLUL 3VXSD 1HNFA 5KS9F 4MJ6A 2VERN 5ISZD 15C8H 1DQQB 5C0AD 2W0PA 5D7SL 5DK0A 2IF7A 4WY7L 1XGTB 5CJXC 2EIDA 4FFYH 5FYKD 2R9HD 3G6AA 3QDJB 4WI4A 1A6TB 1AD9A 5CJBA 4IOFC 4GW4B 2EDNA 1C08B 4G6AD 4N0UE 5KSAA 3ARGD 4OFVA 2NYYD 1OP5K 2ED8A 3R4DA 5HDQL 5D1QB 3EJZC 3QDMA 3RVVC 4XNUL 1CBVL 4FP8L 1FZJA 1G6RH 5D1XD 1FL3A 1EERB 3DX6A 4U0RB 4KTEH 5EUOB 1QPXA 2V2TB 4PRID 2HWZH 2K7PA 4M02A 4UTAH 2WWMC 2BVQA 1P4BH 3OKDB 4PGEA 5L8KB 2N56A 3WFCH 4HLZG 3ZDZE 1WCQA 4H8WC 3HE7B 5IHBA 1IBGL 4NFDA 4PR5B 5F6IC 4KJQC 1RIHH 3N1PC 2W9EL 4JPWL 4LP5A 1LDPH 4XPGH 4Y5VA 4ZOAA 3I75A 4WW2C 4LNVA 2VOTA 2ENSA 3B2VL 2X1WL 1CICD 4W4NA 3T2PA 5EUKB 3HMXL 3S8WA 4QOKA 4XNYH 2JKXA 4P4KA 1G6VK 2XTJB 4PGBA 1LO3H 5HI4D 4K9EL 3BN9C 4ETQB 4PB0L 5C0FB 2WIIA 1NMAL 2BRRH 4LPTA 4YAQB 3SDAA 5D5MA 2DI9A 1PDKA 1KIRA 1MAMH 2IBZX 3U0WL 4FRWA 4KVNH 3FQWB 4O2CB 1AO7A 1U8QB 3CPLA 2E9IA 1KGCD 4OZFB 3I02A 2LAAA 3IFNH 3EYUL 1QFUL 3RDTB 2DQCL 5ALCL 5F8QC 4TNVK 3D0LA 5BV7L 4JDVB 1U8KB 3SE8H 1IL1A 5KSBE 3GEWB 4KKCC 5LGHH 4EDXA 1FJ1A 1QFHA 2EC9T 5TFSL 2JIXD 4PLKC 3FO0H 5H2BB 4M8VA 3LKPB 2Z91A 4ZG1A 4OD2B 5A43C 4NKMA 4FQQB 1RIUH 1GOFA 1ZLSH 4JANA 4LSUH 5CGMA 3MJ7A 3UYRL 1LO0H 1CS6A 2UYLB 4N0FA 3MPCA 4NRXB 4OCWH 3EO1A 1LQSR 3MBXH 1J1PL 3KPPB 3LRGA 1NL0H 1EUUA 5DLMH 3BIBX 1TFHA 5JQ6H 3QQ9D 1N26A 5A2LH 1MAJA 4WU5B 3BIKA 2YHGA 2FO4B 3ZDXF 2HLFC 4PV9B 4DGVL 1EO8H 4XNQB 4I2XE 3CVHH 4PGDB 3UBXA 4KTYA 1JWSB 2X4PA 3GBLA 5C0CD 4L29B 3WIFB 3T0DA 5ID1B 3KLSA 4N8VA 3TEUA 3JZ7A 2IH3A 3FMGH 2XFXA 2Z92B 4J12A 4PRAA 1XEDA 3TGXA 2JCCF 1ADQL 3NACL 3QEHA 4E5XA 3WSQH 1JTOA 3T0ED 2DQTH 1FE8L 1TZHB 4XWGL 5FB8A 3TCLB 5FO7B 2OTUB 4AIZB 2AK4D 4LQFL 4O02L 1ES0B 5DHVH 5DJYB 2DDQH 4M4PA 1DZBA 3DETC 1Y6MR 3U4AA 4FTVB 1G7LA 2MKWA 2DIBA 5F8RC 1YNLH 5I30H 1GIGH 2CK0L 4KU1A 5GSRB 3ESVF 5D1ZD 3UROR 2DLIA 5C7XH 2AV7A 5CD5D 5IEHA 1AFVL 3HMXA 4RWYH 3O11B 3IFPB 3LB6D 5DJXB 4AL8L 4EUPB 4G7YL 4WI8A 4MWFA 1PW3A 4M9PA 1AGCB 1MPAH 5K9QI 1PEZA 3ZTJH 1AHWA 5GRXG 1J8HD 5T3ZL 5ESVB 1NC2D 3G5ZB 3O4OB 3BKJL 3OKKB 4R4NC 1JPSH 4CU8A 4RIRA 2DM7A 1E6JL 4RFNB 4G9FA 3QDME 4Y2DA 1CXEA 2GHWB 2R0LH 2DYPD 3SKOA 2GJZB 4FN0A 4J3XA 2GJ6A 2OR7A 4ZTOL 2WZPD 3TBVA 2MNUA 2V2WA 3N1GC 2ZUTA 2Z35B 4JFEA 4TSAH 4P5TD 5D70L 3BW9B 4NNXB 4NKDB 3AAZB 3THMH 3SDXF 4M1DH 3RI5F 4MYWB 4JRWA 4NO3A 2RR3A 4WRLA 4U1MA 4XH2A 5I76B 2W92A 4QHUA 3STZA 1KB9K 4Q9RH 2EO9A 4MNGA 4GKOA 4YUEL 5AWNH 4G8FA 1KEGL 4JRXB 3QUML 5EU4B 3FN3A 2OXGA 3GMOB 5SV4A 3ZSTA 2B7DT 3PHQA 1XCQB 4KGJA 2R4RH 4FOMA 1EDQA 2GSGA 3NTCL 3PWNA 4L4TB 1N6VA 3ZKNC 1GGBL 3O9WD 4AJ0A 4QOKE 1SEQH 2VISA 3PF2A 2DLFH 1T2QH 5ADOH 5J1AA 5MHSE 1GGIL 4P2QA 4Z7WF 2ZNXA 3PV6A 4NBYB 4LCIH 1RUAL 3QAZC 5DEFA 4GO6B 5IMLA 1BBJA 5D5ME 1ZHKB 2QSCH 2V5MA 5K93A 3QRGL 2PCPA 4CU6A 3EO0A 5I1EH 3JTSA 2PXYD 1AO7E 4HWEL 1IAMA 4OFYA 1JGUH 2UV3A 3GMNA 3IETA 3WS3B 3DX9B 1A4JA 2L7JA 1RULL 4FXGB 1UEMA 4GH7B 4WWKC 1T3FB 4XP6H 1R3IL 2LABA 1ADQA 4DOHB 4G7VL 1JMXA 1J7VR 1D5XB 4KK5D 4J3SA 2GITA 1OTTC 3DURB 1F90H 2E7CA 2IPKA 1WLHA 4PJ9B 4RX4A 2GK2A 3QFDB 1R5IA 2IMMA 3RKDC 4JJ5A 1MJJB 3NIDE 1CCZA 2EDBA 3QG7L 3VMPA 4IMLA 1EGJH 1NBYB 2NR6D 4XP4L 2GK0B 4QF1A 4P49A 2IG2H 5DWUH 3ROLA 4GG6A 3KDMB 2AV1B 4KHTH 1FNEB 1HXMB 3TC9A 5DHVB 2BNUB 4PD4K 7FABH 4UIMA 3FN0L 4HDIA 3RKPA 4YHLH 1IGYA 3U4BH 1LO2L 4Y5YB 5T1KA 5B3JE 4Q97A 2BSRA 3RWCB 5KSUB 4S0TD 4XMPH 1S5HA 3CNKA 4ONGL 2B20A 2DQEL 2ZCLL 1OAUH 4YEFA 3QCTL 4MDJB 5IMOB 1BJ1H 5I1KH 1WTGT 1BMGA 1X5YA 2NZIA 4U3CA 3LEVH 5I74C 5BQ7B 1A6WL 1PX3A 2QTEA 5GXBB 1YC8A 3QXUA 4P2RA 4ELMA 4KJPC 3BD3A 3UTSB 3BE1L 1D6EA 4G80B 3BT2L 4MSWA 3GSVB 5AUMB 4M1CC 3S5LG 3O3UN 1EHXA 2J1KA 2EKSB 2CR3A 1I3RA 5DJDA 4BUHA 1BF2A 5ERWA 1N6UA 1XF1A 4JZJC 5GQBA 4RNRA 5KVFH 3PGDA 4C56A 3PGCB 5JNYA 1JZ6A 2ZCHH 4LBEB 1G9ML 2D2OA 2I9LB 3QUMA 3VGAB 1JPFA 4ZUUB 4PJ5B 3MLZL 5GRJL 1HSAB 4UNUA 4PPTA 2G5BA 2EDWA 4HJGB 3QAZB 1U41A 4QXUH 4MB5A 3B5GA 3RZCA 4O2EB 3GSNB 1UM6H 1RU9L 3LQAH 4NNPH 4Z0XA 3AXLB 2JLLA 3REVA 3TBYB 4ZUSA 5HVGB 5EC1B 3MRLB 1YNKL 2AAVA 3VXME 4IRSD 4UV7L 4OGYH 5EO0B 2YD6A 4H25B 4RAHA 1F3RB 1P9MA 2F58L 4XVUD 2FNBA 1CFQA 5I1AA 3JV5A 