3LR1A

The crystal structure of the tungstate abc transporter from geobacter sulfurreducens
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
232
Chain Sequence
NAEERLKMSTTTSTQDSGLLKVLLPPFEKKNNVKVDVIAVGTGQALKLGEAGDVDVVFVHARKLEDKFVADGFGVNRKDVMYNDFVIVGPKNDPAGIAKAKTAAEALKLLATKGATFISRGDKSGTHTKELDLWKSAGVDPKGNWYVEAGQGMGPVITMATERRAYTLTDRGTYNAFKGAKTDLVILFQGLFNPYGIMAVNPKKFPHVKYDLAMKLIDYVTGPEGLKIISDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungstate ABC transporter, periplasmic tungstate-binding pro
publication title The crystal structure of the tungstate ABC transporter from Geobacter sulfurreducens
rcsb
source organism Geobacter sulfurreducens
molecule tags Transport protein
total genus 65
structure length 232
sequence length 235
ec nomenclature
pdb deposition date 2010-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3lr1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3lr1A02
1M5EA 5I56A 3H4ZA 1HSJA 3TDJA 4EQ9A 1QUKA 4G68A 1ZU0A 2O6AA 2DWAA 4NF6A 4R72A 5AA4B 1QKAA 3IORA 5HPQA 3DP4A 5ICTA 5H8NA 5AE4A 2D5WA 3QUJA 3RY3A 4I1DA 1SD3A 3RGYA 2HAUA 3CR9A 2NUVA 2ZYOA 3JYRA 1SI1A 3MQ9A 3T96B 1MQGA 2F78A 3K1MA 4JBZA 4KR5A 2V3UA 3BKIB 2HXWA 2O1MA 1PBPA 3G3KA 3ILUB 3WAEA 3TTNA 2V3QA 1IXGA 1OMPA 3TUSA 2WKYA 5AA3A 5I59B 4ONYA 2PT1A 4ND9A 4F2OA 1J1NA 4FEBA 4R9GA 1NL5A 1Z7ME 3I5OA 4FE8A 4R6HA 4GQOA 3A3UA 4DXCA 1TWYA 2VP1A 4M1VA 1FQBA 2XX8A 2I6EA 4QF9A 1NMUA 1B1HA 4YB6A 1MY3A 4O3AA 4KI0E 3T9UA 3K1NA 3OD7A 2HZKA 2QSXA 4EDPA 2QRYA 3H6UA 1RKMA 4DCYA 2RC8A 2QMWA 3LSXA 2F6GA 3SERA 4X1BA 4H5FA 2GHAA 1VSOA 3CFXA 4G2ZA 4LATA 3TQWA 1ATGA 1PB9A 2HAVA 5ICQA 4RXLA 4JXIA 5L9MA 4WEDA 2YPNA 1IQ7A 1FQAA 2UXAA 3T22A 1MXYA 3G7WA 2OCUA 4R74A 1LFHA 3FD3A 2V25A 1LB9A 4TQUQ 1LLSA 1B32A 2Q2CA 3H6VA 3B6WA 2ZYKA 2F7AA 3CFZA 5CMBA 3VE1B 1FCKA 1ZTYA 1IXCA 3FXQA 3VFJA 4YMBA 5DT6A 4OVJA 4C0RA 1B7ZA 5CMMA 3PGFA 3K4UA 2D21A 4P0GA 1B0LA 4GWOA 4C1TA 1FTKA 3LC8A 4YKIA 3C4MA 2ONKE 2AYSA 1USYH 5I59A 3MBPA 4PE5B 3QAXA 4LZ5A 4JDFA 3TAJA 1JW5A 2B65A 3P7IA 4U4XA 4Q5TA 1GTKA 4GIZA 2XXHA 5H8HB 2DS9A 2REJA 3IB1A 1DOTA 2RC9A 5DVFA 2HQ0A 3K6XA 3F11A 1BKAA 5ITPA 2QS4A 3C36A 3PD8A 4WKMA 1NNFA 5CC2A 1H44A 1UTHA 4UA8A 3EHTA 4KD5A 4TLLB 4QFKA 2GH9A 3B7DA 3SKPA 3CSGA 3K6UA 5DVIA 5ISUA 5KDTB 4K3FA 1Y4TA 4R2FA 