3LR1A

The crystal structure of the tungstate abc transporter from geobacter sulfurreducens
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
232
Chain Sequence
b'NAEERLKMSTTTSTQDSGLLKVLLPPFEKKNNVKVDVIAVGTGQALKLGEAGDVDVVFVHARKLEDKFVADGFGVNRKDVMYNDFVIVGPKNDPAGIAKAKTAAEALKLLATKGATFISRGDKSGTHTKELDLWKSAGVDPKGNWYVEAGQGMGPVITMATERRAYTLTDRGTYNAFKGAKTDLVILFQGLFNPYGIMAVNPKKFPHVKYDLAMKLIDYVTGPEGLKIISDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungstate ABC transporter, periplasmic tungstate-binding pro
publication title The crystal structure of the tungstate ABC transporter from Geobacter sulfurreducens
rcsb
source organism Geobacter sulfurreducens
molecule tags Transport protein
total genus 65
structure length 232
sequence length 235
ec nomenclature
pdb deposition date 2010-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3lr1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3lr1A02
2F78A 4JSDA 5FTHA 2UVJA 1IXIA 1ZIUA 3MVYA 4KYDA 1VE4A 1B2HA 1QKBA 4RYAA 5DEXB 4ZEKA 1Z7ME 3FXQA 5CMCA 2V25A 4MF3A 3L6HA 3EF7A 1LAFE 4IO7A 2DQVA 4QHQA 1M5EA 2DWJA 1ZU0A 3TDJA 3V89B 3DELB 4R6YA 3SEWA 1GV8A 2OK2A 4LUBA 1PBQA 4XKRA 4NWCA 3OD7A 1ANFA 4YB5A 5H8HB 2O6AA 2P1SA 3K01A 5H8NB 2ZMBA 3IOWA 3PV0E 4POWA 4R6HA 4KQPA 2DXRA 3K02A 1LGBC 3LUYA 3SESA 3FVOA 4FORA 3RT8A 3S4UA 3FVGA 1SYHA 3DP6A 4QFLA 3T66A 1I6BA 3FV1A 4H5FA 1MY3A 4RPOA 4TLLB 3UGWA 4ZE8A 1UTHA 4NF6B 2RC9A 1S9TA 1LFHA 2AL4A 1H43A 4XKPA 2ZNSA 3EHSA 1XC1A 1SDXA 4U21A 4L17A 4E0XA 1WVJA 2D3IA 4ND9A 4PFWA 5I56A 2G29A 1IXHA 1A99A 1NNFA 4I62A 4OFOA 4X9TA 1B5JA 4ONYA 3OSRA 2R9JA 3OEKA 1IUDA 2Z8DA 1O7TA 4EXLA 4RY1A 1R6ZA 3E4RA 1JNFA 1B40A 4F2OA 1B5HA 5I2KA 1TWYA 1MRPA 5DT6A 2DWAA 3G3IA 4YU0A 5ISUA 3MPKA 5ELVA 4XIGQ 3CFXA 4BDQA 1QULA 1Q1KA 4OTEA 2F97A 3TUSA 1QJMA 2I48A 2ONSA 4DXUA 2PT1A 1QW0A 1D9VA 4YAHX 3PGFA 3S2VA 3KJ7A 3IAZA 4HTGA 4OFJA 4O3AA 4OEUA 5TP9A 3O9PA 4MLVA 2RCAA 3BFTA 3M3FA 1XT8A 3WAEA 4ZEDA 3OSQA 2XXVA 5AA4B 1LFIA 2XX8A 2XXYA 2ANJA 2DE4A 3H7MA 3GBBA 3KEIA 4JBZA 1JQFA 1PC3A 1LAHE 1MQJA 2R6GE 4C1TA 3CSBA 4HS7A 3CIJA 4F1UA 3DLNA 3IJXB 3S9LC 1LB9A 2GFEA 4OYVA 3K6UA 4F19A 4OVJA 5I57A 2F34A 2H4IA 1SW1A 1Y3QA 3O6HA 2OJTA 4UA8A 4H0WA 4NF5B 2XXPA 5AA2A 3TTLA 2HFBA 2RKMA 3D4GA 4DIGA 1FCKA 1MG1A 1YAEA 3RGYA 4YKKA 1GTKA 3FASA 2DVZA 2I0CA 4G68A 1A55A 4ELOA 3RN8A 3IO6A 5CI5A 2O51A 3SKPA 1Y3PA 5F1QA 1B52A 2QJEA 4NF4B 1Y1ZA 4U4XA 5EHMA 3MW0A 4FJPA 4Q5TA 3EN3A 4O3CA 2ZYMA 4HW8A 5KCJB 3U94A 1DTGA 4LP2B 1LBBA 1B3LA 4OQOA 3RNNA 4FATA 5I58B 3VLWA 2RC7A 2DS9A 3SETA 1N7XA 4FAJA 3VFJA 1R1NA 2CZLA 3VXBA 4BDLA 3C4MA 2UYEA 1VSOA 1MPDA 5ICQA 1LLSA 2X7QA 1LCFA 3Q25A 3E13X 1YCJA 2THIA 2VGQA 4IO6A 1YPNA 3QUFA 3KG2A 1ELJA 3KSXA 1PDAA 3JV9A 2O7UA 4F39A 4NTLA 1YTVA 1II5A 3PUYE 2E1SA 3CRBA 3N5LA 1OMPA 2Y7IA 2RCBA 3E9XA 1DMBA 1LB8A 3O2AA 1TXFA 2I4BA 4QRZA 4RA1A 4R72A 2I6EA 4PFTA 4R74A 1Y1MA 3LSLA 4F3SA 2YLNA 3KN3A 4F31B 4AQ4A 5CMBA 3N94A 3VDFA 3UORA 2XXRA 3EHTA 2XXIA 5DVFA 1I69A 1RYOA 3EPEA 4R6KA 5HPQA 3V8XB 3G7WA 2YPNA 3HV1A 4TQUQ 1B7ZA 1GGGA 2D5WA 1N0TA 4EQBA 1SBPA 4R73A 4ZS9A 2FA7A 5I59B 5I2NB 4G2ZA 1NH7A 1AIVA 3H06B 2F6GA 3PMWA 3RLFE 4ZEIA 2CMOA 1FQCA 2XD3A 1UTBB 4I1DA 4EF2A 4EDPA 3LSFB 1Y4TA 1N76A 2QS2A 3VLUA 4IO2A 1FQEA 1MQDA 1D4NA 1A40A 4R75A 2DVCA 1NFTA 2XX9A 1IXCA 2X26A 2PBWA 4RK2A 5AE4A 4DCXA 3H03A 3LC8A 2Z23A 4G68C 4ISUA 4LATA 5A5XA 1LAGE 2XXXA 5B70A 1PB7A 5AA2D 3FGSA 5JEIA 1LBCA 2Y84A 1M5DA 1B32A 4QSDA 2VP1A 3U8QA 1T0KA 4XTCQ 5ITPA 4QSEA 2VD3A 4OMBA 4PETA 4KCDA 3AXFA 2QSXA 1OLAA 4PFYA 3SEYA 4BLAA 3KN8A 2DP8A 3MP8A 1B7UA 3MZ9A 3HSTA 4P0GA 4QFOA 3I6VA 3PMVA 2AL5A 4NF5A 3RPWA 1UIUA 2RF1A 1PEBA 3PPQA 3L6GA 3ECRA 2OBGA 3DP4A 1B5IA 2DOJA 4RPNA 5TU0A 4JXIA 1FTLA 5KDTB 4F3PA 3G3KA 2M8CA 4KHZE 4LZ5A 1S50A 4N13A 4NF4A 2B3BA 2HCAA 3HN0A 1MXWA 4FEBA 3TCHA 2XXQA 4FE8A 2ZYKA 2DXYA 4GD5A 5K2YA 5HM4B 4GWOA 1I6QA 1B6HA 1HSLA 2UVIA 1EZ9A 4EF1A 3IJOB 3VVEA 3H6WA 4ZDMA 4TLMB 2DYXA 3RTWB 1SW4A 3VVFA 2Z8FA 2HAUA 4GXAA 3VXCA 1IITA 1Y20A 3O66A 3H6UA 2RINA 3ILUB 1IZ1A 3BKIB 2UXAA 5FHNA 1EU8A 5AA3A 2ZXTA 2NUVA 1EZPA 4IY6A 4JWOA 3O28A 4ZECA 1SW5A 2QMXA 2RC8A 4F1VA 4GRKA 3IR1A 1ZKBA 5JTYB 3GXAA 1TFAA 1NNPA 1GR2A 4HCWA 1O63A 4ZE9A 1B1XA 1DTZA 2PX1A 1SI1A 3Q29A 1MPCA 4QF9A 1B0LA 4KYEA 3FD3A 1N84A 1FQBA 1NMUA 3TTKA 4RXLA 5IAIA 4NE4A 4R2FA 5H8QB 1B9JA 4E0WA 3TQLA 3MP6A 1RYXA 2VOZA 3U72A 2OZZA 2X7PA 2F36A 4GXSB 4LZ8A 4BDMA 5CBRA 3TCGA 3R7XA 2NVUB 3TODA 3JZJA 3N26A 3WAFA 3TCFA 5I84A 4OXVA 1NL5A 2QS1A 4AB6A 4OERA 1SI0A 3TQWA 1B46A 4BDRA 2I4CA 1FTMA 5TPAB 3O29A 1SD3A 5H8FB 5CMKA 2HXWA 3RUMA 3B6WA 2XXWA 1ATGA 4ZEFA 5FHOA 4Q30B 1M5FA 1LFGA 2H5YA 3RT6B 4JDFA 4N07A 2ZNUA 1MY4A 1P1NA 2W7YA 1H45A 1JEUA 1AH5A 2Y7PA 2Y7RA 2F7BA 4KD5A 3CG1A 3P7IA 4GLIA 2HEUA 4H6DA 1EH3A 4YB6A 2ESNA 1URSA 3GBAA 2AYSA 1USYH 2GH9A 3MZ1A 4ZZEA 1XVYA 4NEDA 4G4PA 4DE8A 4EQ9A 4QFPA 1MDP1 1BTJA 4MH5A 4ELPA 2HZLA 1PB9A 4KFQA 4YMBA 1XOCA 3CR9A 1Y3NA 1XS5A 1QKAA 1B05A 1MY0A 4QFNA 4R9GA 1BKAA 2F7CA 3C31A 3VV5A 4IO3A 3FXUA 5EYFA 3ZSFA 3VVDA 3EHUA 4WKMA 2HZKA 1H76A 3PPNA 3O6IA 4OESA 2VD2A 3PUWE 2FNCA 4F3GA 4H65A 2QL3A 1KWHA 5DEXA 1N04A 3CI8A 3V5AA 4OWDA 1SQYA 3K6XA 4YB7A 4GVOA 2P0SA 4WEPA 3JYRA 3K6WA 4AB5A 5L9OA 3THIA 2OLBA 3LSWA 1ZLQA 4JWXA 1OVBA 4H67A 3C34A 5CC2A 1RKMA 5H8HA 4LVQA 2ALUA 1VFDA 5H8NA 1Y4CA 3SERA 3TZAA 3BFUA 4G77A 3B6QA 1XHYA 3FVNA 4DLDA 3VLVA 3C9HA 3B7DA 1NKXA 2O68A 2XXHA 2B3FA 2ZYOA 2A5TB 1P1OA 3S9NC 3FVKA 4THIA 5IKBA 3I3VA 3TELA 3O6GA 3MWBA 1HSJA 4UACA 2AIXA 2XX7A 2V3QA 3RQTA 4NF6A 4JB7A 1S7YA 1NNKA 2QS4A 3R26A 4MLQA 4NWDA 5J1DA 3HCQA 1B4HA 4Z7EA 3C32A 4BDOA 3OXNA 2H99A 3M3LA 2F6PA 1M5CA 4OFLA 1ZJLA 1UTHB 4NMYA 3K1MA 3MJNA 4YKPA 5LOMA 3N6UA 5M2VA 3HHFA 3MVZA 1PBPA 1N3WA 3TPAA 5I56B 2ZNTA 2YJPA 2DE2A 5FTIA 3LR1A 4U1ZA 4U2RA 1AL3A 3IB1A 4IO5A 2UVGA 4OEVA 2F5XA 5DTBA 3K1NA 4M1VA 1MQIA 5I2KB 3PD9A 4F18A 5FHMA 3FXRA 2D21A 1OLCA 5KZTA 3TMGA 3UIFA 3T93B 3K0VA 4H5GA 1OIBA 3HHGA 1DPPA 1B58A 5CMMA 3PPPA 4X1BA 5L9MA 4EXKA 4U1OA 3V83A 3PU5A 2XXUA 3MPLA 1MXVA 3MZBA 5AA4A 4R9FA 4MBPA 5HBCA 5CBSA 5TP9B 3OMBA 4OHNA 3C33A 1A8EA 1IQ7A 1MH4A 3KJTA 1NH8A 2I3WA 2Q2CA 4ZEBA 3MVWA 1H44A 1AOVA 1QUJA 1Q35A 1SYIA 1A8FA 3IORA 2IA4A 3RY3A 1B3EA 2REJA 3FZVA 4X48A 2Z8EA 4GL8A 1D9YA 2Q9TA 3KBRA 1B3GA 1J1NA 3K00A 1FTJA 4RNSA 3H6VA 1Z7NE 1FQFA 2I49A 4OETA 3UP9A 1US4A 5I57B 3MVXA 3OOAA 2G93A 2E0SA 1URDA 3QK6A 4KPTA 3DM0A 3K4UA 2O1MA 4GF8A 5AA2B 1UIVA 3T9UA 2F8DA 5B7DA 3K6VA 4KI0E 4ECFA 1JETA 4G68B 4YZZA 1MDQA 3MAMA 3M8UA 1NNTA 3TYHA 2H98A 5KCJA 1ZBMA 3FIRA 2V3TA 4H8IA 1R9LA 1URGA 5ICTA 3TTMA 1FTKA 1WDNA 5I58A 1M5BA 2V3UA 3R6UA 3GLBA 2DSFA 2A5TA 1WODA 1P1QA 1DOTA 1IEJA 1POTA 5BWJA 1DSNA 1VR5A 3SEUA 3B6TA 4EUOA 1OQGA 3Q28A 3E3KA 1JVXA 3T96B 3S9EA 2UYFA 3CFLA 2O69A 2V93A 2NWJA 2B65A 1N3XA 3S9MC 1USYE 2Q2AA 3FUZA 4NF8B 3CFZA 4IGTA 4GIZA 3A3CA 3T9XB 3QIMA 5DYHA 2QMWA 4Q0CA 2WKYA 3G3FA 1B4ZA 3TFLA 3KZGA 2Z22A 5BUUA 3QAXA 2LAOA 4I9DA 4G8NA 3G3HA 4IO4A 1AMFA 1FTOA 4U22A 1JW1A 1LAXA 3IOVA 3FJMA 3Q26A 5DVIA 1OQHA 3TEPA 3PUXE 2OCUA 4DDDA 3IK6B 3OO8A 2REGA 3LBSA 2I0BA 1A7LA 5DVJA 3RTFB 4ZZAA 4RK9A 5I59A 1MXYA 5I2NA 4LONB 4YICA 1R9QA 3KN7A 3TTNA 3KSJA 3IOUA 3KOSA 1UTBA 1P99A 2A5SA 4KR5A 4F29A 3GZGA 3TTRA 4R2BA 3OO9A 2IEEA 3K1PA 2ZYNA 5AA1A 2HAVA 3ILTB 3MP1A 1QUIA 5L9SA 1B1HA 1MXUA 4U4SA 1JW5A 3KFMA 2OWTA 3BBRA 3DP8A 1UQWA 1MH3A 1XVXA 2F7AA 3ZS6A 2ONRA 4Q8RA 3Q27A 1OVTA 5JK4A 1SVXB 4DCYA 3UK4A 3G3GA 4U23A 3CVGA 3T9VA 1B7HA 1ZMGA 3W9WA 5ITOA 2OWSA 4ESWA 3U93A 3A09A 2V84A 1MQGA 4G8HA 1P1UA 5A5XB 1O64A 4KCCA 3IX1A 4H1XA 3USDA 4XKQA 4JWYA 1VFEA 4XXUA 1H3DA 4OZ9A 4P11A 2I58A 2ABHA 1L5TA 5H8SA 1MM7A 3C36A 4JSOA 5KDTA 5L8DA 2GHBA 3W15C 4F3BA 3D4CA 3U92A 4PQJA 1ZTYA 3QSLA 2I3VA 3IL1B 4FIMA 2Y7WA 4M4GA 4H8JA 3U1OA 1B51A 2GHAA 3QYTA 3IO4A 4I8CA 2Q89A 3CG3A 3I5OA 3ONMA 3UN6A 1BIYA 1MY2A 2H25A 3QXMA 4DXBA 1IIWA 4YMAA 1A54A 4P0IA 1MM6A 4BDNA 1MS7A 3PPOA 2R71A 1JEVA 4LA9A 3OO6A 5CRYA 3TAJA 2F35A 1CB6A 4LQ5A 2KLFA 2GRVA 1FQAA 2QRYA 3MQ9A 3FJ7A 4PFUA 4IB2A 1SW2A 5JTYA 4DXCA 1B3FA 2DWHA 2XD2A 4GOTA 4IY5A 3KGCA 2O7IA 3ZKKA 1FW0A 1PB8A 3T9HB 2UVHA 3H4ZA 1F9BA 3VE1B 4F22A 3OENA 4N6PA 4FECA 3SEVA 2O1LA 1JW4A 3O97A 1D3KA 1TFDA 4K3FA 3IOTA 4NF8A 5H8QA 3A3UA 3MUQA 1MXXA 1Y9UA 1LSTA 4PE5B 1POY1 2PVUA 4WXJA 4DZ1A 1MY1A 2BJJX 2Y7KA 4C0RA 4FEDA 3KOTA 5K2XA 1EZOA 2Q88A 3W9VA 1MXZA 4Z0IA 4MFIA 3C35A 3QUJA 3H6TA 3OO7A 3M3KA 5TPAA 1B0HA 2FYIA 4PP0A 5H8FA 4EQ7A 4TOZA 1BLFA 2PYYA 5CM6A 2PMSA 3OELA 2ONKE 3PUZE 4G8MA 4HCYA 2QS3A 4XKNA 2HQ0A 3LSXA 3F11A 3FATA 4WEDA 4YKJA 3UA8A 3HPIA 1US5A 1JVYA 2QPQA 3H3GA 3ODBA 3IB0A 2O84X 1BP5A 2NXOA 1HSEA 3OEMA 3G3JA 2DE3A 4O3BA 1QVSA 3TKDA 2NOOA 4LQ2A 3N6TA 3SEXA 4YKIA 2XXTA 2P2AA 4POXA 3SDFA 1MQHA 3MBPA 3T22A 4ELRA 3CSGA 1IXGA 3K2DA 2DWIA 2VHAA 1CE2A 1P1WA 4GFRA 4IGRA 1N7WA 1DPEA 3HO7A 4RJZA 3EQ1A 4GL0A 1MPBA 5EHSA 4X1DA 4QFKA 2Q8JA 1QUKA 4ELQA 4KYSA 1B3HA 3ZKLA 2H9BA 4ESXA 4C1UA 3FV2A 4LZ7A 4F2QA 2PT2A 3PUVE 4OENA 1GVCA 4F1YA 4QSCA 3PD8A 5F7VA 3PMXA 1FQDA 1LCTA 1TT1A 4GQOA 3IB2A 3MC2A 3PPRA 1I6AA 3FJGA 2XHDA