3WCYA 4G9FE 1HEZB 4KK9D 4QWWC 3MOBH 2DIJA 4WWKB 3VXSA 3ZTNH 5KG9A 1H0DA 5CD3A 2VABA 1YEEL 5EZIL 1CXFA 5ISZA 5TGBA 3HPLB 2GJ6E 3UJIH 1KTDA 3BEVA 3EOTH 1AR2A 1QBLL 3VDCA 3RNQA 4OKVB 3CFBB 1J12A 2DM3A 4U6HA 4MDIB 3GO1L 3ARGA 1FZKB 4P4RB 3A67L 5GS1A 5CEZL 5LXGH 3WFDL 5TDOA 3WUWG 4NM8L 4MNGE 4KI5F 4L4VB 1ORSA 2ORBL 3S9DB 3LQMA 1MHHA 1AI1L 3U7YL 1UWXH 2VE6A 4H88H 3ZDZF 4N9GB 4WFFE 1JGLL 5JR1L 1UXSB 3MOQA 5BS0D 1KNOB 1GHFH 1LEIB 3G9VA 3MODH 2IH1B 1Q1JL 2VLLB 1U8LB 4YE4H 1JZ8A 1XGPA 2CPCA 2FD6H 2EDDA 2JJTA 4ZO8A 3V8CA 5KS9B 1CD1A 4MJ5A 4WFEE 4YO0A 3W9EB 4P2QE 1NCUA 5LVEA 4BQ9A 3O2DH 4ISVA 3C6LA 4G8EA 2ZKHH 4IOIB 4UIKL 5DTFA 2Q7YA 3D9AL 4U1NB 2HRPH 3LQZB 2Y23A 3HC4H 4IDJL 1CICA 5I74B 1BP3B 5IB4B 4FQCH 4JY6A 3VGHA 4LVNC 2AABH 2ARJQ 1KYOJ 2FEDC 5DMGC 4DFIA 1BGXL 5ANMB 2HT2D 1EAPB 5SWZD 3D3VD 1FO0A 1D5ZA 2XWTA 1JWMA 1TITA 2WINB 1K8DA 2QQKL 1X5KA 5D7LB 3B9AA 1T20B 4U0QB 4X7DC 1VERA 4YHNB 4FA8A 3CDFA 3QIWD 4OCYL 4JZJB 4XGZB 3VE0A 1U95B 3OF6D 1LEKA 3T1WA 2FO1A 2AKRA 3KXFB 2DTMH 4KRPC 5DC4B 4D94A 5FCSH 2NNAB 3SO5A 3GHBH 1IAOB 4WI7A 2YUWA 4XWOD 4YQXL 3N9GH 5IV2B 1G1CA 3HB3C 5HGHB 1AGFB 1E4WL 1IGML 4OCRH 5A2FA 1SVZA 1BJMA 1FORH 3TF7C 1Z0MA 2XQBL 1OSPH 3VD3A 4E41D 1G84A 2VAAA 3HNVH 4NKQB 1F4YL 5I2IB 4GG6E 1II4E 4O4YL 4Q9QL 3VFRB 4BFEA 2DN7A 2YPVL 1MIEL 1U8JB 2ADGB 2JIXA 4XX1E 2VN4A 2HN7B 4HBQA 5IB1B 2A0LD 1O7VA 4N0CD 4OLYL 3KR3H 3NABL 1SJVA 1MJ8L 1NBVL 3SGKC 4YHOH 2BY2A 2Y5TB 5T3ZE 5IM7A 3Q5YA 4HS6B 3WD5H 4IOSD 5KAQG 3QCUH 4JFZL 4JJHA 4OT1L 4NWUH 2BVEA 2CDFA 2VXUL 2XKNA 2F74B 5GS0C 3KPSB 2HVJB 4ZD3L 4NQCD 4P2RE 4ELME 1T66C 5BO1H 4PY7A 4FMKA 1QPPA 4DKFH 5E5RB 4CJ0A 5SWSB 4ZYKA 2W60B 4WFHE 4KUCD 5C0CA 1WBXA 1NAKL 3W82A 2AK1L 2XWBA 3H7LA 1MQKL 1S7TA 1SEBB 4OF8A 4CADB 4TNWK 5IQ7H 5DD5H 4C56E 3HE6B 1BIIB 3OR6B 1HH9A 3IAPA 2UWEA 2MCPH 1KFAH 4TPRH 4P23D 1XMWA 1IKFL 5IMMA 2R0KH 5JW4N 1MFAL 3VGFA 3T0EA 3QEQD 3LKOA 2PYEB 1H5BA 1NANI 2N7BA 4AYFA 3M8OH 5EBMB 2XWJB 5FGCE 2AK4A 3VFTA 4HIIB 4XBEH 5DD6B 3X14B 1Q9LB 3GIVA 4KPHL 2E7HA 3RVTC 1K4DA 4LVNB 2NTFB 3BKYH 3HNTH 3GMLB 2E6JA 4GS7B 5C6WH 3CMOL 4FABH 2X4UA 5D1ZA 3O45A 1DQDH 3VXSE 1W72L 4IIQC 2CXKA 3ILPA 1RJZB 2F53A 4Z9KB 4DUVA 3OJMB 3VXOB 1FHGA 4R96B 3HAEB 4ODXB 3H9HB 3EOBA 4JY5L 2C4XA 2XXCB 3L6FB 1EZVY 1NMCC 3CGTA 1ZT1B 3LZFL 4U1HB 3L3IA 1J8HA 1C5DA 4EI5C 1A3QA 1OTUC 4J1UB 3U2SB 1XZ0B 4I18A 1P7QA 1LD9A 4JVPA 2XRAL 4KMQA 5EIIA 5IKCB 1FNGB 1T83A 2XXMB 4OZHA 1IM3A 4MXQC 4ZFGL 2AW2A 4QLRA 2DYPA 5T1DH 1I1AA 3IVKB 2L0DA 3HG1B 3FQRA 4RRPA 4BZYA 1A7OH 1EH9A 4ZTPH 3UJJH 5IBTH 3V0VB 4F7TB 4Z5RA 5AAWA 3X3GH 3MLTB 2IPUK 3PGFH 4P5TA 1QSEB 3EO9H 3MNZB 3E2HB 3OKYA 1S5IL 3CVIL 1I7RA 3MRKB 3ZTJG 1L7IL 1C16B 4L1HA 3VCLB 1QFWH 5HYQB 3VRIA 4B7IA 3H3BC 3MRCA 3OV6A 2AVGA 5DHYB 3PHOA 5LAXB 1MRDH 5MEPB 5C9KA 3T08A 1BBDL 3RUGF 4R8WH 4K3HA 4JO2H 3FOLB 2HG5B 5TDNB 3SGJA 1IC4L 3O9WA 5K9JL 1JN6B 4ODSL 4YHKH 4HV8B 3OAUL 1A6UH 5CILL 2H1PL 5KOMC 4LKXA 1NFDA 1QBMH 3NZ8B 4FNLL 5GGRA 2X9WA 4PUBH 1ZVHA 4HK3J 3KHOA 1A6VL 4MAUH 2ZJSL 1HWGB 4S2SA 3SDYH 2FYYB 1FL5B 4IHOB 2UVFA 4CUCA 1JPTL 4OLXH 1J1OH 3SDXB 1EFQA 2P48B 2VXQL 2PXYA 1ZT4A 4XCEB 1KGCE 3FB6B 4S11A 3T3MF 3BH9B 4IS6A 3RA7L 3O8XD 3BH8A 2GT9A 3U36B 2LVCA 1K3ZA 1NMBH 3MOAH 2I5YH 3BZ4A 4MD4A 3UXFA 3DRQB 5C70A 2DLHA 1FZOA 1V7NH 1KOAA 3ULSB 5DD1H 4HK0A 5GGVH 3QI9C 1R0AL 1YMMD 1YEDB 4J3OC 2WWKT 3SOBH 4LLYB 5IW6B 1MRCL 4ZO9A 4Z7WB 1I1FA 3GSUB 2V7NA 2P49B 4DGIH 5BW7C 3MV9D 4IIQB 4OD1L 3MZGB 4GLRI 1AGBB 4PJFE 4F2MB 1YUHA 4AH2B 3ARFC 2YKLL 5I75C 2MTPA 1ZGLM 4XCFL 1U6AL 4B0MM 3WXWL 3JWOL 5TF1L 4JG1L 3GHEH 4H1LH 5E7FA 1HK6A 4EI5B 1W72A 4H0GA 4UILH 3GSWA 4TUOA 2ICWI 2UY6A 5LGJA 1XH3B 4PJ8C 5I8EA 5JUEH 3PWVA 4ZUTB 4P5MB 2GY7B 1CTOA 1A9EB 1I85A 2ZG1A 4OZIA 3FOMA 5HYFA 1EAJA 5C0CE 3RBSA 5BRZD 1SVCP 4S10A 4EXKA 4OJFL 5CEZE 2CKBB 1VFAB 4MA8L 5GRUH 5B39A 3QDGB 1Q0YH 1QHPA 3VDAA 4L8DA 2PYFA 4R0LB 2UWEE 1QRKA 4WUKL 4LSPH 3LKSA 3CDCA 3HRZA 4KI5C 4OGZA 3T0EE 1BVKA 1EA9C 4B53A 4BFGA 4KROB 5CBAA 1SBSL 1B0GB 3G9AB 3O3DB 4M3JA 3SKNA 3MRHA 2AK4E 2B4CH 3DWTA 4EN3A 5I15H 4HIEB 4X6FA 1Q38A 2RCSL 1RUPH 