3LR1A

The crystal structure of the tungstate abc transporter from geobacter sulfurreducens
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
232
Chain Sequence
NAEERLKMSTTTSTQDSGLLKVLLPPFEKKNNVKVDVIAVGTGQALKLGEAGDVDVVFVHARKLEDKFVADGFGVNRKDVMYNDFVIVGPKNDPAGIAKAKTAAEALKLLATKGATFISRGDKSGTHTKELDLWKSAGVDPKGNWYVEAGQGMGPVITMATERRAYTLTDRGTYNAFKGAKTDLVILFQGLFNPYGIMAVNPKKFPHVKYDLAMKLIDYVTGPEGLKIISDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the tungstate ABC transporter from Geobacter sulfurreducens
rcsb
source organism Geobacter sulfurreducens
molecule tags Transport protein
molecule keywords Tungstate ABC transporter, periplasmic tungstate-binding pro
total genus 65
structure length 232
sequence length 235
ec nomenclature
pdb deposition date 2010-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3lr1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3lr1A02
3M3KA 5A5XB 2F6GA 4THIA 3SEVA 2ZXTA 4LZ8A 4ZEIA 2A5TA 1Y3QA 4WXJA 3PMWA 5ISUA 3C36A 3KSXA 3IOTA 5H8QA 4GOTA 2ZYKA 3K2DA 4U4XA 5I56B 4ZEDA 1URDA 2ZNUA 5EHMA 5K2XA 1POTA 2DSFA 5I59B 1CE2A 3KFMA 5I58A 3V83A 3FV2A 3IOWA 1FQDA 3JYRA 1B3LA 3MWBA 2DWJA 3W15C 3H03A 1AH5A 2HEUA 5FHOA 4JWXA 1PDAA 1SW5A 2DE2A 2H5YA 3O66A 3H6VA 5AA4A 1USYH 3KN3A 3L6GA 3QAXA 4MF3A 4EQ7A 4KI0E 1I6AA 5ITOA 4IO2A 3RNNA 2QS3A 1Y1ZA 3BKIB 3VXBA 4GRKA 5FTIA 4PFUA 4AQ4A 4JSDA 3RLFE 2QSXA 4BDQA 3H6UA 1JEVA 3CRBA 3H6WA 3OENA 2VD3A 3H7MA 2B3BA 3K1NA 3QUJA 4FEBA 2RCAA 1JW5A 4U23A 3ZS6A 1LBBA 4U4SA 1XS5A 3LR1A 3RN8A 3O97A 3OD7A 5K2YA 3H3GA 1LCTA 1D9YA 1JNFA 4BDOA 4OENA 2R71A 4HS7A 4PQJA 1ZBMA 4RA1A 4DDDA 3G3IA 4HW8A 2OK2A 4G77A 1A8EA 2DOJA 3ZKLA 4UACA 3QSLA 2GHBA 4NWCA 4U1ZA 3OMBA 4L17A 3MC2A 1D3KA 3TZAA 1MG1A 3U8QA 2O7UA 3MP8A 1XVXA 2CZLA 4TQUQ 2Q8JA 3IOVA 3CI8A 5KCJB 3OEKA 4R6YA 1MXWA 5M2VA 1ZU0A 1QULA 4N07A 4Q30B 2D21A 3FVKA 2Q88A 1FQCA 3VLUA 3ZSFA 2O51A 3VVFA 3K00A 4P0IA 4FATA 5CBRA 5KCJA 1T0KA 1TFAA 3QXMA 2THIA 4FORA 2F7BA 2REJA 2B65A 5KDTA 4ZECA 4JXIA 2IA4A 3B6WA 5DVFA 5ITPA 2XXYA 4EF1A 2W7YA 3BFUA 1DOTA 2H98A 4NF4A 1MPDA 5CM6A 4LATA 1MXVA 2G29A 1MXYA 2QMXA 1SW4A 1YAEA 3K01A 1OVBA 3DELB 3OSQA 1MY0A 3TFLA 3H4ZA 3HSTA 3RT8A 3BFTA 1A54A 1MXUA 2O68A 3LC8A 4GF8A 1O7TA 1HSEA 1Z7ME 4M4GA 2DYXA 3Q29A 4QFPA 3T9HB 1B9JA 3FXQA 5EYFA 4OYVA 4I1DA 1L5TA 3KN7A 4R74A 4YB6A 1B40A 3IO4A 1GVCA 1B1HA 3IB2A 3G3HA 2I49A 3N94A 4N13A 1OMPA 4NMYA 4R6KA 5TU0A 3SKPA 3RTWB 4F3BA 4F3PA 1UTHB 4KR5A 4LA9A 1SW1A 3W9VA 1MRPA 2Z22A 2OZZA 3W9WA 1F9BA 4IO3A 4XKNA 3V5AA 3RTFB 3OELA 1UQWA 3MJNA 3TKDA 1FCKA 4GD5A 3SEUA 2O6AA 2XX7A 3HPIA 4H8IA 3KEIA 1P1NA 4G4PA 3FVGA 1S50A 3SETA 4R6HA 1S7YA 4QRZA 4ZS9A 4H5FA 4GXAA 3V8XB 2FNCA 1DTZA 2DE3A 3PMXA 4YAHX 1N0TA 1VR5A 3EHUA 3DLNA 1ANFA 4KFQA 5TP9A 3UA8A 3E3KA 1OVTA 4F2OA 4XKRA 3C33A 1FQAA 4OERA 1MY1A 4KYDA 3TCHA 1AOVA 3QUFA 5H8QB 1SI1A 1LFGA 1NNKA 3G3JA 1FQEA 1LAHE 3IORA 1R6ZA 1B3HA 1GR2A 2OWSA 4I9DA 4LQ5A 4WEPA 2I48A 1NMUA 4PFWA 5AE4A 3MZBA 1LAGE 5L9SA 3MZ9A 1Z7NE 4H65A 4IB2A 4LUBA 2NOOA 2UYFA 1NH7A 2B3FA 1LBCA 1MY4A 2QPQA 3AXFA 3OO6A 4G8HA 4GWOA 2NUVA 2F78A 4NTLA 1A7LA 1Y3NA 4KHZE 3SEXA 4YB7A 1IEJA 1B5JA 1CB6A 4IGRA 4I8CA 2O69A 2IEEA 5LOMA 3MPLA 3KJTA 2FYIA 3TDJA 3S9MC 1JETA 4K3FA 5IAIA 2P2AA 5JTYB 4EXLA 2I0CA 1Y3PA 1O63A 4TOZA 1A8FA 2NVUB 1B7UA 1VFDA 2XXVA 5H8NB 3WAFA 1LCFA 2QS4A 4QSDA 3KBRA 1FTKA 2V84A 1SDXA 3E4RA 2UVIA 2UXAA 3FXUA 3VV5A 5JEIA 5I58B 2HAVA 3O2AA 3UIFA 2V3UA 4YKJA 4F2QA 2XXQA 4POXA 4ECFA 4YB5A 4FE8A 1J1NA 3SERA 1ZKBA 3U94A 4UA8A 2ZYNA 3T22A 1B6HA 4IY5A 4HCWA 4FECA 5I57B 4F19A 1II5A 2RC7A 2M8CA 4JDFA 1RYXA 4DXBA 1US5A 1MH3A 3GBAA 3K02A 4F3SA 3TTLA 3O28A 1B3GA 1URSA 4MH5A 4EQBA 3S9EA 1MPCA 4R2FA 3O9PA 1XVYA 3KGCA 2YJPA 1VE4A 1P1WA 3ONMA 2Y7IA 4IO7A 2PT1A 2VGQA 4GL8A 4RK9A 5DYHA 1TXFA 2GHAA 2YPNA 4N6PA 5I2KB 4ISUA 3S4UA 3T93B 1A55A 4BLAA 4F39A 5HM4B 4YZZA 4H0WA 5H8SA 3FZVA 3KOTA 1NFTA 3C32A 3MPKA 3C9HA 3LSWA 1URGA 3OO9A 5DVJA 2X26A 1ZTYA 3MQ9A 4R9FA 5HBCA 2Q2AA 3T9XB 2H4IA 3Q28A 3ILTB 5I84A 1FQFA 3VXCA 3IAZA 4HCYA 1M5EA 1MDQA 4C1UA 2DWAA 3KOSA 2HZKA 4GXSB 4HTGA 2A5TB 4OFOA 4PFTA 4PFYA 1JW1A 1WDNA 4U1OA 4XIGQ 3T9UA 4QSCA 1UTBB 5JK4A 3TCFA 4KPTA 3CR9A 3Q27A 3FATA 2AL4A 3DM0A 5I2KA 3OO7A 4NF8B 3VFJA 1D4NA 4YMBA 4PP0A 4GIZA 3K6WA 1OLCA 2CMOA 2HCAA 2O84X 3CG1A 4MBPA 1QUKA 5ICQA 2I0BA 5IKBA 3PD8A 1R9QA 1PB8A 2OCUA 4OZ9A 3RUMA 2RC8A 4YKKA 1H44A 4FAJA 4IGTA 5B7DA 3MVWA 3LSFB 4C0RA 3CFZA 4WKMA 1IITA 3MUQA 3OXNA 3PPQA 2H99A 4H8JA 1NNPA 3DP4A 2ANJA 2OJTA 1MQHA 3CSGA 4LQ2A 4R72A 4E0XA 4KYEA 1ZIUA 3T9VA 3GLBA 3TODA 5AA2B 3PU5A 4NF8A 1XOCA 2ESNA 2HZLA 3PPOA 4ELOA 3RQTA 1KWHA 1P99A 4MLQA 1N7WA 2I58A 1IXIA 3G3FA 3HV1A 1PC3A 2KLFA 1Y20A 3S9LC 1QUJA 1Q1KA 2QL3A 3V89B 3N26A 3FASA 3K0VA 2HQ0A 3EQ1A 3GZGA 4G68C 2UVGA 3B6QA 1SW2A 3USDA 4X1DA 2ZNTA 5B70A 2DVCA 1LB8A 3H06B 3ODBA 5L8DA 2F6PA 2Q9TA 3GBBA 3PPPA 2VP1A 3MVYA 3K6UA 3PUWE 4OVJA 1ZLQA 5EHSA 3SESA 3WAEA 4OFLA 3I6VA 3I5OA 5KZTA 3A3UA 4M1VA 5I59A 4DLDA 2UYEA 4E0WA 4OEUA 3IK6B 3TQWA 1QKAA 1DMBA 4O3AA 4OEVA 1FQBA 3OEMA 3PPRA 1LFHA 2O7IA 2ZMBA 4NF4B 4NEDA 4ELQA 1FW0A 3K1MA 1B32A 2DVZA 4F31B 3N6UA 2LAOA 1UTHA 5JTYA 3HO7A 4Z7EA 3UK4A 3S9NC 1LSTA 4U21A 3VVEA 2F7CA 3O6IA 4FEDA 1EU8A 4H67A 3D4GA 4BDRA 1QKBA 3FJGA 3G7WA 1HSLA 4KCCA 3TTMA 1IXGA 3TYHA 1HSJA 3C4MA 5CBSA 5I2NA 1GGGA 1B3FA 2VOZA 3FJMA 2HXWA 2RCBA 4JBZA 2PMSA 4JWYA 3R7XA 3L6HA 1IQ7A 2ONRA 3OO8A 3UORA 5TPAB 3PUZE 3F11A 3I3VA 5ICTA 3TTKA 3ILUB 1B05A 1BP5A 3FXRA 3EF7A 3HN0A 3KG2A 4NE4A 4AB6A 5DVIA 3U1OA 1Y1MA 4IO5A 3RGYA 5H8HB 2I3VA 3K1PA 3GXAA 3U92A 3R26A 3VE1B 1UTBA 3FVOA 1JVYA 4F22A 4X48A 1JEUA 4LZ7A 1XT8A 2E1SA 1A99A 4F18A 5AA2A 3PPNA 4O3CA 4NF5A 3C31A 3M3LA 1B46A 4AB5A 4ESWA 2O1MA 3U93A 3K4UA 2VD2A 3G3KA 2Z8DA 4MLVA 1MY2A 3A09A 3G3GA 2OWTA 3C35A 4QFNA 4GQOA 1YCJA 4DE8A 1XHYA 5CMBA 3KJ7A 1B5HA 1N84A 4ZEFA 2AL5A 1N76A 3IJOB 4PE5B 4BDNA 1N7XA 1BTJA 3IB0A 4QSEA 1YTVA 1Y4CA 1IZ1A 3DP8A 3MP6A 4Q5TA 1I6BA 4XKPA 3RT6B 1MY3A 1PB7A 2Y84A 2DWHA 3CIJA 1NH8A 1B52A 3TAJA 2F36A 1RKMA 1VSOA 2VHAA 2Y7RA 3VDFA 1H43A 3O6HA 2E0SA 5I56A 3VLVA 2Y7KA 4OESA 5BWJA 5F1QA 2PYYA 3OSRA 2GFEA 1MXZA 4NF6A 3SEWA 5H8FA 3TUSA 1EZOA 2V3TA 4G8NA 2OBGA 4ELPA 4EXKA 3TPAA 4KD5A 1EZPA 1UIVA 4TLLB 1R1NA 4G68B 1OLAA 3Q25A 4X1BA 2V93A 2XXHA 4PETA 1N04A 4JB7A 5FTHA 1QVSA 2PT2A 2R9JA 3H6TA 3PMVA 4LONB 2XXWA 1PBPA 2Y7PA 4DXUA 2RINA 2P1SA 4RYAA 3DP6A 3S2VA 3QYTA 4QFOA 3EPEA 3B7DA 4RXLA 5ELVA 4DCYA 1B1XA 4Z0IA 3ECRA 2HAUA 4IY6A 5DTBA 5TP9B 1GV8A 4EUOA 4ONYA 1FTLA 1AMFA 1NNTA 3VLWA 2F7AA 3JV9A 4QFLA 1NKXA 4GFRA 1FTMA 4F1UA 1EZ9A 2DXRA 3JZJA 1MM7A 3MVZA 1JW4A 5CI5A 1B3EA 3IOUA 3QK6A 4P11A 4POWA 2NWJA 1B7HA 3MAMA 4KCDA 2QMWA 4BDMA 4LZ5A 3TTRA 1EH3A 2I3WA 3FUZA 1IUDA 1LFIA 1MQJA 1Q35A 1SI0A 1P1UA 3IO6A 3LSXA 4NWDA 2HFBA 1FTJA 4RY1A 1B0LA 5H8NA 1B0HA 2Y7WA 3O6GA 2FA7A 2ONSA 4ND9A 1Y4TA 4R2BA 1WVJA 4DZ1A 2P0SA 3FIRA 4OMBA 2XXXA 2PX1A 4RPNA 2RC9A 4YKPA 1QJMA 2XX8A 2Z8FA 4DXCA 1P1OA 1GTKA 2DP8A 2XXTA 4C1TA 2XXRA 1B7ZA 1S9TA 5BUUA 2DE4A 1RYOA 3K6VA 4IO4A 2ALUA 4F3GA 4QFKA 4P0GA 1H76A 1OIBA 1TFDA 1FTOA 2UVJA 4YICA 4ZE9A 3KN8A 3PUVE 4FJPA 4RK2A 4U22A 1ATGA 1SVXB 3D4CA 1VFEA 3MP1A 2RKMA 5CMCA 4NF5B 5H8FB 3VVDA 4ESXA 1LB9A 1AIVA 3UP9A 2AIXA 4JSOA 1PB9A 3PV0E 4ZZAA 2G93A 2XX9A 5DEXA 5AA2D 3HHGA 2QS2A 4JWOA 5DT6A 2DS9A 5H8HA 4ZDMA 4EF2A 2D3IA 4OTEA 4EQ9A 4XXUA 4DIGA 4H5GA 4YKIA 3LSLA 1MXXA 2ABHA 1N3XA 1B2HA 2UVHA 2F34A 3LBSA 1ELJA 3PUXE 4R73A 4YU0A 4F1YA 2F35A 2F5XA 2WKYA 4OQOA 1OQGA 4OFJA 5I2NB 1WODA 1B4HA 2QRYA 2H9BA 4MFIA 5L9MA 5AA1A 2XD2A 5KDTB 3M3FA 2XHDA 4ZE8A 3PD9A 4NF6B 1D9VA 3CSBA 1A40A 5F7VA 1PEBA 2QJEA 1MH4A 3TELA 2D5WA 3IL1B 1IIWA 1LGBC 2Z8EA 1NL5A 1ZMGA 3N6TA 4XTCQ 1B5IA 1PBQA 3HHFA 1MPBA 3LUYA 3FJ7A 3IB1A 4G2ZA 1N3WA 4GVOA 4OXVA 2XXPA 1H45A 3R6UA 5TPAA 4H1XA 4I62A 3OOAA 1AL3A 3TCGA 5AA4B 1BIYA 1UIUA 1YPNA 2XXUA 2YLNA 2X7QA 1MM6A 1ZJLA 2BJJX 4LVQA 1NNFA 3IJXB 1LLSA 2I6EA 4F1VA 1M5FA 3HCQA 4O3BA 2REGA 4DCXA 4Q8RA 1MDP1 1SD3A 2O1LA 2QS1A 3E9XA 4QHQA 3FGSA 1DSNA 4YMAA 1QUIA 1SQYA 3MBPA 3RY3A 3C34A 1P1QA 1BLFA 1LAXA 1JQFA 3FD3A 3K6XA 4GLIA 2F8DA 3T96B 1SBPA 1XC1A 3CFXA 1MQIA 4X9TA 1DPEA 1USYE 4OETA 4IO6A 4OHNA 1R9LA 4TLMB 1IXHA 5CMMA 4BDLA 2PBWA 2NXOA 5FHNA 1I69A 3MW0A 3TTNA 1SYHA 1Y9UA 1MQGA 1O64A 1POY1 3PUYE 3SDFA 1BKAA 3CG3A 3U72A 3UGWA 3ZKKA 2GH9A 2RF1A 4ELRA 2ZYMA 1QW0A 1B58A 2AYSA 2OLBA 2V25A 1H3DA 2GRVA 4RJZA 2R6GE 5CRYA 1SYIA 4RPOA 5HPQA 2H25A 3EN3A 1M5DA 4GL0A 4ZEKA 1TWYA 1US4A 5I57A 2A5SA 2DXYA 3IR1A 4Q0CA 5CMKA 3TMGA 2V3QA 1TT1A 3MVXA 3MZ1A 3N5LA 4QF9A 3M8UA 1B4ZA 5AA3A 2Z23A 2ZNSA 1M5CA 3QIMA 3CVGA 1LAFE 1MQDA 3P7IA 3PGFA 2F97A 4R9GA 4G68A 2Q89A 3CFLA 4XKQA 3T66A 3IX1A 5A5XA 5CC2A 3E13X 3TQLA 3A3CA 3KZGA 1I6QA 3B6TA 1OQHA 1MS7A 3FVNA 2I4BA 2ONKE 4KQPA 4F29A 2ZYOA 4LP2B 1IXCA 4FIMA 4G8MA 5J1DA 3UN6A 2I4CA 2DWIA 1DTGA 1JVXA 3EHTA 3SEYA 3O29A 1DPPA 4KYSA 3TEPA 3KSJA 2Q2CA 5FHMA 2XXIA 5DEXB 4ZEBA 4OWDA 1M5BA 4EDPA 5L9OA 3Q26A 2DQVA 4U2RA 1B51A 3RPWA 2X7PA 3FV1A 4H6DA 3BBRA 4RNSA 2PVUA 4R75A 4WEDA 3THIA 3EHSA 4ZZEA 2XD3A