1N04A 3ODBA 3UA8A 1AL3A 4THIA 4RJZA 2DVZA 3H06B 2BJJX 4NEDA 4YB7A 1N84A 2DE2A 3TTMA 4IO3A 3I6VA 4POXA 3V89B 2XXUA 1RYXA 1US5A 3SESA 3N94A 3S9LC 4P0IA 2X26A 4OFLA 3IR1A 3KOTA 3K6VA 4R2BA 1YPNA 4GD5A 1QW0A 4N13A 3GBAA 3OSQA 4BDRA 1YTVA 2XXQA 2H98A 1URSA 1Y3PA 1S7YA 1ZIUA 3PUZE 3FVGA 1VFEA 1OLAA 3PPNA 4H8IA 3C34A 3S9NC 3V8XB 5J1DA 4NE4A 4E0XA 5DVJA 3TCFA 3FVKA 3SEUA 3M8UA 4BDQA 2XD2A 5H8HA 4LA9A 2Y84A 2OK2A 3MVYA 4U1OA 1SW4A 1YCJA 4ZECA 3ILTB 1UIUA 4AQ4A 4YICA 2H99A 3UP9A 2GFEA 4PETA 3DELB 4U2RA 4EQBA 2Z8EA 5L9SA 3K6WA 3T9HB 2QS1A 3N5LA 1A99A 4KQPA 2V84A 1NNPA 4IO5A 4DE8A 3PPRA 2ZYMA 1LGBC 3T93B 4YKJA 4OYVA 1B58A 3HHFA 2PMSA 5I56B 2I3VA 5KDTA 1OIBA 3HSTA 2RF1A 2H25A 2V93A 2QS2A 4R9FA 2KLFA 1WODA 3U8QA 4JSOA 5JTYA 3CG1A 3MUQA 3EHUA 3G3HA 1UIVA 3S4UA 4R75A 4NF6B 4YKKA 1F9BA 1QULA 1XS5A 3KN7A 5H8NB 3H3GA 3O9PA 4KCCA 2QL3A 2YLNA 5IAIA 4KYDA 3O6GA 2W7YA 5EHMA 1CB6A 3VDFA 3K2DA 2NVUB 3VXCA 1BP5A 2O51A 1N0TA 1MM6A 4C1UA 3U72A 3VV5A 3FGSA 2IA4A 2X7QA 5FHNA 1PB7A 4OTEA 4G8NA 4QFPA 3IB2A 5I57B 3PPOA 5FHOA 3FVNA 2VGQA 3EQ1A 1PDAA 1SVXB 2I49A 3ZKKA 3FXUA 4H5GA 3LBSA 1JNFA 1MQDA 1B0HA 3IO4A 4F1VA 3HO7A 3UN6A 1FQEA 3G3FA 4POWA 3QYTA 4NF8B 3Q27A 2E1SA 5AA1A 3O6IA 1T0KA 5FHMA 1H45A 2ESNA 3ZS6A 2DWHA 1B3LA 3MW0A 3H03A 3TTKA 1A8FA 2Y7WA 4HW8A 5AA2D 1N7WA 1XT8A 4NWDA 3Q29A 4JWOA 1R1NA 1SI0A 4G68C 3IOVA 1XVXA 3RT8A 1M5FA 3KN8A 3E13X 4U21A 1DTGA 4FEDA 4EXKA 4FATA 2Z8FA 3U93A 4OETA 3UK4A 3AXFA 1P1NA 2NXOA 1NNKA 2PYYA 2HFBA 1JVXA 3O2AA 4GL0A 4RK2A 2Q9TA 1SW1A 3Q25A 3USDA 3TEPA 5H8FB 3KFMA 1HSLA 3N26A 4XKPA 1Y1ZA 1AOVA 1DPEA 5TU0A 3RPWA 3FXRA 2REGA 4FECA 3MPLA 4F3SA 1P99A 3SEWA 2F7CA 4G8MA 3RLFE 1IUDA 1B3FA 3GZGA 1SDXA 3IK6B 1PB8A 3LUYA 4DXUA 1FW0A 2A5TB 4DXBA 4ZEBA 2I0BA 4MFIA 3TELA 5I57A 3K00A 1N3WA 2ANJA 2I4CA 1OVTA 2AL4A 3Q26A 3U92A 3K02A 2X7PA 4BDLA 3PMXA 3MZ1A 5ELVA 2VHAA 1Y3QA 3DP8A 2I3WA 5TPAB 4MF3A 3RTWB 4WEPA 4NF8A 3MVWA 3FV1A 3VLUA 3B6QA 5JEIA 3V83A 2XXYA 5TP9A 4F2QA 1LBBA 2R71A 4KYSA 4YB5A 4RPOA 4NMYA 1LAGE 5CMCA 5F7VA 1AH5A 4F22A 1XVYA 2P1SA 1M5DA 1UTHB 3IB0A 2RKMA 4FORA 4IY5A 4ZZEA 1Z7NE 4KFQA 4XKRA 3Q28A 4ESXA 5I58A 4RYAA 4DIGA 3RN8A 3R7XA 3KZGA 4QFOA 2I58A 4LZ8A 4LONB 4OFOA 4BDMA 1MPDA 5KCJA 4IGTA 3O28A 2NOOA 3C31A 1MXVA 3OELA 2DXYA 1NNTA 2PX1A 3UIFA 2YJPA 4MBPA 