1N0XH 1FRGL 4PJ7F 3QH3A 2FGWH 3UJTH 5GGSY 4X6CA 1NGWB 2VZVA 4O5LH 3U9PH 1ZEAL 1J9CT 5IFJA 1CT8A 1V7ML 4HIXH 1WZKA 3DSFH 4HSQA 1JHLL 1OLZA 3TN0B 5FYLH 3PQYD 4JG0L 1CDBA 5F7DA 2ID5A 1I8MB 1VACB 4TTDD 2F53E 4L8SA 5E03A 4QRSA 4JPIB 2QADC 3BVNA 4IRSA 3F6IA 1J8HE 1XCTB 1U8PA 2XPGA 4ELKB 5A1AA 1TCRB 2VZSA 3FZUC 4PG9A 4KZEL 3MRMA 1YJDH 3VXTB 3O6ML 4XTRD 4HKBB 1LK2B 4F33B 1Q0XL 3BWAA 1NGYB 3RX7A 1FG2B 1Z9MA 4D9RE 3QI9B 5IJKA 5DJZA 5IROA 5HHNA 4DQOH 3GMRA 4LPXA 1N6QH 4I5BA 3PWLB 1F4WH 1C1EL 4NRYB 3UTTB 4YHZL 4FQXC 1HHJA 2G75B 2HLAA 5CEYB 1J05A 3G5YA 4AMKL 1KPRA 5FUZH 5D2LF 3VFSA 5TE6L 4XP1H 5I75B 5B22A 2HJLA 1MCPL 5HJ3B 5DFVD 4ZMAT 4X4ZA 1ZWIA 5J8OA 4ZOCA 4LKCB 5IVZA 1LO4L 2AEPL 5BS0A 3L3OA 2J88H 4QEGA 1IC7L 2OXHA 2IQAA 5E9DD 4KXZH 3K46A 4PTUA 4NQUA 4N0UB 1NFDE 2BX5A 4MNQD 5I1HL 4M6NL 5E8NB 4MQSB 3SGEH 4DGYL 4X0KB 2LQRA 3CX2A 3KPNA 4U1GC 4X4YB 3RGVD 3PWUB 4DVRL 3LH2H 4P48A 1BQHA 1FZMB 2NY6B 3ARQA 1VEPA 1NCTA 5E8EB 1UZ6E 1WUNT 1WWCA 3EGSA 4JO4H 3IDGA 4U3HA 3DRTB 4HUVB 3MRJA 2W9DL 3ETBF 1QSFD 3D3VA 5SWZA 5IGXH 1B9ZA 1S8DA 1BAFH 1U8IA 1HDMB 4LSDA 4R7DA 4RGNB 4G9DA 4XCYB 1U3HD 2GFBB 1CGUA 1MFNA 3GMPB 4U1LA 3TBSA 1MFCL 3QZWB 4AENB 4BFIB 3ULUD 2ZUUA 5GPRA 4CBPA 2Y1VA 3K80A 1PG7W 2DMKA 2Y6SC 4ZDHB 5DQDH 4BZ2H 5DC0A 1C7TA 5ITBL 4QHNB 2X42A 4NQXA 1JNNH 5KANI 1CK0H 1D6VH 4GBXA 1JNHA 4UV4H 5EZLB 1A7PH 1JNJA 1MY5A 1KG0B 4XPAL 2O5YL 3O2WH 4K94C 1I8IA 4FG6D 4NQEB 1FGVL 3MUZ1 5F7NC 1WAAF 3FFDA 2P24A 4NRZB 4XCCL 4ZXBD 3VWJD 3SN6N 4DCQA 5IB3A 3MYJB 3PNWA 3RPIB 4PGCB 4XZUB 3GZKA 4OBRA 1OGTA 1SJHB 4GFTB 4OZIE 3QHFH 4HUWB 4OLVH 5I8CA 5CP3A 4CMMB 5DO2D 1F6AB 5IB5B 1HNGA 5C8JB 4ELMF 4LASH 3KLHC 4LHQB 5ICZA 4KMTL 3OJ2C 4PG2C 3RWDB 2X70A 3GSOB 5HGDB 4FQXB 3TZVC 2ZUWA 2AJZB 4NQCA 4UT9H 1ZVSA 1FLRH 1P2CA 1OCWH 3QUZD 1CL7I 1SM3L 3OR7A 3MBED 5IT2H 5I8KL 3Q6GH 3ARWA 4HKZB 3T0WA 4L3EE 4LGPB 1EEUA 2OI9C 1HI6B 1GPOH 4J3UA 4X6CE 5J89A 1JFQL 4M5YL 3SE3A 4PRBB 4LCYA 5F7FA 3BUTA 5C0GA 3MLWL 3V0WL 2EH7L 4WEMB 1LGVA 1RZKC 3QEQA 5E6IC 1RZ8A 1QYGH 1XF3A 5EN2B 5HVHC 4ZFOL 4U1GB 4CN6A 2BOBA 1MLBB 2J3SA 4HWZA 1HQRA 2Q8AL 2J5LC 5DEGB 5T3XD 4BH7A 2NY5L 1RIVL 1KJ2H 5JDSA 3TO4D 3IKCB 5LBSH 1GAFL 4G8IA 1BOGB 3QXAB 5DRXA 5E2WL 3DHMA 4LLQB 5TQ0L 2CLVA 2AEIT 4NZRH 4K7FA 3DIFB 4I1NB 5DF0A 3SO3B 4JREC 4Z7OE 2IQ9L 3MROB 4PY8I 5B38A 5F7KC 1S78C 3QBTB 2EDLA 1R3JB 5FO9A 5C86A 1CZ8L 2CSPA 3BKML 3FAXA 3WFHA 3G6DL 4AT6A 4I0PB 5DVOA 2HFTA 5TE4L 3EYFA 3F58H 4UQ2B 1UH2A 3MRFA 5D7SH 3VH8B 5HPMB 4WY7H 4TQEL 5I17B 4LK4A 3EOYG 1OPGL 4AM0B 2QLVB 1TQCB 4U6VL 1GRWA 1EXUB 4MJ6B 1UB6A 5BS0E 1CVSC 2WSKA 2LTQC 5KVDL 4JZNB 5HDQH 2D7OA 4WI6A 4GKNB 1W0YT 1ACYH 1CBVH 1UCBL 2X7LA 1RZ7H 4FP8H 1AD9B 4QTIL 3PWPE 3MJ8B 4ZAKD 5C0IB 4F37F 5JW4Q 3VXQA 5E0QA 4YX2H 1FZJB 1CFTA 5IUSA 4TYUA 3QRFM 3DX6B 4QYOA 3TO2A 2YOCA 1ORQB 1H15A 2W9EH 5SWZE 2BVQB 3D3VE 5E24E 5IBUG 4JO3L 3LPGA 3WJJA 3B2VH 3P9LA 4YXLL 4UUJA 2FHCA 3HNSL 3HMXH 2C4FU 4Y5VB 2OI9B 1FFNB 4PJCF 3I75B 5IWLA 2EDHA 3LS4L 4WO4A 5FHAL 1P6AB 1VGEH 3WE6A 5DR5L 4K9EH 1UT9A 3RP1A 2ITDA 1TJHL 2EEDA 4JO1L 4PB0H 2J8OA 3L3JA 1NMAH 2D0FA 5ELIA 4N5ED 4HFUL 3KPRD 3O8XA 3IU4L 4OI8A 4LIQL 4PGBB 1EFXB 4QGYA 4WEBL 2O5XH 4N90D 1A7BA 2R1YA 3U0WH 3OKNA 1DBJL 4NQVA 4NBZB 3MUHL 2WIIB 2VLME 4E0RB 1K4CA 1NBZB 1ZHBA 3SDAB 1QFUH 2DQCH 3UYOD 1YMMA 1FCGA 4FQPA 5ALCH 2ZUQC 4ZFOA 3KGRA 5BV7H 1S9XA 3NCEB 1AY1L 1CE6A 3W9DA 4MJIB 5GGTA 4JFHD 2OL3B 1YEJL 1IMHC 5TFSH 4KQ3L 5DZNA 3MRIA 3ILQD 3PDGA 1I3UA 5D7KE 1IL1B 4TVPL 4LSSL 3BZFA 3WUWB 1FJ1B 4YNYA 4QTHA 5FUCC 2HRLA 5EPMB 2IAMD 4TSCL 2MHAB 2Z91B 3BMVA 4NQCE 3U4EA 2KQMA 1OGAD 3DO7A 1MCJA 4MCZA 4Y4KD 1I7ZB 3O6LL 4NP4L 4JFPA 5BRZA 3O0RL 1JYWA 4DEPB 2LTQB 2QJDA 1AXIB 4DN3L 4HWNA 5CFHA 4DGVH 1GGYA 4EDWL 3HZYA 4DAGH 3UAJD 3SE4C 4H1LG 2EDQA 4LSRH 1YZZA 1MLCA 3BPOC 3ULVD 3DXAA 3HFML 1RHFA 2X4PB 2VUOA 5F70A 5MENB 3TYFB 3NACH 1AGDA 4Z7VA 1FE8H 4NC1E 4PRAB 3P9MA 4F57L 4O02H 3PQYA 3VXRA 5DRZA 4E5XB 4X5WA 2YUVA 3BESR 3RDTD 4NUJB 3B8SA 4PJGA 3OAYK 1FSKB 4NDMB 4NKOA 2CK0H 4OZHF 1F4XL 4PJBA 4LLVB 4NC2B 1MVUA 1AFVH 1AGEB 4LHUA 3BQUD 1QFOA 3E8UL 1KB5H 1G7LB 