chains in the Genus database with same CATH superfamily
5A5XB 4THIA 4ZEIA 4WXJA 4U4XA 1POTA 2DSFA 3KFMA 3W15C 1SW5A 2H5YA 1FBFA 5AA4A 3KN3A 4EQ7A 3IFAA 5ITOA 1Y1ZA 5FTIA 4AQ4A 3RLFE 4QXDA 2VD3A 3K1NA 1LBBA 3RN8A 3OD7A 3H3GA 2R71A 3G3IA 2OK2A 1A8EA 4UACA 3QSLA 3TZAA 1XVXA 1LBXA 1IMCA 1ZU0A 4Q30B 3ZSFA 1FQCA 1FBHA 2O51A 3K00A 4P0IA 3QXMA 1AWBA 2WEFA 4JXIA 4NF4A 2G29A 3K01A 4GWZA 3TFLA 3H4ZA 2O68A 1HSEA 1YZ0A 1GVCA 1B1HA 3IB2A 4GWWA 3N94A 3SKPA 5TU0A 4N13A 1OMPA 4N8GA 1IMAA 3W9WA 4IO3A 3RTFB 3TKDA 4GD5A 5ET7A 3FVGA 1S50A 4GXAA 3V8XB 1FPLA 2DE3A 1VR5A 1ANFA 4KFQA 4F2OA 3E3KA 4XKRA 3C33A 1MY1A 4KYDA 3QUFA 1FPKA 4WEPA 1FPIA 3MZBA 5L9SA 3MZ9A 1Z7NE 4LUBA 2B3FA 2QPQA 4KHZE 4YB7A 1IEJA 1B5JA 1CB6A 4IGRA 3S9MC 4K3FA 4EXLA 4PAIA 4DI4B 2L5VA 4PGNA 1B7UA 1VFDA 4QSDA 3FXUA 2UXAA 2HAVA 3UIFA 3IFCA 3LV0A 1ZKBA 2ZYNA 1II5A 1US5A 1MH3A 4MH5A 1MPCA 2FIXA 1VE4A 2WYPA 2YJPA 2PT1A 3KC0A 4N6PA 4F39A 1A55A 1FBCA 5HM4B 4YZZA 3FZVA 3LSWA 3OO9A 4KXPA 3MQ9A 1ZTYA 5HBCA 3Q28A 3IAZA 1M5EA 4PFTA 3KOSA 1FPJA 4AS4A 2A5TB 4QSCA 3FATA 5I2KA 1IMBA 4GIZA 2CMOA 4MBPA 3PD8A 1PB8A 5B7DA 4IGTA 3MVWA 3OXNA 3PPQA 1NNPA 3CSGA 1MQHA 4LQ2A 4E0XA 3PU5A 2HZLA 3RQTA 3HV1A 2KLFA 2FBPA 1Y20A 1QUJA 2QL3A 3MSTA 3V89B 3EQ1A 4PFBA 4G68C 4X1DA 3ODBA 2VP1A 3MVYA 3SESA 3I6VA 4E0WA 1DMBA 4O3AA 1FQBA 3PPRA 2OX3A 4F31B 1FJ6A 3HO7A 4Z7EA 3S9NC 4OVRA 4H67A 4FEDA 1EU8A 3TTMA 3TYHA 1NV0A 1HSJA 4JWYA 3L6HA 3OO8A 5TPAB 3PUZE 3F11A 4PFIA 1INPA 1BP5A 4PCDA 3HN0A 3RGYA 3K1PA 4LZ7A 4F18A 3PPNA 3C31A 3M3LA 1B46A 4AB5A 4ESWA 2WBBA 3G3KA 1IMFA 2Z8DA 3A09A 2OWTA 4XFEA 4QFNA 4GQOA 1YCJA 5CMBA 3KJ7A 1N76A 4BDNA 1YTVA 1Y4CA 3MP6A 4Q5TA 2VPNA 2Y84A 1B52A 4MMPA 1RKMA 1G0HA 1H43A 3O6HA 2Y7KA 3FXBA 5F1QA 2V3TA 4ELPA 1UIVA 4TLLB 2XXWA 2RINA 3QYTA 3EPEA 3B7DA 1B1XA 4Z0IA 1Q9DA 1NKXA 2KQZA 4GX3A 1QGXA 3IOUA 3QK6A 2CEXA 4P11A 1B7HA 2QMWA 4LZ5A 1Q35A 4NWDA 1FTJA 1NV3A 3O6GA 2ONSA 3B8BA 2PX1A 2Z8FA 4P1EA 2DE4A 3KN8A 3PUVE 1ATGA 1SVXB 3D4CA 1VFEA 2CZKA 1AIVA 5EQ9A 5DEXA 2QS2A 5DT6A 4GWYA 3SZPA 5JTYA 2F34A 4R73A 2F35A 1WODA 2XD2A 5KDTB 4ZE8A 2QJEA 1IIWA 3N6TA 3KBZA 4XTCQ 1B5IA 1MPBA 1N3WA 4GVOA 4OXVA 4I62A 1K9YA 1BIYA 2BJJX 4LVQA 4JVCA 3IJXB 1M5FA 4DCXA 1IMEA 4QHQA 1QUIA 3MBPA 1JQFA 2F8DA 1SBPA 1DPEA 4IO6A 2HXRA 4MIJA 1Y9UA 1MQGA 2XWIA 3UGWA 2FHYA 2GH9A 2ZYMA 4DI3D 5CRYA 1QW0A 4HE1A 2H25A 1M5DA 4GL0A 2A5SA 2V3QA 1TT1A 3MVXA 1NI9A 2XWKA 3M8UA 2Z23A 2XXKA 4EQBA 1M5CA 3QIMA 3CVGA 4G68A 3CFLA 3IX1A 4NHBA 1OQHA 2ONKE 4LP2B 4FIMA 1JVXA 3EHTA 3KSJA 2XXIA 4NX1A 5L9OA 1B51A 3EKIA 3THIA 3EHSA 4ZZEA 2F6GA 3SEVA 2ZXTA 1Y3QA 3KSXA 4PDHA 2ZNUA 5EHMA 1FPFA 1CE2A 1FQDA 2QVUA 3JYRA 1B3LA 2MKZA 3MWBA 3H03A 5FHOA 1PDAA 3O66A 4O8MA 4MF3A 4NQ8A 4KI0E 2QS3A 3BKIB 4GRKA 2FIEA 3OENA 3H7MA 2RCAA 1JW5A 4U23A 4U4SA 1XS5A 5F24A 1FBGA 4I3EA 1JNFA 4BDOA 4HS7A 4PQJA 1ZBMA 4MCOA 4G77A 2F3DA 2CZLA 2Q8JA 3OEKA 5M2VA 4N07A 3RYDA 4OANA 4FATA 5CBRA 1T0KA 1TFAA 2THIA 2REJA 2CEYA 1G0IA 5DVFA 1DOTA 2QMXA 5EYHA 4XEQA 3B50A 3HSTA 3RT8A 4UABA 4GF8A 1B9JA 5EYFA 1L5TA 2I49A 4R6KA 3BIGA 1UTHB 3W9VA 1MRPA 3V5AA 1FCKA 1LBVA 3SETA 4R6HA 1S7YA 4QRZA 4H5FA 3PMXA 3EHUA 3DLNA 3TCHA 3QMFA 5EQ8A 1SI1A 2WYKA 1GR2A 2OWSA 2QFLA 4H65A 3T66A 3U93A 4GWOA 2WX9A 5LOMA 3MPLA 1K9ZA 2FYIA 3TDJA 3RPLB 5IAIA 2V84A 3E4RA 1SDXA 5JEIA 2UVIA 4GBWA 4N4UA 5I58B 4F2QA 5IZZA 4UA8A 4IY5A 4HCWA 4F19A 4JDFA 1RYXA 4F3SA 1B3GA 4P9KA 4IO7A 1TXFA 2YPNA 4ISUA 4H0WA 3MPKA 3T9XB 3ILTB 3VXCA 2DWAA 4XIGQ 4PFYA 3Q27A 4P3LA 3VFJA 4PP0A 2I0BA 5IKBA 3RUMA 2RC8A 4YKKA 1RDYA 4FAJA 4MX6A 5HPQA 3DP4A 4KYEA 1RDXA 4NF8A 4ELOA 1P99A 1IXIA 3S9LC 3N26A 3K0VA 2HQ0A 2UVGA 3B6QA 2ZNTA 3H06B 2Q9TA 3PPPA 3PUWE 4BDLA 1FJ9A 5I59A 5ET8A 4NF4B 2ZMBA 1FW0A 1B32A 4NN3A 3N6UA 2LAOA 3D4GA 1QKBA 2VOZA 1FTAA 2RCBA 4JBZA 1IQ7A 3LUZA 4OA4A 3UORA 3I3VA 3ILUB 1B05A 4O94A 4AB6A 5DVIA 4IO5A 3GYYA 1UTBA 3FVOA 4OVPA 2E1SA 3CHGA 1CNQA 2O1MA 5I5PA 4ZEFA 2AL5A 4PE5B 4HE2A 2VPOA 4QSEA 1IZ1A 1I6BA 3RT6B 1PB7A 3CIJA 2DWHA 2VHAA 1VSOA 4NF6A 5H8FA 1FRPA 2OBGA 3TPAA 1EZPA 2BJIA 4G68B 4PETA 5FTHA 1QVSA 2PT2A 2R9JA 3H6TA 2Y7PA 1PBPA 4RYAA 4RXLA 5ELVA 3ECRA 5TP9B 1FBDA 1FTLA 4GFRA 1EZ9A 3JZJA 1MM7A 1JW4A 5CI5A 1B3EA 1EH3A 1LFIA 1P1UA 1LBZA 3IO6A 2HFBA 4GX6A 4MNPA 3KC1A 4R2BA 2P3NA 4OVSA 1QJMA 1P1OA 1NV5A 4C1TA 2XXRA 1B7ZA 1EYKA 1RYOA 4F3GA 4QFKA 1FTOA 4FJPA 4RK2A 4U22A 2RKMA 4GX4A 1LB9A 4JSOA 4ZZAA 2XX9A 3HHGA 4ZDMA 2DS9A 4OTEA 4EQ9A 3LSLA 1MXXA 3PUXE 2UVHA 3LBSA 2WKYA 4OQOA 1OQGA 4OFJA 4MFIA 5L9MA 3M3FA 2XHDA 3PD9A 1A40A 1NUXA 1PEBA 1MH4A 2V4CA 3HHFA 3LUYA 2OWZA 1YXIA 5TPAA 1H45A 3OOAA 4AS5A 2YLNA 1MDP1 1SD3A 3T0JA 1DSNA 1SQYA 1P1QA 1FBEA 1LAXA 3FD3A 3U8QA 3E78A 3CFXA 2DDKA 1R9LA 5FHNA 1I69A 5EQ7A 3ZKKA 1O64A 2Y5KA 2V25A 5IZ3A 1H3DA 2GRVA 4P1LA 4RJZA 1TWYA 2DXYA 3IR1A 1FPEA 2HPGA 3PGFA 1MQDA 4XKQA 3P7IA 3NOHA 4JVIA 2Q89A 4NF0A 3TQLA 4GWUA 1NV2A 3KZGA 2I4BA 5J1DA 2DWIA 4KYSA 2HHMA 4ZEBA 1RDZA 3BBRA 2PVUA 4R75A 4LZ8A 2A5TA 3PMWA 3IOTA 1URDA 3V83A 5I58A 3IOWA 1AH5A 2HEUA 4JWXA 4PAKA 1USYH 3QAXA 5DW8A 4IO2A 5EQAA 4PFUA 4JSDA 2QSXA 4BDQA 3H6UA 3CRBA 2B3BA 3QUJA 3ZS6A 3LR1A 4H45A 3O97A 5K2YA 2B4LA 1D9YA 1KA1A 4OENA 4RA1A 4HW8A 2DOJA 4NWCA 3OMBA 4L17A 3MC2A 1D3KA 1MG1A 5T3JA 3IOVA 3CI8A 4R6YA 4MNCA 2D21A 2Q88A 3VVFA 4FORA 2F7BA 4ZECA 2IA4A 5ITPA 2XXYA 2W7YA 3BFUA 2H98A 2XWOA 4LATA 1MXVA 1FSAA 1MXYA 1SW4A 1YAEA 3OSQA 1A54A 1MXUA 3LC8A 2DYXA 3Q29A 4QFPA 3T9HB 3FXQA 4OYVA 4I1DA 3KN7A 4R74A 4NMYA 4KR5A 2OZZA 1F9BA 4XKNA 3OELA 1UQWA 3MJNA 3KEIA 1P1NA 4G4PA 2Q74A 4ZS9A 2FNCA 4YAHX 5TP9A 1N0TA 1FBPA 4NG7A 1FQAA 4OERA 4X8RA 5H8QB 3G3JA 4LQ5A 1FQEA 1LAHE 1R6ZA 1B3HA 4I9DA 2I48A 4H46A 1NMUA 5AE4A 1LAGE 5EHSA 4EDPA 1NH7A 4G8HA 1LBCA 1MY4A 5BUUA 4NTLA 2NUVA 1A7LA 3SEXA 4HXVA 4I8CA 2IEEA 4N6KA 2P2AA 5JTYB 2I0CA 4MEVA 3ROJA 1Y3PA 1O63A 4TOZA 1A8FA 5H8NB 1LCFA 3VV5A 1FTKA 3O2AA 4N6DA 2V3UA 4YKJA 4POXA 4YB5A 3SERA 3T22A 5I57B 2RC7A 3GBAA 3K02A 3O28A 4NAPA 3S9EA 4R2FA 3O9PA 1XVYA 1P1WA 3ONMA 4GBVA 2VGQA 4GL8A 3T93B 2GHAA 3C32A 3C9HA 1URGA 2H4IA 2Q8MA 5I84A 4HCYA 1MDQA 2HZKA 4OFOA 1JW1A 5JK4A 1UTBB 3TCFA 2AL4A 3DM0A 4NF8B 1D4NA 4YMBA 3CFZA 2H99A 4H8JA 2OJTA 5IZ1A 1ZIUA 3GLBA 3TODA 2ESNA 4N17A 1KWHA 1NV4A 4MLQA 4PE3A 1N7WA 3G3FA 1Q1KA 2DVCA 1LB8A 3GBBA 3K6UA 3WAEA 4OFLA 3I5OA 5KZTA 3A3UA 4M1VA 2CZHA 4DLDA 2UYEA 4OEUA 3TQWA 1QKAA 4OEVA 3OEMA 2O7IA 4NEDA 4ELQA 1LBWA 2F7CA 3G7WA 1IXGA 2HXWA 5ICTA 3TTKA 4NE4A 5H8HB 3U92A 3VE1B 4F22A 3R26A 1JVYA 4X48A 1A99A 1MY2A 3G3GA 4FBPA 3C35A 1XI6A 1XHYA 1B5HA 1N84A 1SPIA 3IJOB 4MHFA 1N7XA 1BTJA 3DP8A 1MY3A 1NH8A 2F36A 2Y7RA 3E79A 4PF8A 2E0SA 5I56A 3OSRA 1MXZA 5J16A 5IM2A 4OVTA 4OVQA 4KD5A 1R1NA 1OLAA 3Q25A 2V93A 4PFRA 1N04A 4LONB 2P1SA 3DP6A 3S2VA 4QFOA 4IY6A 2HAUA 4EUOA 4ONYA 4PDDA 1AMFA 1NNTA 2F7AA 3JV9A 4QFLA 2DXRA 4KCDA 3TTRA 2I3WA 3FUZA 1IUDA 1SI0A 1B0LA 1FPGA 2FA7A 4ND9A 1Y4TA 2P0SA 3FIRA 4OMBA 4MNIA 2XXXA 4RPNA 5FBPA 4DXCA 1GTKA 2DP8A 2XXTA 4PBHA 3K6VA 4IO4A 2ALUA 1TFDA 4ZE9A 2GQ1A 1PB9A 3PV0E 2G93A 5AA2D 4JWOA 2D3IA 3HFUA 1IMDA 4H5GA 4YKIA 2KR0A 1ELJA 1KZ8A 5I2NB 1B4HA 2QRYA 5AA1A 1D9VA 5F7VA 1FPDA 3IL1B 1NL5A 2P3VA 1EYJA 4N91A 3R6UA 3TCGA 4H1XA 1JP4A 2X7QA 1ZJLA 1NNFA 1LLSA 4F1VA 3HCQA 4O3BA 2REGA 3PTYA 2O1LA 3E9XA 4PBQA 3RY3A 3C34A 1USYE 4OETA 2WBDA 4OHNA 5CMMA 4TLMB 2PBWA 2NXOA 3TTNA 3MW0A 3U72A 1POY1 1AOVA 3CG3A 4PC9A 4ELRA 2RF1A 2AYSA 2OLBA 4PF6A 2R6GE 1SYIA 4RPOA 3EN3A 2Y5LA 5I57A 4LN5A 1NUWA 4Q0CA 5CMKA 3TMGA 3MZ1A 3N5LA 4P56A 2ZNSA 2FVZA 5CC2A 3E13X 1I6QA 1MS7A 4G8MA 3UN6A 3T1BA 3U65A 1DTGA 3SEYA 2Q2CA 5FHMA 5DEXB 4U2RA 2X7PA 4RNSA 2XD3A 3M3KA 5ISUA 3MYUA 3C36A 5H8QA 4GOTA 2ZYKA 3K2DA 2QVRA 5I56B 4ZEDA 5K2XA 5I59B 3FV2A 2DWJA 2DE2A 3H6VA 3L6GA 