chains in the Genus database with same CATH superfamily
2F78A 1FPGA 4JSDA 1YXIA 5FTHA 2UVJA 1IXIA 1ZIUA 3MVYA 5ET5A 4KYDA 1VE4A 1B2HA 1QKBA 4RYAA 5DEXB 4ZEKA 1Z7ME 3FXQA 5CMCA 2V25A 5A5LA 4MF3A 2F3DA 3L6HA 3EF7A 5F24A 2KR0A 1LAFE 4IO7A 2DQVA 4QHQA 1M5EA 2DWJA 4N81A 1ZU0A 3TDJA 4QBAA 2MKZA 3V89B 3DELB 4R6YA 3SEWA 3NOHA 4N15A 1GV8A 2OK2A 4LUBA 3MYUA 1IMEA 1PBQA 4XKRA 4PFRA 2JJKA 4NWCA 3E79A 3OD7A 1ANFA 4YB5A 2WYPA 5H8HB 2O6AA 2P1SA 3K01A 5H8NB 2ZMBA 3IOWA 3PV0E 4POWA 4R6HA 4KQPA 2DXRA 3K02A 3A29A 1LGBC 3LUYA 3SESA 3FVOA 4FORA 3RT8A 3S4UA 3B8BA 3FVGA 1SYHA 3DP6A 4QFLA 3T66A 1I6BA 2B4LA 3FV1A 4OVRA 5I7IA 4H5FA 1MY3A 5ET6A 4RPOA 4TLLB 3UGWA 4ZE8A 2Y5LA 1IMCA 1UTHA 4NF6B 2RC9A 1S9TA 4PDHA 1LFHA 2AL4A 1H43A 4XKPA 2ZNSA 3EHSA 1XC1A 1SDXA 3CHGA 4U21A 4L17A 4E0XA 1WVJA 2D3IA 4ND9A 1KA1A 4PFWA 5I56A 2G29A 1IXHA 4MMPA 1A99A 1NNFA 4I62A 4OFOA 4X9TA 1B5JA 4ONYA 3OSRA 1FBHA 2R9JA 1NV5A 1DBZA 3OEKA 1IUDA 2Z8DA 1O7TA 4G61A 4EXLA 4RY1A 1R6ZA 3E4RA 1JNFA 1B40A 4F2OA 3KC0A 4MNIA 1B5HA 5I2KA 1TWYA 1MRPA 5DT6A 2DWAA 3G3IA 4YU0A 5EQAA 5ISUA 4PDDA 3MPKA 5ELVA 4XIGQ 3CFXA 4BDQA 1QULA 1Q1KA 4NG7A 5IZ3A 1YZ0A 4OTEA 2F97A 4HE0A 1FPJA 1G0IA 3TUSA 1QJMA 2I48A 2ONSA 4DXUA 2PT1A 1QW0A 2P3VA 1D9VA 4YAHX 3PGFA 4AS4A 3S2VA 3KJ7A 3IAZA 4HTGA 4OFJA 4O3AA 4OEUA 4MNPA 5TP9A 3O9PA 4MLVA 2RCAA 1LBZA 3BFTA 1FPEA 3M3FA 1XT8A 3WAEA 3BIGA 4ZEDA 3OSQA 2XXVA 5AA4B 1LFIA 2XX8A 2XXYA 3T1BA 1G0HA 2ANJA 2DE4A 3H7MA 2CZIA 3ROJA 3GBBA 3KEIA 4JBZA 1JQFA 1PC3A 1LAHE 1MQJA 2R6GE 4C1TA 3CSBA 4HS7A 3CIJA 4F1UA 3DLNA 3IJXB 3S9LC 1LB9A 4H45A 2GFEA 4OYVA 3K6UA 5EYGA 4F19A 4OVJA 1IMDA 2F34A 2H4IA 1SW1A 5I57A 3PTYA 1Y3QA 3O6HA 2QVUA 2OJTA 4UA8A 4H0WA 1FPKA 4NF5B 2XXPA 5AA2A 3TTLA 2HFBA 2RKMA 3D4GA 4DIGA 1FCKA 1MG1A 1YAEA 2CEXA 3RGYA 4YKKA 1GTKA 3FASA 2DVZA 1KZ8A 2I0CA 4G68A 1A55A 4ELOA 4PCDA 3RN8A 3IO6A 5CI5A 2QFLA 2O51A 3SKPA 3HFUA 1Y3PA 5F1QA 4GWXA 1B52A 2QJEA 4NF4B 1Y1ZA 4U4XA 5EHMA 4NAPA 3MW0A 4FJPA 4Q5TA 3EN3A 4OVTA 4O3CA 2FIEA 2ZYMA 4HW8A 5KCJB 3U94A 1DTGA 4LP2B 1LBBA 2CEYA 1B3LA 4O8MA 4OQOA 1FBPA 3RNNA 2HPGA 4FATA 5I58B 3VLWA 2RC7A 2DS9A 4PBHA 3SETA 1N7XA 4FAJA 3VFJA 1R1NA 2CZLA 4UABA 3VXBA 4BDLA 3C4MA 2UYEA 1VSOA 1MPDA 5ICQA 1LLSA 2X7QA 1LCFA 3Q25A 3E13X 3KC1A 1YCJA 2THIA 2VGQA 4IO6A 2WEFA 1YPNA 4GWWA 3QUFA 3KG2A 1ELJA 3KSXA 1PDAA 3JV9A 2O7UA 4F39A 4NTLA 4XEQA 1YTVA 1II5A 3PUYE 2E1SA 4H46A 3CRBA 3N5LA 1OMPA 2Y7IA 2RCBA 3E9XA 1DMBA 1LB8A 3O2AA 4QXDA 1TXFA 2I4BA 4QRZA 4RA1A 4R72A 2I6EA 4PFTA 4R74A 1Y1MA 1D9QA 3LSLA 4O94A 4F3SA 2YLNA 3KN3A 4F31B 4AQ4A 5CMBA 3N94A 3VDFA 3ISPA 3UORA 2XXRA 3EHTA 2Q8MA 2XXIA 5DVFA 1I69A 1RYOA 3EPEA 4R6KA 5HPQA 3V8XB 1IMBA 3G7WA 2YPNA 2ZZVA 3HV1A 4TQUQ 1B7ZA 4X8RA 1GGGA 2D5WA 1N0TA 3LUZA 4EQBA 4GX6A 1SBPA 2PCRA 4R73A 4ZS9A 2FA7A 5I59B 5I2NB 2FBPA 4G2ZA 1NH7A 3RPLA 1AIVA 3H06B 2F6GA 3PMWA 3RLFE 4ZEIA 3E78A 2CMOA 1FQCA 2XD3A 1UTBB 4I1DA 4EF2A 4EDPA 3LSFB 1Y4TA 1N76A 2QS2A 3VLUA 4IO2A 1FQEA 4PGPA 1MQDA 1D4NA 1A40A 4R75A 2DVCA 1NFTA 2XX9A 1IXCA 2X26A 2PBWA 4RK2A 5AE4A 4P8BA 4DCXA 3H03A 3LC8A 2Z23A 4G68C 4ISUA 4LATA 5A5XA 1LAGE 2XXXA 1XI6A 4FBPA 5B70A 1PB7A 2HHMA 5AA2D 3FGSA 4IR8A 5JEIA 1LBCA 2Y84A 1M5DA 1B32A 4QSDA 2VP1A 3U8QA 1T0KA 4MJOA 4XTCQ 5ITPA 4QSEA 2VD3A 4OMBA 4PETA 4PGNA 4KCDA 3AXFA 2QSXA 1OLAA 4PFYA 3SEYA 1FPDA 4BLAA 3KN8A 2DP8A 3MP8A 1B7UA 3MZ9A 3HSTA 4P0GA 4QFOA 3I6VA 3PMVA 2AL5A 4NF5A 3RPWA 1UIUA 2RF1A 1PEBA 3PPQA 3L6GA 3ECRA 2OBGA 3DP4A 1B5IA 2DOJA 4RPNA 5TU0A 4JXIA 1FTLA 5KDTB 4F3PA 2ZZWA 2CZHA 4NF0A 2BJIA 3G3KA 2M8CA 4KHZE 4LZ5A 1S50A 4N13A 4NF4A 2B3BA 2HCAA 3HN0A 1MXWA 4FEBA 3TCHA 2XXQA 4FE8A 2ZYKA 2DXYA 4GD5A 5K2YA 5HM4B 4GWOA 1I6QA 1B6HA 1HSLA 2UVIA 1EZ9A 4EF1A 3IJOB 3VVEA 5ET8A 3H6WA 4ZDMA 4TLMB 2DYXA 3RTWB 1BK4A 1SW4A 3VVFA 2HXRA 2Z8FA 2HAUA 5IGAA 4GXAA 3VXCA 4N4UA 1IITA 1Y20A 3O66A 3BIHA 3H6UA 2DDKA 2RINA 4DI3D 3ILUB 1IZ1A 3BKIB 2UXAA 5FHNA 1EU8A 5AA3A 2ZXTA 2NUVA 1EZPA 4IY6A 4JWOA 3O28A 4ZECA 1SW5A 2QMXA 2RC8A 4F1VA 4GRKA 3IR1A 4N8GA 1ZKBA 5JTYB 1NUYA 3GXAA 1TFAA 1YYZA 1NNPA 1GR2A 4HCWA 1O63A 4ZE9A 1B1XA 1RDXA 1DTZA 2PX1A 1SI1A 3Q29A 1MPCA 4QF9A 2FIXA 1B0LA 4KYEA 3FD3A 1N84A 5LTCA 1FQBA 1NMUA 3TTKA 4RXLA 5IAIA 4NE4A 4R2FA 5H8QB 1B9JA 4E0WA 3TQLA 3MP6A 1RYXA 2VOZA 3U72A 1IMFA 2OZZA 2X7PA 2F36A 4GXSB 4LZ8A 4BDMA 2L5VA 5CBRA 3TCGA 3R7XA 1K9ZA 2NVUB 3TODA 1NV3A 2P3NA 3JZJA 1LBYA 3N26A 3WAFA 3TCFA 5I84A 4OXVA 1NL5A 2QS1A 4AB6A 4OERA 1DCUA 1SI0A 3TQWA 1B46A 4N6DA 4BDRA 2I4CA 1FTMA 5TPAB 2XXKA 4XF5A 3O29A 1SD3A 5H8FB 4HXVA 5CMKA 2HXWA 3RUMA 3B6WA 2XXWA 1ATGA 4ZEFA 5FHOA 4Q30B 1M5FA 1LFGA 2H5YA 3RT6B 2GQ1A 4JDFA 5EYHA 4N07A 2ZNUA 4NN3A 1MY4A 1P1NA 2W7YA 1INPA 1H45A 1JEUA 1AH5A 2Y7PA 4O7MA 2Y7RA 2F7BA 1FTAA 4KD5A 3CG1A 3P7IA 4GLIA 2HEUA 4H6DA 1EH3A 4YB6A 2ESNA 1URSA 3GBAA 2AYSA 1USYH 2V4CA 2GH9A 3MZ1A 4ZZEA 1XVYA 3FXBA 4NEDA 4G4PA 1CNQA 4DE8A 4EQ9A 4QFPA 4OVSA 1MDP1 1BTJA 4MH5A 4ELPA 2HZLA 1PB9A 4KFQA 4YMBA 1XOCA 3CR9A 1Y3NA 1XS5A 3LV0A 1QKAA 1B05A 1MY0A 4QFNA 4R9GA 1BKAA 2F7CA 3C31A 3VV5A 4IO3A 3FXUA 5EYFA 3ZSFA 3VVDA 3EHUA 4WKMA 2HZKA 1H76A 4LN5A 3PPNA 3O6IA 4OESA 2VD2A 4HE2A 5J16A 3PUWE 2FVZA 2FNCA 4F3GA 4H65A 2QL3A 1KWHA 5DEXA 2PFYA 1N04A 3CI8A 3V5AA 4OWDA 2QVVA 1SQYA 4I3YA 3K6XA 4YB7A 4GVOA 2P0SA 4WEPA 3JYRA 4JVIA 3K6WA 4AB5A 5L9OA 3THIA 2OLBA 1AWBA 3LSWA 1ZLQA 4JWXA 1OVBA 4H67A 3C34A 4NHBA 4OVQA 5CC2A 1RKMA 5H8HA 4N17A 4LVQA 2ALUA 1VFDA 5H8NA 1Y4CA 5LDZA 3SERA 3TZAA 3BFUA 4G77A 3B6QA 1XHYA 3FVNA 4DLDA 3VLVA 3C9HA 3B7DA 1NKXA 2O68A 1NV0A 2XXHA 2B3FA 2ZYOA 2A5TB 1P1OA 3S9NC 3FVKA 4THIA 5IKBA 3I3VA 3TELA 2XWOA 3O6GA 3MWBA 1HSJA 4UACA 4X04A 2AIXA 2XX7A 2V3QA 3RQTA 4NF6A 4JB7A 1S7YA 1NNKA 2QS4A 3R26A 4PAIA 4MLQA 4NWDA 5J1DA 4AS5A 3HCQA 1B4HA 4Z7EA 3C32A 3IFCA 4BDOA 4N91A 3OXNA 2H99A 3M3LA 2F6PA 1M5CA 4OFLA 2XWIA 1ZJLA 4P9KA 1UTHB 4JVDA 4NMYA 3K1MA 3MJNA 4YKPA 5I3SA 5LOMA 3N6UA 5M2VA 3HHFA 3MVZA 1PBPA 1N3WA 3TPAA 5I56B 2ZNTA 2YJPA 2DE2A 5FTIA 3LR1A 4U1ZA 4U2RA 1AL3A 4PAFA 3IB1A 4IO5A 2UVGA 2VT5A 3D1RA 2Q74A 4OEVA 1NI9A 4NQ8A 4P1LA 5IM2A 2Y5KA 2F5XA 5DTBA 3K1NA 4M1VA 1MQIA 5I2KB 4HE1A 3PD9A 4F18A 5FHMA 2CZKA 3FXRA 2D21A 4P47A 1OLCA 5IZZA 5KZTA 3TMGA 3UIFA 3T93B 5IZ3B 3K0VA 4H5GA 1OIBA 3HHGA 1DPPA 4GWZA 1B58A 1VDWA 5CMMA 3PPPA 4P56A 4X1BA 4JVCA 5L9MA 4EXKA 4U1OA 3V83A 3PU5A 2XXUA 3MPLA 1MXVA 3MZBA 5AA4A 4R9FA 4MBPA 5HBCA 5CBSA 5TP9B 3OMBA 4GWYA 4OHNA 3C33A 1A8EA 1Q9DA 1IQ7A 1MH4A 3KJTA 1NH8A 2I3WA 2Q2CA 4ZEBA 3MVWA 1H44A 1AOVA 1QUJA 1Q35A 1SYIA 1A8FA 3IORA 2IA4A 3RY3A 4MHFA 1B3EA 2REJA 3FZVA 3IFAA 4X48A 2WYKA 2Z8EA 4GBWA 4GL8A 4GX3A 1D9YA 2Q9TA 3KBRA 1B3GA 1J1NA 3K00A 2R8TA 1FTJA 4N6KA 4RNSA 3H6VA 3MSTA 4PFIA 1Z7NE 1FQFA 2I49A 4OETA 1NUWA 3UP9A 1US4A 5I57B 3MVXA 3OOAA 3SZPA 2G93A 2WBDA 2E0SA 1URDA 3QK6A 4KPTA 3DM0A 1NV4A 3K4UA 2O1MA 4GF8A 4PFBA 5AA2B 1UIVA 3T9UA 2F8DA 5B7DA 1NV2A 3K6VA 4KI0E 4ECFA 1JETA 4G68B 1FBFA 4YZZA 1MDQA 3MAMA 5DW8A 3M8UA 1NNTA 3TYHA 2H98A 5KCJA 1ZBMA 3FIRA 4OVPA 2V3TA 4H8IA 1R9LA 1URGA 5ICTA 3TTMA 1FTKA 1WDNA 5I58A 2VPNA 1M5BA 2V3UA 3R6UA 3GLBA 2DSFA 2A5TA 1WODA 1P1QA 1DOTA 1IEJA 1POTA 5BWJA 1DSNA 1VR5A 2XWKA 3SEUA 3B6TA 4EUOA 1OQGA 3Q28A 1LEVA 3E3KA 1JVXA 3T96B 3S9EA 2UYFA 3CFLA 1JP4A 2O69A 1FJ6A 2V93A 2NWJA 2B65A 5I5PA 1N3XA 3S9MC 1USYE 2Q2AA 3EKIA 3FUZA 4NF8B 3CFZA 4IGTA 3KBZA 4GIZA 3A3CA 3T9XB 3QIMA 5EQ7A 5DYHA 2QMWA 4Q0CA 2WKYA 1FJ9A 3G3FA 2ZZXA 4NX1A 1FBCA 1B4ZA 3TFLA 3KZGA 2Z22A 5BUUA 3QAXA 2LAOA 1FBDA 4I9DA 4G8NA 3G3HA 4IO4A 1NV1A 1AMFA 1FTOA 4U22A 1JW1A 1LAXA 3IOVA 3FJMA 3Q26A 5DVIA 1OQHA 3TEPA 3PUXE 2OCUA 4DDDA 3IK6B 3OO8A 2REGA 3LBSA 2I0BA 1A7LA 5DVJA 3RTFB 5FBPA 4MAGA 4ZZAA 4RK9A 5I59A 1MXYA 1NV7A 5I2NA 4LONB 4YICA 