3ARXA 5HTSA 3C60D 3KPTA 4AL8H 2XZAL 4D8PA 5CLTA 2A83A 5HYEA 1CD9B 4PJ7B 1E4XH 4JFDD 2GQHA 5T3ZH 4PJHA 3X11B 1J5OL 4CMHC 3BKJH 4XC3H 2APBA 2YPLD 3H3KA 1EO7A 1RFDL 4XCNB 2E7LC 5KVGL 5F1SA 4MWFB 1E6JH 3QIBC 4G8GD 1X44A 4PJXA 3IFLL 1BEYL 4IOFD 3VFGL 3PP3K 4OCXL 3FQUA 4ZTOH 3OZ9L 4ZPVA 4RIRB 5BOZG 3P4OB 1EBAA 4P46C 4Y2DB 3RVVD 3H3PL 1NCAL 5D70H 5ALBL 1BF8A 1AD0B 4JDZB 3R06A 2GJ6B 4X7SL 2RFXB 3TBVB 5E9DA 2H2SC 4JFEB 2WBJA 4YUEH 4Z7NE 4I9WD 4X99A 4Z8FL 4M8QA 3LD8B 3QUMH 3UTOA 4MNQA 4D0BA 2ARJA 4U1MB 3BZEB 4TUKL 4HG4K 4B41A 5H8DA 2FEEI 2P47B 3OKOA 4MNGB 4HUXA 1GGBH 2E5EA 4L8CB 3RGVA 2GJJA 3ARBC 4G8FB 4KKLC 2ZUVA 4PBXA 3VI3E 3PHQB 1GGIH 3KPMB 5D2LB 2A1WL 4NJAL 4E42A 4KKAC 3RI5K 4F9LA 1CGVA 1RUAH 1PZUB 2VN7A 3C5ZC 2VISB 3GK8H 1VGKA 4XVTL 5J1AB 5DD3L 2HTLD 3BPOB 1U3HA 1XGRA 4P2QB 1MQ8A 3QRGH 4XAKD 1AQKL 3PV6B 2Z4QA 2IADA 5I8OL 4R4FL 2NXZD 5A16B 3BD4A 5DEFB 2YD5A 1A7QL 4WHDA 5IMLB 1BBJB 1VFOA 3S88H 1YMME 2A6DB 2VR4A 4EKXA 4WENB 2VUYA 4QHKI 1HHIB 1RULH 2PCPB 3EO0B 3JTSB 3PJSB 2BJML 3WHE1 1X7QA 1YYLL 3D2UD 1R3IH 4K2UL 4RCAA 1EVTC 4ZNCD 2B39A 4J4PC 2QSTA 1XGUA 4G7VH 3OXRB 3V79C 2YUZA 1N4XL 1CLOL 4GRLC 4Y0GA 4KKCD 3DI3B 1MVFA 3GNML 1OB1A 4NSKA 4XXCC 3STLA 1NLBH 1U8OA 4LEOA 4OZIF 2GITB 4MA7L 4PLKD 4XP4H 2IPKB 1QLEH 3VI4E 4L9LA 4Z0BL 1OD7A 3NPSC 3O6FA 3VWJA 4ZXBA 1R5IB 2AQ1A 3OPZL 4PRNB 2Q6WA 1I3VA 4CW1A 4IMLB 3G5VB 5F88A 5FUOH 4QGTA 1M7DB 2MPAL 3VD5A 4QF1B 3UEZA 3ROLB 1LO2H 4G3YL 5D1XC 1NKRA 4H26B 3E1F1 1ETZA 3ZHDA 2QL1A 4Y4HC 4ONGH 1IGYB 2DQEH 5T1KB 3QCTH 1ONQB 5DDHA 1WWAX 4P46B 1QBBA 3QUZA 3VJ6A 1L4IA 1UKTA 2CQVA 3CK0L 3MBEA 3WJLC 5CWSB 3QUXC 3DXAE 1FBIH 1UB5B 2JJUA 5DJCA 2NY0C 3FJTA 1A6WH 1IAKA 4S1DC 1D9KD 1B88A 2DBLH 4Z7VE 1NFIB 3IDMB 3BE1H 3K81A 3BT2H 1KTLA 5F7UA 4I3RL 3GM8A 5E8OB 1U42A 2CLZA 4BSVA 1QVOA 1FNHA 2C9AA 1Z2KA 3VXRE 1KJMA 1KCRL 1KLGA 4ELMB 2IBGA 4CJ1A 3N1MC 5HI4C 4MSWB 3O3BA 4PJGE 1ZS8A 3IFOB 1G9MH 7CGTA 5BZDB 5DJDB 3TO4A 5ERWB 4DZBA 3MLZH 4PJBE 5DJ2A 5GRJH 4RNRB 3PGDB 4C56B 2Z31D 3C5ZB 5JNYB 4JRYE 2XQYG 3DETD 4NQSB 1RU9H 1GYAA 2MQ3A 4HS3A 2I60L 2FSEA 4HUKB 2G5BB 4KDWA 4M7KL 4UV7H 1DANT 3LQAC 1X5FA 2EYSA 5FGCB 3PWJA 1R24B 4LIQE 4KUZL 2DWEA 4N1CA 4ZUSB 2Z8VC 3ZT6A 3FB8B 5KW9L 2H9GB 3V5KA 4PJXE 1YEEH 5EZIH 1SYSA 1NAMA 3BEWA 5I1AB 5TQ2L 1CFSB 4GRLB 2XNAA 1QBLH 5ICXB 3X12A 4HS8L 3V4VH 3VXSB 1H0DB 5ISZB 5C0AB 3DVNB 4U6YB 2VLRD 3A67H 2VDPL 2OQJB 1KTDB 5CEZH 2K1MA 3BEVB 5E9DE 5SV3A 3WFDH 5L2JB 3NPSB 4NM8H 4JM2F 2ORBH 1FVCA 4U6HB 3LV3B 1AI1H 4ZAKA 3ARGB 1JGLH 4MNQE 5JR1H 4MS8C 5GS1B 4LCCC 3QXWA 4IEFB 3H9SE 1Q1JH 4GUPA 3UTSD 3BYYA 5D1XB 2EE9A 4OM1L 1DLFL 2YN3A 2BP3A 3C8KB 5C6TL 3H42L 4BH8A 4HKJB 4PRIB 4Y4HB 1RAMA 4PV8B 3ZKND 4LPCA 1OVZA 5I1DA 3IDIA 3DVFA 4UIKH 1XGPB 2H8PA 2P5WA 3D9AH 4APQC 2IJ0C 1CD1B 3U9UA 1NQBA 4IDJH 4OQTL 2BZDA 4H20L 5GJSL 5D7IA 5ID0A 3WNPA 3T4AA 5JOPD 1BGXH 1KN4L 3X13B 2Q7YB 2BVUA 1PBYA 3FO2A 4HC1A 4OSUL 3QFJD 1CICB 2QQKH 4OV6F 4K8RL 3H9YA 5J1TC 3QQNA 2YMXL 5MI0C 3OKLB 3FQXB 1FIGL 4JY6B 3VXNB 2I24N 2ATPA 3Q6FB 2ICWJ 3KPRA 4OCYH 3MLSL 4ODWB 1FO0B 1D5ZB 2XWTB 5BXFB 3QISA 8FABB 1JWMB 2ADIB 3V7AE 1K8DB 1WK0A 2CMRL 5SX4I 4OV5A 5CD5C 2LU7A 3EDEA 4NO0A 4GKSA 3VE0B 1RI8A 1FYTD 5IQ9A 1IGMH 2AKRB 2A9ML 3LB6C 5DA0B 1OTTD 2XQBH 5FA4B 4JPVL 4Z78A 3EW3B 2CDEB 4MLIA 1F4YH 3HI1B 5E1AA 4O4YH 4Q9QH 3RKDD 4GW4A 2YPVH 4PJCB 1T0PB 1OW0A 5KBNC 3TVMD 4HQQH 3HPJA 3MLVH 3NFSL 5IFAH 1T1XB 5J6HA 1QSVA 3LPWA 1MNUL 1IQDB 3LVEA 3TM6A 4H8WL 2JIXB 3MO1B 3R8BB 4KUCF 2F8XC 1CN4A 2VXVL 1NBVH 5EUOA 3OBAA 1OGAA 4FFWC 3W11C 3RNKB 1QHOA 4Y4KA 3GBNL 3GI9H 3FO1B 4JFZH 3PDOB 2OP4L 4OT1H 4NM4H 2VXUH 1JHTB 3BISA 4ZD3H 4PR5A 3C9NA 1BQLL 1VCAA 4ALAL 5JTWA 2CDFB 5HHQA 2XKNB 1NAKH 2AK1H 5ACZB 4LRIC 1MQKH 2ICWA 3ZE2E 1MCRA 4KJPD 1F4HA 3IJYA 4RGOL 4AG4L 1IQWL 4RQQB 3FRPA 1Z0NA 4M1CD 3CZJA 3HZVA 5C0CB 4LLMB 5C0FA 1S7TB 1IKFH 1MFAH 1DEEA 2E7MA 2VDOL 1F6LL 2GUOA 1IRAY 1HQ4B 4HT1L 4APQB 3FQWA 3TJEL 1A14L 5H37G 1U8QA 3RWGB 4OZFA 5IMMB 1JTPA 3T0EB 3VXUB 5F9JB 3LKOB 2A6JA 1H5BB 3RDTA 1JE6A 3CXHK 2R69L 3NCJL 2AK4B 4P2YA 2NY2C 4OB5H 4JDVA 4S1QL 1P84J 5IHLB 