1I6AA 3RNNA 3VXBA 1JEVA 3H6WA 1VDWA 2PCRA 4FEBA 1NV1A 1LCTA 4DDDA 4P8BA 3ZKLA 2GHBA 4U1ZA 2O7UA 3MP8A 4TQUQ 1MXWA 4JVDA 1QULA 3FVKA 4XF5A 3VLUA 4MAGA 2B65A 5KDTA 3B6WA 4NGUA 4EF1A 5ESYA 1MPDA 5CM6A 2F3BA 1OVBA 3DELB 5EYGA 1MY0A 2CZIA 2ZZXA 3BFTA 1O7TA 1Z7ME 4M4GA 4YB6A 1B40A 3IO4A 3G3HA 1KA0A 4F3BA 4F3PA 3RTWB 4LA9A 1SW1A 2Z22A 3SEUA 2O6AA 2XX7A 3HPIA 4H8IA 1DTZA 3UA8A 1LFHA 1OVTA 1LFGA 1NNKA 3U1OA 3IORA 5A5LA 4PAFA 4PFWA 2R8TA 4IB2A 2XA5A 2NOOA 2UYFA 3AXFA 3OO6A 2F78A 1YYZA 1Y3NA 2PFZA 5ET6A 2O69A 3KJTA 1JETA 2XWVA 2NVUB 2XXVA 1NV7A 3WAFA 2QS4A 4P47A 3KBRA 2XXQA 4X04A 4ECFA 4FE8A 1J1NA 3U94A 1D9QA 1B6HA 4N15A 4FECA 2M8CA 4DXBA 3TTLA 1URSA 3KGCA 2Y7IA 4RK9A 5DYHA 3VVEA 5I2KB 5I3SA 3S4UA 4BLAA 5H8SA 3KOTA 1NFTA 5DVJA 2X26A 4R9FA 2Q2AA 5KCJB 1FQFA 5KCJA 4C1UA 4HTGA 4GXSB 1WDNA 4U1OA 3T9UA 4KPTA 3CR9A 3OO7A 3K6WA 1OLCA 2O84X 2HCAA 2ZZVA 3CG1A 1EYIA 1QUKA 5ICQA 1R9QA 4OZ9A 2OCUA 1H44A 4HE0A 3LSFB 4C0RA 4WKMA 1IITA 3MUQA 4R72A 2ANJA 3T9VA 5AA2B 1XOCA 3PPOA 2JJKA 2I58A 1NUZA 1PC3A 3FASA 3GZGA 3USDA 1SW2A 5B70A 5L8DA 2F6PA 4OVJA 1ZLQA 3IK6B 3K1MA 2DVZA 1UTHA 3UK4A 1LSTA 4U21A 3O6IA 4BDRA 4KCCA 3FJGA 5I2NA 1HSLA 5CBSA 3C4MA 1GGGA 1B3FA 3R7XA 3FJMA 5IZ3B 1LBYA 2PMSA 4PGPA 2ONRA 1FPBA 3RPLA 3FXRA 3KG2A 3EF7A 1Y1MA 2I3VA 3GXAA 1JEUA 1XT8A 5AA2A 4O3CA 4G61A 4NF5A 4PTKA 3K4UA 2VD2A 4MLVA 4GWXA 4DE8A 5I7IA 3IB0A 4XKPA 3TAJA 1DCUA 3VDFA 3VLVA 4OESA 5BWJA 2PYYA 3SEWA 2GFEA 3TUSA 1EZOA 4G8NA 4N81A 4EXKA 4X1BA 1LEVA 2XXHA 4JB7A 5LDZA 3PMVA 4DXUA 3ISPA 4DCYA 5DTBA 1GV8A 5ET5A 2QVVA 3VLWA 4QBAA 3D1RA 1FTMA 4F1UA 3MVZA 4POWA 2NWJA 4BDMA 3MAMA 4I40A 1MQJA 3LSXA 4RY1A 5H8NA 1B0HA 2Y7WA 4DZ1A 1WVJA 2RC9A 4YKPA 2XX8A 1DK4A 1S9TA 4P0GA 1H76A 1OIBA 4YICA 2UVJA 4IR8A 5CMCA 3MP1A 5H8FB 4ESXA 4NF5B 3VVDA 3UP9A 2AIXA 2ZZWA 4N8YA 5H8HA 4EF2A 3BIHA 4XXUA 4DIGA 3FBPA 2ABHA 1N3XA 1B2HA 4YU0A 4F1YA 2F5XA 1DBZA 2H9BA 4O7IA 4GWSA 4NF6B 3CSBA 3TELA 2D5WA 1LGBC 2Z8EA 1ZMGA 1PBQA 2B4MA 3FJ7A 3IB1A 4G2ZA 2XXPA 1AL3A 5AA4B 1UIUA 1YPNA 2XXUA 1MM6A 2I6EA 4Q8RA 2QS1A 4YMAA 3FGSA 1BLFA 3K6XA 4GLIA 3T96B 5LTCA 1XC1A 1MQIA 4X9TA 1IXHA 5IGAA 1SYHA 3SDFA 3PUYE 1BKAA 1B58A 2VT5A 4ZEKA 1US4A 4O7MA 1NV6A 4QF9A 1B4ZA 5AA3A 1LAFE 2F97A 4R9GA 5A5XA 3A3CA 3B6TA 3FVNA 4F29A 4KQPA 2ZYOA 1IXCA 1NUYA 2I4CA 2PFYA 3O29A 1DPPA 3TEPA 1BK4A 4MJOA 3A29A 4OWDA 1M5BA 4I3YA 3Q26A 2DQVA 3RPWA 3FV1A 4H6DA 4WEDA
chains in the Genus database with same CATH topology
3M3KA 5A5XB 2F6GA 4THIA 3SEVA 2ZXTA 4LZ8A 4ZEIA 2A5TA 1Y3QA 4WXJA 3PMWA 5ISUA 3C36A 3KSXA 3IOTA 5H8QA 4GOTA 2ZYKA 3K2DA 4U4XA 5I56B 4ZEDA 1URDA 2ZNUA 5EHMA 5K2XA 1POTA 2DSFA 5I59B 1CE2A 3KFMA 5I58A 3V83A 3FV2A 3IOWA 1FQDA 3JYRA 1B3LA 3MWBA 2DWJA 3W15C 3H03A 1AH5A 2HEUA 5FHOA 4JWXA 1PDAA 1SW5A 2DE2A 2H5YA 3O66A 3H6VA 5AA4A 1USYH 3KN3A 3L6GA 3QAXA 4MF3A 4EQ7A 4KI0E 1I6AA 5ITOA 4IO2A 3RNNA 2QS3A 1Y1ZA 3BKIB 3VXBA 4GRKA 5FTIA 4PFUA 4AQ4A 4JSDA 3RLFE 2QSXA 4BDQA 3H6UA 1JEVA 3CRBA 3H6WA 3OENA 2VD3A 3H7MA 2B3BA 3K1NA 3QUJA 4FEBA 2RCAA 1JW5A 4U23A 3ZS6A 1LBBA 4U4SA 1XS5A 3LR1A 3RN8A 3O97A 3OD7A 5K2YA 3H3GA 1LCTA 1D9YA 1JNFA 4BDOA 4OENA 2R71A 4HS7A 4PQJA 1ZBMA 4RA1A 4DDDA 3G3IA 4HW8A 2OK2A 4G77A 1A8EA 2DOJA 3ZKLA 4UACA 3QSLA 2GHBA 4NWCA 4U1ZA 3OMBA 4L17A 3MC2A 1D3KA 3TZAA 1MG1A 3U8QA 2O7UA 3MP8A 1XVXA 2CZLA 4TQUQ 2Q8JA 3IOVA 3CI8A 5KCJB 3OEKA 4R6YA 1MXWA 5M2VA 1ZU0A 1QULA 4N07A 4Q30B 2D21A 3FVKA 2Q88A 1FQCA 3VLUA 3ZSFA 2O51A 3VVFA 3K00A 4P0IA 4FATA 5CBRA 5KCJA 1T0KA 1TFAA 3QXMA 2THIA 4FORA 2F7BA 2REJA 2B65A 5KDTA 4ZECA 4JXIA 2IA4A 3B6WA 5DVFA 5ITPA 2XXYA 4EF1A 2W7YA 3BFUA 1DOTA 2H98A 4NF4A 1MPDA 5CM6A 4LATA 1MXVA 2G29A 1MXYA 2QMXA 1SW4A 1YAEA 3K01A 1OVBA 3DELB 3OSQA 1MY0A 3TFLA 3H4ZA 3HSTA 3RT8A 3BFTA 1A54A 1MXUA 2O68A 3LC8A 4GF8A 1O7TA 1HSEA 1Z7ME 4M4GA 2DYXA 3Q29A 4QFPA 3T9HB 1B9JA 3FXQA 5EYFA 4OYVA 4I1DA 1L5TA 3KN7A 4R74A 4YB6A 1B40A 3IO4A 1GVCA 1B1HA 3IB2A 3G3HA 2I49A 3N94A 4N13A 1OMPA 4NMYA 4R6KA 5TU0A 3SKPA 3RTWB 4F3BA 4F3PA 1UTHB 4KR5A 4LA9A 1SW1A 3W9VA 1MRPA 2Z22A 2OZZA 3W9WA 1F9BA 4IO3A 4XKNA 3V5AA 3RTFB 3OELA 1UQWA 3MJNA 3TKDA 1FCKA 4GD5A 3SEUA 2O6AA 2XX7A 3HPIA 4H8IA 3KEIA 1P1NA 4G4PA 3FVGA 1S50A 3SETA 4R6HA 1S7YA 4QRZA 4ZS9A 4H5FA 4GXAA 3V8XB 2FNCA 1DTZA 2DE3A 3PMXA 4YAHX 1N0TA 1VR5A 3EHUA 3DLNA 1ANFA 4KFQA 5TP9A 3UA8A 3E3KA 1OVTA 4F2OA 4XKRA 3C33A 1FQAA 4OERA 1MY1A 4KYDA 3TCHA 1AOVA 3QUFA 5H8QB 1SI1A 1LFGA 1NNKA 3G3JA 1FQEA 1LAHE 3IORA 1R6ZA 1B3HA 1GR2A 2OWSA 4I9DA 4LQ5A 4WEPA 2I48A 1NMUA 4PFWA 5AE4A 3MZBA 1LAGE 5L9SA 3MZ9A 1Z7NE 4H65A 4IB2A 4LUBA 2NOOA 2UYFA 1NH7A 2B3FA 1LBCA 1MY4A 2QPQA 3AXFA 3OO6A 4G8HA 4GWOA 2NUVA 2F78A 4NTLA 1A7LA 1Y3NA 4KHZE 3SEXA 4YB7A 1IEJA 1B5JA 1CB6A 4IGRA 4I8CA 2O69A 2IEEA 5LOMA 3MPLA 3KJTA 2FYIA 3TDJA 3S9MC 1JETA 4K3FA 5IAIA 2P2AA 5JTYB 4EXLA 2I0CA 1Y3PA 1O63A 4TOZA 1A8FA 2NVUB 1B7UA 1VFDA 2XXVA 5H8NB 3WAFA 1LCFA 2QS4A 4QSDA 3KBRA 1FTKA 2V84A 1SDXA 3E4RA 2UVIA 2UXAA 3FXUA 3VV5A 5JEIA 5I58B 2HAVA 3O2AA 3UIFA 2V3UA 4YKJA 4F2QA 2XXQA 4POXA 4ECFA 4YB5A 4FE8A 1J1NA 3SERA 1ZKBA 3U94A 4UA8A 2ZYNA 3T22A 1B6HA 4IY5A 4HCWA 4FECA 5I57B 4F19A 1II5A 2RC7A 2M8CA 4JDFA 1RYXA 4DXBA 1US5A 1MH3A 3GBAA 3K02A 4F3SA 3TTLA 3O28A 1B3GA 1URSA 4MH5A 4EQBA 3S9EA 1MPCA 4R2FA 3O9PA 1XVYA 3KGCA 2YJPA 1VE4A 1P1WA 3ONMA 2Y7IA 4IO7A 2PT1A 2VGQA 4GL8A 4RK9A 5DYHA 1TXFA 2GHAA 2YPNA 4N6PA 5I2KB 4ISUA 3S4UA 3T93B 1A55A 4BLAA 4F39A 5HM4B 4YZZA 4H0WA 5H8SA 3FZVA 3KOTA 1NFTA 3C32A 3MPKA 3C9HA 3LSWA 1URGA 3OO9A 5DVJA 2X26A 1ZTYA 3MQ9A 4R9FA 5HBCA 2Q2AA 3T9XB 2H4IA 3Q28A 3ILTB 5I84A 1FQFA 3VXCA 3IAZA 4HCYA 1M5EA 1MDQA 4C1UA 2DWAA 3KOSA 2HZKA 4GXSB 4HTGA 2A5TB 4OFOA 4PFTA 4PFYA 1JW1A 1WDNA 4U1OA 4XIGQ 3T9UA 4QSCA 1UTBB 5JK4A 3TCFA 4KPTA 3CR9A 3Q27A 3FATA 2AL4A 3DM0A 5I2KA 3OO7A 4NF8B 3VFJA 1D4NA 4YMBA 4PP0A 4GIZA 3K6WA 1OLCA 2CMOA 2HCAA 2O84X 3CG1A 4MBPA 1QUKA 5ICQA 2I0BA 5IKBA 3PD8A 1R9QA 1PB8A 2OCUA 4OZ9A 3RUMA 2RC8A 4YKKA 1H44A 4FAJA 4IGTA 5B7DA 3MVWA 3LSFB 4C0RA 3CFZA 4WKMA 1IITA 3MUQA 3OXNA 3PPQA 2H99A 4H8JA 1NNPA 3DP4A 2ANJA 2OJTA 1MQHA 3CSGA 4LQ2A 4R72A 4E0XA 4KYEA 1ZIUA 3T9VA 3GLBA 3TODA 5AA2B 3PU5A 4NF8A 1XOCA 2ESNA 2HZLA 3PPOA 4ELOA 3RQTA 1KWHA 1P99A 4MLQA 1N7WA 2I58A 1IXIA 3G3FA 3HV1A 1PC3A 2KLFA 1Y20A 3S9LC 1QUJA 1Q1KA 2QL3A 3V89B 3N26A 3FASA 3K0VA 2HQ0A 3EQ1A 3GZGA 4G68C 2UVGA 3B6QA 1SW2A 3USDA 4X1DA 2ZNTA 5B70A 2DVCA 1LB8A 3H06B 3ODBA 5L8DA 2F6PA 2Q9TA 3GBBA 3PPPA 2VP1A 3MVYA 3K6UA 3PUWE 4OVJA 1ZLQA 5EHSA 3SESA 3WAEA 4OFLA 3I6VA 3I5OA 5KZTA 3A3UA 4M1VA 5I59A 4DLDA 2UYEA 4E0WA 4OEUA 3IK6B 3TQWA 1QKAA 1DMBA 4O3AA 4OEVA 1FQBA 3OEMA 3PPRA 1LFHA 2O7IA 2ZMBA 4NF4B 4NEDA 4ELQA 1FW0A 3K1MA 1B32A 2DVZA 4F31B 3N6UA 2LAOA 1UTHA 5JTYA 3HO7A 4Z7EA 3UK4A 3S9NC 1LSTA 4U21A 3VVEA 2F7CA 3O6IA 4FEDA 1EU8A 4H67A 3D4GA 4BDRA 1QKBA 3FJGA 3G7WA 1HSLA 4KCCA 3TTMA 1IXGA 3TYHA 1HSJA 3C4MA 5CBSA 5I2NA 1GGGA 1B3FA 2VOZA 3FJMA 2HXWA 2RCBA 4JBZA 2PMSA 4JWYA 3R7XA 3L6HA 1IQ7A 2ONRA 3OO8A 3UORA 5TPAB 3PUZE 3F11A 3I3VA 5ICTA 3TTKA 3ILUB 1B05A 1BP5A 3FXRA 3EF7A 3HN0A 3KG2A 4NE4A 4AB6A 5DVIA 3U1OA 1Y1MA 4IO5A 3RGYA 5H8HB 2I3VA 3K1PA 3GXAA 3U92A 3R26A 3VE1B 1UTBA 3FVOA 1JVYA 4F22A 4X48A 1JEUA 4LZ7A 1XT8A 2E1SA 1A99A 4F18A 5AA2A 3PPNA 4O3CA 4NF5A 3C31A 3M3LA 1B46A 4AB5A 4ESWA 2O1MA 3U93A 3K4UA 2VD2A 3G3KA 2Z8DA 4MLVA 1MY2A 3A09A 3G3GA 2OWTA 3C35A 4QFNA 4GQOA 1YCJA 4DE8A 1XHYA 5CMBA 3KJ7A 1B5HA 1N84A 4ZEFA 2AL5A 1N76A 3IJOB 4PE5B 4BDNA 1N7XA 1BTJA 3IB0A 4QSEA 1YTVA 1Y4CA 1IZ1A 3DP8A 3MP6A 4Q5TA 1I6BA 4XKPA 3RT6B 1MY3A 1PB7A 2Y84A 2DWHA 3CIJA 1NH8A 1B52A 3TAJA 2F36A 1RKMA 1VSOA 2VHAA 2Y7RA 3VDFA 1H43A 3O6HA 2E0SA 5I56A 3VLVA 2Y7KA 4OESA 5BWJA 5F1QA 2PYYA 3OSRA 2GFEA 1MXZA 4NF6A 3SEWA 5H8FA 3TUSA 1EZOA 2V3TA 4G8NA 2OBGA 4ELPA 4EXKA 3TPAA 4KD5A 1EZPA 1UIVA 4TLLB 1R1NA 4G68B 1OLAA 3Q25A 4X1BA 2V93A 2XXHA 4PETA 1N04A 4JB7A 5FTHA 1QVSA 2PT2A 2R9JA 3H6TA 3PMVA 4LONB 2XXWA 1PBPA 2Y7PA 4DXUA 2RINA 2P1SA 4RYAA 3DP6A 3S2VA 3QYTA 4QFOA 3EPEA 3B7DA 4RXLA 5ELVA 4DCYA 1B1XA 4Z0IA 3ECRA 2HAUA 4IY6A 5DTBA 5TP9B 1GV8A 4EUOA 4ONYA 1FTLA 1AMFA 1NNTA 3VLWA 2F7AA 3JV9A 4QFLA 1NKXA 4GFRA 1FTMA 4F1UA 1EZ9A 2DXRA 3JZJA 1MM7A 3MVZA 1JW4A 5CI5A 1B3EA 3IOUA 3QK6A 4P11A 4POWA 2NWJA 1B7HA 3MAMA 4KCDA 2QMWA 4BDMA 4LZ5A 3TTRA 1EH3A 2I3WA 3FUZA 1IUDA 1LFIA 1MQJA 1Q35A 1SI0A 1P1UA 3IO6A 3LSXA 4NWDA 2HFBA 1FTJA 4RY1A 1B0LA 5H8NA 1B0HA 2Y7WA 3O6GA 2FA7A 2ONSA 