1LB8A 5H8FA 5H8QA 2HZLA 4ECFA 5EHSA 2O1LA 1XOCA 3KEIA 3R26A 5CM6A 3UGWA 2XXPA 3IJOB 2A5TA 1A55A 4MLVA 3TCHA 1VFDA 1Y4CA 4GVOA 4ISUA 5BUUA 3PV0E 3OMBA 4L17A 3IX1A 4F3PA 3CG3A 3EHSA 5CBRA 2ZXTA 3QIMA 5TPAA 1Y1MA 1B7UA 2M8CA 5AA2B 1EU8A 1Y3NA 3JV9A 4QSEA 1R9LA 2Q89A 3ONMA 1URGA 4GLIA 3HCQA 1H76A 1QUJA 3TTLA 4O3BA 3QXMA 1LFIA 3RUMA 4OEUA 3MPKA 1A8EA 3RQTA 1PBQA 1MH3A 3PMVA 1SW2A 3KJ7A 2G29A 1LFGA 3C35A 1MH4A 3O97A 2F35A 4FIMA 2CMOA 5DTBA 1B5JA 1ANFA 5JTYB 5I2NB 3OO6A 1ELJA 1SW5A 3CFLA 2FYIA 2B3BA 3HV1A 4KCDA 1IITA 4DZ1A 2OLBA 1US4A 1A40A 4LP2B 3PD9A 4ELOA 5ITOA 1MQIA 2QPQA 2AIXA 3FVOA 4P11A 4LQ5A 3R6UA 1S9TA 4ZS9A 3THIA 5B70A 3T9XB 2QS3A 5K2XA 2GHBA 3H6WA 3UORA 4ZE8A 1FTOA 3HN0A 4PFTA 1NH7A 1TFDA 1B3HA 4IY6A 4OERA 1JW1A 4KPTA 5FTHA 2RCAA 3HPIA 1I6BA 1MDP1 5CMKA 3A3CA 5AA2A 4QHQA 1PEBA 4Q30B 3VVDA 3TZAA 1GV8A 3A09A 5DYHA 4IO2A 1P1WA 2E0SA 3QK6A 4YKPA 2O68A 2DYXA 3MP6A 4GRKA 2R6GE 2RINA 4R6YA 1D9VA 3ECRA 3C33A 4F3BA 1GGGA 1OLCA 4ZEIA 1LCTA 1FQFA 2UVJA 1B40A 2O7IA 1EZPA 2A5SA 2XXTA 2DE3A 4HCYA 4X9TA 4X1DA 3FJMA 4JSDA 4MLQA 2H5YA 1MXUA 3IOUA 4ESWA 4F3GA 3BFUA 3IL1B 1A7LA 4NF5B 3QSLA 1MXWA 2Y7PA 2XXVA 1R9QA 1B3EA 3FJ7A 3LR1A 3C9HA 5I2NA 4OZ9A 4OEVA 2P0SA 2LAOA 3S9MC 1MQJA 4EXLA 1I6AA 5K2YA 4ZEFA 2DE4A 4F19A 1B5HA 4H8JA 4PFYA 5CBSA 1UQWA 1A54A 3N6TA 2Q88A 4HS7A 4Z7EA 4QFNA 1MY1A 4LUBA 1BLFA 1B5IA 1ZLQA 3PU5A 4H67A 4IB2A 3PMWA 1LBCA 3IO6A 4GF8A 3I3VA 4EF2A 3G3GA 1JEUA 3OEMA 1BIYA 2XXXA 1M5CA 4TLMB 2DSFA 3TYHA 3MP8A 1MG1A 3MVZA 2V3TA 4ZZAA 4U1ZA 4MH5A 3O29A 3W9VA 5KZTA 3FZVA 2VOZA 1JW4A 4XXUA 3FJGA 4RK9A 2XX9A 4QSDA 3LSWA 2DXRA 1VR5A 1IIWA 1NFTA 1SQYA 4IO6A 3MP1A 1N3XA 5I84A 3IOTA 4GXAA 1EZOA 5TP9B 1NKXA 4H1XA 4R6KA 4ZE9A 1Y9UA 3W15C 4ELPA 1N7XA 2AL5A 1UTBB 3LSFB 2Y7KA 2NWJA 5M2VA 1DSNA 1URDA 1WVJA 1I69A 3MZ9A 1FTMA 4NF5A 1B1XA 1IZ1A 3KJTA 3E4RA 2B3FA 2UVGA 4OESA 3SEVA 3ZKLA 4PQJA 1MQHA 1TFAA 3TMGA 1JVYA 1FTLA 1H3DA 5I58B 1MDQA 3TTRA 2DP8A 4KYEA 3VLWA 1AIVA 3EN3A 3RTFB 1O7TA 3TFLA 1ZKBA 4F1YA 4JWXA 5KCJB 4GFRA 3VLVA 5A5XA 4G4PA 4GL8A 4U4SA 1KWHA 5L9OA 2RCBA 2ZNUA 5H8QB 3U1OA 4YZZA 3K01A 4H65A 1ZMGA 2XX7A 1B46A 4RNSA 3VXBA 3FASA 4ZEKA 3CSBA 5FTIA 4U23A 3MWBA 3D4GA 4OMBA 2Z22A 1GR2A 4BLAA 3FATA 2G93A 3B6TA 2UYFA 3T9VA 2F5XA 1LCFA 2XHDA 4R73A 3T66A 2F36A 3QUFA 4HTGA 1OVBA 