1R9QA 3KN7A 3TTNA 3KSJA 3IOUA 3KOSA 4PE3A 1EYKA 4GX4A 1UTBA 1P99A 2A5SA 4KR5A 4F29A 3GZGA 3TTRA 4R2BA 2FHYA 3OO9A 2IEEA 3K1PA 2ZYNA 5AA1A 2HAVA 3ILTB 3MP1A 4GWSA 1QUIA 5L9SA 1B1HA 1MXUA 4U4SA 3RPLB 4I40A 1JW5A 3KFMA 2OWTA 3BBRA 3DP8A 1UQWA 1MH3A 1XVXA 2F7AA 3ZS6A 2ONRA 4Q8RA 3Q27A 1OVTA 3U65A 5JK4A 1SVXB 4DCYA 3UK4A 3G3GA 1FBEA 4U23A 3CVGA 3T9VA 1FRPA 1B7HA 1ZMGA 4MX6A 3W9WA 5ITOA 2OWSA 5ESYA 4ESWA 4MIJA 1NUZA 3U93A 1FBGA 3A09A 1KA0A 2V84A 1MQGA 4G8HA 1P1UA 5A5XB 1O64A 4KCCA 3IX1A 2QVRA 4H1XA 3USDA 4XKQA 1RDZA 4JWYA 1VFEA 5IZ1A 4XXUA 1H3DA 4OZ9A 4P11A 2I58A 2ABHA 1L5TA 5H8SA 1MM7A 4XFEA 3C36A 4JSOA 5KDTA 5L8DA 2GHBA 3W15C 4F3BA 3D4CA 3U92A 4PQJA 1ZTYA 3QSLA 2I3VA 1DK4A 5T3JA 3IL1B 4FIMA 2Y7WA 4M4GA 4MCOA 4NGUA 4OANA 4H8JA 3U1OA 1B51A 2GHAA 4I3EA 3QYTA 3RYDA 3IO4A 4I8CA 2Q89A 3CG3A 3I5OA 4PC9A 3ONMA 3UN6A 1BIYA 1MY2A 2H25A 3QXMA 4DXBA 3B50A 1IIWA 4YMAA 4PBQA 1A54A 3T0JA 4P0IA 1MM6A 4BDNA 1MS7A 3PPOA 2R71A 1JEVA 4LA9A 1QGXA 3OO6A 2PFZA 5CRYA 3TAJA 2F35A 1CB6A 4LQ5A 2KLFA 2GRVA 1FQAA 2QRYA 3MQ9A 1K9YA 3FJ7A 4PFUA 4IB2A 1SW2A 1RDYA 5JTYA 4DXCA 1B3FA 1NV6A 2XWVA 1NUXA 2DWHA 2OX3A 2XD2A 4GOTA 4IY5A 3KGCA 2O7IA 3ZKKA 1FW0A 1PB8A 3T9HB 2UVHA 4OA4A 4P1EA 3H4ZA 1F9BA 3VE1B 4F22A 3OENA 4N6PA 4FECA 3SEVA 1EYIA 2O1LA 1JW4A 3O97A 1FPBA 1D3KA 4GWUA 1TFDA 4K3FA 3IOTA 4NF8A 5H8QA 3A3UA 3MUQA 1MXXA 4N8YA 1Y9UA 1LSTA 4PE5B 1POY1 3GYYA 2PVUA 4WXJA 4DZ1A 1MY1A 1SPIA 2BJJX 2Y7KA 3QMFA 4C0RA 4FEDA 3KOTA 5K2XA 1EZOA 2Q88A 3W9VA 1MXZA 4Z0IA 4MFIA 3C35A 3QUJA 3H6TA 3OO7A 3M3KA 2OWZA 5TPAA 2F3BA 4GBVA 1B0HA 2FYIA 4PP0A 5H8FA 4EQ7A 4TOZA 1BLFA 2PYYA 5CM6A 2PMSA 1LBXA 3OELA 2ONKE 2KQZA 3PUZE 4G8MA 4HCYA 1FPFA 2QS3A 4XKNA 2HQ0A 3LSXA 3F11A 3FATA 4WEDA 4YKJA 4KXPA 3UA8A 3HPIA 1US5A 1JVYA 2QPQA 5EQ9A 4PF8A 3H3GA 1LBWA 3ODBA 3IB0A 2O84X 1BP5A 2NXOA 1HSEA 3OEMA 3G3JA 3FBPA 5ET7A 2DE3A 2WX9A 4O3BA 1QVSA 4O7IA 3TKDA 2NOOA 4PF6A 4LQ2A 3N6TA 3SEXA 4YKIA 2XXTA 2P2AA 1FPIA 4POXA 4PAKA 2VPOA 3SDFA 1MQHA 3MBPA 3T22A 4DI4B 4ELRA 3CSGA 1IXGA 3K2DA 4MNCA 2DWIA 1IMAA 4PTKA 2VHAA 1CE2A 2WBBA 1P1WA 4GFRA 4IGRA 1N7WA 1DPEA 3HO7A 4RJZA 3EQ1A 4GL0A 1MPBA 5EQ8A 5EHSA 4X1DA 4QFKA 4P3LA 2Q8JA 1QUKA 4ELQA 4KYSA 4MEVA 1B3HA 3ZKLA 2H9BA 4ESXA 4C1UA 1FSAA 3FV2A 4LZ7A 1LBVA 2B4MA 4F2QA 2PT2A 3PUVE 4OENA 1GVCA 4F1YA 4QSCA 3PD8A 5F7VA 1FPLA 3PMXA 1FQDA 1LCTA 1TT1A 4GQOA 3IB2A 3MC2A 1EYJA 3PPRA 1I6AA 2XA5A 3FJGA 2XHDA
chains in the Genus database with same CATH topology
2F78A 4JSDA 5FTHA 2UVJA 1IXIA 1ZIUA 3MVYA 4KYDA 1VE4A 1B2HA 1QKBA 4RYAA 5DEXB 4ZEKA 1Z7ME 3FXQA 5CMCA 2V25A 4MF3A 3L6HA 3EF7A 1LAFE 4IO7A 2DQVA 4QHQA 1M5EA 2DWJA 1ZU0A 3TDJA 3V89B 3DELB 4R6YA 3SEWA 1GV8A 2OK2A 4LUBA 1PBQA 4XKRA 4NWCA 3OD7A 1ANFA 4YB5A 5H8HB 2O6AA 2P1SA 3K01A 5H8NB 2ZMBA 3IOWA 3PV0E 4POWA 4R6HA 4KQPA 2DXRA 3K02A 1LGBC 3LUYA 3SESA 3FVOA 4FORA 3RT8A 3S4UA 3FVGA 1SYHA 3DP6A 4QFLA 3T66A 1I6BA 3FV1A 4H5FA 1MY3A 4RPOA 4TLLB 3UGWA 4ZE8A 1UTHA 4NF6B 2RC9A 1S9TA 1LFHA 2AL4A 1H43A 4XKPA 2ZNSA 3EHSA 1XC1A 1SDXA 4U21A 4L17A 4E0XA 1WVJA 2D3IA 4ND9A 4PFWA 5I56A 2G29A 1IXHA 1A99A 1NNFA 4I62A 4OFOA 4X9TA 1B5JA 4ONYA 3OSRA 2R9JA 3OEKA 1IUDA 2Z8DA 1O7TA 4EXLA 4RY1A 1R6ZA 3E4RA 1JNFA 1B40A 4F2OA 1B5HA 5I2KA 1TWYA 1MRPA 5DT6A 2DWAA 3G3IA 4YU0A 5ISUA 3MPKA 5ELVA 4XIGQ 3CFXA 4BDQA 1QULA 1Q1KA 4OTEA 2F97A 3TUSA 1QJMA 2I48A 2ONSA 4DXUA 2PT1A 1QW0A 1D9VA 4YAHX 3PGFA 3S2VA 3KJ7A 3IAZA 4HTGA 4OFJA 4O3AA 4OEUA 5TP9A 3O9PA 4MLVA 2RCAA 3BFTA 3M3FA 1XT8A 3WAEA 4ZEDA 3OSQA 2XXVA 5AA4B 1LFIA 2XX8A 2XXYA 2ANJA 2DE4A 3H7MA 3GBBA 3KEIA 4JBZA 1JQFA 1PC3A 1LAHE 1MQJA 2R6GE 4C1TA 3CSBA 4HS7A 3CIJA 4F1UA 3DLNA 3IJXB 3S9LC 1LB9A 2GFEA 4OYVA 3K6UA 4F19A 4OVJA 5I57A 2F34A 2H4IA 1SW1A 1Y3QA 3O6HA 2OJTA 4UA8A 4H0WA 4NF5B 2XXPA 5AA2A 3TTLA 2HFBA 2RKMA 3D4GA 4DIGA 1FCKA 1MG1A 1YAEA 3RGYA 4YKKA 1GTKA 3FASA 2DVZA 2I0CA 4G68A 1A55A 4ELOA 3RN8A 3IO6A 5CI5A 2O51A 3SKPA 1Y3PA 5F1QA 1B52A 2QJEA 4NF4B 1Y1ZA 4U4XA 5EHMA 3MW0A 4FJPA 4Q5TA 3EN3A 4O3CA 2ZYMA 4HW8A 5KCJB 3U94A 1DTGA 4LP2B 1LBBA 1B3LA 4OQOA 3RNNA 4FATA 5I58B 3VLWA 2RC7A 2DS9A 3SETA 1N7XA 4FAJA 3VFJA 1R1NA 2CZLA 3VXBA 4BDLA 3C4MA 2UYEA 1VSOA 1MPDA 5ICQA 1LLSA 2X7QA 1LCFA 3Q25A 3E13X 1YCJA 2THIA 2VGQA 4IO6A 1YPNA 3QUFA 3KG2A 1ELJA 3KSXA 1PDAA 3JV9A 2O7UA 4F39A 4NTLA 1YTVA 1II5A 3PUYE 2E1SA 3CRBA 3N5LA 1OMPA 2Y7IA 2RCBA 3E9XA 1DMBA 1LB8A 3O2AA 1TXFA 2I4BA 4QRZA 4RA1A 4R72A 2I6EA 4PFTA 4R74A 1Y1MA 3LSLA 4F3SA 2YLNA 3KN3A 4F31B 4AQ4A 5CMBA 3N94A 3VDFA 3UORA 2XXRA 3EHTA 2XXIA 5DVFA 1I69A 1RYOA 3EPEA 4R6KA 5HPQA 3V8XB 3G7WA 2YPNA 3HV1A 4TQUQ 1B7ZA 1GGGA 2D5WA 1N0TA 4EQBA 1SBPA 4R73A 4ZS9A 2FA7A 5I59B 5I2NB 4G2ZA 1NH7A 1AIVA 3H06B 2F6GA 3PMWA 3RLFE 4ZEIA 2CMOA 1FQCA 2XD3A 1UTBB 4I1DA 4EF2A 4EDPA 3LSFB 1Y4TA 1N76A 2QS2A 3VLUA 4IO2A 1FQEA 1MQDA 1D4NA 1A40A 4R75A 2DVCA 1NFTA 2XX9A 1IXCA 2X26A 2PBWA 4RK2A 5AE4A 4DCXA 3H03A 3LC8A 2Z23A 4G68C 4ISUA 4LATA 5A5XA 1LAGE 2XXXA 5B70A 1PB7A 5AA2D 3FGSA 5JEIA 1LBCA 2Y84A 1M5DA 1B32A 4QSDA 2VP1A 3U8QA 1T0KA 4XTCQ 5ITPA 4QSEA 2VD3A 4OMBA 4PETA 4KCDA 3AXFA 2QSXA 1OLAA 4PFYA 3SEYA 4BLAA 3KN8A 2DP8A 3MP8A 1B7UA 3MZ9A 3HSTA 4P0GA 4QFOA 3I6VA 3PMVA 2AL5A 4NF5A 3RPWA 1UIUA 2RF1A 1PEBA 3PPQA 3L6GA 3ECRA 2OBGA 3DP4A 1B5IA 2DOJA 4RPNA 5TU0A 4JXIA 1FTLA 5KDTB 4F3PA 3G3KA 2M8CA 4KHZE 4LZ5A 1S50A 4N13A 4NF4A 2B3BA 2HCAA 3HN0A 1MXWA 4FEBA 3TCHA 2XXQA 4FE8A 2ZYKA 2DXYA 4GD5A 5K2YA 5HM4B 4GWOA 1I6QA 1B6HA 1HSLA 2UVIA 1EZ9A 4EF1A 3IJOB 3VVEA 3H6WA 4ZDMA 4TLMB 2DYXA 3RTWB 1SW4A 3VVFA 2Z8FA 2HAUA 4GXAA 3VXCA 1IITA 1Y20A 3O66A 3H6UA 2RINA 3ILUB 1IZ1A 3BKIB 2UXAA 5FHNA 1EU8A 5AA3A 2ZXTA 2NUVA 1EZPA 4IY6A 4JWOA 3O28A 4ZECA 1SW5A 2QMXA 2RC8A 4F1VA 4GRKA 3IR1A 1ZKBA 5JTYB 3GXAA 1TFAA 1NNPA 1GR2A 4HCWA 1O63A 4ZE9A 1B1XA 1DTZA 2PX1A 1SI1A 3Q29A 1MPCA 4QF9A 1B0LA 4KYEA 3FD3A 1N84A 1FQBA 1NMUA 3TTKA 4RXLA 5IAIA 4NE4A 4R2FA 5H8QB 1B9JA 4E0WA 3TQLA 3MP6A 1RYXA 2VOZA 3U72A 2OZZA 2X7PA 2F36A 4GXSB 4LZ8A 4BDMA 5CBRA 3TCGA 3R7XA 2NVUB 3TODA 3JZJA 3N26A 3WAFA 3TCFA 5I84A 4OXVA 1NL5A 2QS1A 4AB6A 4OERA 1SI0A 3TQWA 1B46A 4BDRA 2I4CA 1FTMA 5TPAB 3O29A 1SD3A 5H8FB 5CMKA 2HXWA 3RUMA 3B6WA 2XXWA 1ATGA 4ZEFA 5FHOA 4Q30B 1M5FA 1LFGA 2H5YA 3RT6B 4JDFA 4N07A 2ZNUA 1MY4A 1P1NA 2W7YA 1H45A 1JEUA 1AH5A 2Y7PA 2Y7RA 2F7BA 4KD5A 3CG1A 3P7IA 4GLIA 2HEUA 4H6DA 1EH3A 4YB6A 2ESNA 1URSA 3GBAA 2AYSA 1USYH 2GH9A 3MZ1A 4ZZEA 1XVYA 4NEDA 4G4PA 4DE8A 4EQ9A 4QFPA 1MDP1 1BTJA 4MH5A 4ELPA 2HZLA 1PB9A 4KFQA 4YMBA 1XOCA 3CR9A 1Y3NA 1XS5A 1QKAA 1B05A 1MY0A 4QFNA 4R9GA 1BKAA 2F7CA 3C31A 3VV5A 4IO3A 3FXUA 5EYFA 3ZSFA 3VVDA 3EHUA 4WKMA 2HZKA 1H76A 3PPNA 3O6IA 4OESA 2VD2A 3PUWE 2FNCA 4F3GA 4H65A 2QL3A 1KWHA 5DEXA 1N04A 3CI8A 3V5AA 4OWDA 1SQYA 3K6XA 4YB7A 4GVOA 2P0SA 4WEPA 3JYRA 3K6WA 4AB5A 5L9OA 3THIA 2OLBA 3LSWA 1ZLQA 4JWXA 1OVBA 4H67A 3C34A 5CC2A 1RKMA 5H8HA 4LVQA 2ALUA 1VFDA 5H8NA 1Y4CA 3SERA 3TZAA 3BFUA 4G77A 3B6QA 1XHYA 3FVNA 4DLDA 3VLVA 3C9HA 3B7DA 1NKXA 2O68A 2XXHA 2B3FA 2ZYOA 2A5TB 1P1OA 3S9NC 3FVKA 4THIA 5IKBA 3I3VA 3TELA 3O6GA 3MWBA 1HSJA 4UACA 2AIXA 2XX7A 2V3QA 3RQTA 4NF6A 4JB7A 1S7YA 1NNKA 2QS4A 3R26A 4MLQA 4NWDA 5J1DA 3HCQA 1B4HA 4Z7EA 3C32A 4BDOA 3OXNA 2H99A 3M3LA 2F6PA 1M5CA 4OFLA 1ZJLA 1UTHB 4NMYA 3K1MA 3MJNA 4YKPA 5LOMA 3N6UA 5M2VA 3HHFA 3MVZA 1PBPA 1N3WA 3TPAA 5I56B 2ZNTA 2YJPA 2DE2A 5FTIA 3LR1A 4U1ZA 4U2RA 1AL3A 3IB1A 4IO5A 2UVGA 4OEVA 2F5XA 5DTBA 3K1NA 4M1VA 1MQIA 5I2KB 3PD9A 4F18A 5FHMA 3FXRA 2D21A 1OLCA 5KZTA 3TMGA 3UIFA 3T93B 3K0VA 4H5GA 1OIBA 3HHGA 1DPPA 1B58A 5CMMA 3PPPA 4X1BA 5L9MA 4EXKA 4U1OA 3V83A 3PU5A 2XXUA 3MPLA 1MXVA 3MZBA 5AA4A 4R9FA 4MBPA 5HBCA 5CBSA 5TP9B 3OMBA 4OHNA 3C33A 1A8EA 1IQ7A 1MH4A 3KJTA 1NH8A 2I3WA 2Q2CA 4ZEBA 3MVWA 1H44A 1AOVA 1QUJA 1Q35A 1SYIA 1A8FA 3IORA 2IA4A 3RY3A 1B3EA 2REJA 3FZVA 4X48A 2Z8EA 4GL8A 1D9YA 2Q9TA 3KBRA 1B3GA 1J1NA 3K00A 1FTJA 4RNSA 3H6VA 1Z7NE 1FQFA 2I49A 4OETA 3UP9A 1US4A 5I57B 3MVXA 3OOAA 2G93A 2E0SA 1URDA 3QK6A 4KPTA 3DM0A 3K4UA 2O1MA 4GF8A 5AA2B 1UIVA 3T9UA 2F8DA 5B7DA 3K6VA 4KI0E 4ECFA 1JETA 4G68B 4YZZA 1MDQA 3MAMA 3M8UA 1NNTA 3TYHA 2H98A 5KCJA 1ZBMA 3FIRA 2V3TA 4H8IA 1R9LA 1URGA 5ICTA 3TTMA 1FTKA 1WDNA 5I58A 1M5BA 2V3UA 3R6UA 3GLBA 2DSFA 2A5TA 1WODA 1P1QA 1DOTA 1IEJA 1POTA 5BWJA 1DSNA 1VR5A 3SEUA 3B6TA 4EUOA 1OQGA 3Q28A 3E3KA 1JVXA 3T96B 3S9EA 2UYFA 3CFLA 2O69A 2V93A 2NWJA 2B65A 1N3XA 3S9MC 1USYE 2Q2AA 3FUZA 4NF8B 3CFZA 4IGTA 