4ND9A 1Y4TA 4R2BA 1WVJA 4DZ1A 2P0SA 3FIRA 4OMBA 2XXXA 2PX1A 4RPNA 2RC9A 4YKPA 1QJMA 2XX8A 2Z8FA 4DXCA 1P1OA 1GTKA 2DP8A 2XXTA 4C1TA 2XXRA 1B7ZA 1S9TA 5BUUA 2DE4A 1RYOA 3K6VA 4IO4A 2ALUA 4F3GA 4QFKA 4P0GA 1H76A 1OIBA 1TFDA 1FTOA 2UVJA 4YICA 4ZE9A 3KN8A 3PUVE 4FJPA 4RK2A 4U22A 1ATGA 1SVXB 3D4CA 1VFEA 3MP1A 2RKMA 5CMCA 4NF5B 5H8FB 3VVDA 4ESXA 1LB9A 1AIVA 3UP9A 2AIXA 4JSOA 1PB9A 3PV0E 4ZZAA 2G93A 2XX9A 5DEXA 5AA2D 3HHGA 2QS2A 4JWOA 5DT6A 2DS9A 5H8HA 4ZDMA 4EF2A 2D3IA 4OTEA 4EQ9A 4XXUA 4DIGA 4H5GA 4YKIA 3LSLA 1MXXA 2ABHA 1N3XA 1B2HA 2UVHA 2F34A 3LBSA 1ELJA 3PUXE 4R73A 4YU0A 4F1YA 2F35A 2F5XA 2WKYA 4OQOA 1OQGA 4OFJA 5I2NB 1WODA 1B4HA 2QRYA 2H9BA 4MFIA 5L9MA 5AA1A 2XD2A 5KDTB 3M3FA 2XHDA 4ZE8A 3PD9A 4NF6B 1D9VA 3CSBA 1A40A 5F7VA 1PEBA 2QJEA 1MH4A 3TELA 2D5WA 3IL1B 1IIWA 1LGBC 2Z8EA 1NL5A 1ZMGA 3N6TA 4XTCQ 1B5IA 1PBQA 3HHFA 1MPBA 3LUYA 3FJ7A 3IB1A 4G2ZA 1N3WA 4GVOA 4OXVA 2XXPA 1H45A 3R6UA 5TPAA 4H1XA 4I62A 3OOAA 1AL3A 3TCGA 5AA4B 1BIYA 1UIUA 1YPNA 2XXUA 2YLNA 2X7QA 1MM6A 1ZJLA 2BJJX 4LVQA 1NNFA 3IJXB 1LLSA 2I6EA 4F1VA 1M5FA 3HCQA 4O3BA 2REGA 4DCXA 4Q8RA 1MDP1 1SD3A 2O1LA 2QS1A 3E9XA 4QHQA 3FGSA 1DSNA 4YMAA 1QUIA 1SQYA 3MBPA 3RY3A 3C34A 1P1QA 1BLFA 1LAXA 1JQFA 3FD3A 3K6XA 4GLIA 2F8DA 3T96B 1SBPA 1XC1A 3CFXA 1MQIA 4X9TA 1DPEA 1USYE 4OETA 4IO6A 4OHNA 1R9LA 4TLMB 1IXHA 5CMMA 4BDLA 2PBWA 2NXOA 5FHNA 1I69A 3MW0A 3TTNA 1SYHA 1Y9UA 1MQGA 1O64A 1POY1 3PUYE 3SDFA 1BKAA 3CG3A 3U72A 3UGWA 3ZKKA 2GH9A 2RF1A 4ELRA 2ZYMA 1QW0A 1B58A 2AYSA 2OLBA 2V25A 1H3DA 2GRVA 4RJZA 2R6GE 5CRYA 1SYIA 4RPOA 5HPQA 2H25A 3EN3A 1M5DA 4GL0A 4ZEKA 1TWYA 1US4A 5I57A 2A5SA 2DXYA 3IR1A 4Q0CA 5CMKA 3TMGA 2V3QA 1TT1A 3MVXA 3MZ1A 3N5LA 4QF9A 3M8UA 1B4ZA 5AA3A 2Z23A 2ZNSA 1M5CA 3QIMA 3CVGA 1LAFE 1MQDA 3P7IA 3PGFA 2F97A 4R9GA 4G68A 2Q89A 3CFLA 4XKQA 3T66A 3IX1A 5A5XA 5CC2A 3E13X 3TQLA 3A3CA 3KZGA 1I6QA 3B6TA 1OQHA 1MS7A 3FVNA 2I4BA 2ONKE 4KQPA 4F29A 2ZYOA 4LP2B 1IXCA 4FIMA 4G8MA 5J1DA 3UN6A 2I4CA 2DWIA 1DTGA 1JVXA 3EHTA 3SEYA 3O29A 1DPPA 4KYSA 3TEPA 3KSJA 2Q2CA 5FHMA 2XXIA 5DEXB 4ZEBA 4OWDA 1M5BA 4EDPA 5L9OA 3Q26A 2DQVA 4U2RA 1B51A 3RPWA 2X7PA 3FV1A 4H6DA 3BBRA 4RNSA 2PVUA 4R75A 4WEDA 3THIA 3EHSA 4ZZEA 2XD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3K A;  5A5X B;  2F6G A;  4THI A;  3SEV A;  2ZXT A;  4LZ8 A;  4ZEI A;  2A5T A;  1Y3Q A;  4WXJ A;  3PMW A;  5ISU A;  3C36 A;  3KSX A;  3IOT A;  5H8Q A;  4GOT A;  2ZYK A;  3K2D A;  4U4X A;  5I56 B;  4ZED A;  1URD A;  2ZNU A;  5EHM A;  5K2X A;  1POT A;  2DSF A;  5I59 B;  1CE2 A;  3KFM A;  5I58 A;  3V83 A;  3FV2 A;  3IOW A;  1FQD A;  3JYR A;  1B3L A;  3MWB A;  2DWJ A;  3W15 C;  3H03 A;  1AH5 A;  2HEU A;  5FHO A;  4JWX A;  1PDA A;  1SW5 A;  2DE2 A;  2H5Y A;  3O66 A;  3H6V A;  5AA4 A;  1USY H;  3KN3 A;  3L6G A;  3QAX A;  4MF3 A;  4EQ7 A;  4KI0 E;  1I6A A;  5ITO A;  4IO2 A;  3RNN A;  2QS3 A;  1Y1Z A;  3BKI B;  3VXB A;  4GRK A;  5FTI A;  4PFU A;  4AQ4 A;  4JSD A;  3RLF E;  2QSX A;  4BDQ A;  3H6U A;  1JEV A;  3CRB A;  3H6W A;  3OEN A;  2VD3 A;  3H7M A;  2B3B A;  3K1N A;  3QUJ A;  4FEB A;  2RCA A;  1JW5 A;  4U23 A;  3ZS6 A;  1LBB A;  4U4S A;  1XS5 A;  3LR1 A;  3RN8 A;  3O97 A;  3OD7 A;  5K2Y A;  3H3G A;  1LCT A;  1D9Y A;  1JNF A;  4BDO A;  4OEN A;  2R71 A;  4HS7 A;  4PQJ A;  1ZBM A;  4RA1 A;  4DDD A;  3G3I A;  4HW8 A;  2OK2 A;  4G77 A;  1A8E A;  2DOJ A;  3ZKL A;  4UAC A;  3QSL A;  2GHB A;  4NWC A;  4U1Z A;  3OMB A;  4L17 A;  3MC2 A;  1D3K A;  3TZA A;  1MG1 A;  3U8Q A;  2O7U A;  3MP8 A;  1XVX A;  2CZL A;  4TQU Q;  2Q8J A;  3IOV A;  3CI8 A;  5KCJ B;  3OEK A;  4R6Y A;  1MXW A;  5M2V A;  1ZU0 A;  1QUL A;  4N07 A;  4Q30 B;  2D21 A;  3FVK A;  2Q88 A;  1FQC A;  3VLU A;  3ZSF A;  2O51 A;  3VVF A;  3K00 A;  4P0I A;  4FAT A;  5CBR A;  5KCJ A;  1T0K A;  1TFA A;  3QXM A;  2THI A;  4FOR A;  2F7B A;  2REJ A;  2B65 A;  5KDT A;  4ZEC A;  4JXI A;  2IA4 A;  3B6W A;  5DVF A;  5ITP A;  2XXY A;  4EF1 A;  2W7Y A;  3BFU A;  1DOT A;  2H98 A;  4NF4 A;  1MPD A;  5CM6 A;  4LAT A;  1MXV A;  2G29 A;  1MXY A;  2QMX A;  1SW4 A;  1YAE A;  3K01 A;  1OVB A;  3DEL B;  3OSQ A;  1MY0 A;  3TFL A;  3H4Z A;  3HST A;  3RT8 A;  3BFT A;  1A54 A;  1MXU A;  2O68 A;  3LC8 A;  4GF8 A;  1O7T A;  1HSE A;  1Z7M E;  4M4G A;  2DYX A;  3Q29 A;  4QFP A;  3T9H B;  1B9J A;  3FXQ A;  5EYF A;  4OYV A;  4I1D A;  1L5T A;  3KN7 A;  4R74 A;  4YB6 A;  1B40 A;  3IO4 A;  1GVC A;  1B1H A;  3IB2 A;  3G3H A;  2I49 A;  3N94 A;  4N13 A;  1OMP A;  4NMY A;  4R6K A;  5TU0 A;  3SKP A;  3RTW B;  4F3B A;  4F3P A;  1UTH B;  4KR5 A;  4LA9 A;  1SW1 A;  3W9V A;  1MRP A;  2Z22 A;  2OZZ A;  3W9W A;  1F9B A;  4IO3 A;  4XKN A;  3V5A A;  3RTF B;  3OEL A;  1UQW A;  3MJN A;  3TKD A;  1FCK A;  4GD5 A;  3SEU A;  2O6A A;  2XX7 A;  3HPI A;  4H8I A;  3KEI A;  1P1N A;  4G4P A;  3FVG A;  1S50 A;  3SET A;  4R6H A;  1S7Y A;  4QRZ A;  4ZS9 A;  4H5F A;  4GXA A;  3V8X B;  2FNC A;  1DTZ A;  2DE3 A;  3PMX A;  4YAH X;  1N0T A;  1VR5 A;  3EHU A;  3DLN A;  1ANF A;  4KFQ A;  5TP9 A;  3UA8 A;  3E3K A;  1OVT A;  4F2O A;  4XKR A;  3C33 A;  1FQA A;  4OER A;  1MY1 A;  4KYD A;  3TCH A;  1AOV A;  3QUF A;  5H8Q B;  1SI1 A;  1LFG A;  1NNK A;  3G3J A;  1FQE A;  1LAH E;  3IOR A;  1R6Z A;  1B3H A;  1GR2 A;  2OWS A;  4I9D A;  4LQ5 A;  4WEP A;  2I48 A;  1NMU A;  4PFW A;  5AE4 A;  3MZB A;  1LAG E;  5L9S A;  3MZ9 A;  1Z7N E;  4H65 A;  4IB2 A;  4LUB A;  2NOO A;  2UYF A;  1NH7 A;  2B3F A;  1LBC A;  1MY4 A;  2QPQ A;  3AXF A;  3OO6 A;  4G8H A;  4GWO A;  2NUV A;  2F78 A;  4NTL A;  1A7L A;  1Y3N A;  4KHZ E;  3SEX A;  4YB7 A;  1IEJ A;  1B5J A;  1CB6 A;  4IGR A;  4I8C A;  2O69 A;  2IEE A;  5LOM A;  3MPL A;  3KJT A;  2FYI A;  3TDJ A;  3S9M C;  1JET A;  4K3F A;  5IAI A;  2P2A A;  5JTY B;  4EXL A;  2I0C A;  1Y3P A;  1O63 A;  4TOZ A;  1A8F A;  2NVU B;  1B7U A;  1VFD A;  2XXV A;  5H8N B;  3WAF A;  1LCF A;  2QS4 A;  4QSD A;  3KBR A;  1FTK A;  2V84 A;  1SDX A;  3E4R A;  2UVI A;  2UXA A;  3FXU A;  3VV5 A;  5JEI A;  5I58 B;  2HAV A;  3O2A A;  3UIF A;  2V3U A;  4YKJ A;  4F2Q A;  2XXQ A;  4POX A;  4ECF A;  4YB5 A;  4FE8 A;  1J1N A;  3SER A;  1ZKB A;  3U94 A;  4UA8 A;  2ZYN A;  3T22 A;  1B6H A;  4IY5 A;  4HCW A;  4FEC A;  5I57 B;  4F19 A;  1II5 A;  2RC7 A;  2M8C A;  4JDF A;  1RYX A;  4DXB A;  1US5 A;  1MH3 A;  3GBA A;  3K02 A;  4F3S A;  3TTL A;  3O28 A;  1B3G A;  1URS A;  4MH5 A;  4EQB A;  3S9E A;  1MPC A;  4R2F A;  3O9P A;  1XVY A;  3KGC A;  2YJP A;  1VE4 A;  1P1W A;  3ONM A;  2Y7I A;  4IO7 A;  2PT1 A;  2VGQ A;  4GL8 A;  4RK9 A;  5DYH A;  1TXF A;  2GHA A;  2YPN A;  4N6P A;  5I2K B;  4ISU A;  3S4U A;  3T93 B;  1A55 A;  4BLA A;  4F39 A;  5HM4 B;  4YZZ A;  4H0W A;  5H8S A;  3FZV A;  3KOT A;  1NFT A;  3C32 A;  3MPK A;  3C9H A;  3LSW A;  1URG A;  3OO9 A;  5DVJ A;  2X26 A;  1ZTY A;  3MQ9 A;  4R9F A;  5HBC A;  2Q2A A;  3T9X B;  2H4I A;  3Q28 A;  3ILT B;  5I84 A;  1FQF A;  3VXC A;  3IAZ A;  4HCY A;  1M5E A;  1MDQ A;  4C1U A;  2DWA A;  3KOS A;  2HZK A;  4GXS B;  4HTG A;  2A5T B;  4OFO A;  4PFT A;  4PFY A;  1JW1 A;  1WDN A;  4U1O A;  4XIG Q;  3T9U A;  4QSC A;  1UTB B;  5JK4 A;  3TCF A;  4KPT A;  3CR9 A;  3Q27 A;  3FAT A;  2AL4 A;  3DM0 A;  5I2K A;  3OO7 A;  4NF8 B;  3VFJ A;  1D4N A;  4YMB A;  4PP0 A;  4GIZ A;  3K6W A;  1OLC A;  2CMO A;  2HCA A;  2O84 X;  3CG1 A;  4MBP A;  1QUK A;  5ICQ A;  2I0B A;  5IKB A;  3PD8 A;  1R9Q A;  1PB8 A;  2OCU A;  4OZ9 A;  3RUM A;  2RC8 A;  4YKK A;  1H44 A;  4FAJ A;  4IGT A;  5B7D A;  3MVW A;  3LSF B;  4C0R A;  3CFZ A;  4WKM A;  1IIT A;  3MUQ A;  3OXN A;  3PPQ A;  2H99 A;  4H8J A;  1NNP A;  3DP4 A;  2ANJ A;  2OJT A;  1MQH A;  3CSG A;  4LQ2 A;  4R72 A;  4E0X A;  4KYE A;  1ZIU A;  3T9V A;  3GLB A;  3TOD A;  5AA2 B;  3PU5 A;  4NF8 A;  1XOC A;  2ESN A;  2HZL A;  3PPO A;  4ELO A;  3RQT A;  1KWH A;  1P99 A;  4MLQ A;  1N7W A;  2I58 A;  1IXI A;  3G3F A;  3HV1 A;  1PC3 A;  2KLF A;  1Y20 A;  3S9L C;  1QUJ A;  1Q1K A;  2QL3 A;  3V89 B;  3N26 A;  3FAS A;  3K0V A;  2HQ0 A;  3EQ1 A;  3GZG A;  4G68 C;  2UVG A;  3B6Q A;  1SW2 A;  3USD A;  4X1D A;  2ZNT A;  5B70 A;  2DVC A;  1LB8 A;  3H06 B;  3ODB A;  5L8D A;  2F6P A;  2Q9T A;  3GBB A;  3PPP A;  2VP1 A;  3MVY A;  3K6U A;  3PUW E;  4OVJ A;  1ZLQ A;  5EHS A;  3SES A;  3WAE A;  4OFL A;  3I6V A;  3I5O A;  5KZT A;  3A3U A;  4M1V A;  5I59 A;  4DLD A;  2UYE A;  4E0W A;  4OEU