4N6PA 3MAMA 4YMAA 1Q35A 1TXFA 3RNNA 3TPAA 4NF4A 2QJEA 3SEYA 2ZYNA 2CZLA 4XIGQ 3MJNA 4XKQA 1CE2A 1I6QA 2I48A 1UTBA 2XD3A 3DLNA 4G77A 5BWJA 2HCAA 2OZZA 3WAFA 4UACA 4HCWA 1NH8A 2FNCA 5I2KB 3TODA 3CVGA 2H4IA 3SEXA 3LSLA 1XC1A 4OWDA 2Z23A 2UVIA 1JEVA 3M3FA 2FA7A 3KSJA 3IJXB 3G3IA 1S50A 4OQOA 3ZSFA 5CI5A 5HM4B 2ZNSA 4DLDA 4XTCQ 2ONRA 3KGCA 3S2VA 3H7MA 3VVEA 2F7BA 5AA4A 3OXNA 3PUVE 4F29A 1EZ9A 3GLBA 2P2AA 1D4NA 1LAFE 2Y7IA 3MC2A 3CIJA 1OQGA 2PT2A 3PUWE 1O64A 2OJTA 1AMFA 4NWCA 5F1QA 4E0WA 5L8DA 4Q8RA 3D4CA 4F18A 3KSXA 1VE4A 3BBRA 3OEKA 1B6HA 1R6ZA 4IO7A 2HEUA 1MY0A 3CRBA 1LAHE 2UYEA 3KBRA 2ABHA 3IAZA 1QVSA 2XXRA 1TT1A 4XKNA 3VVFA 4IGRA 2VD2A 1P1QA 2DQVA 1Q1KA 2Z8DA 1MY2A 1QKBA 4H0WA 3EF7A 1ZBMA 2OWSA 2DWJA 1B3GA 1FQCA 3L6HA 1BTJA 4Z0IA 1DMBA 4IO4A 1GVCA 2O84X 3MZBA 4GOTA 4OENA 4OXVA 3IOWA 3EPEA 3O6HA 2I4BA 5I2KA 2O7UA 1FQDA 3N6UA 4QFLA 2QMXA 2ZMBA 4U22A 1POTA 4F39A 1MPCA 2F97A 4JB7A 3C32A 4EQ7A 5EYFA 2OWTA 1II5A 1IEJA 2IEEA 4PP0A 1M5BA 1USYE 4YU0A 1EH3A 3K1PA 1MXZA 2DWIA 2RC7A 3E3KA 4EF1A 4F1UA 1QJMA 1L5TA 4YAHX 4H6DA 4G8HA 5JK4A 3M3KA 2ZNTA 3PPQA 4BDOA 3FIRA 1LSTA 2D3IA 5DEXB 3KG2A 2Y7RA 4JWYA 1B51A 3L6GA 1B4ZA 1N76A 1YAEA 4PFUA 2PBWA 3TQLA 4I9DA 2I0CA 3OENA 4I8CA 3O66A 4PFWA 5CRYA 1PC3A 4TOZA 1RYOA 1B7HA 3SDFA 4OFJA 3W9WA 3KOSA 4FAJA 4N07A 4NTLA 4EUOA 3OSRA 2UVHA 4ZDMA 1FTJA 1MXXA 4OHNA 3DM0A 1SYIA 2Q8JA 3FV2A 2R9JA 4ELQA 3E9XA 2ONSA 4WXJA 4F31B 2Q2AA 1HSEA 1B4HA 3MVXA 1XHYA 4FJPA 3K0VA 3M3LA 2XXWA 1O63A 5LOMA 1ZJLA 3GBBA 1SYHA 4QRZA 1P1UA 2DVCA 2F8DA 4QSCA 2ALUA 1JETA 1WDNA 1D9YA 1POY1 3PUXE 3OO7A 3FUZA 2OBGA 4RA1A 4Q0CA 4GXSB 3HHGA 3G3JA 1B05A 3OO8A 3KN3A 1B52A 3CI8A 4G68B 1Y20A 5A5XB 4KHZE 2PVUA 2F6PA 1LAXA 1B2HA 5DEXA 2THIA 4ZEDA 4LVQA 3OOAA 3SETA 2GRVA 4I62A 1DPPA 2DOJA 3OO9A 1P1OA 3V5AA 2F34A 3RT6B 3PPPA 4RPNA 4AB6A 3U94A 4DCXA 4DDDA 1IXHA 2VD3A 4ELRA 5B7DA 1DTZA 1D3KA 1MS7A 4AB5A 3TCGA 2XXIA 4LZ7A 3JZJA 1OQHA 4BDNA 4RY1A 5IKBA 3DP6A 5HBCA 4NF4B 1MY4A 4M4GA 3PUYE 2O69A 2H9BA 4O3CA 4X48A 1SBPA 4LQ2A 3S9EA 1QUIA 1JQFA 3GXAA 1MM7A 3H6TA 1MPBA 1MRPA 1H43A 1B9JA 1IXIA 3BFTA 3TKDA 5H8SA
chains in the Genus database with same CATH superfamily