4GIZA 3A3CA 3T9XB 3QIMA 5DYHA 2QMWA 4Q0CA 2WKYA 3G3FA 1B4ZA 3TFLA 3KZGA 2Z22A 5BUUA 3QAXA 2LAOA 4I9DA 4G8NA 3G3HA 4IO4A 1AMFA 1FTOA 4U22A 1JW1A 1LAXA 3IOVA 3FJMA 3Q26A 5DVIA 1OQHA 3TEPA 3PUXE 2OCUA 4DDDA 3IK6B 3OO8A 2REGA 3LBSA 2I0BA 1A7LA 5DVJA 3RTFB 4ZZAA 4RK9A 5I59A 1MXYA 5I2NA 4LONB 4YICA 1R9QA 3KN7A 3TTNA 3KSJA 3IOUA 3KOSA 1UTBA 1P99A 2A5SA 4KR5A 4F29A 3GZGA 3TTRA 4R2BA 3OO9A 2IEEA 3K1PA 2ZYNA 5AA1A 2HAVA 3ILTB 3MP1A 1QUIA 5L9SA 1B1HA 1MXUA 4U4SA 1JW5A 3KFMA 2OWTA 3BBRA 3DP8A 1UQWA 1MH3A 1XVXA 2F7AA 3ZS6A 2ONRA 4Q8RA 3Q27A 1OVTA 5JK4A 1SVXB 4DCYA 3UK4A 3G3GA 4U23A 3CVGA 3T9VA 1B7HA 1ZMGA 3W9WA 5ITOA 2OWSA 4ESWA 3U93A 3A09A 2V84A 1MQGA 4G8HA 1P1UA 5A5XB 1O64A 4KCCA 3IX1A 4H1XA 3USDA 4XKQA 4JWYA 1VFEA 4XXUA 1H3DA 4OZ9A 4P11A 2I58A 2ABHA 1L5TA 5H8SA 1MM7A 3C36A 4JSOA 5KDTA 5L8DA 2GHBA 3W15C 4F3BA 3D4CA 3U92A 4PQJA 1ZTYA 3QSLA 2I3VA 3IL1B 4FIMA 2Y7WA 4M4GA 4H8JA 3U1OA 1B51A 2GHAA 3QYTA 3IO4A 4I8CA 2Q89A 3CG3A 3I5OA 3ONMA 3UN6A 1BIYA 1MY2A 2H25A 3QXMA 4DXBA 1IIWA 4YMAA 1A54A 4P0IA 1MM6A 4BDNA 1MS7A 3PPOA 2R71A 1JEVA 4LA9A 3OO6A 5CRYA 3TAJA 2F35A 1CB6A 4LQ5A 2KLFA 2GRVA 1FQAA 2QRYA 3MQ9A 3FJ7A 4PFUA 4IB2A 1SW2A 5JTYA 4DXCA 1B3FA 2DWHA 2XD2A 4GOTA 4IY5A 3KGCA 2O7IA 3ZKKA 1FW0A 1PB8A 3T9HB 2UVHA 3H4ZA 1F9BA 3VE1B 4F22A 3OENA 4N6PA 4FECA 3SEVA 2O1LA 1JW4A 3O97A 1D3KA 1TFDA 4K3FA 3IOTA 4NF8A 5H8QA 3A3UA 3MUQA 1MXXA 1Y9UA 1LSTA 4PE5B 1POY1 2PVUA 4WXJA 4DZ1A 1MY1A 2BJJX 2Y7KA 4C0RA 4FEDA 3KOTA 5K2XA 1EZOA 2Q88A 3W9VA 1MXZA 4Z0IA 4MFIA 3C35A 3QUJA 3H6TA 3OO7A 3M3KA 5TPAA 1B0HA 2FYIA 4PP0A 5H8FA 4EQ7A 4TOZA 1BLFA 2PYYA 5CM6A 2PMSA 3OELA 2ONKE 3PUZE 4G8MA 4HCYA 2QS3A 4XKNA 2HQ0A 3LSXA 3F11A 3FATA 4WEDA 4YKJA 3UA8A 3HPIA 1US5A 1JVYA 2QPQA 3H3GA 3ODBA 3IB0A 2O84X 1BP5A 2NXOA 1HSEA 3OEMA 3G3JA 2DE3A 4O3BA 1QVSA 3TKDA 2NOOA 4LQ2A 3N6TA 3SEXA 4YKIA 2XXTA 2P2AA 4POXA 3SDFA 1MQHA 3MBPA 3T22A 4ELRA 3CSGA 1IXGA 3K2DA 2DWIA 2VHAA 1CE2A 1P1WA 4GFRA 4IGRA 1N7WA 1DPEA 3HO7A 4RJZA 3EQ1A 4GL0A 1MPBA 5EHSA 4X1DA 4QFKA 2Q8JA 1QUKA 4ELQA 4KYSA 1B3HA 3ZKLA 2H9BA 4ESXA 4C1UA 3FV2A 4LZ7A 4F2QA 2PT2A 3PUVE 4OENA 1GVCA 4F1YA 4QSCA 3PD8A 5F7VA 3PMXA 1FQDA 1LCTA 1TT1A 4GQOA 3IB2A 3MC2A 3PPRA 1I6AA 3FJGA 2XHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F78 A;  4JSD A;  5FTH A;  2UVJ A;  1IXI A;  1ZIU A;  3MVY A;  4KYD A;  1VE4 A;  1B2H A;  1QKB A;  4RYA A;  5DEX B;  4ZEK A;  1Z7M E;  3FXQ A;  5CMC A;  2V25 A;  4MF3 A;  3L6H A;  3EF7 A;  1LAF E;  4IO7 A;  2DQV A;  4QHQ A;  1M5E A;  2DWJ A;  1ZU0 A;  3TDJ A;  3V89 B;  3DEL B;  4R6Y A;  3SEW A;  1GV8 A;  2OK2 A;  4LUB A;  1PBQ A;  4XKR A;  4NWC A;  3OD7 A;  1ANF A;  4YB5 A;  5H8H B;  2O6A A;  2P1S A;  3K01 A;  5H8N B;  2ZMB A;  3IOW A;  3PV0 E;  4POW A;  4R6H A;  4KQP A;  2DXR A;  3K02 A;  1LGB C;  3LUY A;  3SES A;  3FVO A;  4FOR A;  3RT8 A;  3S4U A;  3FVG A;  1SYH A;  3DP6 A;  4QFL A;  3T66 A;  1I6B A;  3FV1 A;  4H5F A;  1MY3 A;  4RPO A;  4TLL B;  3UGW A;  4ZE8 A;  1UTH A;  4NF6 B;  2RC9 A;  1S9T A;  1LFH A;  2AL4 A;  1H43 A;  4XKP A;  2ZNS A;  3EHS A;  1XC1 A;  1SDX A;  4U21 A;  4L17 A;  4E0X A;  1WVJ A;  2D3I A;  4ND9 A;  4PFW A;  5I56 A;  2G29 A;  1IXH A;  1A99 A;  1NNF A;  4I62 A;  4OFO A;  4X9T A;  1B5J A;  4ONY A;  3OSR A;  2R9J A;  3OEK A;  1IUD A;  2Z8D A;  1O7T A;  4EXL A;  4RY1 A;  1R6Z A;  3E4R A;  1JNF A;  1B40 A;  4F2O A;  1B5H A;  5I2K A;  1TWY A;  1MRP A;  5DT6 A;  2DWA A;  3G3I A;  4YU0 A;  5ISU A;  3MPK A;  5ELV A;  4XIG Q;  3CFX A;  4BDQ A;  1QUL A;  1Q1K A;  4OTE A;  2F97 A;  3TUS A;  1QJM A;  2I48 A;  2ONS A;  4DXU A;  2PT1 A;  1QW0 A;  1D9V A;  4YAH X;  3PGF A;  3S2V A;  3KJ7 A;  3IAZ A;  4HTG A;  4OFJ A;  4O3A A;  4OEU A;  5TP9 A;  3O9P A;  4MLV A;  2RCA A;  3BFT A;  3M3F A;  1XT8 A;  3WAE A;  4ZED A;  3OSQ A;  2XXV A;  5AA4 B;  1LFI A;  2XX8 A;  2XXY A;  2ANJ A;  2DE4 A;  3H7M A;  3GBB A;  3KEI A;  4JBZ A;  1JQF A;  1PC3 A;  1LAH E;  1MQJ A;  2R6G E;  4C1T A;  3CSB A;  4HS7 A;  3CIJ A;  4F1U A;  3DLN A;  3IJX B;  3S9L C;  1LB9 A;  2GFE A;  4OYV A;  3K6U A;  4F19 A;  4OVJ A;  5I57 A;  2F34 A;  2H4I A;  1SW1 A;  1Y3Q A;  3O6H A;  2OJT A;  4UA8 A;  4H0W A;  4NF5 B;  2XXP A;  5AA2 A;  3TTL A;  2HFB A;  2RKM A;  3D4G A;  4DIG A;  1FCK A;  1MG1 A;  1YAE A;  3RGY A;  4YKK A;  1GTK A;  3FAS A;  2DVZ A;  2I0C A;  4G68 A;  1A55 A;  4ELO A;  3RN8 A;  3IO6 A;  5CI5 A;  2O51 A;  3SKP A;  1Y3P A;  5F1Q A;  1B52 A;  2QJE A;  4NF4 B;  1Y1Z A;  4U4X A;  5EHM A;  3MW0 A;  4FJP A;  4Q5T A;  3EN3 A;  4O3C A;  2ZYM A;  4HW8 A;  5KCJ B;  3U94 A;  1DTG A;  4LP2 B;  1LBB A;  1B3L A;  4OQO A;  3RNN A;  4FAT A;  5I58 B;  3VLW A;  2RC7 A;  2DS9 A;  3SET A;  1N7X A;  4FAJ A;  3VFJ A;  1R1N A;  2CZL A;  3VXB A;  4BDL A;  3C4M A;  2UYE A;  1VSO A;  1MPD A;  5ICQ A;  1LLS A;  2X7Q A;  1LCF A;  3Q25 A;  3E13 X;  1YCJ A;  2THI A;  2VGQ A;  4IO6 A;  1YPN A;  3QUF A;  3KG2 A;  1ELJ A;  3KSX A;  1PDA A;  3JV9 A;  2O7U A;  4F39 A;  4NTL A;  1YTV A;  1II5 A;  3PUY E;  2E1S A;  3CRB A;  3N5L A;  1OMP A;  2Y7I A;  2RCB A;  3E9X A;  1DMB A;  1LB8 A;  3O2A A;  1TXF A;  2I4B A;  4QRZ A;  4RA1 A;  4R72 A;  2I6E A;  4PFT A;  4R74 A;  1Y1M A;  3LSL A;  4F3S A;  2YLN A;  3KN3 A;  4F31 B;  4AQ4 A;  5CMB A;  3N94 A;  3VDF A;  3UOR A;  2XXR A;  3EHT A;  2XXI A;  5DVF A;  1I69 A;  1RYO A;  3EPE A;  4R6K A;  5HPQ A;  3V8X B;  3G7W A;  2YPN A;  3HV1 A;  4TQU Q;  1B7Z A;  1GGG A;  2D5W A;  1N0T A;  4EQB A;  1SBP A;  4R73 A;  4ZS9 A;  2FA7 A;  5I59 B;  5I2N B;  4G2Z A;  1NH7 A;  1AIV A;  3H06 B;  2F6G A;  3PMW A;  3RLF E;  4ZEI A;  2CMO A;  1FQC A;  2XD3 A;  1UTB B;  4I1D A;  4EF2 A;  4EDP A;  3LSF B;  1Y4T A;  1N76 A;  2QS2 A;  3VLU A;  4IO2 A;  1FQE A;  1MQD A;  1D4N A;  1A40 A;  4R75 A;  2DVC A;  1NFT A;  2XX9 A;  1IXC A;  2X26 A;  2PBW A;  4RK2 A;  5AE4 A;  4DCX A;  3H03 A;  3LC8 A;  2Z23 A;  4G68 C;  4ISU A;  4LAT A;  5A5X A;  1LAG E;  2XXX A;  5B70 A;  1PB7 A;  5AA2 D;  3FGS A;  5JEI A;  1LBC A;  2Y84 A;  1M5D A;  1B32 A;  4QSD A;  2VP1 A;  3U8Q A;  1T0K A;  4XTC Q;  5ITP A;  4QSE A;  2VD3 A;  4OMB A;  4PET A;  4KCD A;  3AXF A;  2QSX A;  1OLA A;  4PFY A;  3SEY A;  4BLA A;  3KN8 A;  2DP8 A;  3MP8 A;  1B7U A;  3MZ9 A;  3HST A;  4P0G A;  4QFO A;  3I6V A;  3PMV A;  2AL5 A;  4NF5 A;  3RPW A;  1UIU A;  2RF1 A;  1PEB A;  3PPQ A;  3L6G A;  3ECR A;  2OBG A;  3DP4 A;  1B5I A;  2DOJ A;  4RPN A;  5TU0 A;  4JXI A;  1FTL A;  5KDT B;  4F3P A;  3G3K A;  2M8C A;  4KHZ E;  4LZ5 A;  1S50 A;  4N13 A;  4NF4 A;  2B3B A;  2HCA A;  3HN0 A;  1MXW A;  4FEB A;  3TCH A;  2XXQ A;  4FE8 A;  2ZYK A;  2DXY A;  4GD5 A;  5K2Y A;  5HM4 B;  4GWO A;  1I6Q A;  1B6H A;  1HSL A;  2UVI A;  1EZ9 A;  4EF1 A;  3IJO B;  3VVE A;  3H6W A;  4ZDM A;  4TLM B;  2DYX A;  3RTW B;  1SW4 A;  3VVF A;  2Z8F A;  2HAU A;  4GXA A;  3VXC A;  1IIT A;  1Y20 A;  3O66 A;  3H6U A;  2RIN A;  3ILU B;  1IZ1 A;  3BKI B;  2UXA A;  5FHN A;  1EU8 A;  5AA3 A;  2ZXT A;  2NUV A;  1EZP A;  4IY6 A;  4JWO A;  3O28 A;  4ZEC A;  1SW5 A;  2QMX A;  2RC8 A;  4F1V A;  4GRK A;  3IR1 A;  1ZKB A;  5JTY B;  3GXA A;  1TFA A;  1NNP A;  1GR2 A;  4HCW A;  1O63 A;  4ZE9 A;  1B1X A;  1DTZ A;  2PX1 A;  1SI1 A;  3Q29 A;  1MPC A;  4QF9 A;  1B0L A;  4KYE A;  3FD3 A;  1N84 A;  1FQB A;  1NMU A;  3TTK A;  4RXL A;  5IAI A;  4NE4 A;  4R2F A;  5H8Q B;  1B9J A;  4E0W A;  3TQL A;  3MP6 A;  1RYX A;  2VOZ A;  3U72 A;  2OZZ A;  2X7P A;  2F36 A;  4GXS B;  4LZ8 A;  4BDM A;  5CBR A;  3TCG A;  3R7X A;  2NVU B;  3TOD A;  3JZJ A;  3N26 A;  3WAF A;  3TCF A;  5I84 A;  4OXV A;  1NL5 A;  2QS1 A;  4AB6 A;  4OER A;  1SI0 A;  3TQW A;  1B46 A;  4BDR A;  2I4C A;  1FTM A;  5TPA B;  3O29 A;  1SD3 A;  5H8F B;  5CMK A;  2HXW A;  3RUM A;  3B6W A;  2XXW A;  1ATG A;  4ZEF A;  5FHO A;  4Q30 B;  1M5F A;  1LFG A;  2H5Y A;  3RT6 B;  4JDF A;  4N07 A;  2ZNU A;  1MY4 A;  1P1N A;  2W7Y A;  1H45 A;  1JEU A;  1AH5 A;  2Y7P A;  2Y7R A;  2F7B A;  4KD5 A;  3CG1 A;  3P7I A;  4GLI A;  2HEU A;  4H6D A;  1EH3 A;  4YB6 A;  2ESN A;  1URS A;  3GBA A;  2AYS A;  1USY H;  2GH9 A;  3MZ1 A;  4ZZE A;  1XVY A;  4NED A;  4G4P A;  4DE8 A;  4EQ9 A;  4QFP A;  1MDP 1;  1BTJ A;  4MH5 A;  4ELP A;  2HZL A;  1PB9 A;  4KFQ A;  4YMB A;  1XOC A;  3CR9 A;  1Y3N A;  1XS5 A;  1QKA A;  1B05 A;  1MY0 A;  4QFN A;  4R9G A;  1BKA A;  2F7C A;  3C31 A;  3VV5 A;  