1NSNH 4JM4L 3ZE0E 3GIVB 4Y4FC 2D4DA 3QCVL 1K4DB 3EDJA 2B0SL 4KK5C 3BQUA 3BP4A 5H2BA 3C60A 3LKPA 1X4XA 2X4UB 5C09D 5D1ZB 4FQQA 3O45B 4JY5H 5L9DL 3MC0A 3BSZL 4W4OA 2DM4A 4QWWD 4YBQC 4JFDA 3LZFH 3OX8A 1NUGA 2AJVL 3KLAA 1A2YA 3P11L 2UYLA 4XXDA 1G7HA 4L1DA 2XRAH 5I1JL 2YPLA 1AXSA 3ALXA 5CJXA 5EBWA 3EOBB 4JFOA 1PSKL 1CG9A 3MSPA 4ZFGH 3EHBC 3H6JA 1C5DB 1NC2B 1UZ8A 4I18B 1NUFA 1LD9B 2FO4A 1ITBB 1DBKL 4F8TA 4XX1G 5EIIB 1ODAA 4OZHB 4PV9A 3D6GA 1M1SA 4Z7NF 2DYPB 4M3KB 5E70A 1JWSA 3FQRB 2EXWD 1R3KB 3CVIH 4P3CL 3WIFA 1FGNL 1L7IH 4Z5RB 5IF0B 4WV1C 4P5TB 3TJHC 3S7GA 2Z92A 2P5WE 4NQDB 3ZL4L 4L4JA 5CJ8A 3VWKC 1QSZA 3VI3F 1I7RB 2YD3A 1BBDH 4DJMA 5BMFL 5EOCL 5FF6B 2IGFL 5D7IE 1IC4H 3VRIB 3MXVL 5E7BA 5K9JH 2EXYC 2FIKA 1TZHA 4ODSH 4WW2A 1PKQE 2OTUA 3OAUH 5CILH 2MCG1 4AIZA 1NGPL 5E2TL 3A6CL 1JPGA 1TLKA 1LNUB 2R4SL 1E6OL 4FNLH 1BM3L 1R3HB 4KAQL 1JF5A 1WBZA 3O9WB 5DMGD 3KPRE 1A6VH 1T89C 5GS2D 3W0WD 2ZJSH 4A2LA 5J11C 3AB0B 2Q3ZA 4GQPH 4FTVA 1JPTH 1EIBA 1KENL 4ZO6A 3GUTA 1E27B 4X98B 5GSRA 5GGRB 2FB4L 1KEML 5JIPA 1EJOL 5JDJA 3LN4B 2YRPA 4S2SB 5L7XH 3O11A 2J8UF 3IFPA 1B6DA 3WN5C 4KRPD 4ZS7L 2HH0L 4EUPA 4OCMC 3T77A 1U8MB 2O61A 1LWRA 2PXYB 12E8L 1ZT4B 3HB3D 5AZEL 1JYNA 3D2UA 3F5WA 1B3JA 4IDLA 5EOQL 2DLGA 5ESVA 1CXIA 2GT9B 1O5DT 5GHWH 1R0AH 2VDQL 3GI8L 4R97C 4XP5L 1CXKA 4MD4B 1MRCH 1QBAA 1ULVA 5MEOA 1YY8A 2PTTB 1ZV5A 1UJTA 4HK0B 3P4NB 4OD1H 3D69B 5EUOE 4XNMB 2YKLH 1OGAE 1MCLA 3CAFA 4WHCA 4XCFH 1I1FB 1U6AH 2V7NB 2YRLA 2N4IA 4NNXA 4OIIL 3JWOH 3BPNB 3AAZA 5TF1H 3T3PE 5I66A 2CGRH 1OT2A 5I76A 4G6ML 4Z76B 1I9IH 1YUHB 2G2RA 5EORH 1TVBA 1KBGL 4BQ6A 3EYSL 1IGTA 3V6FA 4JRXA 1W72B 3V6ZB 3SPVA 3GSWB 5GS0D 3MJ9L 4TUOB 2DL9A 3RAJL 5LGJB 1MEXL 4OJFH 4F9PC 5I8EB 4Z7VF 2XYCA 3PWVB 2XTJE 3F7VB 4JVWA 4O51A 2Q76A 4NGHL 4G6KL 4PY8J 3ULVE 2AEQL 4OZIB 1GGUA 5I0ZA 2E7BA 3FOMB 4WUKH 2VXSL 3HN3A 1RUQH 3VRJB 3QJHB 4JM2C 4WUUD 1JCKA 1DQMH 2DJUA 5B39B 4WV1B 1SBSH 2BVYA 4L8DB 1ZHKA 4PJGF 4O00A 3SKMB 3LKSB 4HGMA 2RCSH 3GDBA 4PJBF 1PVHA 3WLBB 4AEIL 3HRZB 1FVEA 1BVKB 3QWOB 1J0JA 3SKNB 2B4CC 1ZEAH 3MRHB 1V7MH 4M7ZC 5EG6C 1JHLH 4HIHA 4X6FB 3QIWC 3RVTD 2AJ3A 3Q3GA 4N0RA 1K5NA 4NPYB 4X6CB 2K7QA 3ARRA 4KZDL 5IFJB 3I2CL 1ZA3A 4PJHF 2RGSA 4FZEL 3IJHA 3MNVB 1OD9A 4CVWA 3BRFA 3LKQA 3UYPA 1OP5H 1MJJA 5F7DB 2EE3A 3WEXB 4JFDE 1NBYA 5J9PB 2GK0A 3WN5B 4L8SB 3OGCA 1CF8L 4Y16C 3KDMA 4KZEH 5IHUL 3SDCD 2AV1A 3BVNB 1HXMA 4LSVL 2BNUA 1HILB 3EYQC 1Q0XH 2Y07L 2XPGB 1OTUD 2NY3D 2A0LC 4R97B 1YJDC 4X7TB 4K23L 4K7PY 3MRMB 4N0CC 1C1EH 3RWCA 1I1YA 1BECA 4MXQD 4PRHD 4YHZH 1UWEL 8CGTA 3ECBB 3W81A 3S4SA 2VLRA 4AMKH 3I85A 3LHPL 5HHNB 3NIFE 1F02I 4I5BB 5TE6H 1YEIL 4D9QD 3OG6B 1AR1D 3RU8L 2EC9U 2CIIA 1MCPH 1N7MH 1HHJB 1MHPH 5EC2B 3DV4A 3G5YB 1KPRB 1LO4H 2AEPH 3O6KL 5BQ7A 5J7CC 3VFSB 4YHIA 1IC7H 1FFRA 4LQ1A 1G9NL 2HJLB 1WITA 2ADFL 3UTSA 1OL0A 4G80A 2FGZA 3KYNB 4DK6A 1ZWIB 5FYJD 2EKSA 4M5ZL 5BS0B 5I1HH 2DAVA 4HUNB 2IQAB 4M6NH 3TV3L 3ULUF 4JCMA 2GTZB 3PGCA 4PJAA 4PTUB 1UH4A 1OWWA 4FZ8L 4DVRH 4LBEA 4RMTA 3S34H 4FTVE 4ODUB 1NH6A 3PG2A 4P23C 2I9LA 4UT7L 1YPZF 4XAKE 1H3GA 4GXUN 2VR9A 4UINL 2W9DH 1MREL 1S7WA 4O2EA 3SDDC 3I50L 1WISA 5EIQA 3EGSB 1A0QL 3IDGB 4M48L 1HKLL 3MRLA 3MRJB 1MFCH 5SWZB 3D3VB 4F15C 5EO0A 1U8IB 2C3HA 5JXEC 4R7DB 4M7ZB 5DT1L 1TDQA 3X17A 4WWKA 3QIWB 3TBSB 1FYTA 5IW3A 2QKIA 1MCWW 3HPLA 3QUYC 1DSFL 4NQXB 3JWDL 1EHLL 3RL1B 2O5YH 4MDIA 3C5SB 4P4RA 4N1EA 3LS5L 4E41B 2D7TL 1YMHA 3ARFD 2H32A 4J6RL 5DGRA 3UDWC 3PL6C 1YC7A 4XVSL 4M7JL 1UADC 4JRXE 1P69B 2ATKA 2B2XL 5C07D 1GXEA 2IH1A 3FFDB 1U8LA 4PJ8D 4UT6L 4YPGB 5IB3B 4KMTH 5GJTH 5KS9A 5DXWA 4XNZB 1OGTB 1T7XA 5I8CB 4H0HB 4L3CB 3NCMA 1YEKL 3KPLB 2ZUYA 1KXQE 4POZC 5KN5B 2WQ8A 4PB9L 1PY4A 2X70B 4KQ4H 3LQZA 3VFNA 5LG1A 1SM3H 3QWRD 4PGZA 3C8HA 5IB4A 3Q0HA 3D18A 4NQCB 2DOCA 1ZVSB 3QNXB 1FVDA 5F89A 4YXHH 1EO5A 4KI5D 5FA3A 3LRSA 4JPKL 2X4SA 2WWKO 4M5YH 4AQOA 5I73C 4JKPL 2WINA 3OR7B 4ZNEE 2E9WA 4XPTL 1T20A 3MLWH 3V0WH 2EH7H 4P5KB 4LRNL 4JZJA 5DGQA 3ET9F 4DOHE 3RX8A 1WZMA 5ABDE 4LCYB 2NW2A 3TH2T 4P23B 3MCKB 1QOKA 5HGHA 2Q8AH 1ZGLP 4ESKA 1AGFA 3QEQB 1RIVH 2OSLB 4LEXL 1XF3B 