2ZZVA 2B4LA 1M5EA 3KC1A 5I56A 4N15A 3H4ZA 4MCOA 1HSJA 3TDJA 4EQ9A 1KA1A 1QUKA 4G68A 1ZU0A 2O6AA 4OVPA 1XI6A 2DWAA 4PF6A 4NF6A 4R72A 5AA4B 1QKAA 3IORA 5HPQA 3DP4A 1FPJA 5ICTA 5H8NA 5AE4A 2OWZA 2D5WA 3QUJA 3RY3A 4I1DA 1SD3A 3RGYA 2HAUA 3CR9A 1NV6A 2NUVA 2ZYOA 3JYRA 1SI1A 3MQ9A 3T96B 1MQGA 2F78A 3K1MA 4JVDA 2Q74A 4JBZA 4N6KA 4KR5A 2V3UA 3BKIB 2Y5KA 1FSAA 2HXWA 1FJ6A 4OVQA 2O1MA 1PBPA 3G3KA 3ILUB 3WAEA 3TTNA 2V3QA 1IXGA 1OMPA 3ISPA 3TUSA 2WKYA 4DI3D 5AA3A 5I59B 4ONYA 2PT1A 4ND9A 4F2OA 1J1NA 4FEBA 4R9GA 1NL5A 1Z7ME 3I5OA 4FE8A 4R6HA 2PFYA 4GQOA 3A3UA 1FBEA 4DXCA 1TWYA 2VP1A 4M1VA 1FBCA 1FQBA 1FTAA 2XX8A 2I6EA 4X04A 4QF9A 3GYYA 1NMUA 1B1HA 4YB6A 4OA4A 1MY3A 4O3AA 4KI0E 3T9UA 3K1NA 3OD7A 2HZKA 2QSXA 4EDPA 2QRYA 3H6UA 1RKMA 4DCYA 2RC8A 2QMWA 3LSXA 1FBPA 4GBVA 2F6GA 3SERA 4X1BA 4H5FA 2GHAA 1VSOA 3CFXA 4G2ZA 4LATA 3TQWA 1ATGA 3KC0A 5I5PA 1PB9A 2HAVA 5ICQA 4RXLA 4JXIA 5L9MA 1IMDA 4WEDA 2YPNA 1IQ7A 1FQAA 2UXAA 4I3EA 1MXYA 3T22A 3G7WA 5EQ7A 2OCUA 2BJIA 4R74A 1LFHA 3FD3A 1NV3A 2V25A 1LB9A 4TQUQ 4GBWA 1LLSA 1B32A 2Q2CA 3H6VA 3B6WA 2ZYKA 2F7AA 3CFZA 5CMBA 1IMEA 3VE1B 1FCKA 1ZTYA 1IXCA 3FXQA 3VFJA 4YMBA 5DT6A 4OVJA 4C0RA 2GQ1A 1B7ZA 5CMMA 3PGFA 3K4UA 2D21A 1KA0A 1NV7A 4O7MA 4AS4A 4P0GA 1B0LA 4GWOA 4PC9A 4C1TA 1FTKA 3LC8A 4YKIA 3C4MA 2ONKE 2AYSA 2WYKA 1USYH 5I59A 3MBPA 4PE5B 3QAXA 4LZ5A 1FPBA 2PCRA 4JDFA 3TAJA 1JW5A 2B65A 3P7IA 4U4XA 3FXBA 4Q5TA 1GTKA 4GIZA 2XWOA 2XXHA 4I3YA 5H8HB 2DS9A 2REJA 3IB1A 1DOTA 2RC9A 5DVFA 2HQ0A 5ET7A 3K6XA 4HXVA 3F11A 1BKAA 4OVSA 4N4UA 5ITPA 4XFEA 2QS4A 3C36A 3PD8A 4WKMA 1NNFA 4PGPA 5CC2A 1H44A 4PCDA 1UTHA 4UA8A 3EHTA 4KD5A 4TLLB 4QFKA 2QFLA 2GH9A 3B7DA 3SKPA 3CSGA 3K6UA 4PF8A 5DVIA 5ISUA 5KDTB 4PAKA 4K3FA 1Y4TA 4R2FA 1N04A 2QVUA 3ODBA 3UA8A 1AL3A 1JP4A 4THIA 4RJZA 2DVZA 3H06B 2BJJX 4NEDA 4YB7A 5I7IA 1N84A 4MAGA 2DE2A 3TTMA 4IO3A 3I6VA 4POXA 3V89B 2XXUA 1RYXA 1US5A 2P3NA 3SESA 3N94A 3S9LC 4P0IA 2X26A 4OFLA 5ET5A 3IR1A 3KOTA 3K6VA 3T1BA 4R2BA 1YPNA 3CHGA 4GD5A 1QW0A 4N13A 3GBAA 3OSQA 1FBHA 4BDRA 1YTVA 2XXQA 2H98A 1URSA 1Y3PA 1S7YA 4OANA 1ZIUA 3PUZE 3FVGA 1VFEA 1OLAA 3PPNA 1RDYA 4H8IA 3C34A 3S9NC 3V8XB 5J1DA 4NE4A 4E0XA 5DVJA 3TCFA 3FVKA 3SEUA 3M8UA 4BDQA 2XD2A 5H8HA 5IZ3B 4N8YA 4LA9A 2Y84A 4N6DA 2OK2A 3MVYA 4U1OA 1SW4A 2FHYA 1YCJA 4ZECA 3ILTB 1YZ0A 1UIUA 4AQ4A 4YICA 2H99A 3UP9A 2GFEA 4PETA 3DELB 4PDHA 4U2RA 4EQBA 4GWUA 2Z8EA 5L9SA 3K6WA 3T9HB 2QS1A 3N5LA 1A99A 4KQPA 