A;  3IK6 B;  3TQW A;  1QKA A;  1DMB A;  4O3A A;  4OEV A;  1FQB A;  3OEM A;  3PPR A;  1LFH A;  2O7I A;  2ZMB A;  4NF4 B;  4NED A;  4ELQ A;  1FW0 A;  3K1M A;  1B32 A;  2DVZ A;  4F31 B;  3N6U A;  2LAO A;  1UTH A;  5JTY A;  3HO7 A;  4Z7E A;  3UK4 A;  3S9N C;  1LST A;  4U21 A;  3VVE A;  2F7C A;  3O6I A;  4FED A;  1EU8 A;  4H67 A;  3D4G A;  4BDR A;  1QKB A;  3FJG A;  3G7W A;  1HSL A;  4KCC A;  3TTM A;  1IXG A;  3TYH A;  1HSJ A;  3C4M A;  5CBS A;  5I2N A;  1GGG A;  1B3F A;  2VOZ A;  3FJM A;  2HXW A;  2RCB A;  4JBZ A;  2PMS A;  4JWY A;  3R7X A;  3L6H A;  1IQ7 A;  2ONR A;  3OO8 A;  3UOR A;  5TPA B;  3PUZ E;  3F11 A;  3I3V A;  5ICT A;  3TTK A;  3ILU B;  1B05 A;  1BP5 A;  3FXR A;  3EF7 A;  3HN0 A;  3KG2 A;  4NE4 A;  4AB6 A;  5DVI A;  3U1O A;  1Y1M A;  4IO5 A;  3RGY A;  5H8H B;  2I3V A;  3K1P A;  3GXA A;  3U92 A;  3R26 A;  3VE1 B;  1UTB A;  3FVO A;  1JVY A;  4F22 A;  4X48 A;  1JEU A;  4LZ7 A;  1XT8 A;  2E1S A;  1A99 A;  4F18 A;  5AA2 A;  3PPN A;  4O3C A;  4NF5 A;  3C31 A;  3M3L A;  1B46 A;  4AB5 A;  4ESW A;  2O1M A;  3U93 A;  3K4U A;  2VD2 A;  3G3K A;  2Z8D A;  4MLV A;  1MY2 A;  3A09 A;  3G3G A;  2OWT A;  3C35 A;  4QFN A;  4GQO A;  1YCJ A;  4DE8 A;  1XHY A;  5CMB A;  3KJ7 A;  1B5H A;  1N84 A;  4ZEF A;  2AL5 A;  1N76 A;  3IJO B;  4PE5 B;  4BDN A;  1N7X A;  1BTJ A;  3IB0 A;  4QSE A;  1YTV A;  1Y4C A;  1IZ1 A;  3DP8 A;  3MP6 A;  4Q5T A;  1I6B A;  4XKP A;  3RT6 B;  1MY3 A;  1PB7 A;  2Y84 A;  2DWH A;  3CIJ A;  1NH8 A;  1B52 A;  3TAJ A;  2F36 A;  1RKM A;  1VSO A;  2VHA A;  2Y7R A;  3VDF A;  1H43 A;  3O6H A;  2E0S A;  5I56 A;  3VLV A;  2Y7K A;  4OES A;  5BWJ A;  5F1Q A;  2PYY A;  3OSR A;  2GFE A;  1MXZ A;  4NF6 A;  3SEW A;  5H8F A;  3TUS A;  1EZO A;  2V3T A;  4G8N A;  2OBG A;  4ELP A;  4EXK A;  3TPA A;  4KD5 A;  1EZP A;  1UIV A;  4TLL B;  1R1N A;  4G68 B;  1OLA A;  3Q25 A;  4X1B A;  2V93 A;  2XXH A;  4PET A;  1N04 A;  4JB7 A;  5FTH A;  1QVS A;  2PT2 A;  2R9J A;  3H6T A;  3PMV A;  4LON B;  2XXW A;  1PBP A;  2Y7P A;  4DXU A;  2RIN A;  2P1S A;  4RYA A;  3DP6 A;  3S2V A;  3QYT A;  4QFO A;  3EPE A;  3B7D A;  4RXL A;  5ELV A;  4DCY A;  1B1X A;  4Z0I A;  3ECR A;  2HAU A;  4IY6 A;  5DTB A;  5TP9 B;  1GV8 A;  4EUO A;  4ONY A;  1FTL A;  1AMF A;  1NNT A;  3VLW A;  2F7A A;  3JV9 A;  4QFL A;  1NKX A;  4GFR A;  1FTM A;  4F1U A;  1EZ9 A;  2DXR A;  3JZJ A;  1MM7 A;  3MVZ A;  1JW4 A;  5CI5 A;  1B3E A;  3IOU A;  3QK6 A;  4P11 A;  4POW A;  2NWJ A;  1B7H A;  3MAM A;  4KCD A;  2QMW A;  4BDM A;  4LZ5 A;  3TTR A;  1EH3 A;  2I3W A;  3FUZ A;  1IUD A;  1LFI A;  1MQJ A;  1Q35 A;  1SI0 A;  1P1U A;  3IO6 A;  3LSX A;  4NWD A;  2HFB A;  1FTJ A;  4RY1 A;  1B0L A;  5H8N A;  1B0H A;  2Y7W A;  3O6G A;  2FA7 A;  2ONS A;  4ND9 A;  1Y4T A;  4R2B A;  1WVJ A;  4DZ1 A;  2P0S A;  3FIR A;  4OMB A;  2XXX A;  2PX1 A;  4RPN A;  2RC9 A;  4YKP A;  1QJM A;  2XX8 A;  2Z8F A;  4DXC A;  1P1O A;  1GTK A;  2DP8 A;  2XXT A;  4C1T A;  2XXR A;  1B7Z A;  1S9T A;  5BUU A;  2DE4 A;  1RYO A;  3K6V A;  4IO4 A;  2ALU A;  4F3G A;  4QFK A;  4P0G A;  1H76 A;  1OIB A;  1TFD A;  1FTO A;  2UVJ A;  4YIC A;  4ZE9 A;  3KN8 A;  3PUV E;  4FJP A;  4RK2 A;  4U22 A;  1ATG A;  1SVX B;  3D4C A;  1VFE A;  3MP1 A;  2RKM A;  5CMC A;  4NF5 B;  5H8F B;  3VVD A;  4ESX A;  1LB9 A;  1AIV A;  3UP9 A;  2AIX A;  4JSO A;  1PB9 A;  3PV0 E;  4ZZA A;  2G93 A;  2XX9 A;  5DEX A;  5AA2 D;  3HHG A;  2QS2 A;  4JWO A;  5DT6 A;  2DS9 A;  5H8H A;  4ZDM A;  4EF2 A;  2D3I A;  4OTE A;  4EQ9 A;  4XXU A;  4DIG A;  4H5G A;  4YKI A;  3LSL A;  1MXX A;  2ABH A;  1N3X A;  1B2H A;  2UVH A;  2F34 A;  3LBS A;  1ELJ A;  3PUX E;  4R73 A;  4YU0 A;  4F1Y A;  2F35 A;  2F5X A;  2WKY A;  4OQO A;  1OQG A;  4OFJ A;  5I2N B;  1WOD A;  1B4H A;  2QRY A;  2H9B A;  4MFI A;  5L9M A;  5AA1 A;  2XD2 A;  5KDT B;  3M3F A;  2XHD A;  4ZE8 A;  3PD9 A;  4NF6 B;  1D9V A;  3CSB A;  1A40 A;  5F7V A;  1PEB A;  2QJE A;  1MH4 A;  3TEL A;  2D5W A;  3IL1 B;  1IIW A;  1LGB C;  2Z8E A;  1NL5 A;  1ZMG A;  3N6T A;  4XTC Q;  1B5I A;  1PBQ A;  3HHF A;  1MPB A;  3LUY A;  3FJ7 A;  3IB1 A;  4G2Z A;  1N3W A;  4GVO A;  4OXV A;  2XXP A;  1H45 A;  3R6U A;  5TPA A;  4H1X A;  4I62 A;  3OOA A;  1AL3 A;  3TCG A;  5AA4 B;  1BIY A;  1UIU A;  1YPN A;  2XXU A;  2YLN A;  2X7Q A;  1MM6 A;  1ZJL A;  2BJJ X;  4LVQ A;  1NNF A;  3IJX B;  1LLS A;  2I6E A;  4F1V A;  1M5F A;  3HCQ A;  4O3B A;  2REG A;  4DCX A;  4Q8R A;  1MDP 1;  1SD3 A;  2O1L A;  2QS1 A;  3E9X A;  4QHQ A;  3FGS A;  1DSN A;  4YMA A;  1QUI A;  1SQY A;  3MBP A;  3RY3 A;  3C34 A;  1P1Q A;  1BLF A;  1LAX A;  1JQF A;  3FD3 A;  3K6X A;  4GLI A;  2F8D A;  3T96 B;  1SBP A;  1XC1 A;  3CFX A;  1MQI A;  4X9T A;  1DPE A;  1USY E;  4OET A;  4IO6 A;  4OHN A;  1R9L A;  4TLM B;  1IXH A;  5CMM A;  4BDL A;  2PBW A;  2NXO A;  5FHN A;  1I69 A;  3MW0 A;  3TTN A;  1SYH A;  1Y9U A;  1MQG A;  1O64 A;  1POY 1;  3PUY E;  3SDF A;  1BKA A;  3CG3 A;  3U72 A;  3UGW A;  3ZKK A;  2GH9 A;  2RF1 A;  4ELR A;  2ZYM A;  1QW0 A;  1B58 A;  2AYS A;  2OLB A;  2V25 A;  1H3D A;  2GRV A;  4RJZ A;  2R6G E;  5CRY A;  1SYI A;  4RPO A;  5HPQ A;  2H25 A;  3EN3 A;  1M5D A;  4GL0 A;  4ZEK A;  1TWY A;  1US4 A;  5I57 A;  2A5S A;  2DXY A;  3IR1 A;  4Q0C A;  5CMK A;  3TMG A;  2V3Q A;  1TT1 A;  3MVX A;  3MZ1 A;  3N5L A;  4QF9 A;  3M8U A;  1B4Z A;  5AA3 A;  2Z23 A;  2ZNS A;  1M5C A;  3QIM A;  3CVG A;  1LAF E;  1MQD A;  3P7I A;  3PGF A;  2F97 A;  4R9G A;  4G68 A;  2Q89 A;  3CFL A;  4XKQ A;  3T66 A;  3IX1 A;  5A5X A;  5CC2 A;  3E13 X;  3TQL A;  3A3C A;  3KZG A;  1I6Q A;  3B6T A;  1OQH A;  1MS7 A;  3FVN A;  2I4B A;  2ONK E;  4KQP A;  4F29 A;  2ZYO A;  4LP2 B;  1IXC A;  4FIM A;  4G8M A;  5J1D A;  3UN6 A;  2I4C A;  2DWI A;  1DTG A;  1JVX A;  3EHT A;  3SEY A;  3O29 A;  1DPP A;  4KYS A;  3TEP A;  3KSJ A;  2Q2C A;  5FHM A;  2XXI A;  5DEX B;  4ZEB A;  4OWD A;  1M5B A;  4EDP A;  5L9O A;  3Q26 A;  2DQV A;  4U2R A;  1B51 A;  3RPW A;  2X7P A;  3FV1 A;  4H6D A;  3BBR A;  4RNS A;  2PVU A;  4R75 A;  4WED A;  3THI A;  3EHS A;  4ZZE A;  2XD3 A; 
#chains in the Genus database with same CATH topology
 5A5X B;  4THI A;  4ZEI A;  4WXJ A;  4U4X A;  1POT A;  2DSF A;  3KFM A;  3W15 C;  1SW5 A;  2H5Y A;  1FBF A;  5AA4 A;  3KN3 A;  4EQ7 A;  3IFA A;  5ITO A;  1Y1Z A;  5FTI A;  4AQ4 A;  3RLF E;  4QXD A;  2VD3 A;  3K1N A;  1LBB A;  3RN8 A;  3OD7 A;  3H3G A;  2R71 A;  3G3I A;  2OK2 A;  1A8E A;  4UAC A;  3QSL A;  3TZA A;  1XVX A;  1LBX A;  1IMC A;  1ZU0 A;  4Q30 B;  3ZSF A;  1FQC A;  1FBH A;  2O51 A;  3K00 A;  4P0I A;  3QXM A;  1AWB A;  2WEF A;  4JXI A;  4NF4 A;  2G29 A;  3K01 A;  4GWZ A;  3TFL A;  3H4Z A;  2O68 A;  1HSE A;  1YZ0 A;  1GVC A;  1B1H A;  3IB2 A;  4GWW A;  3N94 A;  3SKP A;  5TU0 A;  4N13 A;  1OMP A;  4N8G A;  1IMA A;  3W9W A;  4IO3 A;  3RTF B;  3TKD A;  4GD5 A;  5ET7 A;  3FVG A;  1S50 A;  4GXA A;  3V8X B;  1FPL A;  2DE3 A;  1VR5 A;  1ANF A;  4KFQ A;  4F2O A;  3E3K A;  4XKR A;  3C33 A;  1MY1 A;  4KYD A;  3QUF A;  1FPK A;  4WEP A;  1FPI A;  3MZB A;  5L9S A;  3MZ9 A;  1Z7N E;  4LUB A;  2B3F A;  2QPQ A;  4KHZ E;  4YB7 A;  1IEJ A;  1B5J A;  1CB6 A;  4IGR A;  3S9M C;  4K3F A;  4EXL A;  4PAI A;  4DI4 B;  2L5V A;  4PGN A;  1B7U A;  1VFD A;  4QSD A;  3FXU A;  2UXA A;  2HAV A;  3UIF A;  3IFC A;  3LV0 A;  1ZKB A;  2ZYN A;  1II5 A;  1US5 A;  1MH3 A;  4MH5 A;  1MPC A;  2FIX A;  1VE4 A;  2WYP A;  2YJP A;  2PT1 A;  3KC0 A;  4N6P A;  4F39 A;  1A55 A;  1FBC A;  5HM4 B;  4YZZ A;  3FZV A;  3LSW A;  3OO9 A;  4KXP A;  3MQ9 A;  1ZTY A;  5HBC A;  3Q28 A;  3IAZ A;  1M5E A;  4PFT A;  3KOS A;  1FPJ A;  4AS4 A;  2A5T B;  4QSC A;  3FAT A;  5I2K A;  1IMB A;  4GIZ A;  2CMO A;  4MBP A;  3PD8 A;  1PB8 A;  5B7D A;  4IGT A;  3MVW A;  3OXN A;  3PPQ A;  1NNP A;  3CSG A;  1MQH A;  4LQ2 A;  4E0X A;  3PU5 A;  2HZL A;  3RQT A;  3HV1 A;  2KLF A;  2FBP A;  1Y20 A;  1QUJ A;  2QL3 A;  3MST A;  3V89 B;  3EQ1 A;  4PFB A;  4G68 C;  4X1D A;  3ODB A;  2VP1 A;  3MVY A;  3SES A;  3I6V A;  4E0W A;  1DMB A;  4O3A A;  1FQB A;  3PPR A;  2OX3 A;  4F31 B;  1FJ6 A;  3HO7 A;  4Z7E A;  3S9N C;  4OVR A;  4H67 A;  4FED A;  1EU8 A;  3TTM A;  3TYH A;  1NV0 A;  1HSJ A;  4JWY A;  3L6H A;  3OO8 A;  5TPA B;  3PUZ E;  3F11 A;  4PFI A;  1INP A;  1BP5 A;  4PCD A;  3HN0 A;  3RGY A;  3K1P A;  4LZ7 A;  4F18 A;  3PPN A;  3C31 A;  3M3L A;  1B46 A;  4AB5 