2VDLL 1K6QL 1GAFH 1T0MA 1GZPA 2P7TB 2RQ8A 4HK3N 4BQ8A 1NCNA 2BOBB 5TQ0H 4EVNA 3SJVD 3IU3A 4GAJH 3RVWC 2QADD 3VFRA 4XPFL 5JDSB 2IQ9H 1GJIA 1MRFL 4NN6C 4PYHA 5DRXB 4OF3A 2HN7A 2CLVB 3QIUD 4FQ1L 5D96C 1T21B 5C09A 2EECA 4K7FB 1MCIA 1CZ8H 3FZUD 2CDGB 3HC0A 3G6DH 5DJAA 3SCMC 2V7HB 4UNVA 5TE4H 3EFFB 5D72L 4KRLB 2Y5TA 4YBLC 3QP3A 5FO9B 1OP3K 1HHKB 5HYSG 4TQEH 4X4MA 2BRQA 1OQXA 1UACL 4KJYB 1OPGH 1IAIL 4AT6B 4U6VH 2YK1L 3EYFB 2F74A 2CJUL 2WUBL 3KPSA 2HVJA 5MEQA 3MRFB 5JMRA 4HWBL 5KVDH 4ZSOA 3RWJA 5F6HI 1A02N 4OM0L 5F7WC 3UTSE 4ENEC 4Y7MA 5EU5A 3VG0H 2R15A 1UCBH 4GQ9L 4QTIH 5SWSA 2W60A 3EBAA 3Q5TA 1UB6B 2UY7A 1SEBA 3QDHA 4CADA 5D7IF 1NUDA 4QHKJ 5JOEA 3P9WB 1BIIA 3OR6A 4PJAE 1XIWD 1NGXB 1QLRB 1T03L 5GZNC 3ZKSD 4GAGL 3VXQB 4PJ5E 2J2ZA 4UAOB 5JOPE 2PYEA 3JV4A 4FQJL 3H9ZA 1CTNA 4HXAL 1MJUL 2XWJA 4JO3H 2OTWA 3L5XH 4OLWL 5DD6A 3X14A 1T22A 1Q9LA 4QYOB 3TO2B 4YXLH 1QQDA 2NTFA 1H15B 4F37K 3HNSH 3W0WA 3D1MC 4QRRD 1L9NA 3LS4H 5FHAH 2HVKA 5SWQB 5DR5H 3MZTA 3L95B 1TJHH 1WIOA 4JO1H 4UUJB 4OLZL 2B5IC 4YIQA 5CZVH 4HFUH 3U46B 1JP5A 3R0MA 4U49A 3IU4H 4LIQH 4UI2A 5EB9A 2Y6SD 3HAEA 1EVUA 4R96A 2C7UB 4WEBH 2VLJD 4RISL 2JCCA 2ITDB 1DBJH 1D5IL 3V6OC 3L6FA 1ZT1A 2CXGA 3L3JB 1QTYT 2O93L 4U7KA 2EIZB 3TIEA 1VENA 3O8XB 4Q9BA 2CKBL 1ZVYA 2UUDK 2R1YB 1ZXQA 4OF0A 5DZLA 1MHEB 3U30B 1AY1H 2MSPA 4NQVB 3BP5A 3MRDA 4XP9L 5C0BD 4LL9A 3IVKA 1YMMB 1YEJH 3TH4T 4ZFOB 4KQ3H 4WVRA 4X4XB 1S9XB 3WDHA 1RK0A 1CE6B 2YS4A 4DKDC 3KG5A 1NEUA 4TVPH 1QSEA 4LSSH 5FYJL 3MV9B 2C26A 1SMOA 5KS9E 4DZ8A 4FQHA 3SGKA 4TSCH 2J6EL 4K3EL 5D6CA 1HHGB 2DQHL 5EDXA 3KLHD 3BD5A 5B4MD 5DFVC 3BZFB 4CN1A 3E6HA 4LPVA 3TA3C 2EC8A 4YNYB 3ULVF 1EEQA 3O6LH 4NP4H 2WIMA 4YK4C 3TZVD 4Y19D 3FOLA 4HAFA 4P9HC 5TDNA 1P1ZA 3O0RH 4K71C 1EMTH 3MTRA 4YZFF 1JL8A 1JN6A 3QEUA 2OMNA 1KYOK 4MCZB 4DN3H 1A7NH 4HV8A 3B5TA 1IM9D 5EWIL 3KAAA 4EDWH 5J3HD 1UWXK 1Z3GL 4JFPB 1EBPA 5BRZB 2B1AH 5JW4M 1KCVL 5E2VL 1NKOA 5CUSL 4HWBA 2YBRB 4MHHI 3CDGA 3KXFE 3L3KB 2IPTL 4BKLB 2D0HA 1FC2D 3U6RA 1W0VB 3SDXA 3MA7A 2M2DA 1OARL 3HZYB 4OTXL 2A74A 3HFMH 1M7XA 4MXVF 3FB6A 1DJSA 3LN9A 5E6ID 1HSBA 5DMIH 4HPOL 1EHAA 2ENYA 2YZ1A 4X7FC 3U36A 4KVCL 1INQA 2CKNA 4F57H 3DRQA 5C08D 3ULUC 3VFWB 1VFMA 3ULSA 4JAMA 2ED9A 4Z7VB 4KK8D 3DLQR 4X83A 1FH5L 1YEDA 3VD7A 4X9FA 1G0DA 3N50A 3P9MB 2AEWA 2EDTA 2CRIA 2DJ4A 4Z7WA 5D7JD 3GSUA 3PQYB 1F4XH 5DRZB 5M95B 4X5WB 1K9TA 3EAKA 3GSQA 4IIQA 1DVFC 1XFPA 4F2MA 1S78D 4PJGB 4AH2A 3FKUS 4HZLA 5FCUL 4GMTL 2AXFA 1HOCA 1DFBH 4X4ME 1QRNB 5FIEA 4PJBB 4A6YB 3PXJA 1W0WB 4EI5A 5DVLA 1I1RA 3V8OA 3KPSE 2UZIL 2ZG2A 4PLNC 4OUUA 1J5OH 3OKEB 1S7QB 3P3YA 1XH3A 4ZSOE 1RFDH 4WHTA 5KVGH 2A83B 3WHE0 1IZKA 4ZUTA 4TN9A 2PTUA 4KI1A 1ZMYA 2WLYA 5SWSE 3WIHL 4PJHB 4Y8AA 3OAZK 4JHAL 3OZ9H 1PY9A 1VFAA 4LARL 3QDGA 2FRGP 4YH6A 3H3PH 1NCAH 4WW2F 1V5JA 3LEYL 5ALBH 2VSCA 2RJMA 1QR4A 4X7SH 5I1IL 3FCTB 2PYEE 1ZLVK 4XRCA 1B0GA 1B90A 3O3DA 2ERJB 1LP9F 3BGMA 4Z8FH 5IESH 3LKNB 3R06B 4HIEA 5EU6D 4YK4B 4TUKH 3I6KB 1EEYA 5J13B 4UDUA 5IEKA 1MCOL 1NGWA 4OGAC 3RX5A 5C92A 4X99B 1RHHA 1TMCB 2YXMA 4Q6YA 4MA1C 4XBGA 2OZ4L 4MNQB 4D0BB 5EIVA 4NJAH 1FCCA 3OKOB 4HUXB 3IT8D 2A77L 3RGVB 2SEBB 4UB0L 1I8MA 1VACA 5EULV 1QP1A 2VNCA 3V4UL 5DD3H 3UTZA 3M45A 4JPIA 2V9QA 2JCCE 4E42B 5LCVL 5I8OH 4WTXA 2VAJA 1QSFB 2NTSP 4R4FH 2PUQT 3MNWB 2PF6A 4D0DA 1A7QH 2P43B 4KRMB 4CVUA 3MGOA 1U3HB 1XGRB 2Q8BL 3VXTA 2Z4QB 2IADB 4HKBA 4X9GA 3QO0A 2BJMH 1YYLH 4GRWF 4JDTH 4K2UH 1IGIH 4K3GA 3QI9A 1WFOA 2FLBT 1B4RA 1BD2D 4J3TA 3PWLA 4JCLA 1YPZB 5L2KD 3AMLA 4RDQG 1CLOH 4NRYA 3UTTA 3ARZA 1X7QB 4LVHC 1QSEE 1AH1A 1HH6B 3U7WL 5BW7A 1AC6A 1HWHB 1XGUB 3GNMH 1AJ7H 3KS0H 2F8OA 3D5OF 3ARFA 5ADPL 3JVGC 4Z0BH 2NMSA 2HMIC 4CN4A 3SBWC 3OPZH 4YDLC 5ETUA 3VFUA 1ZA6B 1FNSL 1U8OB 4IJ3B 3T1FB 4TULL 1VPOL 1I9JH 2MPAH 1FPTH 4PJ8A 3VWJB 4ZXBB 1LO5A 4G3YH 4YJZL 4WNQA 4XAWL 4CW1B 5F88B 5E8NA 4HCRH 4GXVH 1MFBL 3PWUA 5TPWH 1QKZH 3L9RA 3BP6B 3QWRA 3SDXE 1ETZB 3CK0H 1NUNB 5JQHC 4YPJA 3T2NH 3DRTA 3HI6L 3WIHA 2F5BL 3FB7B 3V52L 5DDHB 3V4PL 4M93B 3FN9A 3QUZB 5D71L 3MBEB 3PXHA 1WVZA 2GFBA 5DJCB 1OM3L 4YHML 3LIZL 1IAKB 1KCRH 3ARVA 