2V84A 1NNPA 4IO5A 4DE8A 3PPRA 2ZYMA 1LGBC 3T93B 4YKJA 4OYVA 1B58A 3HHFA 2PMSA 5I56B 1EYIA 2FVZA 2I3VA 5KDTA 1OIBA 3HSTA 2RF1A 4O8MA 2H25A 2V93A 4NN3A 2QS2A 4R9FA 2KLFA 1WODA 2KQZA 3U8QA 4JSOA 5JTYA 3CG1A 3MUQA 3EHUA 1IMBA 3G3HA 1UIVA 3S4UA 4R75A 4DI4B 4NF6B 5IZZA 5LDZA 4YKKA 1F9BA 1QULA 1XS5A 4MNCA 3KN7A 5H8NB 3H3GA 1FPFA 3O9PA 4KCCA 2QL3A 2YLNA 5IAIA 4KYDA 3O6GA 2W7YA 5EHMA 4PDDA 1CB6A 3VDFA 3K2DA 2NVUB 3VXCA 1BP5A 2O51A 1N0TA 1MM6A 4P47A 2XXKA 4C1UA 3U72A 3VV5A 4HE1A 3FGSA 2IA4A 4H46A 2X7QA 5FHNA 1PB7A 4OTEA 4G8NA 4QFPA 3IB2A 5I57B 3PPOA 5FHOA 3BIGA 3FVNA 2VGQA 1AWBA 3EQ1A 1FJ9A 1PDAA 4PFBA 1SVXB 2I49A 3ZKKA 3B50A 3FXUA 1NV4A 4H5GA 3LBSA 1JNFA 1MQDA 3FBPA 1B0HA 3IO4A 4F1VA 3HO7A 3UN6A 1FQEA 3G3FA 4POWA 3QYTA 4NF8B 3Q27A 2E1SA 4PAFA 5AA1A 3O6IA 1T0KA 5FHMA 1H45A 2ESNA 4MEVA 3ZS6A 2DWHA 1B3LA 3MW0A 3H03A 3TTKA 1A8FA 2Y7WA 4HW8A 5AA2D 2XWIA 1N7WA 1XT8A 4NWDA 3Q29A 4JWOA 1R1NA 4HE2A 2HHMA 1IMAA 1SI0A 4G68C 3IOVA 1XVXA 3RT8A 1M5FA 3KN8A 3E13X 4U21A 1DTGA 4FEDA 4EXKA 4FATA 2Z8FA 3U93A 4GX6A 4OETA 5ET8A 3UK4A 3AXFA 1P1NA 2NXOA 1NNKA 2VT5A 2PYYA 2HFBA 1JVXA 3O2AA 4GL0A 1EYKA 4P1EA 4RK2A 2Q9TA 1SW1A 3Q25A 3USDA 3KBZA 3TEPA 5H8FB 3KFMA 1HSLA 1LBWA 3N26A 4XKPA 1Y1ZA 1AOVA 1DPEA 5TU0A 3RPWA 3FXRA 2CZKA 2REGA 4FECA 3MPLA 4F3SA 1P99A 3SEWA 2F7CA 2XWVA 4MJOA 4G8MA 3RLFE 1IUDA 5A5LA 4N81A 1B3FA 3GZGA 1SDXA 3IK6B 1PB8A 3LUYA 4DXUA 1FW0A 2A5TB 4O7IA 4DXBA 2JJKA 4ZEBA 2I0BA 4MFIA 3TELA 5I57A 3K00A 1N3WA 2ANJA 2P3VA 2I4CA 1OVTA 2AL4A 3Q26A 1NUZA 3U92A 1NI9A 3K02A 2X7PA 4BDLA 4NG7A 3PMXA 3MZ1A 4XF5A 5ELVA 1FPEA 2VHAA 1Y3QA 3DP8A 2I3WA 5TPAB 4MF3A 3RTWB 4WEPA 4NF8A 3MVWA 3FV1A 4O94A 3VLUA 3B6QA 5JEIA 3V83A 2XXYA 5TP9A 4F2QA 1LBBA 2R71A 4KYSA 4YB5A 4RPOA 4NMYA 2FIEA 1LAGE 4NAPA 5CMCA 5F7VA 1AH5A 4F22A 1XVYA 2P1SA 1M5DA 1UTHB 4PTKA 3IB0A 2RKMA 4FORA 4IY5A 4ZZEA 4NF0A 1Z7NE 4KFQA 4XKRA 3Q28A 4ESXA 2Q8MA 5I58A 4RYAA 4DIGA 3RN8A 4G61A 3PTYA 3R7XA 3KZGA 4QFOA 2I58A 4LZ8A 4LONB 4MMPA 4OFOA 4BDMA 1MPDA 5KCJA 4IGTA 3O28A 2NOOA 3C31A 1MXVA 3OELA 2DXYA 1NNTA 4KXPA 2PX1A 3UIFA 2YJPA 4MBPA 1LB8A 5H8FA 4LN5A 5H8QA 2HZLA 4OVTA 4ECFA 5EHSA 2O1LA 1XOCA 2PFZA 3KEIA 3R26A 5CM6A 3UGWA 2XXPA 3IJOB 2A5TA 1A55A 4MLVA 5FBPA 3TCHA 1VFDA 1Y4CA 4GVOA 4ISUA 1BK4A 5BUUA 3PV0E 3OMBA 4L17A 3IX1A 4F3PA 3A29A 