A;  4ESW A;  2WBB A;  3G3K A;  1IMF A;  2Z8D A;  3A09 A;  2OWT A;  4XFE A;  4QFN A;  4GQO A;  1YCJ A;  5CMB A;  3KJ7 A;  1N76 A;  4BDN A;  1YTV A;  1Y4C A;  3MP6 A;  4Q5T A;  2VPN A;  2Y84 A;  1B52 A;  4MMP A;  1RKM A;  1G0H A;  1H43 A;  3O6H A;  2Y7K A;  3FXB A;  5F1Q A;  2V3T A;  4ELP A;  1UIV A;  4TLL B;  2XXW A;  2RIN A;  3QYT A;  3EPE A;  3B7D A;  1B1X A;  4Z0I A;  1Q9D A;  1NKX A;  2KQZ A;  4GX3 A;  1QGX A;  3IOU A;  3QK6 A;  2CEX A;  4P11 A;  1B7H A;  2QMW A;  4LZ5 A;  1Q35 A;  4NWD A;  1FTJ A;  1NV3 A;  3O6G A;  2ONS A;  3B8B A;  2PX1 A;  2Z8F A;  4P1E A;  2DE4 A;  3KN8 A;  3PUV E;  1ATG A;  1SVX B;  3D4C A;  1VFE A;  2CZK A;  1AIV A;  5EQ9 A;  5DEX A;  2QS2 A;  5DT6 A;  4GWY A;  3SZP A;  5JTY A;  2F34 A;  4R73 A;  2F35 A;  1WOD A;  2XD2 A;  5KDT B;  4ZE8 A;  2QJE A;  1IIW A;  3N6T A;  3KBZ A;  4XTC Q;  1B5I A;  1MPB A;  1N3W A;  4GVO A;  4OXV A;  4I62 A;  1K9Y A;  1BIY A;  2BJJ X;  4LVQ A;  4JVC A;  3IJX B;  1M5F A;  4DCX A;  1IME A;  4QHQ A;  1QUI A;  3MBP A;  1JQF A;  2F8D A;  1SBP A;  1DPE A;  4IO6 A;  2HXR A;  4MIJ A;  1Y9U A;  1MQG A;  2XWI A;  3UGW A;  2FHY A;  2GH9 A;  2ZYM A;  4DI3 D;  5CRY A;  1QW0 A;  4HE1 A;  2H25 A;  1M5D A;  4GL0 A;  2A5S A;  2V3Q A;  1TT1 A;  3MVX A;  1NI9 A;  2XWK A;  3M8U A;  2Z23 A;  2XXK A;  4EQB A;  1M5C A;  3QIM A;  3CVG A;  4G68 A;  3CFL A;  3IX1 A;  4NHB A;  1OQH A;  2ONK E;  4LP2 B;  4FIM A;  1JVX A;  3EHT A;  3KSJ A;  2XXI A;  4NX1 A;  5L9O A;  1B51 A;  3EKI A;  3THI A;  3EHS A;  4ZZE A;  2F6G A;  3SEV A;  2ZXT A;  1Y3Q A;  3KSX A;  4PDH A;  2ZNU A;  5EHM A;  1FPF A;  1CE2 A;  1FQD A;  2QVU A;  3JYR A;  1B3L A;  2MKZ A;  3MWB A;  3H03 A;  5FHO A;  1PDA A;  3O66 A;  4O8M A;  4MF3 A;  4NQ8 A;  4KI0 E;  2QS3 A;  3BKI B;  4GRK A;  2FIE A;  3OEN A;  3H7M A;  2RCA A;  1JW5 A;  4U23 A;  4U4S A;  1XS5 A;  5F24 A;  1FBG A;  4I3E A;  1JNF A;  4BDO A;  4HS7 A;  4PQJ A;  1ZBM A;  4MCO A;  4G77 A;  2F3D A;  2CZL A;  2Q8J A;  3OEK A;  5M2V A;  4N07 A;  3RYD A;  4OAN A;  4FAT A;  5CBR A;  1T0K A;  1TFA A;  2THI A;  2REJ A;  2CEY A;  1G0I A;  5DVF A;  1DOT A;  2QMX A;  5EYH A;  4XEQ A;  3B50 A;  3HST A;  3RT8 A;  4UAB A;  4GF8 A;  1B9J A;  5EYF A;  1L5T A;  2I49 A;  4R6K A;  3BIG A;  1UTH B;  3W9V A;  1MRP A;  3V5A A;  1FCK A;  1LBV A;  3SET A;  4R6H A;  1S7Y A;  4QRZ A;  4H5F A;  3PMX A;  3EHU A;  3DLN A;  3TCH A;  3QMF A;  5EQ8 A;  1SI1 A;  2WYK A;  1GR2 A;  2OWS A;  2QFL A;  4H65 A;  3T66 A;  3U93 A;  4GWO A;  2WX9 A;  5LOM A;  3MPL A;  1K9Z A;  2FYI A;  3TDJ A;  3RPL B;  5IAI A;  2V84 A;  3E4R A;  1SDX A;  5JEI A;  2UVI A;  4GBW A;  4N4U A;  5I58 B;  4F2Q A;  5IZZ A;  4UA8 A;  4IY5 A;  4HCW A;  4F19 A;  4JDF A;  1RYX A;  4F3S A;  1B3G A;  4P9K A;  4IO7 A;  1TXF A;  2YPN A;  4ISU A;  4H0W A;  3MPK A;  3T9X B;  3ILT B;  3VXC A;  2DWA A;  4XIG Q;  4PFY A;  3Q27 A;  4P3L A;  3VFJ A;  4PP0 A;  2I0B A;  5IKB A;  3RUM A;  2RC8 A;  4YKK A;  1RDY A;  4FAJ A;  4MX6 A;  5HPQ A;  3DP4 A;  4KYE A;  1RDX A;  4NF8 A;  4ELO A;  1P99 A;  1IXI A;  3S9L C;  3N26 A;  3K0V A;  2HQ0 A;  2UVG A;  3B6Q A;  2ZNT A;  3H06 B;  2Q9T A;  3PPP A;  3PUW E;  4BDL A;  1FJ9 A;  5I59 A;  5ET8 A;  4NF4 B;  2ZMB A;  1FW0 A;  1B32 A;  4NN3 A;  3N6U A;  2LAO A;  3D4G A;  1QKB A;  2VOZ A;  1FTA A;  2RCB A;  4JBZ A;  1IQ7 A;  3LUZ A;  4OA4 A;  3UOR A;  3I3V A;  3ILU B;  1B05 A;  4O94 A;  4AB6 A;  5DVI A;  4IO5 A;  3GYY A;  1UTB A;  3FVO A;  4OVP A;  2E1S A;  3CHG A;  1CNQ A;  2O1M A;  5I5P A;  4ZEF A;  2AL5 A;  4PE5 B;  4HE2 A;  2VPO A;  4QSE A;  1IZ1 A;  1I6B A;  3RT6 B;  1PB7 A;  3CIJ A;  2DWH A;  2VHA A;  1VSO A;  4NF6 A;  5H8F A;  1FRP A;  2OBG A;  3TPA A;  1EZP A;  2BJI A;  4G68 B;  4PET A;  5FTH A;  1QVS A;  2PT2 A;  2R9J A;  3H6T A;  2Y7P A;  1PBP A;  4RYA A;  4RXL A;  5ELV A;  3ECR A;  5TP9 B;  1FBD A;  1FTL A;  4GFR A;  1EZ9 A;  3JZJ A;  1MM7 A;  1JW4 A;  5CI5 A;  1B3E A;  1EH3 A;  1LFI A;  1P1U A;  1LBZ A;  3IO6 A;  2HFB A;  4GX6 A;  4MNP A;  3KC1 A;  4R2B A;  2P3N A;  4OVS A;  1QJM A;  1P1O A;  1NV5 A;  4C1T A;  2XXR A;  1B7Z A;  1EYK A;  1RYO A;  4F3G A;  4QFK A;  1FTO A;  4FJP A;  4RK2 A;  4U22 A;  2RKM A;  4GX4 A;  1LB9 A;  4JSO A;  4ZZA A;  2XX9 A;  3HHG A;  4ZDM A;  2DS9 A;  4OTE A;  4EQ9 A;  3LSL A;  1MXX A;  3PUX E;  2UVH A;  3LBS A;  2WKY A;  4OQO A;  1OQG A;  4OFJ A;  4MFI A;  5L9M A;  3M3F A;  2XHD A;  3PD9 A;  1A40 A;  1NUX A;  1PEB A;  1MH4 A;  2V4C A;  3HHF A;  3LUY A;  2OWZ A;  1YXI A;  5TPA A;  1H45 A;  3OOA A;  4AS5 A;  2YLN A;  1MDP 1;  1SD3 A;  3T0J A;  1DSN A;  1SQY A;  1P1Q A;  1FBE A;  1LAX A;  3FD3 A;  3U8Q A;  3E78 A;  3CFX A;  2DDK A;  1R9L A;  5FHN A;  1I69 A;  5EQ7 A;  3ZKK A;  1O64 A;  2Y5K A;  2V25 A;  5IZ3 A;  1H3D A;  2GRV A;  4P1L A;  4RJZ A;  1TWY A;  2DXY A;  3IR1 A;  1FPE A;  2HPG A;  3PGF A;  1MQD A;  4XKQ A;  3P7I A;  3NOH A;  4JVI A;  2Q89 A;  4NF0 A;  3TQL A;  4GWU A;  1NV2 A;  3KZG A;  2I4B A;  5J1D A;  2DWI A;  4KYS A;  2HHM A;  4ZEB A;  1RDZ A;  3BBR A;  2PVU A;  4R75 A;  4LZ8 A;  2A5T A;  3PMW A;  3IOT A;  1URD A;  3V83 A;  5I58 A;  3IOW A;  1AH5 A;  2HEU A;  4JWX A;  4PAK A;  1USY H;  3QAX A;  5DW8 A;  4IO2 A;  5EQA A;  4PFU A;  4JSD A;  2QSX A;  4BDQ A;  3H6U A;  3CRB A;  2B3B A;  3QUJ A;  3ZS6 A;  3LR1 A;  4H45 A;  3O97 A;  5K2Y A;  2B4L A;  1D9Y A;  1KA1 A;  4OEN A;  4RA1 A;  4HW8 A;  2DOJ A;  4NWC A;  3OMB A;  4L17 A;  3MC2 A;  1D3K A;  1MG1 A;  5T3J A;  3IOV A;  3CI8 A;  4R6Y A;  4MNC A;  2D21 A;  2Q88 A;  3VVF A;  4FOR A;  2F7B A;  4ZEC A;  2IA4 A;  5ITP A;  2XXY A;  2W7Y A;  3BFU A;  2H98 A;  2XWO A;  4LAT A;  1MXV A;  1FSA A;  1MXY A;  1SW4 A;  1YAE A;  3OSQ A;  1A54 A;  1MXU A;  3LC8 A;  2DYX A;  3Q29 A;  4QFP A;  3T9H B;  3FXQ A;  4OYV A;  4I1D A;  3KN7 A;  4R74 A;  4NMY A;  4KR5 A;  2OZZ A;  1F9B A;  4XKN A;  3OEL A;  1UQW A;  3MJN A;  3KEI A;  1P1N A;  4G4P A;  2Q74 A;  4ZS9 A;  2FNC A;  4YAH X;  5TP9 A;  1N0T A;  1FBP A;  4NG7 A;  1FQA A;  4OER A;  4X8R A;  5H8Q B;  3G3J A;  4LQ5 A;  1FQE A;  1LAH E;  1R6Z A;  1B3H A;  4I9D A;  2I48 A;  4H46 A;  1NMU A;  5AE4 A;  1LAG E;  5EHS A;  4EDP A;  1NH7 A;  4G8H A;  1LBC A;  1MY4 A;  5BUU A;  4NTL A;  2NUV A;  1A7L A;  3SEX A;  4HXV A;  4I8C A;  2IEE A;  4N6K A;  2P2A A;  5JTY B;  2I0C A;  4MEV A;  3ROJ A;  1Y3P A;  1O63 A;  4TOZ A;  1A8F A;  5H8N B;  1LCF A;  3VV5 A;  1FTK A;  3O2A A;  4N6D A;  2V3U A;  4YKJ A;  4POX A;  4YB5 A;  3SER A;  3T22 A;  5I57 B;  2RC7 A;  3GBA A;  3K02 A;  3O28 A;  4NAP A;  3S9E A;  4R2F A;  3O9P A;  1XVY A;  1P1W A;  3ONM A;  4GBV A;  2VGQ A;  4GL8 A;  3T93 B;  2GHA A;  3C32 A;  3C9H A;  1URG A;  2H4I A;  2Q8M A;  5I84 A;  4HCY A;  1MDQ A;  2HZK A;  4OFO A;  1JW1 A;  5JK4 A;  1UTB B;  3TCF A;  2AL4 A;  3DM0 A;  4NF8 B;  1D4N A;  4YMB A;  3CFZ A;  2H99 A;  4H8J A;  2OJT A;  5IZ1 A;  1ZIU A;  3GLB A;  3TOD A;  2ESN A;  4N17 A;  1KWH A;  1NV4 A;  4MLQ A;  4PE3 A;  1N7W A;  3G3F A;  1Q1K A;  2DVC A;  1LB8 A;  3GBB A;  3K6U A;  3WAE A;  4OFL A;  3I5O A;  5KZT A;  3A3U A;  4M1V A;  2CZH A;  4DLD A;  2UYE A;  4OEU A;  3TQW A;  1QKA A;  4OEV A;  3OEM A;  2O7I A;  4NED A;  4ELQ A;  1LBW A;  2F7C A;  3G7W A;  1IXG A;  2HXW A;  5ICT A;  3TTK A;  4NE4 A;  5H8H B;  3U92 A;  3VE1 B;  4F22 A;  3R26 A;  1JVY A;  4X48 A;  1A99 A;  1MY2 A;  3G3G A;  4FBP A;  3C35 A;  1XI6 A;  1XHY A;  1B5H A;  1N84 A;  1SPI A;  3IJO B;  4MHF A;  1N7X A;  1BTJ A;  3DP8 A;  1MY3 A;  1NH8 A;  2F36 A;  2Y7R A;  3E79 A;  4PF8 A;  2E0S A;  5I56 A;  3OSR A;  1MXZ A;  5J16 A;  5IM2 A;  4OVT A;  4OVQ A;  4KD5 A;  1R1N A;  1OLA A;  3Q25 A;  2V93 A;  4PFR A;  1N04 A;  4LON B;  2P1S A;  3DP6 A;  3S2V A;  4QFO A;  4IY6 A;  2HAU A;  4EUO A;  4ONY A;  4PDD A;  1AMF A;  1NNT A;  2F7A A;  3JV9 A;  4QFL A;  2DXR A;  4KCD A;  3TTR A;  2I3W A;  3FUZ A;  1IUD A;  1SI0 A;  1B0L A;  1FPG A;  2FA7 A;  4ND9 A;  1Y4T A;  2P0S A;  3FIR A;  4OMB A;  4MNI A;  2XXX A;  4RPN A;  5FBP A;  4DXC A;  1GTK A;  2DP8 A;  2XXT A;  4PBH A;  3K6V A;  4IO4 A;  2ALU A;  1TFD A;  4ZE9 A;  2GQ1 A;  1PB9 A;  3PV0 E;  2G93 A;  5AA2 D;  4JWO A;  2D3I A;  3HFU A;  1IMD A;  4H5G A;  4YKI A;  2KR0 A;  1ELJ A;  1KZ8 A;  5I2N B;  1B4H A;  2QRY A;  5AA1 A;  1D9V A;  5F7V A;  1FPD A;  3IL1 B;  1NL5 A;  2P3V A;  1EYJ A;  4N91 A;  3R6U