4IO3 A;  3FXU A;  5EYF A;  3ZSF A;  3VVD A;  3EHU A;  4WKM A;  2HZK A;  1H76 A;  3PPN A;  3O6I A;  4OES A;  2VD2 A;  3PUW E;  2FNC A;  4F3G A;  4H65 A;  2QL3 A;  1KWH A;  5DEX A;  1N04 A;  3CI8 A;  3V5A A;  4OWD A;  1SQY A;  3K6X A;  4YB7 A;  4GVO A;  2P0S A;  4WEP A;  3JYR A;  3K6W A;  4AB5 A;  5L9O A;  3THI A;  2OLB A;  3LSW A;  1ZLQ A;  4JWX A;  1OVB A;  4H67 A;  3C34 A;  5CC2 A;  1RKM A;  5H8H A;  4LVQ A;  2ALU A;  1VFD A;  5H8N A;  1Y4C A;  3SER A;  3TZA A;  3BFU A;  4G77 A;  3B6Q A;  1XHY A;  3FVN A;  4DLD A;  3VLV A;  3C9H A;  3B7D A;  1NKX A;  2O68 A;  2XXH A;  2B3F A;  2ZYO A;  2A5T B;  1P1O A;  3S9N C;  3FVK A;  4THI A;  5IKB A;  3I3V A;  3TEL A;  3O6G A;  3MWB A;  1HSJ A;  4UAC A;  2AIX A;  2XX7 A;  2V3Q A;  3RQT A;  4NF6 A;  4JB7 A;  1S7Y A;  1NNK A;  2QS4 A;  3R26 A;  4MLQ A;  4NWD A;  5J1D A;  3HCQ A;  1B4H A;  4Z7E A;  3C32 A;  4BDO A;  3OXN A;  2H99 A;  3M3L A;  2F6P A;  1M5C A;  4OFL A;  1ZJL A;  1UTH B;  4NMY A;  3K1M A;  3MJN A;  4YKP A;  5LOM A;  3N6U A;  5M2V A;  3HHF A;  3MVZ A;  1PBP A;  1N3W A;  3TPA A;  5I56 B;  2ZNT A;  2YJP A;  2DE2 A;  5FTI A;  3LR1 A;  4U1Z A;  4U2R A;  1AL3 A;  3IB1 A;  4IO5 A;  2UVG A;  4OEV A;  2F5X A;  5DTB A;  3K1N A;  4M1V A;  1MQI A;  5I2K B;  3PD9 A;  4F18 A;  5FHM A;  3FXR A;  2D21 A;  1OLC A;  5KZT A;  3TMG A;  3UIF A;  3T93 B;  3K0V A;  4H5G A;  1OIB A;  3HHG A;  1DPP A;  1B58 A;  5CMM A;  3PPP A;  4X1B A;  5L9M A;  4EXK A;  4U1O A;  3V83 A;  3PU5 A;  2XXU A;  3MPL A;  1MXV A;  3MZB A;  5AA4 A;  4R9F A;  4MBP A;  5HBC A;  5CBS A;  5TP9 B;  3OMB A;  4OHN A;  3C33 A;  1A8E A;  1IQ7 A;  1MH4 A;  3KJT A;  1NH8 A;  2I3W A;  2Q2C A;  4ZEB A;  3MVW A;  1H44 A;  1AOV A;  1QUJ A;  1Q35 A;  1SYI A;  1A8F A;  3IOR A;  2IA4 A;  3RY3 A;  1B3E A;  2REJ A;  3FZV A;  4X48 A;  2Z8E A;  4GL8 A;  1D9Y A;  2Q9T A;  3KBR A;  1B3G A;  1J1N A;  3K00 A;  1FTJ A;  4RNS A;  3H6V A;  1Z7N E;  1FQF A;  2I49 A;  4OET A;  3UP9 A;  1US4 A;  5I57 B;  3MVX A;  3OOA A;  2G93 A;  2E0S A;  1URD A;  3QK6 A;  4KPT A;  3DM0 A;  3K4U A;  2O1M A;  4GF8 A;  5AA2 B;  1UIV A;  3T9U A;  2F8D A;  5B7D A;  3K6V A;  4KI0 E;  4ECF A;  1JET A;  4G68 B;  4YZZ A;  1MDQ A;  3MAM A;  3M8U A;  1NNT A;  3TYH A;  2H98 A;  5KCJ A;  1ZBM A;  3FIR A;  2V3T A;  4H8I A;  1R9L A;  1URG A;  5ICT A;  3TTM A;  1FTK A;  1WDN A;  5I58 A;  1M5B A;  2V3U A;  3R6U A;  3GLB A;  2DSF A;  2A5T A;  1WOD A;  1P1Q A;  1DOT A;  1IEJ A;  1POT A;  5BWJ A;  1DSN A;  1VR5 A;  3SEU A;  3B6T A;  4EUO A;  1OQG A;  3Q28 A;  3E3K A;  1JVX A;  3T96 B;  3S9E A;  2UYF A;  3CFL A;  2O69 A;  2V93 A;  2NWJ A;  2B65 A;  1N3X A;  3S9M C;  1USY E;  2Q2A A;  3FUZ A;  4NF8 B;  3CFZ A;  4IGT A;  4GIZ A;  3A3C A;  3T9X B;  3QIM A;  5DYH A;  2QMW A;  4Q0C A;  2WKY A;  3G3F A;  1B4Z A;  3TFL A;  3KZG A;  2Z22 A;  5BUU A;  3QAX A;  2LAO A;  4I9D A;  4G8N A;  3G3H A;  4IO4 A;  1AMF A;  1FTO A;  4U22 A;  1JW1 A;  1LAX A;  3IOV A;  3FJM A;  3Q26 A;  5DVI A;  1OQH A;  3TEP A;  3PUX E;  2OCU A;  4DDD A;  3IK6 B;  3OO8 A;  2REG A;  3LBS A;  2I0B A;  1A7L A;  5DVJ A;  3RTF B;  4ZZA A;  4RK9 A;  5I59 A;  1MXY A;  5I2N A;  4LON B;  4YIC A;  1R9Q A;  3KN7 A;  3TTN A;  3KSJ A;  3IOU A;  3KOS A;  1UTB A;  1P99 A;  2A5S A;  4KR5 A;  4F29 A;  3GZG A;  3TTR A;  4R2B A;  3OO9 A;  2IEE A;  3K1P A;  2ZYN A;  5AA1 A;  2HAV A;  3ILT B;  3MP1 A;  1QUI A;  5L9S A;  1B1H A;  1MXU A;  4U4S A;  1JW5 A;  3KFM A;  2OWT A;  3BBR A;  3DP8 A;  1UQW A;  1MH3 A;  1XVX A;  2F7A A;  3ZS6 A;  2ONR A;  4Q8R A;  3Q27 A;  1OVT A;  5JK4 A;  1SVX B;  4DCY A;  3UK4 A;  3G3G A;  4U23 A;  3CVG A;  3T9V A;  1B7H A;  1ZMG A;  3W9W A;  5ITO A;  2OWS A;  4ESW A;  3U93 A;  3A09 A;  2V84 A;  1MQG A;  4G8H A;  1P1U A;  5A5X B;  1O64 A;  4KCC A;  3IX1 A;  4H1X A;  3USD A;  4XKQ A;  4JWY A;  1VFE A;  4XXU A;  1H3D A;  4OZ9 A;  4P11 A;  2I58 A;  2ABH A;  1L5T A;  5H8S A;  1MM7 A;  3C36 A;  4JSO A;  5KDT A;  5L8D A;  2GHB A;  3W15 C;  4F3B A;  3D4C A;  3U92 A;  4PQJ A;  1ZTY A;  3QSL A;  2I3V A;  3IL1 B;  4FIM A;  2Y7W A;  4M4G A;  4H8J A;  3U1O A;  1B51 A;  2GHA A;  3QYT A;  3IO4 A;  4I8C A;  2Q89 A;  3CG3 A;  3I5O A;  3ONM A;  3UN6 A;  1BIY A;  1MY2 A;  2H25 A;  3QXM A;  4DXB A;  1IIW A;  4YMA A;  1A54 A;  4P0I A;  1MM6 A;  4BDN A;  1MS7 A;  3PPO A;  2R71 A;  1JEV A;  4LA9 A;  3OO6 A;  5CRY A;  3TAJ A;  2F35 A;  1CB6 A;  4LQ5 A;  2KLF A;  2GRV A;  1FQA A;  2QRY A;  3MQ9 A;  3FJ7 A;  4PFU A;  4IB2 A;  1SW2 A;  5JTY A;  4DXC A;  1B3F A;  2DWH A;  2XD2 A;  4GOT A;  4IY5 A;  3KGC A;  2O7I A;  3ZKK A;  1FW0 A;  1PB8 A;  3T9H B;  2UVH A;  3H4Z A;  1F9B A;  3VE1 B;  4F22 A;  3OEN A;  4N6P A;  4FEC A;  3SEV A;  2O1L A;  1JW4 A;  3O97 A;  1D3K A;  1TFD A;  4K3F A;  3IOT A;  4NF8 A;  5H8Q A;  3A3U A;  3MUQ A;  1MXX A;  1Y9U A;  1LST A;  4PE5 B;  1POY 1;  2PVU A;  4WXJ A;  4DZ1 A;  1MY1 A;  2BJJ X;  2Y7K A;  4C0R A;  4FED A;  3KOT A;  5K2X A;  1EZO A;  2Q88 A;  3W9V A;  1MXZ A;  4Z0I A;  4MFI A;  3C35 A;  3QUJ A;  3H6T A;  3OO7 A;  3M3K A;  5TPA A;  1B0H A;  2FYI A;  4PP0 A;  5H8F A;  4EQ7 A;  4TOZ A;  1BLF A;  2PYY A;  5CM6 A;  2PMS A;  3OEL A;  2ONK E;  3PUZ E;  4G8M A;  4HCY A;  2QS3 A;  4XKN A;  2HQ0 A;  3LSX A;  3F11 A;  3FAT A;  4WED A;  4YKJ A;  3UA8 A;  3HPI A;  1US5 A;  1JVY A;  2QPQ A;  3H3G A;  3ODB A;  3IB0 A;  2O84 X;  1BP5 A;  2NXO A;  1HSE A;  3OEM A;  3G3J A;  2DE3 A;  4O3B A;  1QVS A;  3TKD A;  2NOO A;  4LQ2 A;  3N6T A;  3SEX A;  4YKI A;  2XXT A;  2P2A A;  4POX A;  3SDF A;  1MQH A;  3MBP A;  3T22 A;  4ELR A;  3CSG A;  1IXG A;  3K2D A;  2DWI A;  2VHA A;  1CE2 A;  1P1W A;  4GFR A;  4IGR A;  1N7W A;  1DPE A;  3HO7 A;  4RJZ A;  3EQ1 A;  4GL0 A;  1MPB A;  5EHS A;  4X1D A;  4QFK A;  2Q8J A;  1QUK A;  4ELQ A;  4KYS A;  1B3H A;  3ZKL A;  2H9B A;  4ESX A;  4C1U A;  3FV2 A;  4LZ7 A;  4F2Q A;  2PT2 A;  3PUV E;  4OEN A;  1GVC A;  4F1Y A;  4QSC A;  3PD8 A;  5F7V A;  3PMX A;  1FQD A;  1LCT A;  1TT1 A;  4GQO A;  3IB2 A;  3MC2 A;  3PPR A;  1I6A A;  3FJG A;  2XHD A; 
#chains in the Genus database with same CATH topology
 2F78 A;  1FPG A;  4JSD A;  1YXI A;  5FTH A;  2UVJ A;  1IXI A;  1ZIU A;  3MVY A;  5ET5 A;  4KYD A;  1VE4 A;  1B2H A;  1QKB A;  4RYA A;  5DEX B;  4ZEK A;  1Z7M E;  3FXQ A;  5CMC A;  2V25 A;  5A5L A;  4MF3 A;  2F3D A;  3L6H A;  3EF7 A;  5F24 A;  2KR0 A;  1LAF E;  4IO7 A;  2DQV A;  4QHQ A;  1M5E A;  2DWJ A;  4N81 A;  1ZU0 A;  3TDJ A;  4QBA A;  2MKZ A;  3V89 B;  3DEL B;  4R6Y A;  3SEW A;  3NOH A;  4N15 A;  1GV8 A;  2OK2 A;  4LUB A;  3MYU A;  1IME A;  1PBQ A;  4XKR A;  4PFR A;  2JJK A;  4NWC A;  3E79 A;  3OD7 A;  1ANF A;  4YB5 A;  2WYP A;  5H8H B;  2O6A A;  2P1S A;  3K01 A;  5H8N B;  2ZMB A;  3IOW A;  3PV0 E;  4POW A;  4R6H A;  4KQP A;  2DXR A;  3K02 A;  3A29 A;  1LGB C;  3LUY A;  3SES A;  3FVO A;  4FOR A;  3RT8 A;  3S4U A;  3B8B A;  3FVG A;  1SYH A;  3DP6 A;  4QFL A;  3T66 A;  1I6B A;  2B4L A;  3FV1 A;  4OVR A;  5I7I A;  4H5F A;  1MY3 A;  5ET6 A;  4RPO A;  4TLL B;  3UGW A;  4ZE8 A;  2Y5L A;  1IMC A;  1UTH A;  4NF6 B;  2RC9 A;  1S9T A;  4PDH A;  1LFH A;  2AL4 A;  1H43 A;  4XKP A;  2ZNS A;  3EHS A;  1XC1 A;  1SDX A;  3CHG A;  4U21 A;  4L17 A;  4E0X A;  1WVJ A;  2D3I A;  4ND9 A;  1KA1 A;  4PFW A;  5I56 A;  2G29 A;  1IXH A;  4MMP A;  1A99 A;  1NNF A;  4I62 A;  4OFO A;  4X9T A;  1B5J A;  4ONY A;  3OSR A;  1FBH A;  2R9J A;  1NV5 A;  1DBZ A;  3OEK A;  1IUD A;  2Z8D A;  1O7T A;  4G61 A;  4EXL A;  4RY1 A;  1R6Z A;  3E4R A;  1JNF A;  1B40 A;  4F2O A;  3KC0 A;  4MNI A;  1B5H A;  5I2K A;  1TWY A;  1MRP A;  5DT6 A;  2DWA A;  3G3I A;  4YU0 A;  5EQA A;  5ISU A;  4PDD A;  3MPK A;  5ELV A;  4XIG Q;  3CFX A;  4BDQ A;  1QUL A;  1Q1K A;  4NG7 A;  5IZ3 A;  1YZ0 A;  4OTE A;  2F97 A;  4HE0 A;  1FPJ A;  1G0I A;  3TUS A;  1QJM A;  2I48 A;  2ONS A;  4DXU A;  2PT1 A;  1QW0 A;  2P3V A;  1D9V A;  4YAH X;  3PGF A;  4AS4 A;  3S2V A;  3KJ7 A;  3IAZ A;  4HTG A;  4OFJ A;  4O3A A;  4OEU A;  4MNP A;  5TP9 A;  3O9P A;  4MLV A;  2RCA A;  1LBZ A;  3BFT A;  1FPE A;  3M3F A;  1XT8 A;  3WAE A;  3BIG A;  4ZED A;  3OSQ A;  2XXV A;  5AA4 B;  1LFI A;  2XX8 A;  2XXY A;  3T1B A;  1G0H A;  2ANJ A;  2DE4 A;  3H7M A;  2CZI A;  3ROJ A;  3GBB A;  3KEI A;  4JBZ A;  1JQF A;  1PC3 A;  1LAH E;  1MQJ A;  2R6G E;  4C1T A;  3CSB A;  4HS7 