3CG3A 3EHSA 5CBRA 2ZXTA 3QIMA 2FIXA 1Y1MA 2VPOA 5TPAA 1B7UA 5IM2A 1KZ8A 2M8CA 5AA2B 1EU8A 1Y3NA 3JV9A 3MYUA 1R9LA 4QSEA 2Q89A 3ONMA 1URGA 4GLIA 3HCQA 1H76A 1QUJA 2KR0A 3TTLA 3LV0A 4O3BA 2QVRA 3QXMA 1LFIA 5ESYA 5LTCA 1FBFA 3RUMA 4OEUA 4UABA 3MPKA 1A8EA 4N17A 3RQTA 1PBQA 1MH3A 3PMVA 1SW2A 3SZPA 3KJ7A 2G29A 2WEFA 2QVVA 1LFGA 3C35A 1MH4A 3E79A 3O97A 2F35A 4FIMA 4GX4A 2CMOA 5DTBA 1B5JA 1ANFA 3NOHA 5ET6A 5JTYB 5I2NB 3OO6A 1ELJA 1SW5A 3CFLA 2FYIA 2B3BA 3HV1A 3HFUA 4KCDA 1IITA 4GWWA 4DZ1A 2OLBA 1US4A 1A40A 4LP2B 2VPNA 3PD9A 4ELOA 5ITOA 1MQIA 2QPQA 2AIXA 3FVOA 4P11A 4LQ5A 3R6UA 1S9TA 4PE3A 1QGXA 4ZS9A 3THIA 5B70A 3T9XB 2QS3A 3RYDA 5K2XA 2GHBA 2DDKA 3H6WA 3UORA 4ZE8A 1FTOA 3HN0A 4PFTA 5IGAA 1NH7A 1TFDA 1B3HA 4IY6A 4OERA 1JW1A 4XEQA 4KPTA 5FTHA 2RCAA 3HPIA 1IMFA 1I6BA 1SPIA 1MDP1 5CMKA 3A3CA 5AA2A 4QHQA 4P8BA 1PEBA 4PGNA 4Q30B 3VVDA 3TZAA 1GV8A 3A09A 5DYHA 4IO2A 1Q9DA 1P1WA 2E0SA 3QK6A 4YKPA 2O68A 2DYXA 3MP6A 4MNIA 4GRKA 2R6GE 2RINA 4R6YA 1IMCA 1D9VA 3ECRA 3LUZA 3C33A 4F3BA 1GGGA 1OLCA 4ZEIA 1LCTA 4MX6A 1FQFA 2UVJA 1B40A 2O7IA 3ROJA 1EZPA 4X8RA 2CZHA 2A5SA 2XXTA 2DE3A 4HCYA 4PBQA 4X9TA 4X1DA 3FJMA 4JSDA 4MLQA 1FBGA 1NV5A 2H5YA 1MXUA 3IOUA 4ESWA 4F3GA 3BFUA 3IL1B 1A7LA 4GWYA 4NF5B 3QSLA 1MXWA 2Y7PA 2XXVA 1R9QA 1B3EA 3FJ7A 4P1LA 4QXDA 3LR1A 3C9HA 5I2NA 4OZ9A 4OEVA 5EQ8A 2P0SA 2LAOA 3S9MC 1MQJA 4EXLA 1I6AA 5K2YA 4ZEFA 2DE4A 4F19A 1B5HA 4H8JA 4PFYA 5CBSA 1UQWA 1A54A 3N6TA 2Q88A 4HS7A 4N91A 4OVRA 4Z7EA 4QFNA 1MY1A 4LUBA 1BLFA 1B5IA 1ZLQA 3PU5A 4H67A 4IB2A 3PMWA 1LBCA 3IO6A 4GF8A 3I3VA 4EF2A 3G3GA 1LBYA 1JEUA 1YYZA 3OEMA 1BIYA 2XXXA 1M5CA 4TLMB 2DSFA 3MSTA 3TYHA 3MP8A 1MG1A 3MVZA 4P3LA 2V3TA 4NX1A 4ZZAA 4U1ZA 4MH5A 3O29A 3W9VA 5KZTA 3FZVA 4MHFA 2VOZA 1JW4A 4XXUA 3FJGA 2CEYA 4RK9A 2XX9A 4QSDA 1K9YA 3LSWA 2DXRA 1VR5A 1IIWA 4PAIA 1NFTA 1EYJA 1SQYA 4IO6A 1D9QA 3MP1A 1N3XA 5I84A 3IOTA 4GXAA 1EZOA 5TP9B 1NKXA 4H1XA 4R6KA 4ZE9A 1Y9UA 3W15C 4ELPA 1N7XA 2AL5A 1UTBB 3LSFB 2Y7KA 2NWJA 5M2VA 1DSNA 1URDA 1G0IA 1WVJA 1I69A 3MZ9A 1FTMA 4NF5A 2HPGA 1B1XA 1IZ1A 4AS5A 3KJTA 3E4RA 3T0JA 2B3FA 2UVGA 4OESA 3SEVA 3ZKLA 4PQJA 1MQHA 1TFAA 3TMGA 1JVYA 1FTLA 1H3DA 5I58B 1MDQA 3TTRA 2DP8A 4KYEA 3VLWA 1LBZA 1AIVA 3EN3A 3RTFB 1O7TA 3TFLA 1ZKBA 1LEVA 2R8TA 4F1YA 4JWXA 5KCJB 4GWXA 4GFRA 3VLVA 5A5XA 