A;  3TCG A;  4H1X A;  1JP4 A;  2X7Q A;  1ZJL A;  1NNF A;  1LLS A;  4F1V A;  3HCQ A;  4O3B A;  2REG A;  3PTY A;  2O1L A;  3E9X A;  4PBQ A;  3RY3 A;  3C34 A;  1USY E;  4OET A;  2WBD A;  4OHN A;  5CMM A;  4TLM B;  2PBW A;  2NXO A;  3TTN A;  3MW0 A;  3U72 A;  1POY 1;  1AOV A;  3CG3 A;  4PC9 A;  4ELR A;  2RF1 A;  2AYS A;  2OLB A;  4PF6 A;  2R6G E;  1SYI A;  4RPO A;  3EN3 A;  2Y5L A;  5I57 A;  4LN5 A;  1NUW A;  4Q0C A;  5CMK A;  3TMG A;  3MZ1 A;  3N5L A;  4P56 A;  2ZNS A;  2FVZ A;  5CC2 A;  3E13 X;  1I6Q A;  1MS7 A;  4G8M A;  3UN6 A;  3T1B A;  3U65 A;  1DTG A;  3SEY A;  2Q2C A;  5FHM A;  5DEX B;  4U2R A;  2X7P A;  4RNS A;  2XD3 A;  3M3K A;  5ISU A;  3MYU A;  3C36 A;  5H8Q A;  4GOT A;  2ZYK A;  3K2D A;  2QVR A;  5I56 B;  4ZED A;  5K2X A;  5I59 B;  3FV2 A;  2DWJ A;  2DE2 A;  3H6V A;  3L6G A;  1I6A A;  3RNN A;  3VXB A;  1JEV A;  3H6W A;  1VDW A;  2PCR A;  4FEB A;  1NV1 A;  1LCT A;  4DDD A;  4P8B A;  3ZKL A;  2GHB A;  4U1Z A;  2O7U A;  3MP8 A;  4TQU Q;  1MXW A;  4JVD A;  1QUL A;  3FVK A;  4XF5 A;  3VLU A;  4MAG A;  2B65 A;  5KDT A;  3B6W A;  4NGU A;  4EF1 A;  5ESY A;  1MPD A;  5CM6 A;  2F3B A;  1OVB A;  3DEL B;  5EYG A;  1MY0 A;  2CZI A;  2ZZX A;  3BFT A;  1O7T A;  1Z7M E;  4M4G A;  4YB6 A;  1B40 A;  3IO4 A;  3G3H A;  1KA0 A;  4F3B A;  4F3P A;  3RTW B;  4LA9 A;  1SW1 A;  2Z22 A;  3SEU A;  2O6A A;  2XX7 A;  3HPI A;  4H8I A;  1DTZ A;  3UA8 A;  1LFH A;  1OVT A;  1LFG A;  1NNK A;  3U1O A;  3IOR A;  5A5L A;  4PAF A;  4PFW A;  2R8T A;  4IB2 A;  2XA5 A;  2NOO A;  2UYF A;  3AXF A;  3OO6 A;  2F78 A;  1YYZ A;  1Y3N A;  2PFZ A;  5ET6 A;  2O69 A;  3KJT A;  1JET A;  2XWV A;  2NVU B;  2XXV A;  1NV7 A;  3WAF A;  2QS4 A;  4P47 A;  3KBR A;  2XXQ A;  4X04 A;  4ECF A;  4FE8 A;  1J1N A;  3U94 A;  1D9Q A;  1B6H A;  4N15 A;  4FEC A;  2M8C A;  4DXB A;  3TTL A;  1URS A;  3KGC A;  2Y7I A;  4RK9 A;  5DYH A;  3VVE A;  5I2K B;  5I3S A;  3S4U A;  4BLA A;  5H8S A;  3KOT A;  1NFT A;  5DVJ A;  2X26 A;  4R9F A;  2Q2A A;  5KCJ B;  1FQF A;  5KCJ A;  4C1U A;  4HTG A;  4GXS B;  1WDN A;  4U1O A;  3T9U A;  4KPT A;  3CR9 A;  3OO7 A;  3K6W A;  1OLC A;  2O84 X;  2HCA A;  2ZZV A;  3CG1 A;  1EYI A;  1QUK A;  5ICQ A;  1R9Q A;  4OZ9 A;  2OCU A;  1H44 A;  4HE0 A;  3LSF B;  4C0R A;  4WKM A;  1IIT A;  3MUQ A;  4R72 A;  2ANJ A;  3T9V A;  5AA2 B;  1XOC A;  3PPO A;  2JJK A;  2I58 A;  1NUZ A;  1PC3 A;  3FAS A;  3GZG A;  3USD A;  1SW2 A;  5B70 A;  5L8D A;  2F6P A;  4OVJ A;  1ZLQ A;  3IK6 B;  3K1M A;  2DVZ A;  1UTH A;  3UK4 A;  1LST A;  4U21 A;  3O6I A;  4BDR A;  4KCC A;  3FJG A;  5I2N A;  1HSL A;  5CBS A;  3C4M A;  1GGG A;  1B3F A;  3R7X A;  3FJM A;  5IZ3 B;  1LBY A;  2PMS A;  4PGP A;  2ONR A;  1FPB A;  3RPL A;  3FXR A;  3KG2 A;  3EF7 A;  1Y1M A;  2I3V A;  3GXA A;  1JEU A;  1XT8 A;  5AA2 A;  4O3C A;  4G61 A;  4NF5 A;  4PTK A;  3K4U A;  2VD2 A;  4MLV A;  4GWX A;  4DE8 A;  5I7I A;  3IB0 A;  4XKP A;  3TAJ A;  1DCU A;  3VDF A;  3VLV A;  4OES A;  5BWJ A;  2PYY A;  3SEW A;  2GFE A;  3TUS A;  1EZO A;  4G8N A;  4N81 A;  4EXK A;  4X1B A;  1LEV A;  2XXH A;  4JB7 A;  5LDZ A;  3PMV A;  4DXU A;  3ISP A;  4DCY A;  5DTB A;  1GV8 A;  5ET5 A;  2QVV A;  3VLW A;  4QBA A;  3D1R A;  1FTM A;  4F1U A;  3MVZ A;  4POW A;  2NWJ A;  4BDM A;  3MAM A;  4I40 A;  1MQJ A;  3LSX A;  4RY1 A;  5H8N A;  1B0H A;  2Y7W A;  4DZ1 A;  1WVJ A;  2RC9 A;  4YKP A;  2XX8 A;  1DK4 A;  1S9T A;  4P0G A;  1H76 A;  1OIB A;  4YIC A;  2UVJ A;  4IR8 A;  5CMC A;  3MP1 A;  5H8F B;  4ESX A;  4NF5 B;  3VVD A;  3UP9 A;  2AIX A;  2ZZW A;  4N8Y A;  5H8H A;  4EF2 A;  3BIH A;  4XXU A;  4DIG A;  3FBP A;  2ABH A;  1N3X A;  1B2H A;  4YU0 A;  4F1Y A;  2F5X A;  1DBZ A;  2H9B A;  4O7I A;  4GWS A;  4NF6 B;  3CSB A;  3TEL A;  2D5W A;  1LGB C;  2Z8E A;  1ZMG A;  1PBQ A;  2B4M A;  3FJ7 A;  3IB1 A;  4G2Z A;  2XXP A;  1AL3 A;  5AA4 B;  1UIU A;  1YPN A;  2XXU A;  1MM6 A;  2I6E A;  4Q8R A;  2QS1 A;  4YMA A;  3FGS A;  1BLF A;  3K6X A;  4GLI A;  3T96 B;  5LTC A;  1XC1 A;  1MQI A;  4X9T A;  1IXH A;  5IGA A;  1SYH A;  3SDF A;  3PUY E;  1BKA A;  1B58 A;  2VT5 A;  4ZEK A;  1US4 A;  4O7M A;  1NV6 A;  4QF9 A;  1B4Z A;  5AA3 A;  1LAF E;  2F97 A;  4R9G A;  5A5X A;  3A3C A;  3B6T A;  3FVN A;  4F29 A;  4KQP A;  2ZYO A;  1IXC A;  1NUY A;  2I4C A;  2PFY A;  3O29 A;  1DPP A;  3TEP A;  1BK4 A;  4MJO A;  3A29 A;  4OWD A;  1M5B A;  4I3Y A;  3Q26 A;  2DQV A;  3RPW A;  3FV1 A;  4H6D A;  4WED A; 
#chains in the Genus database with same CATH homology
 3M3K A;  5A5X B;  2F6G A;  4THI A;  3SEV A;  2ZXT A;  4LZ8 A;  4ZEI A;  2A5T A;  1Y3Q A;  4WXJ A;  3PMW A;  5ISU A;  3C36 A;  3KSX A;  3IOT A;  5H8Q A;  4GOT A;  2ZYK A;  3K2D A;  4U4X A;  5I56 B;  4ZED A;  1URD A;  2ZNU A;  5EHM A;  5K2X A;  1POT A;  2DSF A;  5I59 B;  1CE2 A;  3KFM A;  5I58 A;  3V83 A;  3FV2 A;  3IOW A;  1FQD A;  3JYR A;  1B3L A;  3MWB A;  2DWJ A;  3W15 C;  3H03 A;  1AH5 A;  2HEU A;  5FHO A;  4JWX A;  1PDA A;  1SW5 A;  2DE2 A;  2H5Y A;  3O66 A;  3H6V A;  5AA4 A;  1USY H;  3KN3 A;  3L6G A;  3QAX A;  4MF3 A;  4EQ7 A;  4KI0 E;  1I6A A;  5ITO A;  4IO2 A;  3RNN A;  2QS3 A;  1Y1Z A;  3BKI B;  3VXB A;  4GRK A;  5FTI A;  4PFU A;  4AQ4 A;  4JSD A;  3RLF E;  2QSX A;  4BDQ A;  3H6U A;  1JEV A;  3CRB A;  3H6W A;  3OEN A;  2VD3 A;  3H7M A;  2B3B A;  3K1N A;  3QUJ A;  4FEB A;  2RCA A;  1JW5 A;  4U23 A;  3ZS6 A;  1LBB A;  4U4S A;  1XS5 A;  3LR1 A;  3RN8 A;  3O97 A;  3OD7 A;  5K2Y A;  3H3G A;  1LCT A;  1D9Y A;  1JNF A;  4BDO A;  4OEN A;  2R71 A;  4HS7 A;  4PQJ A;  1ZBM A;  4RA1 A;  4DDD A;  3G3I A;  4HW8 A;  2OK2 A;  4G77 A;  1A8E A;  2DOJ A;  3ZKL A;  4UAC A;  3QSL A;  2GHB A;  4NWC A;  4U1Z A;  3OMB A;  4L17 A;  3MC2 A;  1D3K A;  3TZA A;  1MG1 A;  3U8Q A;  2O7U A;  3MP8 A;  1XVX A;  2CZL A;  4TQU Q;  2Q8J A;  3IOV A;  3CI8 A;  5KCJ B;  3OEK A;  4R6Y A;  1MXW A;  5M2V A;  1ZU0 A;  1QUL A;  4N07 A;  4Q30 B;  2D21 A;  3FVK A;  2Q88 A;  1FQC A;  3VLU A;  3ZSF A;  2O51 A;  3VVF A;  3K00 A;  4P0I A;  4FAT A;  5CBR A;  5KCJ A;  1T0K A;  1TFA A;  3QXM A;  2THI A;  4FOR A;  2F7B A;  2REJ A;  2B65 A;  5KDT A;  4ZEC A;  4JXI A;  2IA4 A;  3B6W A;  5DVF A;  5ITP A;  2XXY A;  4EF1 A;  2W7Y A;  3BFU A;  1DOT A;  2H98 A;  4NF4 A;  1MPD A;  5CM6 A;  4LAT A;  1MXV A;  2G29 A;  1MXY A;  2QMX A;  1SW4 A;  1YAE A;  3K01 A;  1OVB A;  3DEL B;  3OSQ A;  1MY0 A;  3TFL A;  3H4Z A;  3HST A;  3RT8 A;  3BFT A;  1A54 A;  1MXU A;  2O68 A;  3LC8 A;  4GF8 A;  1O7T A;  1HSE A;  1Z7M E;  4M4G A;  2DYX A;  3Q29 A;  4QFP A;  3T9H B;  1B9J A;  3FXQ A;  5EYF A;  4OYV A;  4I1D A;  1L5T A;  3KN7 A;  4R74 A;  4YB6 A;  1B40 A;  3IO4 A;  1GVC A;  1B1H A;  3IB2 A;  3G3H A;  2I49 A;  3N94 A;  4N13 A;  1OMP A;  4NMY A;  4R6K A;  5TU0 A;  3SKP A;  3RTW B;  4F3B A;  4F3P A;  1UTH B;  4KR5 A;  4LA9 A;  1SW1 A;  3W9V A;  1MRP A;  2Z22 A;  2OZZ A;  3W9W A;  1F9B A;  4IO3 A;  4XKN A;  3V5A A;  3RTF B;  3OEL A;  1UQW A;  3MJN A;  3TKD A;  1FCK A;  4GD5 A;  3SEU A;  2O6A A;  2XX7 A;  3HPI A;  4H8I A;  3KEI A;  1P1N A;  4G4P A;  3FVG A;  1S50 A;  3SET A;  4R6H A;  1S7Y A;  4QRZ A;  4ZS9 A;  4H5F A;  4GXA A;  3V8X B;  2FNC A;  1DTZ A;  2DE3 A;  3PMX A;  4YAH X;  1N0T A;  1VR5 A;  3EHU A;  3DLN A;  1ANF A;  4KFQ A;  5TP9 A;  3UA8 A;  3E3K A;  1OVT A;  4F2O A;  4XKR A;  3C33 A;  1FQA A;  4OER A;  1MY1 A;  4KYD A;  3TCH A;  1AOV A;  3QUF A;  5H8Q B;  1SI1 A;  1LFG A;  1NNK A;  3G3J A;  1FQE A;  1LAH E;  3IOR A;  1R6Z A;  1B3H A;  1GR2 A;  2OWS A;  4I9D A;  4LQ5 A;  4WEP A;  2I48 A;  1NMU A;  4PFW A;  5AE4 A;  3MZB A;  1LAG E;  5L9S A;  3MZ9 A;  1Z7N E;  4H65 A;  4IB2 A;  4LUB A;  2NOO A;  2UYF A;  1NH7 A;  2B3F A;  1LBC A;  1MY4 A;  2QPQ A;  3AXF A;  3OO6 A;  4G8H A;  4GWO A;  2NUV A;  2F78 A;  4NTL A;  1A7L A;  1Y3N A;  4KHZ E;  3SEX A;  4YB7 A;  1IEJ A;  1B5J A;  1CB6 A;  4IGR A;  4I8C A;  2O69 A;  2IEE A;  5LOM A;  3MPL A;  3KJT A;  2FYI A;  3TDJ A;  3S9M C;  1JET A;  4K3F A;  5IAI A;  2P2A A;  5JTY B;  4EXL A;  2I0C A;  1Y3P A;  1O63 A;  4TOZ A;  1A8F A;  2NVU B;  1B7U A;  1VFD A;  2XXV A;  5H8N B;  3WAF A;  1LCF A;  2QS4 A;  4QSD A;  3KBR A;  1FTK A;  2V84 A;  1SDX A;  3E4R A;  2UVI A;  2UXA A;  3FXU A;  3VV5 A;  5JEI A;  5I58 B;  2HAV A;  3O2A A;  3UIF A;  2V3U A;  4YKJ A;  4F2Q A;  2XXQ A;  4POX A;  4ECF A;  4YB5 A;  4FE8 A;  1J1N A;  3SER