A;  3CIJ A;  4F1U A;  3DLN A;  3IJX B;  3S9L C;  1LB9 A;  4H45 A;  2GFE A;  4OYV A;  3K6U A;  5EYG A;  4F19 A;  4OVJ A;  1IMD A;  2F34 A;  2H4I A;  1SW1 A;  5I57 A;  3PTY A;  1Y3Q A;  3O6H A;  2QVU A;  2OJT A;  4UA8 A;  4H0W A;  1FPK A;  4NF5 B;  2XXP A;  5AA2 A;  3TTL A;  2HFB A;  2RKM A;  3D4G A;  4DIG A;  1FCK A;  1MG1 A;  1YAE A;  2CEX A;  3RGY A;  4YKK A;  1GTK A;  3FAS A;  2DVZ A;  1KZ8 A;  2I0C A;  4G68 A;  1A55 A;  4ELO A;  4PCD A;  3RN8 A;  3IO6 A;  5CI5 A;  2QFL A;  2O51 A;  3SKP A;  3HFU A;  1Y3P A;  5F1Q A;  4GWX A;  1B52 A;  2QJE A;  4NF4 B;  1Y1Z A;  4U4X A;  5EHM A;  4NAP A;  3MW0 A;  4FJP A;  4Q5T A;  3EN3 A;  4OVT A;  4O3C A;  2FIE A;  2ZYM A;  4HW8 A;  5KCJ B;  3U94 A;  1DTG A;  4LP2 B;  1LBB A;  2CEY A;  1B3L A;  4O8M A;  4OQO A;  1FBP A;  3RNN A;  2HPG A;  4FAT A;  5I58 B;  3VLW A;  2RC7 A;  2DS9 A;  4PBH A;  3SET A;  1N7X A;  4FAJ A;  3VFJ A;  1R1N A;  2CZL A;  4UAB A;  3VXB A;  4BDL A;  3C4M A;  2UYE A;  1VSO A;  1MPD A;  5ICQ A;  1LLS A;  2X7Q A;  1LCF A;  3Q25 A;  3E13 X;  3KC1 A;  1YCJ A;  2THI A;  2VGQ A;  4IO6 A;  2WEF A;  1YPN A;  4GWW A;  3QUF A;  3KG2 A;  1ELJ A;  3KSX A;  1PDA A;  3JV9 A;  2O7U A;  4F39 A;  4NTL A;  4XEQ A;  1YTV A;  1II5 A;  3PUY E;  2E1S A;  4H46 A;  3CRB A;  3N5L A;  1OMP A;  2Y7I A;  2RCB A;  3E9X A;  1DMB A;  1LB8 A;  3O2A A;  4QXD A;  1TXF A;  2I4B A;  4QRZ A;  4RA1 A;  4R72 A;  2I6E A;  4PFT A;  4R74 A;  1Y1M A;  1D9Q A;  3LSL A;  4O94 A;  4F3S A;  2YLN A;  3KN3 A;  4F31 B;  4AQ4 A;  5CMB A;  3N94 A;  3VDF A;  3ISP A;  3UOR A;  2XXR A;  3EHT A;  2Q8M A;  2XXI A;  5DVF A;  1I69 A;  1RYO A;  3EPE A;  4R6K A;  5HPQ A;  3V8X B;  1IMB A;  3G7W A;  2YPN A;  2ZZV A;  3HV1 A;  4TQU Q;  1B7Z A;  4X8R A;  1GGG A;  2D5W A;  1N0T A;  3LUZ A;  4EQB A;  4GX6 A;  1SBP A;  2PCR A;  4R73 A;  4ZS9 A;  2FA7 A;  5I59 B;  5I2N B;  2FBP A;  4G2Z A;  1NH7 A;  3RPL A;  1AIV A;  3H06 B;  2F6G A;  3PMW A;  3RLF E;  4ZEI A;  3E78 A;  2CMO A;  1FQC A;  2XD3 A;  1UTB B;  4I1D A;  4EF2 A;  4EDP A;  3LSF B;  1Y4T A;  1N76 A;  2QS2 A;  3VLU A;  4IO2 A;  1FQE A;  4PGP A;  1MQD A;  1D4N A;  1A40 A;  4R75 A;  2DVC A;  1NFT A;  2XX9 A;  1IXC A;  2X26 A;  2PBW A;  4RK2 A;  5AE4 A;  4P8B A;  4DCX A;  3H03 A;  3LC8 A;  2Z23 A;  4G68 C;  4ISU A;  4LAT A;  5A5X A;  1LAG E;  2XXX A;  1XI6 A;  4FBP A;  5B70 A;  1PB7 A;  2HHM A;  5AA2 D;  3FGS A;  4IR8 A;  5JEI A;  1LBC A;  2Y84 A;  1M5D A;  1B32 A;  4QSD A;  2VP1 A;  3U8Q A;  1T0K A;  4MJO A;  4XTC Q;  5ITP A;  4QSE A;  2VD3 A;  4OMB A;  4PET A;  4PGN A;  4KCD A;  3AXF A;  2QSX A;  1OLA A;  4PFY A;  3SEY A;  1FPD A;  4BLA A;  3KN8 A;  2DP8 A;  3MP8 A;  1B7U A;  3MZ9 A;  3HST A;  4P0G A;  4QFO A;  3I6V A;  3PMV A;  2AL5 A;  4NF5 A;  3RPW A;  1UIU A;  2RF1 A;  1PEB A;  3PPQ A;  3L6G A;  3ECR A;  2OBG A;  3DP4 A;  1B5I A;  2DOJ A;  4RPN A;  5TU0 A;  4JXI A;  1FTL A;  5KDT B;  4F3P A;  2ZZW A;  2CZH A;  4NF0 A;  2BJI A;  3G3K A;  2M8C A;  4KHZ E;  4LZ5 A;  1S50 A;  4N13 A;  4NF4 A;  2B3B A;  2HCA A;  3HN0 A;  1MXW A;  4FEB A;  3TCH A;  2XXQ A;  4FE8 A;  2ZYK A;  2DXY A;  4GD5 A;  5K2Y A;  5HM4 B;  4GWO A;  1I6Q A;  1B6H A;  1HSL A;  2UVI A;  1EZ9 A;  4EF1 A;  3IJO B;  3VVE A;  5ET8 A;  3H6W A;  4ZDM A;  4TLM B;  2DYX A;  3RTW B;  1BK4 A;  1SW4 A;  3VVF A;  2HXR A;  2Z8F A;  2HAU A;  5IGA A;  4GXA A;  3VXC A;  4N4U A;  1IIT A;  1Y20 A;  3O66 A;  3BIH A;  3H6U A;  2DDK A;  2RIN A;  4DI3 D;  3ILU B;  1IZ1 A;  3BKI B;  2UXA A;  5FHN A;  1EU8 A;  5AA3 A;  2ZXT A;  2NUV A;  1EZP A;  4IY6 A;  4JWO A;  3O28 A;  4ZEC A;  1SW5 A;  2QMX A;  2RC8 A;  4F1V A;  4GRK A;  3IR1 A;  4N8G A;  1ZKB A;  5JTY B;  1NUY A;  3GXA A;  1TFA A;  1YYZ A;  1NNP A;  1GR2 A;  4HCW A;  1O63 A;  4ZE9 A;  1B1X A;  1RDX A;  1DTZ A;  2PX1 A;  1SI1 A;  3Q29 A;  1MPC A;  4QF9 A;  2FIX A;  1B0L A;  4KYE A;  3FD3 A;  1N84 A;  5LTC A;  1FQB A;  1NMU A;  3TTK A;  4RXL A;  5IAI A;  4NE4 A;  4R2F A;  5H8Q B;  1B9J A;  4E0W A;  3TQL A;  3MP6 A;  1RYX A;  2VOZ A;  3U72 A;  1IMF A;  2OZZ A;  2X7P A;  2F36 A;  4GXS B;  4LZ8 A;  4BDM A;  2L5V A;  5CBR A;  3TCG A;  3R7X A;  1K9Z A;  2NVU B;  3TOD A;  1NV3 A;  2P3N A;  3JZJ A;  1LBY A;  3N26 A;  3WAF A;  3TCF A;  5I84 A;  4OXV A;  1NL5 A;  2QS1 A;  4AB6 A;  4OER A;  1DCU A;  1SI0 A;  3TQW A;  1B46 A;  4N6D A;  4BDR A;  2I4C A;  1FTM A;  5TPA B;  2XXK A;  4XF5 A;  3O29 A;  1SD3 A;  5H8F B;  4HXV A;  5CMK A;  2HXW A;  3RUM A;  3B6W A;  2XXW A;  1ATG A;  4ZEF A;  5FHO A;  4Q30 B;  1M5F A;  1LFG A;  2H5Y A;  3RT6 B;  2GQ1 A;  4JDF A;  5EYH A;  4N07 A;  2ZNU A;  4NN3 A;  1MY4 A;  1P1N A;  2W7Y A;  1INP A;  1H45 A;  1JEU A;  1AH5 A;  2Y7P A;  4O7M A;  2Y7R A;  2F7B A;  1FTA A;  4KD5 A;  3CG1 A;  3P7I A;  4GLI A;  2HEU A;  4H6D A;  1EH3 A;  4YB6 A;  2ESN A;  1URS A;  3GBA A;  2AYS A;  1USY H;  2V4C A;  2GH9 A;  3MZ1 A;  4ZZE A;  1XVY A;  3FXB A;  4NED A;  4G4P A;  1CNQ A;  4DE8 A;  4EQ9 A;  4QFP A;  4OVS A;  1MDP 1;  1BTJ A;  4MH5 A;  4ELP A;  2HZL A;  1PB9 A;  4KFQ A;  4YMB A;  1XOC A;  3CR9 A;  1Y3N A;  1XS5 A;  3LV0 A;  1QKA A;  1B05 A;  1MY0 A;  4QFN A;  4R9G A;  1BKA A;  2F7C A;  3C31 A;  3VV5 A;  4IO3 A;  3FXU A;  5EYF A;  3ZSF A;  3VVD A;  3EHU A;  4WKM A;  2HZK A;  1H76 A;  4LN5 A;  3PPN A;  3O6I A;  4OES A;  2VD2 A;  4HE2 A;  5J16 A;  3PUW E;  2FVZ A;  2FNC A;  4F3G A;  4H65 A;  2QL3 A;  1KWH A;  5DEX A;  2PFY A;  1N04 A;  3CI8 A;  3V5A A;  4OWD A;  2QVV A;  1SQY A;  4I3Y A;  3K6X A;  4YB7 A;  4GVO A;  2P0S A;  4WEP A;  3JYR A;  4JVI A;  3K6W A;  4AB5 A;  5L9O A;  3THI A;  2OLB A;  1AWB A;  3LSW A;  1ZLQ A;  4JWX A;  1OVB A;  4H67 A;  3C34 A;  4NHB A;  4OVQ A;  5CC2 A;  1RKM A;  5H8H A;  4N17 A;  4LVQ A;  2ALU A;  1VFD A;  5H8N A;  1Y4C A;  5LDZ A;  3SER A;  3TZA A;  3BFU A;  4G77 A;  3B6Q A;  1XHY A;  3FVN A;  4DLD A;  3VLV A;  3C9H A;  3B7D A;  1NKX A;  2O68 A;  1NV0 A;  2XXH A;  2B3F A;  2ZYO A;  2A5T B;  1P1O A;  3S9N C;  3FVK A;  4THI A;  5IKB A;  3I3V A;  3TEL A;  2XWO A;  3O6G A;  3MWB A;  1HSJ A;  4UAC A;  4X04 A;  2AIX A;  2XX7 A;  2V3Q A;  3RQT A;  4NF6 A;  4JB7 A;  1S7Y A;  1NNK A;  2QS4 A;  3R26 A;  4PAI A;  4MLQ A;  4NWD A;  5J1D A;  4AS5 A;  3HCQ A;  1B4H A;  4Z7E A;  3C32 A;  3IFC A;  4BDO A;  4N91 A;  3OXN A;  2H99 A;  3M3L A;  2F6P A;  1M5C A;  4OFL A;  2XWI A;  1ZJL A;  4P9K A;  1UTH B;  4JVD A;  4NMY A;  3K1M A;  3MJN A;  4YKP A;  5I3S A;  5LOM A;  3N6U A;  5M2V A;  3HHF A;  3MVZ A;  1PBP A;  1N3W A;  3TPA A;  5I56 B;  2ZNT A;  2YJP A;  2DE2 A;  5FTI A;  3LR1 A;  4U1Z A;  4U2R A;  1AL3 A;  4PAF A;  3IB1 A;  4IO5 A;  2UVG A;  2VT5 A;  3D1R A;  2Q74 A;  4OEV A;  1NI9 A;  4NQ8 A;  4P1L A;  5IM2 A;  2Y5K A;  2F5X A;  5DTB A;  3K1N A;  4M1V A;  1MQI A;  5I2K B;  4HE1 A;  3PD9 A;  4F18 A;  5FHM A;  2CZK A;  3FXR A;  2D21 A;  4P47 A;  1OLC A;  5IZZ A;  5KZT A;  3TMG A;  3UIF A;  3T93 B;  5IZ3 B;  3K0V A;  4H5G A;  1OIB A;  3HHG A;  1DPP A;  4GWZ A;  1B58 A;  1VDW A;  5CMM A;  3PPP A;  4P56 A;  4X1B A;  4JVC A;  5L9M A;  4EXK A;  4U1O A;  3V83 A;  3PU5 A;  2XXU A;  3MPL A;  1MXV A;  3MZB A;  5AA4 A;  4R9F A;  4MBP A;  5HBC A;  5CBS A;  5TP9 B;  3OMB A;  4GWY A;  4OHN A;  3C33 A;  1A8E A;  1Q9D A;  1IQ7 A;  1MH4 A;  3KJT A;  1NH8 A;  2I3W A;  2Q2C A;  4ZEB A;  3MVW A;  1H44 A;  1AOV A;  1QUJ A;  1Q35 A;  1SYI A;  1A8F A;  3IOR A;  2IA4 A;  3RY3 A;  4MHF A;  1B3E A;  2REJ A;  3FZV A;  3IFA A;  4X48 A;  2WYK A;  2Z8E A;  4GBW A;  4GL8 A;  4GX3 A;  1D9Y A;  2Q9T A;  3KBR A;  1B3G A;  1J1N A;  3K00 A;  2R8T A;  1FTJ A;  4N6K A;  4RNS A;  3H6V A;  3MST A;  4PFI A;  1Z7N E;  1FQF A;  2I49 A;  4OET A;  1NUW A;  3UP9 A;  1US4 A;  5I57 B;  3MVX A;  3OOA A;  3SZP A;  2G93 A;  2WBD A;  2E0S A;  1URD A;  3QK6 A;  4KPT A;  3DM0 A;  1NV4 A;  3K4U A;  2O1M A;  4GF8 A;  4PFB A;  5AA2 B;  1UIV A;  3T9U A;  2F8D A;  5B7D A;  1NV2 A;  3K6V A;  4KI0 E;  4ECF A;  1JET A;  4G68 B;  1FBF A;  4YZZ A;  1MDQ A;  3MAM A;  5DW8 A;  3M8U A;  1NNT A;  3TYH A;  2H98 A;  5KCJ A;  1ZBM A;  3FIR A;  4OVP A;  2V3T A;  4H8I A;  1R9L A;  1URG A;  5ICT A;  3TTM A;  1FTK A;  1WDN A;  5I58 A;  2VPN A;  1M5B A;  2V3U A;  3R6U A;  3GLB A;  2DSF A;  2A5T A;  1WOD A;  1P1Q A;  1DOT A;  1IEJ A;  1POT A;  5BWJ A;  1DSN A;  1VR5 A;  2XWK A;  3SEU A;  3B6T A;  