2VL4A 1KTLB 4ZDHA 2JJWA 4MA1B 2CLZB 4QHNA 4Z7WE 1QVOB 1TVHA 3F6LA 4BSVB 1ZKAA 4N5EC 1KJMB 1KLGB 2BVTA 2XICA 4K94L 2YN5A 3NFPA 4KHXL 3KJ6L 1KSRA 3SJVA 3O3BB 1ZS8B 3ROOB 3O3AB 1KG0A 3EZJB 4KK6C 3S35X 2R2HA 5DJ2B 3B8YA 4LP4A 4M7KH 1FL6A 1PGRB 2HA1A 4NQEA 5JHDD 1KLUB 4UQ3B 3ZSSA 4NRZA 4KUZH 5AZ2H 1UVQB 1IKNC 2BSTA 5CBEB 2V17H 2E27L 5KW9H 3RPIA 1SJHA 4HUWA 3PWJB 2EDEA 4CDGC 2NCMA 5IB5A 1F6AA 5HDBF 2XIDA 5T5NG 2DWEB 3QDGE 4LVHB 4M7LL 3QIBD 4HS8H 3V5KB 3GSOA 5HGDA 3BAEL 4FQXA 2KL6A 2IAMC 2IMNA 1NAMB 1QFWI 1R5VB 2FJHB 2VDPH 2X2YA 3MUGB 3NMEA 4NYLA 2XNAB 3IXTA 1BVZA 4PJAF 5C3TA 4YDLB 2OCFD 5FYJE 3U48A 3CFDA 5J12C 1TXKA 2YRZA 3ZT5A 3HR5B 4DFHA 2H2SD 1HI6A 2DS4A 4LGRB 1FVCB 4PRBA 1T1YB 5ACLA 4PJIA 4OM1H 1WZ1H 1DLFH 4OZFH 3UAJC 2ZCKL 1H8SA 5C6TH 3H42H 3FTGB 4FQ2L 2K9UA 5EN2A 3EYOA 3AC0A 4GRMB 4GUPB 5DMYA 1WFNA 1MLBA 3ARBD 5E5MB 1SYVA 4FFVD 4KKLD 4YDKH 4OQTH 3P77A 5K33A 4BH8B 2VQTA 4H20H 2OL3L 4KKAD 3IKCA 3OB8A 5GJSH 4GW1B 5I1DB 3IDIB 3CIQA 4QRRA 2H8PB 3C5ZD 5DRNA 1RV6X 4XPHL 3RIAK 1MFEL 3AREC 3AMKA 5GGQL 3U9UB 4OSUH 2QSQA 5KSVA 4K8RH 1JK8B 2YMXH 1XR8B 5D7IB 1FIGH 4ZS6C 3VU2A 2KKQA 2V9RA 5ID0B 1TZGL 3P0YL 3MLSH 4NNYB 4IMKC 4M6ML 1R3JA 2G60L 2VLJA 1UH3A 3UTTE 2CMRH 3LKRB 6CGTA 1DBAL 2ATPB 3AS3A 3KPRB 4YFLI 3ZLQC 3HKFA 4J4PD 4UQ2A 5FKAB 5ACMA 4FFYL 2A9MH 3CFJA 5BZWA 1PQZA 1QA9A 4JPVH 4EI6A 5I17A 4X5XB 4GRLD 4AM0A 2VR5A 4PYGA 5EBLA 3GJFA 4GKSB 5C0BA 4UDTB 3IDJA 5IQ9B 3ARDC 2IWGA 1EXUA 3FQTB 1F42A 4BZ1L 4XI5C 3BWUC 4M4RA 3I3EA 3S37X 2ESVB 4JZNA 3NFSH 1G6RL 4Z78B 4GKNA 1CGTA 2E6QA 1MNUH 5E1AB 2HFFB 2HP4A 1JF1A 2HFEA 3MJ8A 4NFBA 4H8WH 3WS6C 5C0IA 2VXVH 3HPJB 1P4BL 3ZZ1A 4M43L 5J6HB 5CS7A 5CMAB 3T4YA 3WFCL 2BY0A 3GBNH 3BXNA 4PG2A 5DVNA 2OP4H 4Y5XC 3GRWH 4R26H 2YC1A 2IAMB 3TZVA 3S5LA 3IS0X 4KWUA 1NGZA 5M7QA 2FDBP 4KV5F 4Y4HD 1OGAB 4G6JH 1SJEB 1ORQA 1BQLH 4KKNA 2VIRA 4KI5E 1S7UA 4ZUVB 4Y4KB 4ALAH 5DZOA 5CJQL 5GRYA 3S97C 4RGNE 3QUXD 1JZ3A 4EQ3A 4NN5C 3C9NB 1LO3L 2NY0D 4WDIA 4RDQF 1FFNA 4S1DD 3WNKA 2DQUL 3HUJA 4RGOH 4AG4H 4EUPH 5HHQB 2P1YA 4GT7A 3SHSA 3LRHA 5E6IA 2ICWB 1PLGL 4U05A 3WV0A 1MAML 2VDOH 2QQLL 3IJYB 1EFXA 2HTLC 5CGYC 3SJVE 5DQJA 3CFKB 3RUGA 1OAQL 3HZVB 3TJEH 1A14H 4RMWA 2NW3A 2NXZC 4E0RA 1DEEB 1NBZA 1RJYA 3B6SB 4FQIL 2GUOB 2LFGA 4NQEE 3QXTA 5BJTB 3TNNA 4P2OC 5EU7C 4JM4H 4MJIA 1DDHB 3KPOB 1LHZA 1K3IA 4YGVA 2DBJA 2OL3A 2A6JB 3CSYB 4X6BB 2B0SH 3HC3L 1QFWM 1RIUL 3NN8A 3QJFB 3K2UL 1X3DA 1OAXH 3V7AG 5L9DH 4OKDA 3BSZH 3WUWA 4BA8A 4WU7A 1VFUA 4LNRA 4OCWL 3BQUB 5EPMA 3BP4B 3MBXL 2AJVH 1G7JA 2MHAA 3C60B 4X6DF 3P11H 4EBQL 5I1JH 1B4JL 1H8NA 5CIPB 1PSKH 4JGMA 1I7ZA 4JFDB 5F97E 2YD9A 4XHJD 4PP2B 3OX8B 3KLAB 1A2YB 4KXZI 5AEAA 4XXDB 1G7HB 1CDUA 1DBKH 2YPLB 1AXSB 5EBGA 5EBWB 4JFOB 4G8GB 1CG9B 5KJRL 5FGSA 5FKPA 1UZ8B 2CRZA 3SGEI 4HBCL 4P3CH 4MS8D 1FGNH 2V5SA 3FMGL 5E4IA 3ZO0A 2AJUL 1G6RA 1VDGA 2H26B 2YD1A 5CZKA 2HKHL 3CLFL 4RSVA 4NCC1 5GISL 4AIXA 5EU6A 5MENA 3TYFA 5BMFH 1IGCL 2DQTL 1OSZB 5EOCH 1D9KC 5JA8B 2IGFH 3MXVH 3VGBA 4QRRE 3S3PA 1TNNA 4LVOC 4HMCA 4APQD 1NGPH 2VDRL 5E2TH 1YQ2A 3A6CH 2DDQL 2R4SH 1E6OH 5KVEL 1BM3H 1PAMA 2FECL 2D03L 5F6IB 3VXUD 4KAQH 2XQYK 1TPXC 2FIKB 1YNLL 3WDIA 4NUJA 1F8TL 4WW2B 1FV1A 1U3YA 4NDMA 1JPGB 3GSXB 1W8NA 2FB4H 1KEMH 1S3KH 4LLVA 1WBZB 5HI3C 1EJOH 2Z31C 4NWTL 1AGEA 1KTKE 1JHKL 3FHAA 4HXBL 4KMLB 2VLKD 4ZS7H 3GUTB 2HH0H 1MCKA 1MPAL 4LMQI 5T1MA 12E8H 1LILA 2NXZB 5AZEH 4PJ7A 3W5NA 5C0BE 5EOQH 5IVOA 2F54B 2NZ9D 5ESAB 2DLEA 1L9MA 4ZUWA 2VH5L 1BD2A 1TETL 3X11A 2VDQH 3GI8H 2ZP0T 3T77B 5L2KA 2O61B 4XCNA 4MQXC 3ZKQD 3BDYH 3BP7A 3D2UB 3F5WB 5F72S 2EEBA 1F00I 3QHTC 2EDXA 4TSAL 5B3NA 1NCWH 3P4OA 2APFA 2CH8A 5FOBA 4OIBA 5MEOB 1YY8B 1AD0A 4JDZA 4O2FA 4HPYH 4G6MH 1DR9A 2RFXA 1XF5B 4GAFB 4LU5L 1U92B 5I18L 4JB9L 1REIA 4FFWD 1GCFA 3W11D 1IARB 1KBGH 4GRWB 3EYSH 1FLTX 4TOYH 4NQDD 1CIDA 2X9YA 5I66B 1IVLA 2V6HA 4XMKH 3BZEA 3D39D 3KNBA 2G2RB 3MJ9H 4JFFD 4U33A 1TVBB 2MQ0A 2EDYA 2P8MB 4L8CA 2BNRD 3KYOA 3GSNH 1BFVL 1IGTB 3K74B 3HUJE 3V6FB 4NGHH 5FAAA 4LCIL 4DKAA 4G6KH 3SPVB 3KPMA 2AEQH 5D2LA 5HHVL 1KC5L 4QRPD 2VXSH 3EUUA 1GGCL 3SE4A 2QSCL 