A;  1ZKB A;  3U94 A;  4UA8 A;  2ZYN A;  3T22 A;  1B6H A;  4IY5 A;  4HCW A;  4FEC A;  5I57 B;  4F19 A;  1II5 A;  2RC7 A;  2M8C A;  4JDF A;  1RYX A;  4DXB A;  1US5 A;  1MH3 A;  3GBA A;  3K02 A;  4F3S A;  3TTL A;  3O28 A;  1B3G A;  1URS A;  4MH5 A;  4EQB A;  3S9E A;  1MPC A;  4R2F A;  3O9P A;  1XVY A;  3KGC A;  2YJP A;  1VE4 A;  1P1W A;  3ONM A;  2Y7I A;  4IO7 A;  2PT1 A;  2VGQ A;  4GL8 A;  4RK9 A;  5DYH A;  1TXF A;  2GHA A;  2YPN A;  4N6P A;  5I2K B;  4ISU A;  3S4U A;  3T93 B;  1A55 A;  4BLA A;  4F39 A;  5HM4 B;  4YZZ A;  4H0W A;  5H8S A;  3FZV A;  3KOT A;  1NFT A;  3C32 A;  3MPK A;  3C9H A;  3LSW A;  1URG A;  3OO9 A;  5DVJ A;  2X26 A;  1ZTY A;  3MQ9 A;  4R9F A;  5HBC A;  2Q2A A;  3T9X B;  2H4I A;  3Q28 A;  3ILT B;  5I84 A;  1FQF A;  3VXC A;  3IAZ A;  4HCY A;  1M5E A;  1MDQ A;  4C1U A;  2DWA A;  3KOS A;  2HZK A;  4GXS B;  4HTG A;  2A5T B;  4OFO A;  4PFT A;  4PFY A;  1JW1 A;  1WDN A;  4U1O A;  4XIG Q;  3T9U A;  4QSC A;  1UTB B;  5JK4 A;  3TCF A;  4KPT A;  3CR9 A;  3Q27 A;  3FAT A;  2AL4 A;  3DM0 A;  5I2K A;  3OO7 A;  4NF8 B;  3VFJ A;  1D4N A;  4YMB A;  4PP0 A;  4GIZ A;  3K6W A;  1OLC A;  2CMO A;  2HCA A;  2O84 X;  3CG1 A;  4MBP A;  1QUK A;  5ICQ A;  2I0B A;  5IKB A;  3PD8 A;  1R9Q A;  1PB8 A;  2OCU A;  4OZ9 A;  3RUM A;  2RC8 A;  4YKK A;  1H44 A;  4FAJ A;  4IGT A;  5B7D A;  3MVW A;  3LSF B;  4C0R A;  3CFZ A;  4WKM A;  1IIT A;  3MUQ A;  3OXN A;  3PPQ A;  2H99 A;  4H8J A;  1NNP A;  3DP4 A;  2ANJ A;  2OJT A;  1MQH A;  3CSG A;  4LQ2 A;  4R72 A;  4E0X A;  4KYE A;  1ZIU A;  3T9V A;  3GLB A;  3TOD A;  5AA2 B;  3PU5 A;  4NF8 A;  1XOC A;  2ESN A;  2HZL A;  3PPO A;  4ELO A;  3RQT A;  1KWH A;  1P99 A;  4MLQ A;  1N7W A;  2I58 A;  1IXI A;  3G3F A;  3HV1 A;  1PC3 A;  2KLF A;  1Y20 A;  3S9L C;  1QUJ A;  1Q1K A;  2QL3 A;  3V89 B;  3N26 A;  3FAS A;  3K0V A;  2HQ0 A;  3EQ1 A;  3GZG A;  4G68 C;  2UVG A;  3B6Q A;  1SW2 A;  3USD A;  4X1D A;  2ZNT A;  5B70 A;  2DVC A;  1LB8 A;  3H06 B;  3ODB A;  5L8D A;  2F6P A;  2Q9T A;  3GBB A;  3PPP A;  2VP1 A;  3MVY A;  3K6U A;  3PUW E;  4OVJ A;  1ZLQ A;  5EHS A;  3SES A;  3WAE A;  4OFL A;  3I6V A;  3I5O A;  5KZT A;  3A3U A;  4M1V A;  5I59 A;  4DLD A;  2UYE A;  4E0W A;  4OEU A;  3IK6 B;  3TQW A;  1QKA A;  1DMB A;  4O3A A;  4OEV A;  1FQB A;  3OEM A;  3PPR A;  1LFH A;  2O7I A;  2ZMB A;  4NF4 B;  4NED A;  4ELQ A;  1FW0 A;  3K1M A;  1B32 A;  2DVZ A;  4F31 B;  3N6U A;  2LAO A;  1UTH A;  5JTY A;  3HO7 A;  4Z7E A;  3UK4 A;  3S9N C;  1LST A;  4U21 A;  3VVE A;  2F7C A;  3O6I A;  4FED A;  1EU8 A;  4H67 A;  3D4G A;  4BDR A;  1QKB A;  3FJG A;  3G7W A;  1HSL A;  4KCC A;  3TTM A;  1IXG A;  3TYH A;  1HSJ A;  3C4M A;  5CBS A;  5I2N A;  1GGG A;  1B3F A;  2VOZ A;  3FJM A;  2HXW A;  2RCB A;  4JBZ A;  2PMS A;  4JWY A;  3R7X A;  3L6H A;  1IQ7 A;  2ONR A;  3OO8 A;  3UOR A;  5TPA B;  3PUZ E;  3F11 A;  3I3V A;  5ICT A;  3TTK A;  3ILU B;  1B05 A;  1BP5 A;  3FXR A;  3EF7 A;  3HN0 A;  3KG2 A;  4NE4 A;  4AB6 A;  5DVI A;  3U1O A;  1Y1M A;  4IO5 A;  3RGY A;  5H8H B;  2I3V A;  3K1P A;  3GXA A;  3U92 A;  3R26 A;  3VE1 B;  1UTB A;  3FVO A;  1JVY A;  4F22 A;  4X48 A;  1JEU A;  4LZ7 A;  1XT8 A;  2E1S A;  1A99 A;  4F18 A;  5AA2 A;  3PPN A;  4O3C A;  4NF5 A;  3C31 A;  3M3L A;  1B46 A;  4AB5 A;  4ESW A;  2O1M A;  3U93 A;  3K4U A;  2VD2 A;  3G3K A;  2Z8D A;  4MLV A;  1MY2 A;  3A09 A;  3G3G A;  2OWT A;  3C35 A;  4QFN A;  4GQO A;  1YCJ A;  4DE8 A;  1XHY A;  5CMB A;  3KJ7 A;  1B5H A;  1N84 A;  4ZEF A;  2AL5 A;  1N76 A;  3IJO B;  4PE5 B;  4BDN A;  1N7X A;  1BTJ A;  3IB0 A;  4QSE A;  1YTV A;  1Y4C A;  1IZ1 A;  3DP8 A;  3MP6 A;  4Q5T A;  1I6B A;  4XKP A;  3RT6 B;  1MY3 A;  1PB7 A;  2Y84 A;  2DWH A;  3CIJ A;  1NH8 A;  1B52 A;  3TAJ A;  2F36 A;  1RKM A;  1VSO A;  2VHA A;  2Y7R A;  3VDF A;  1H43 A;  3O6H A;  2E0S A;  5I56 A;  3VLV A;  2Y7K A;  4OES A;  5BWJ A;  5F1Q A;  2PYY A;  3OSR A;  2GFE A;  1MXZ A;  4NF6 A;  3SEW A;  5H8F A;  3TUS A;  1EZO A;  2V3T A;  4G8N A;  2OBG A;  4ELP A;  4EXK A;  3TPA A;  4KD5 A;  1EZP A;  1UIV A;  4TLL B;  1R1N A;  4G68 B;  1OLA A;  3Q25 A;  4X1B A;  2V93 A;  2XXH A;  4PET A;  1N04 A;  4JB7 A;  5FTH A;  1QVS A;  2PT2 A;  2R9J A;  3H6T A;  3PMV A;  4LON B;  2XXW A;  1PBP A;  2Y7P A;  4DXU A;  2RIN A;  2P1S A;  4RYA A;  3DP6 A;  3S2V A;  3QYT A;  4QFO A;  3EPE A;  3B7D A;  4RXL A;  5ELV A;  4DCY A;  1B1X A;  4Z0I A;  3ECR A;  2HAU A;  4IY6 A;  5DTB A;  5TP9 B;  1GV8 A;  4EUO A;  4ONY A;  1FTL A;  1AMF A;  1NNT A;  3VLW A;  2F7A A;  3JV9 A;  4QFL A;  1NKX A;  4GFR A;  1FTM A;  4F1U A;  1EZ9 A;  2DXR A;  3JZJ A;  1MM7 A;  3MVZ A;  1JW4 A;  5CI5 A;  1B3E A;  3IOU A;  3QK6 A;  4P11 A;  4POW A;  2NWJ A;  1B7H A;  3MAM A;  4KCD A;  2QMW A;  4BDM A;  4LZ5 A;  3TTR A;  1EH3 A;  2I3W A;  3FUZ A;  1IUD A;  1LFI A;  1MQJ A;  1Q35 A;  1SI0 A;  1P1U A;  3IO6 A;  3LSX A;  4NWD A;  2HFB A;  1FTJ A;  4RY1 A;  1B0L A;  5H8N A;  1B0H A;  2Y7W A;  3O6G A;  2FA7 A;  2ONS A;  4ND9 A;  1Y4T A;  4R2B A;  1WVJ A;  4DZ1 A;  2P0S A;  3FIR A;  4OMB A;  2XXX A;  2PX1 A;  4RPN A;  2RC9 A;  4YKP A;  1QJM A;  2XX8 A;  2Z8F A;  4DXC A;  1P1O A;  1GTK A;  2DP8 A;  2XXT A;  4C1T A;  2XXR A;  1B7Z A;  1S9T A;  5BUU A;  2DE4 A;  1RYO A;  3K6V A;  4IO4 A;  2ALU A;  4F3G A;  4QFK A;  4P0G A;  1H76 A;  1OIB A;  1TFD A;  1FTO A;  2UVJ A;  4YIC A;  4ZE9 A;  3KN8 A;  3PUV E;  4FJP A;  4RK2 A;  4U22 A;  1ATG A;  1SVX B;  3D4C A;  1VFE A;  3MP1 A;  2RKM A;  5CMC A;  4NF5 B;  5H8F B;  3VVD A;  4ESX A;  1LB9 A;  1AIV A;  3UP9 A;  2AIX A;  4JSO A;  1PB9 A;  3PV0 E;  4ZZA A;  2G93 A;  2XX9 A;  5DEX A;  5AA2 D;  3HHG A;  2QS2 A;  4JWO A;  5DT6 A;  2DS9 A;  5H8H A;  4ZDM A;  4EF2 A;  2D3I A;  4OTE A;  4EQ9 A;  4XXU A;  4DIG A;  4H5G A;  4YKI A;  3LSL A;  1MXX A;  2ABH A;  1N3X A;  1B2H A;  2UVH A;  2F34 A;  3LBS A;  1ELJ A;  3PUX E;  4R73 A;  4YU0 A;  4F1Y A;  2F35 A;  2F5X A;  2WKY A;  4OQO A;  1OQG A;  4OFJ A;  5I2N B;  1WOD A;  1B4H A;  2QRY A;  2H9B A;  4MFI A;  5L9M A;  5AA1 A;  2XD2 A;  5KDT B;  3M3F A;  2XHD A;  4ZE8 A;  3PD9 A;  4NF6 B;  1D9V A;  3CSB A;  1A40 A;  5F7V A;  1PEB A;  2QJE A;  1MH4 A;  3TEL A;  2D5W A;  3IL1 B;  1IIW A;  1LGB C;  2Z8E A;  1NL5 A;  1ZMG A;  3N6T A;  4XTC Q;  1B5I A;  1PBQ A;  3HHF A;  1MPB A;  3LUY A;  3FJ7 A;  3IB1 A;  4G2Z A;  1N3W A;  4GVO A;  4OXV A;  2XXP A;  1H45 A;  3R6U A;  5TPA A;  4H1X A;  4I62 A;  3OOA A;  1AL3 A;  3TCG A;  5AA4 B;  1BIY A;  1UIU A;  1YPN A;  2XXU A;  2YLN A;  2X7Q A;  1MM6 A;  1ZJL A;  2BJJ X;  4LVQ A;  1NNF A;  3IJX B;  1LLS A;  2I6E A;  4F1V A;  1M5F A;  3HCQ A;  4O3B A;  2REG A;  4DCX A;  4Q8R A;  1MDP 1;  1SD3 A;  2O1L A;  2QS1 A;  3E9X A;  4QHQ A;  3FGS A;  1DSN A;  4YMA A;  1QUI A;  1SQY A;  3MBP A;  3RY3 A;  3C34 A;  1P1Q A;  1BLF A;  1LAX A;  1JQF A;  3FD3 A;  3K6X A;  4GLI A;  2F8D A;  3T96 B;  1SBP A;  1XC1 A;  3CFX A;  1MQI A;  4X9T A;  1DPE A;  1USY E;  4OET A;  4IO6 A;  4OHN A;  1R9L A;  4TLM B;  1IXH A;  5CMM A;  4BDL A;  2PBW A;  2NXO A;  5FHN A;  1I69 A;  3MW0 A;  3TTN A;  1SYH A;  1Y9U A;  1MQG A;  1O64 A;  1POY 1;  3PUY E;  3SDF A;  1BKA A;  3CG3 A;  3U72 A;  3UGW A;  3ZKK A;  2GH9 A;  2RF1 A;  4ELR A;  2ZYM A;  1QW0 A;  1B58 A;  2AYS A;  2OLB A;  2V25 A;  1H3D A;  2GRV A;  4RJZ A;  2R6G E;  5CRY A;  1SYI A;  4RPO A;  5HPQ A;  2H25 A;  3EN3 A;  1M5D A;  4GL0 A;  4ZEK A;  1TWY A;  1US4 A;  5I57 A;  2A5S A;  2DXY A;  3IR1 A;  4Q0C A;  5CMK A;  3TMG A;  2V3Q A;  1TT1 A;  3MVX A;  3MZ1 A;  3N5L A;  4QF9 A;  3M8U A;  1B4Z A;  5AA3 A;  2Z23 A;  2ZNS A;  1M5C A;  3QIM A;  3CVG A;  1LAF E;  1MQD A;  3P7I A;  3PGF A;  2F97 A;  4R9G A;  4G68 A;  2Q89 A;  3CFL A;  4XKQ A;  3T66 A;  3IX1 A;  5A5X A;  5CC2 A;  3E13 X;  3TQL A;  3A3C A;  3KZG A;  1I6Q A;  3B6T A;  1OQH A;  1MS7 A;  3FVN A;  2I4B A;  2ONK E;  4KQP A;  4F29 A;  2ZYO A;  4LP2 B;  1IXC A;  4FIM A;  4G8M A;  5J1D A;  3UN6 A;  2I4C A;  2DWI A;  1DTG A;  1JVX A;  3EHT A;  3SEY A;  3O29 A;  1DPP A;  4KYS A;  3TEP A;  3KSJ A;  2Q2C A;  5FHM A;  2XXI A;  5DEX B;  4ZEB A;  4OWD A;  1M5B A;  4EDP A;  5L9O A;  3Q26 A;  2DQV A;  4U2R A;  1B51 A;  3RPW A;  2X7P A;  3FV1 A;  4H6D A;  3BBR A;  4RNS A;  2PVU A;  4R75 A;  4WED A;  3THI A;  3EHS A;  4ZZE A;  2XD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...