4EUO A;  1OQG A;  3Q28 A;  1LEV A;  3E3K A;  1JVX A;  3T96 B;  3S9E A;  2UYF A;  3CFL A;  1JP4 A;  2O69 A;  1FJ6 A;  2V93 A;  2NWJ A;  2B65 A;  5I5P A;  1N3X A;  3S9M C;  1USY E;  2Q2A A;  3EKI A;  3FUZ A;  4NF8 B;  3CFZ A;  4IGT A;  3KBZ A;  4GIZ A;  3A3C A;  3T9X B;  3QIM A;  5EQ7 A;  5DYH A;  2QMW A;  4Q0C A;  2WKY A;  1FJ9 A;  3G3F A;  2ZZX A;  4NX1 A;  1FBC A;  1B4Z A;  3TFL A;  3KZG A;  2Z22 A;  5BUU A;  3QAX A;  2LAO A;  1FBD A;  4I9D A;  4G8N A;  3G3H A;  4IO4 A;  1NV1 A;  1AMF A;  1FTO A;  4U22 A;  1JW1 A;  1LAX A;  3IOV A;  3FJM A;  3Q26 A;  5DVI A;  1OQH A;  3TEP A;  3PUX E;  2OCU A;  4DDD A;  3IK6 B;  3OO8 A;  2REG A;  3LBS A;  2I0B A;  1A7L A;  5DVJ A;  3RTF B;  5FBP A;  4MAG A;  4ZZA A;  4RK9 A;  5I59 A;  1MXY A;  1NV7 A;  5I2N A;  4LON B;  4YIC A;  1R9Q A;  3KN7 A;  3TTN A;  3KSJ A;  3IOU A;  3KOS A;  4PE3 A;  1EYK A;  4GX4 A;  1UTB A;  1P99 A;  2A5S A;  4KR5 A;  4F29 A;  3GZG A;  3TTR A;  4R2B A;  2FHY A;  3OO9 A;  2IEE A;  3K1P A;  2ZYN A;  5AA1 A;  2HAV A;  3ILT B;  3MP1 A;  4GWS A;  1QUI A;  5L9S A;  1B1H A;  1MXU A;  4U4S A;  3RPL B;  4I40 A;  1JW5 A;  3KFM A;  2OWT A;  3BBR A;  3DP8 A;  1UQW A;  1MH3 A;  1XVX A;  2F7A A;  3ZS6 A;  2ONR A;  4Q8R A;  3Q27 A;  1OVT A;  3U65 A;  5JK4 A;  1SVX B;  4DCY A;  3UK4 A;  3G3G A;  1FBE A;  4U23 A;  3CVG A;  3T9V A;  1FRP A;  1B7H A;  1ZMG A;  4MX6 A;  3W9W A;  5ITO A;  2OWS A;  5ESY A;  4ESW A;  4MIJ A;  1NUZ A;  3U93 A;  1FBG A;  3A09 A;  1KA0 A;  2V84 A;  1MQG A;  4G8H A;  1P1U A;  5A5X B;  1O64 A;  4KCC A;  3IX1 A;  2QVR A;  4H1X A;  3USD A;  4XKQ A;  1RDZ A;  4JWY A;  1VFE A;  5IZ1 A;  4XXU A;  1H3D A;  4OZ9 A;  4P11 A;  2I58 A;  2ABH A;  1L5T A;  5H8S A;  1MM7 A;  4XFE A;  3C36 A;  4JSO A;  5KDT A;  5L8D A;  2GHB A;  3W15 C;  4F3B A;  3D4C A;  3U92 A;  4PQJ A;  1ZTY A;  3QSL A;  2I3V A;  1DK4 A;  5T3J A;  3IL1 B;  4FIM A;  2Y7W A;  4M4G A;  4MCO A;  4NGU A;  4OAN A;  4H8J A;  3U1O A;  1B51 A;  2GHA A;  4I3E A;  3QYT A;  3RYD A;  3IO4 A;  4I8C A;  2Q89 A;  3CG3 A;  3I5O A;  4PC9 A;  3ONM A;  3UN6 A;  1BIY A;  1MY2 A;  2H25 A;  3QXM A;  4DXB A;  3B50 A;  1IIW A;  4YMA A;  4PBQ A;  1A54 A;  3T0J A;  4P0I A;  1MM6 A;  4BDN A;  1MS7 A;  3PPO A;  2R71 A;  1JEV A;  4LA9 A;  1QGX A;  3OO6 A;  2PFZ A;  5CRY A;  3TAJ A;  2F35 A;  1CB6 A;  4LQ5 A;  2KLF A;  2GRV A;  1FQA A;  2QRY A;  3MQ9 A;  1K9Y A;  3FJ7 A;  4PFU A;  4IB2 A;  1SW2 A;  1RDY A;  5JTY A;  4DXC A;  1B3F A;  1NV6 A;  2XWV A;  1NUX A;  2DWH A;  2OX3 A;  2XD2 A;  4GOT A;  4IY5 A;  3KGC A;  2O7I A;  3ZKK A;  1FW0 A;  1PB8 A;  3T9H B;  2UVH A;  4OA4 A;  4P1E A;  3H4Z A;  1F9B A;  3VE1 B;  4F22 A;  3OEN A;  4N6P A;  4FEC A;  3SEV A;  1EYI A;  2O1L A;  1JW4 A;  3O97 A;  1FPB A;  1D3K A;  4GWU A;  1TFD A;  4K3F A;  3IOT A;  4NF8 A;  5H8Q A;  3A3U A;  3MUQ A;  1MXX A;  4N8Y A;  1Y9U A;  1LST A;  4PE5 B;  1POY 1;  3GYY A;  2PVU A;  4WXJ A;  4DZ1 A;  1MY1 A;  1SPI A;  2BJJ X;  2Y7K A;  3QMF A;  4C0R A;  4FED A;  3KOT A;  5K2X A;  1EZO A;  2Q88 A;  3W9V A;  1MXZ A;  4Z0I A;  4MFI A;  3C35 A;  3QUJ A;  3H6T A;  3OO7 A;  3M3K A;  2OWZ A;  5TPA A;  2F3B A;  4GBV A;  1B0H A;  2FYI A;  4PP0 A;  5H8F A;  4EQ7 A;  4TOZ A;  1BLF A;  2PYY A;  5CM6 A;  2PMS A;  1LBX A;  3OEL A;  2ONK E;  2KQZ A;  3PUZ E;  4G8M A;  4HCY A;  1FPF A;  2QS3 A;  4XKN A;  2HQ0 A;  3LSX A;  3F11 A;  3FAT A;  4WED A;  4YKJ A;  4KXP A;  3UA8 A;  3HPI A;  1US5 A;  1JVY A;  2QPQ A;  5EQ9 A;  4PF8 A;  3H3G A;  1LBW A;  3ODB A;  3IB0 A;  2O84 X;  1BP5 A;  2NXO A;  1HSE A;  3OEM A;  3G3J A;  3FBP A;  5ET7 A;  2DE3 A;  2WX9 A;  4O3B A;  1QVS A;  4O7I A;  3TKD A;  2NOO A;  4PF6 A;  4LQ2 A;  3N6T A;  3SEX A;  4YKI A;  2XXT A;  2P2A A;  1FPI A;  4POX A;  4PAK A;  2VPO A;  3SDF A;  1MQH A;  3MBP A;  3T22 A;  4DI4 B;  4ELR A;  3CSG A;  1IXG A;  3K2D A;  4MNC A;  2DWI A;  1IMA A;  4PTK A;  2VHA A;  1CE2 A;  2WBB A;  1P1W A;  4GFR A;  4IGR A;  1N7W A;  1DPE A;  3HO7 A;  4RJZ A;  3EQ1 A;  4GL0 A;  1MPB A;  5EQ8 A;  5EHS A;  4X1D A;  4QFK A;  4P3L A;  2Q8J A;  1QUK A;  4ELQ A;  4KYS A;  4MEV A;  1B3H A;  3ZKL A;  2H9B A;  4ESX A;  4C1U A;  1FSA A;  3FV2 A;  4LZ7 A;  1LBV A;  2B4M A;  4F2Q A;  2PT2 A;  3PUV E;  4OEN A;  1GVC A;  4F1Y A;  4QSC A;  3PD8 A;  5F7V A;  1FPL A;  3PMX A;  1FQD A;  1LCT A;  1TT1 A;  4GQO A;  3IB2 A;  3MC2 A;  1EYJ A;  3PPR A;  1I6A A;  2XA5 A;  3FJG A;  2XHD A; 
#chains in the Genus database with same CATH homology
 2F78 A;  4JSD A;  5FTH A;  2UVJ A;  1IXI A;  1ZIU A;  3MVY A;  4KYD A;  1VE4 A;  1B2H A;  1QKB A;  4RYA A;  5DEX B;  4ZEK A;  1Z7M E;  3FXQ A;  5CMC A;  2V25 A;  4MF3 A;  3L6H A;  3EF7 A;  1LAF E;  4IO7 A;  2DQV A;  4QHQ A;  1M5E A;  2DWJ A;  1ZU0 A;  3TDJ A;  3V89 B;  3DEL B;  4R6Y A;  3SEW A;  1GV8 A;  2OK2 A;  4LUB A;  1PBQ A;  4XKR A;  4NWC A;  3OD7 A;  1ANF A;  4YB5 A;  5H8H B;  2O6A A;  2P1S A;  3K01 A;  5H8N B;  2ZMB A;  3IOW A;  3PV0 E;  4POW A;  4R6H A;  4KQP A;  2DXR A;  3K02 A;  1LGB C;  3LUY A;  3SES A;  3FVO A;  4FOR A;  3RT8 A;  3S4U A;  3FVG A;  1SYH A;  3DP6 A;  4QFL A;  3T66 A;  1I6B A;  3FV1 A;  4H5F A;  1MY3 A;  4RPO A;  4TLL B;  3UGW A;  4ZE8 A;  1UTH A;  4NF6 B;  2RC9 A;  1S9T A;  1LFH A;  2AL4 A;  1H43 A;  4XKP A;  2ZNS A;  3EHS A;  1XC1 A;  1SDX A;  4U21 A;  4L17 A;  4E0X A;  1WVJ A;  2D3I A;  4ND9 A;  4PFW A;  5I56 A;  2G29 A;  1IXH A;  1A99 A;  1NNF A;  4I62 A;  4OFO A;  4X9T A;  1B5J A;  4ONY A;  3OSR A;  2R9J A;  3OEK A;  1IUD A;  2Z8D A;  1O7T A;  4EXL A;  4RY1 A;  1R6Z A;  3E4R A;  1JNF A;  1B40 A;  4F2O A;  1B5H A;  5I2K A;  1TWY A;  1MRP A;  5DT6 A;  2DWA A;  3G3I A;  4YU0 A;  5ISU A;  3MPK A;  5ELV A;  4XIG Q;  3CFX A;  4BDQ A;  1QUL A;  1Q1K A;  4OTE A;  2F97 A;  3TUS A;  1QJM A;  2I48 A;  2ONS A;  4DXU A;  2PT1 A;  1QW0 A;  1D9V A;  4YAH X;  3PGF A;  3S2V A;  3KJ7 A;  3IAZ A;  4HTG A;  4OFJ A;  4O3A A;  4OEU A;  5TP9 A;  3O9P A;  4MLV A;  2RCA A;  3BFT A;  3M3F A;  1XT8 A;  3WAE A;  4ZED A;  3OSQ A;  2XXV A;  5AA4 B;  1LFI A;  2XX8 A;  2XXY A;  2ANJ A;  2DE4 A;  3H7M A;  3GBB A;  3KEI A;  4JBZ A;  1JQF A;  1PC3 A;  1LAH E;  1MQJ A;  2R6G E;  4C1T A;  3CSB A;  4HS7 A;  3CIJ A;  4F1U A;  3DLN A;  3IJX B;  3S9L C;  1LB9 A;  2GFE A;  4OYV A;  3K6U A;  4F19 A;  4OVJ A;  5I57 A;  2F34 A;  2H4I A;  1SW1 A;  1Y3Q A;  3O6H A;  2OJT A;  4UA8 A;  4H0W A;  4NF5 B;  2XXP A;  5AA2 A;  3TTL A;  2HFB A;  2RKM A;  3D4G A;  4DIG A;  1FCK A;  1MG1 A;  1YAE A;  3RGY A;  4YKK A;  1GTK A;  3FAS A;  2DVZ A;  2I0C A;  4G68 A;  1A55 A;  4ELO A;  3RN8 A;  3IO6 A;  5CI5 A;  2O51 A;  3SKP A;  1Y3P A;  5F1Q A;  1B52 A;  2QJE A;  4NF4 B;  1Y1Z A;  4U4X A;  5EHM A;  3MW0 A;  4FJP A;  4Q5T A;  3EN3 A;  4O3C A;  2ZYM A;  4HW8 A;  5KCJ B;  3U94 A;  1DTG A;  4LP2 B;  1LBB A;  1B3L A;  4OQO A;  3RNN A;  4FAT A;  5I58 B;  3VLW A;  2RC7 A;  2DS9 A;  3SET A;  1N7X A;  4FAJ A;  3VFJ A;  1R1N A;  2CZL A;  3VXB A;  4BDL A;  3C4M A;  2UYE A;  1VSO A;  1MPD A;  5ICQ A;  1LLS A;  2X7Q A;  1LCF A;  3Q25 A;  3E13 X;  1YCJ A;  2THI A;  2VGQ A;  4IO6 A;  1YPN A;  3QUF A;  3KG2 A;  1ELJ A;  3KSX A;  1PDA A;  3JV9 A;  2O7U A;  4F39 A;  4NTL A;  1YTV A;  1II5 A;  3PUY E;  2E1S A;  3CRB A;  3N5L A;  1OMP A;  2Y7I A;  2RCB A;  3E9X A;  1DMB A;  1LB8 A;  3O2A A;  1TXF A;  2I4B A;  4QRZ A;  4RA1 A;  4R72 A;  2I6E A;  4PFT A;  4R74 A;  1Y1M A;  3LSL A;  4F3S A;  2YLN A;  3KN3 A;  4F31 B;  4AQ4 A;  5CMB A;  3N94 A;  3VDF A;  3UOR A;  2XXR A;  3EHT A;  2XXI A;  5DVF A;  1I69 A;  1RYO A;  3EPE A;  4R6K A;  5HPQ A;  3V8X B;  3G7W A;  2YPN A;  3HV1 A;  4TQU Q;  1B7Z A;  1GGG A;  2D5W A;  1N0T A;  4EQB A;  1SBP A;  4R73 A;  4ZS9 A;  2FA7 A;  5I59 B;  5I2N B;  4G2Z A;  1NH7 A;  1AIV A;  3H06 B;  2F6G A;  3PMW A;  3RLF E;  4ZEI A;  2CMO A;  1FQC A;  2XD3 A;  1UTB B;  4I1D A;  4EF2 A;  4EDP A;  3LSF B;  1Y4T A;  1N76 A;  2QS2 A;  3VLU A;  4IO2 A;  1FQE A;  1MQD A;  1D4N A;  1A40 A;  4R75 A;  2DVC A;  1NFT A;  2XX9 A;  1IXC A;  2X26 A;  2PBW A;  4RK2 A;  5AE4 A;  4DCX A;  3H03 A;  3LC8 A;  2Z23 A;  4G68 C;  4ISU A;  4LAT A;  5A5X A;  1LAG E;  2XXX A;  5B70 A;  1PB7 A;  5AA2 D;  3FGS A;  5JEI A;  1LBC A;  2Y84 A;  1M5D A;  1B32 A;  4QSD A;  2VP1 A;  3U8Q A;  1T0K A;  4XTC Q;  5ITP A;  4QSE A;  2VD3 A;  4OMB A;  4PET A;  