1ZK9A 2EDKA 4O51B 2Q76B 5I1EL 1Z9OA 4HFWB 4JFQA 2OMBA 1JYXA 3RUGE 5ENWB 3SGDH 4NHCL 1FDLL 5A16A 4K7PH 4AEIH 5IFHL 1D9KB 1PG7X 2A6DA 3T65B 4KDTA 5JXAL 4N8CL 3OGOE 4XB8A 1HHIA 4XP6L 2YWYA 3PJSA 4MJIE 1FVEB 1TPXB 3OXRA 3RHWF 3MLRL 5F6HJ 3VD4A 1WIUA 4KZDH 5FYKL 1GGTA 4FZEH 2NY2D 5D93C 1LE5B 4HIHB 1WWBX 2R1XB 3T3ME 4WI2A 4Y4FD 3RY6C 2AJ3B 3MXWL 3Q3GB 1YDPB 1K5NB 2Z31B 2IG2L 1JTTA 1ZA3B 5JHDA 3GMQB 4UBDD 4I4WA 2D4FA 3MUJA 4KHTL 3IJHB 1CF8H 2P8PB 3I6LE 1NCBL 3LKQB 4QRTA 5IHUH 3UBXI 4PRNA 4LSVH 4YBQD 1V8HA 3TVMC 3G5VA 1BOYA 5KZCD 2Z9TA 1M7DA 2Y07H 2V5RA 3OGCB 1D7FA 3IRPX 2AXJA 3P40A 4K23H 2E7LA 1DLHA 1F58L 3QIBA 4P99A 3FB5B 5HHXL 4H26A 1UWEH 3EHBD 2Z93A 1I7TA 3DYMA 5I1KL 3LHPH 5EZOL 1YEIH 1ONQA 4GJTB 4P46A 3RU8H 1JVKA 1I1YB 5CWSA 3S4SB 2VLRB 5EO1B 1UB5A 2QHLA 5EU6E 5MENE 5DUBB 3O6KH 1FO0L 2QQNH 3NFNB 1WAAA 1M05A 1G9NH 3FO9A 5C2UB 4F7CB 2ADFH 3IDMA 1NFIA 2CIIB 1K8IA 2W59A 1UJ3C 1OAZL 4K3DL 2HT4C 3TJHD 2DICA 3OB0K 3DV4B 5E8OA 3VWKD 4M5ZH 3FQNB 4MAYC 1L0XA 5HGBB 5DJ8B 4YHIB 3TIDA 3TV3H 1BJ8A 2LVEA 1ED3A 2EXYD 3SEPA 3ARBA 4FZ8H 3IFOA 5BZDA 4UT7H 4NKIL 25C8L 2QHRL 4X9BA 4JY4B 4G5ZH 5E2UL 2YWZA 2FIRT 4UINH 3RTQC 1NFKA 2OBGA 1MREH 4M61A 3C5ZA 4PJAB 3L3HA 4NQSA 3CLEL 3RFZC 3I50H 2R39A 1ZTXL 4UOJA 1A0QH 4M48H 1HKLH 3SY0A 2G5RA 4PJ7E 3CH8A 1BJ1J 1FIEA 2NY1D 1S7WB 4PJDF 1R24A 1DQTA 4JFXA 2R1WA 1BD2E 3AS2A 3ZE1F 3QFJB 1F3DH 3C2SA 1CGXA 3FB8A 2H9GA 2X09A 3U7AA 4U1KA 4U1IA 5H35A 4J4PA 2YUXA 3TPKA 4HJ0C 3QXVA 3B43A 1RZJL 4W6XB 1CFSA 4AEEA 1CLYH 4GRLA 5D93B 3ZDYF 3K0WA 5ICXA 1DSFH 2ICCA 2W0LA 1FYTB 3JWDH 5LXGL 2QKIB 4XXCA 2FX8L 5C0AA 3DVNA 5FUCE 4U6YA 1JRHL 2VC2H 3NPZB 2OQJA 2YA1A 2D7TH 2AJYL 4R3SB 2X1XR 5L2JA 2Y4SA 4J6RH 1TJIH 4JFEE 3LV3A 4XVSH 4M7JH 3KVQA 2JELH 3TVMB 2A73A 3WMSA 1QO3A 3GSRB 5T33L 2B2XH 2ITCA 1YMHB 2H32B 1Y6NR 4UT6H 4XVJH 3H0TB 4WTZG 5D1XA 2EXWC 2CIKB 4KY1H 2ATKB 3C8KA 5D2LE 4HKJA 4PRIA 4Y4HA 3GJEA 1UKSA 2BCKB 4PV8A 5GS2H 1AP2B 2M1KA 3IKKA 5JA9A 1MFDH 1NEZG 4MB4A 3HC4L 3IDUA 2J12B 4ETYA 3RJQB 3WJLA 1G7IA 3QUXA 1HXYB 4LLWB 3QQ3B 2P46B 5LKNA 3OAYH 4N8PA 5C0NC 4JM2D 3X13A 1UJ3B 3HAEH 4JPKH 1R6VA 3EZ8A 3VFNB 4JKPH 2LU3A 1WSST 1XT5A 4XPTH 4MAYB 3OKLA 3FQXA 2H6PA 3D18B 2DTML 3VFOB 3VXNA 3Q6FA 4LRNH 5F7LB 1INDL 1FVDB 5F89B 4ODWA 4U4BA 5FA3B 1NC4D 3LRSB 5BXFA 8FABA 1P5UA 2X4SB 2ADIA 1NCCL 2ZSWB 5J06A 4UOW1 1F2QA 4JLRA 1AC0A 4LEXH 3MLYL 1K6QH 2R2EB 5FO8A 3M07A 3CCHA 2NW2B 3P4LA 5FA4A 1QACA 5FYLD 3VD9A 2CDEA 1Q9WB 1BZ9B 1E4XI 2D7PA 3HI1A 3PP3H 4F3FB 1T0MB 3V5DA 1GZPB 1MRFH 4PJCA 1KUMA 4BYHA 4YLQT 3F7PC 4IRJC 4EVNB 3JUZA 1Z9SA 4L9DA 4FQ1H 2DQJH 2FJFA 3IU3B 1T1XA 4OZGF 3NA4A 1IQDA 2VKWA 4Y16D 5ESQA 4YHOL 5JZ7C 3VA6A 3MO1A 2X6MA 3EYQD 5IOPA 5D72H 3SKJL 1JWUB 5C09B 3RNKA 3FO1A 2RIKA 3MREA 1UACH 3LMJH 3PDOA 3HC0B 4F58H 1IAIH 3JV6A 5DJAB 4PJIF 5ILTL 2KH2B 1JV5A 1YN7B 2DRUA 1JHTA 2CJUH 2WUBH 1UM5L 4J2XA 1Q9KA 4HWBH 1WAAE 3S3JA 4DKFL 3G6JA 2WW8A 4OM0H 1MHCA 3DX8A 4H5SA 1BX2B 4GQ9H 3NH7L 4YXKL 1OT1A 5MEQB 4WFGE 5ACZA 4LCCA 3T8XA 4ZSOB 3RWJB 2V2XA 5C6PB 5EZJB 2NY4C 1GC1L 5EU5B 1NDGB 4RQQA 3Q1SL 5AYQA 1BZ7B 4YFEA 4LLMA 1T03H 4OFIA 1K85A 4X6DB 5BVJB 2A6KA 4GAGH 3DMMC 3ARYA 1T7VA 4AIOA 4FQJH 1N64H 4XBEL 5T1LD 2EH8L 4MGXA 1HQ4A 2PNDA 4APQA 5L6YH 3WKMH 4OLWH 4ONFL 3RWGA 1VESA 2YPKA 3VXUA 5F9JA 3JV4B 1RURH 4QY8B 4PJEA 4MCYB 1JI1A 1OF2A 4L5FL 5DFTA 5E8DL 3EYVA 3SDDD 2OTWB 1UXWA 1T22B 3DTXA 2UZXB 1DBML 3QG6A 1QQDB 1H3PL 4OLZH 2OJEB 3W0WB 1TENA 4DKEL 1OLLA 5GGRY 2VLKA 1MIML 4JQXC 2HVKB 5JXED 1X5GA 4RISH 3D85D 1PZ5B 1P6FA 4GG8B 1D5IH 4WEUD 3B9KC 1J1XL 4YIQB 1VADB 4KRPB 5ISZE 5D2NC 5C0AE 1S7SA 2XY1A 2FWOA 2CKBH 2M8XA 3SDCC 2JCCB 1N3NA 5FYKE 5E56A 3QUYD 1I8KB 1NPUA 4KJWC 4XP9H 5KSAD 4DUWA 3TIEB 2FX9L 1NC2A 2BXZA 2NY3C 3DVGA 3RGHA 2CUHA 3QDMD 3TBTA 4AZ8A 3QA3A 3MRGA 3WBDA 3OMZA 5F7MC 1DANU 5CCKL 1R3LA 3BP5B 3MRDB 3PL6D 2VWEE 2EIEA 3I3BA 1R3KA 3MRPA 3UO1L 1KPVB 4PRIE 2J6EH 1AR1C 1RK0B 5CGTA 3QULB 4LHJB 2DQHH 5IF0A 1IC5L 3CFCL 3HUJF 5DUPL 4NQDA 4R8WL 4F7PA 3DYPA 2FL5B 4DZ8B 3L7EA 2EYRA 4FQHB 5HHOB 3D39A 2X4QA 3L1OL 3FT4B 4JFFA 5FF6A 2C1OA 4G43A 5D6CB 5JHLL