4KCD A;  3AXF A;  2QSX A;  1OLA A;  4PFY A;  3SEY A;  4BLA A;  3KN8 A;  2DP8 A;  3MP8 A;  1B7U A;  3MZ9 A;  3HST A;  4P0G A;  4QFO A;  3I6V A;  3PMV A;  2AL5 A;  4NF5 A;  3RPW A;  1UIU A;  2RF1 A;  1PEB A;  3PPQ A;  3L6G A;  3ECR A;  2OBG A;  3DP4 A;  1B5I A;  2DOJ A;  4RPN A;  5TU0 A;  4JXI A;  1FTL A;  5KDT B;  4F3P A;  3G3K A;  2M8C A;  4KHZ E;  4LZ5 A;  1S50 A;  4N13 A;  4NF4 A;  2B3B A;  2HCA A;  3HN0 A;  1MXW A;  4FEB A;  3TCH A;  2XXQ A;  4FE8 A;  2ZYK A;  2DXY A;  4GD5 A;  5K2Y A;  5HM4 B;  4GWO A;  1I6Q A;  1B6H A;  1HSL A;  2UVI A;  1EZ9 A;  4EF1 A;  3IJO B;  3VVE A;  3H6W A;  4ZDM A;  4TLM B;  2DYX A;  3RTW B;  1SW4 A;  3VVF A;  2Z8F A;  2HAU A;  4GXA A;  3VXC A;  1IIT A;  1Y20 A;  3O66 A;  3H6U A;  2RIN A;  3ILU B;  1IZ1 A;  3BKI B;  2UXA A;  5FHN A;  1EU8 A;  5AA3 A;  2ZXT A;  2NUV A;  1EZP A;  4IY6 A;  4JWO A;  3O28 A;  4ZEC A;  1SW5 A;  2QMX A;  2RC8 A;  4F1V A;  4GRK A;  3IR1 A;  1ZKB A;  5JTY B;  3GXA A;  1TFA A;  1NNP A;  1GR2 A;  4HCW A;  1O63 A;  4ZE9 A;  1B1X A;  1DTZ A;  2PX1 A;  1SI1 A;  3Q29 A;  1MPC A;  4QF9 A;  1B0L A;  4KYE A;  3FD3 A;  1N84 A;  1FQB A;  1NMU A;  3TTK A;  4RXL A;  5IAI A;  4NE4 A;  4R2F A;  5H8Q B;  1B9J A;  4E0W A;  3TQL A;  3MP6 A;  1RYX A;  2VOZ A;  3U72 A;  2OZZ A;  2X7P A;  2F36 A;  4GXS B;  4LZ8 A;  4BDM A;  5CBR A;  3TCG A;  3R7X A;  2NVU B;  3TOD A;  3JZJ A;  3N26 A;  3WAF A;  3TCF A;  5I84 A;  4OXV A;  1NL5 A;  2QS1 A;  4AB6 A;  4OER A;  1SI0 A;  3TQW A;  1B46 A;  4BDR A;  2I4C A;  1FTM A;  5TPA B;  3O29 A;  1SD3 A;  5H8F B;  5CMK A;  2HXW A;  3RUM A;  3B6W A;  2XXW A;  1ATG A;  4ZEF A;  5FHO A;  4Q30 B;  1M5F A;  1LFG A;  2H5Y A;  3RT6 B;  4JDF A;  4N07 A;  2ZNU A;  1MY4 A;  1P1N A;  2W7Y A;  1H45 A;  1JEU A;  1AH5 A;  2Y7P A;  2Y7R A;  2F7B A;  4KD5 A;  3CG1 A;  3P7I A;  4GLI A;  2HEU A;  4H6D A;  1EH3 A;  4YB6 A;  2ESN A;  1URS A;  3GBA A;  2AYS A;  1USY H;  2GH9 A;  3MZ1 A;  4ZZE A;  1XVY A;  4NED A;  4G4P A;  4DE8 A;  4EQ9 A;  4QFP A;  1MDP 1;  1BTJ A;  4MH5 A;  4ELP A;  2HZL A;  1PB9 A;  4KFQ A;  4YMB A;  1XOC A;  3CR9 A;  1Y3N A;  1XS5 A;  1QKA A;  1B05 A;  1MY0 A;  4QFN A;  4R9G A;  1BKA A;  2F7C A;  3C31 A;  3VV5 A;  4IO3 A;  3FXU A;  5EYF A;  3ZSF A;  3VVD A;  3EHU A;  4WKM A;  2HZK A;  1H76 A;  3PPN A;  3O6I A;  4OES A;  2VD2 A;  3PUW E;  2FNC A;  4F3G A;  4H65 A;  2QL3 A;  1KWH A;  5DEX A;  1N04 A;  3CI8 A;  3V5A A;  4OWD A;  1SQY A;  3K6X A;  4YB7 A;  4GVO A;  2P0S A;  4WEP A;  3JYR A;  3K6W A;  4AB5 A;  5L9O A;  3THI A;  2OLB A;  3LSW A;  1ZLQ A;  4JWX A;  1OVB A;  4H67 A;  3C34 A;  5CC2 A;  1RKM A;  5H8H A;  4LVQ A;  2ALU A;  1VFD A;  5H8N A;  1Y4C A;  3SER A;  3TZA A;  3BFU A;  4G77 A;  3B6Q A;  1XHY A;  3FVN A;  4DLD A;  3VLV A;  3C9H A;  3B7D A;  1NKX A;  2O68 A;  2XXH A;  2B3F A;  2ZYO A;  2A5T B;  1P1O A;  3S9N C;  3FVK A;  4THI A;  5IKB A;  3I3V A;  3TEL A;  3O6G A;  3MWB A;  1HSJ A;  4UAC A;  2AIX A;  2XX7 A;  2V3Q A;  3RQT A;  4NF6 A;  4JB7 A;  1S7Y A;  1NNK A;  2QS4 A;  3R26 A;  4MLQ A;  4NWD A;  5J1D A;  3HCQ A;  1B4H A;  4Z7E A;  3C32 A;  4BDO A;  3OXN A;  2H99 A;  3M3L A;  2F6P A;  1M5C A;  4OFL A;  1ZJL A;  1UTH B;  4NMY A;  3K1M A;  3MJN A;  4YKP A;  5LOM A;  3N6U A;  5M2V A;  3HHF A;  3MVZ A;  1PBP A;  1N3W A;  3TPA A;  5I56 B;  2ZNT A;  2YJP A;  2DE2 A;  5FTI A;  3LR1 A;  4U1Z A;  4U2R A;  1AL3 A;  3IB1 A;  4IO5 A;  2UVG A;  4OEV A;  2F5X A;  5DTB A;  3K1N A;  4M1V A;  1MQI A;  5I2K B;  3PD9 A;  4F18 A;  5FHM A;  3FXR A;  2D21 A;  1OLC A;  5KZT A;  3TMG A;  3UIF A;  3T93 B;  3K0V A;  4H5G A;  1OIB A;  3HHG A;  1DPP A;  1B58 A;  5CMM A;  3PPP A;  4X1B A;  5L9M A;  4EXK A;  4U1O A;  3V83 A;  3PU5 A;  2XXU A;  3MPL A;  1MXV A;  3MZB A;  5AA4 A;  4R9F A;  4MBP A;  5HBC A;  5CBS A;  5TP9 B;  3OMB A;  4OHN A;  3C33 A;  1A8E A;  1IQ7 A;  1MH4 A;  3KJT A;  1NH8 A;  2I3W A;  2Q2C A;  4ZEB A;  3MVW A;  1H44 A;  1AOV A;  1QUJ A;  1Q35 A;  1SYI A;  1A8F A;  3IOR A;  2IA4 A;  3RY3 A;  1B3E A;  2REJ A;  3FZV A;  4X48 A;  2Z8E A;  4GL8 A;  1D9Y A;  2Q9T A;  3KBR A;  1B3G A;  1J1N A;  3K00 A;  1FTJ A;  4RNS A;  3H6V A;  1Z7N E;  1FQF A;  2I49 A;  4OET A;  3UP9 A;  1US4 A;  5I57 B;  3MVX A;  3OOA A;  2G93 A;  2E0S A;  1URD A;  3QK6 A;  4KPT A;  3DM0 A;  3K4U A;  2O1M A;  4GF8 A;  5AA2 B;  1UIV A;  3T9U A;  2F8D A;  5B7D A;  3K6V A;  4KI0 E;  4ECF A;  1JET A;  4G68 B;  4YZZ A;  1MDQ A;  3MAM A;  3M8U A;  1NNT A;  3TYH A;  2H98 A;  5KCJ A;  1ZBM A;  3FIR A;  2V3T A;  4H8I A;  1R9L A;  1URG A;  5ICT A;  3TTM A;  1FTK A;  1WDN A;  5I58 A;  1M5B A;  2V3U A;  3R6U A;  3GLB A;  2DSF A;  2A5T A;  1WOD A;  1P1Q A;  1DOT A;  1IEJ A;  1POT A;  5BWJ A;  1DSN A;  1VR5 A;  3SEU A;  3B6T A;  4EUO A;  1OQG A;  3Q28 A;  3E3K A;  1JVX A;  3T96 B;  3S9E A;  2UYF A;  3CFL A;  2O69 A;  2V93 A;  2NWJ A;  2B65 A;  1N3X A;  3S9M C;  1USY E;  2Q2A A;  3FUZ A;  4NF8 B;  3CFZ A;  4IGT A;  4GIZ A;  3A3C A;  3T9X B;  3QIM A;  5DYH A;  2QMW A;  4Q0C A;  2WKY A;  3G3F A;  1B4Z A;  3TFL A;  3KZG A;  2Z22 A;  5BUU A;  3QAX A;  2LAO A;  4I9D A;  4G8N A;  3G3H A;  4IO4 A;  1AMF A;  1FTO A;  4U22 A;  1JW1 A;  1LAX A;  3IOV A;  3FJM A;  3Q26 A;  5DVI A;  1OQH A;  3TEP A;  3PUX E;  2OCU A;  4DDD A;  3IK6 B;  3OO8 A;  2REG A;  3LBS A;  2I0B A;  1A7L A;  5DVJ A;  3RTF B;  4ZZA A;  4RK9 A;  5I59 A;  1MXY A;  5I2N A;  4LON B;  4YIC A;  1R9Q A;  3KN7 A;  3TTN A;  3KSJ A;  3IOU A;  3KOS A;  1UTB A;  1P99 A;  2A5S A;  4KR5 A;  4F29 A;  3GZG A;  3TTR A;  4R2B A;  3OO9 A;  2IEE A;  3K1P A;  2ZYN A;  5AA1 A;  2HAV A;  3ILT B;  3MP1 A;  1QUI A;  5L9S A;  1B1H A;  1MXU A;  4U4S A;  1JW5 A;  3KFM A;  2OWT A;  3BBR A;  3DP8 A;  1UQW A;  1MH3 A;  1XVX A;  2F7A A;  3ZS6 A;  2ONR A;  4Q8R A;  3Q27 A;  1OVT A;  5JK4 A;  1SVX B;  4DCY A;  3UK4 A;  3G3G A;  4U23 A;  3CVG A;  3T9V A;  1B7H A;  1ZMG A;  3W9W A;  5ITO A;  2OWS A;  4ESW A;  3U93 A;  3A09 A;  2V84 A;  1MQG A;  4G8H A;  1P1U A;  5A5X B;  1O64 A;  4KCC A;  3IX1 A;  4H1X A;  3USD A;  4XKQ A;  4JWY A;  1VFE A;  4XXU A;  1H3D A;  4OZ9 A;  4P11 A;  2I58 A;  2ABH A;  1L5T A;  5H8S A;  1MM7 A;  3C36 A;  4JSO A;  5KDT A;  5L8D A;  2GHB A;  3W15 C;  4F3B A;  3D4C A;  3U92 A;  4PQJ A;  1ZTY A;  3QSL A;  2I3V A;  3IL1 B;  4FIM A;  2Y7W A;  4M4G A;  4H8J A;  3U1O A;  1B51 A;  2GHA A;  3QYT A;  3IO4 A;  4I8C A;  2Q89 A;  3CG3 A;  3I5O A;  3ONM A;  3UN6 A;  1BIY A;  1MY2 A;  2H25 A;  3QXM A;  4DXB A;  1IIW A;  4YMA A;  1A54 A;  4P0I A;  1MM6 A;  4BDN A;  1MS7 A;  3PPO A;  2R71 A;  1JEV A;  4LA9 A;  3OO6 A;  5CRY A;  3TAJ A;  2F35 A;  1CB6 A;  4LQ5 A;  2KLF A;  2GRV A;  1FQA A;  2QRY A;  3MQ9 A;  3FJ7 A;  4PFU A;  4IB2 A;  1SW2 A;  5JTY A;  4DXC A;  1B3F A;  2DWH A;  2XD2 A;  4GOT A;  4IY5 A;  3KGC A;  2O7I A;  3ZKK A;  1FW0 A;  1PB8 A;  3T9H B;  2UVH A;  3H4Z A;  1F9B A;  3VE1 B;  4F22 A;  3OEN A;  4N6P A;  4FEC A;  3SEV A;  2O1L A;  1JW4 A;  3O97 A;  1D3K A;  1TFD A;  4K3F A;  3IOT A;  4NF8 A;  5H8Q A;  3A3U A;  3MUQ A;  1MXX A;  1Y9U A;  1LST A;  4PE5 B;  1POY 1;  2PVU A;  4WXJ A;  4DZ1 A;  1MY1 A;  2BJJ X;  2Y7K A;  4C0R A;  4FED A;  3KOT A;  5K2X A;  1EZO A;  2Q88 A;  3W9V A;  1MXZ A;  4Z0I A;  4MFI A;  3C35 A;  3QUJ A;  3H6T A;  3OO7 A;  3M3K A;  5TPA A;  1B0H A;  2FYI A;  4PP0 A;  5H8F A;  4EQ7 A;  4TOZ A;  1BLF A;  2PYY A;  5CM6 A;  2PMS A;  3OEL A;  2ONK E;  3PUZ E;  4G8M A;  4HCY A;  2QS3 A;  4XKN A;  2HQ0 A;  3LSX A;  3F11 A;  3FAT A;  4WED A;  4YKJ A;  3UA8 A;  3HPI A;  1US5 A;  1JVY A;  2QPQ A;  3H3G A;  3ODB A;  3IB0 A;  2O84 X;  1BP5 A;  2NXO A;  1HSE A;  3OEM A;  3G3J A;  2DE3 A;  4O3B A;  1QVS A;  3TKD A;  2NOO A;  4LQ2 A;  3N6T A;  3SEX A;  4YKI A;  2XXT A;  2P2A A;  4POX A;  3SDF A;  1MQH A;  3MBP A;  3T22 A;  4ELR A;  3CSG A;  1IXG A;  3K2D A;  2DWI A;  2VHA A;  1CE2 A;  1P1W A;  4GFR A;  4IGR A;  1N7W A;  1DPE A;  3HO7 A;  4RJZ A;  3EQ1 A;  4GL0 A;  1MPB A;  5EHS A;  4X1D A;  4QFK A;  2Q8J A;  1QUK A;  4ELQ A;  4KYS A;  1B3H A;  3ZKL A;  2H9B A;  4ESX A;  4C1U A;  3FV2 A;  4LZ7 A;  4F2Q A;  2PT2 A;  3PUV E;  4OEN A;  1GVC A;  4F1Y A;  4QSC A;  3PD8 A;  5F7V A;  3PMX A;  1FQD A;  1LCT A;  1TT1 A;  4GQO A;  3IB2 A;  3MC2 A;  3PPR A;  1I6A A;  3FJG A;  2XHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...