4FBPA 4G4PA 4NGUA 2WBBA 4GL8A 4U4SA 1KWHA 3RPLB 5L9OA 2ZZXA 2RCBA 2ZNUA 4MNPA 5H8QB 3U1OA 4YZZA 3K01A 4H65A 1ZMGA 2XX7A 1B46A 4RNSA 3FASA 3VXBA 4ZEKA 3CSBA 5FTIA 4U23A 3MWBA 3D4GA 4OMBA 2Z22A 1GR2A 4BLAA 3FATA 2F3DA 2G93A 3B6TA 2UYFA 3T9VA 2CEXA 2F5XA 1LCFA 2XHDA 5J16A 4R73A 3T66A 2F36A 3QUFA 2WBDA 4HTGA 1OVBA 4N6PA 3MAMA 4YMAA 1Q35A 1TXFA 3RNNA 3TPAA 4NF4A 1FRPA 2QJEA 3SEYA 2ZYNA 2CZLA 4XIGQ 3MJNA 4XKQA 1CE2A 1I6QA 2I48A 1UTBA 1RDZA 1DCUA 1FPIA 2XD3A 3DLNA 4G77A 5BWJA 2HCAA 2HXRA 2OZZA 3B8BA 3WAFA 4UACA 4HCWA 1NH8A 2FNCA 5I2KB 3TODA 3CVGA 2H4IA 3SEXA 3LSLA 1XC1A 4OWDA 2Z23A 2UVIA 4HE0A 1JEVA 3M3FA 3E78A 2B4MA 2FA7A 3KSJA 3IJXB 3G3IA 1S50A 4OQOA 1DK4A 3ZSFA 5CI5A 5HM4B 2ZNSA 4DLDA 4XTCQ 2ONRA 3KGCA 4N8GA 3S2VA 3H7MA 3VVEA 2F7BA 5AA4A 3RPLA 3OXNA 3PUVE 4F29A 1EZ9A 3GLBA 2P2AA 1D4NA 1LAFE 2Y7IA 3MC2A 3CIJA 1FBDA 1OQGA 2PT2A 3PUWE 1O64A 2OJTA 1AMFA 4NWCA 1RDXA 5F1QA 4E0WA 5L8DA 4Q8RA 5EQAA 3D4CA 4F18A 3KSXA 2L5VA 1NV2A 1VE4A 3BBRA 3OEKA 1B6HA 1R6ZA 4IO7A 2HEUA 1MY0A 3CRBA 1LAHE 2UYEA 2WYPA 3KBRA 2ABHA 4GX3A 3IAZA 5EYHA 1QVSA 2XXRA 1TT1A 4XKNA 4H45A 1LBVA 3VVFA 4IGRA 2VD2A 2XA5A 1P1QA 5T3JA 2DQVA 1Q1KA 2Z8DA 1FPLA 1MY2A 1QKBA 4H0WA 3EF7A 1ZBMA 2OWSA 2DWJA 1B3GA 1FQCA 3L6HA 1BTJA 4Z0IA 1DMBA 4IO4A 4PBHA 2O84X 3MZBA 4GOTA 4OENA 1GVCA 4OXVA 3IOWA 3D1RA 3EPEA 3O6HA 2I4BA 4MIJA 5I2KA 2O7UA 1FQDA 3N6UA 4PFRA 4QFLA 2QMXA 2ZMBA 4U22A 1POTA 1K9ZA 4F39A 1MPCA 5IZ1A 2F97A 1INPA 4JB7A 3C32A 4EQ7A 5EYFA 2OWTA 1II5A 1IEJA 2IEEA 4PP0A 1M5BA 3QMFA 2F3BA 1USYE 1FPGA 4YU0A 1EH3A 3K1PA 2ZZWA 1MXZA 2DWIA 2RC7A 3E3KA 4EF1A 4F1UA 1QJMA 1L5TA 4YAHX 4H6DA 1NUWA 4G8HA 5JK4A 3M3KA 2ZNTA 3PPQA 4BDOA 3FIRA 1LSTA 2D3IA 5DEXB 3KG2A 2Y7RA 4JWYA 4P9KA 1B51A 3L6GA 3U65A 1B4ZA 2XWKA 1N76A 1YAEA 4PFUA 2PBWA 3TQLA 4I9DA 2I0CA 3OENA 4GWZA 4GWSA 4I8CA 3O66A 4PFWA 5CRYA 1PC3A 4TOZA 1RYOA 1B7HA 3SDFA 4OFJA 3W9WA 3KOSA 5EYGA 4FAJA 4N07A 4NTLA 4EUOA 3OSRA 1LBXA 2UVHA 4ZDMA 1FTJA 1MXXA 4OHNA 3DM0A 1SYIA 2Q8JA 3FV2A 5DW8A 2R9JA 4ELQA 3E9XA 2ONSA 4WXJA 4F31B 2Q2AA 1HSEA 1B4HA 4PFIA 3MVXA 1XHYA 4FJPA 3K0VA 3M3LA 1DBZA 2XXWA 1O63A 5LOMA 1ZJLA 3GBBA 1SYHA 4QRZA 1P1UA 2DVCA 2F8DA 4QSCA 2ALUA 1JETA 1WDNA 1D9YA 1POY1 4JVCA 3PUXE 3OO7A 3FUZA 2OBGA 3EKIA 4RA1A 4Q0CA 4GXSB 3HHGA 3G3JA 1B05A 3OO8A 5EQ9A 3KN3A 1B52A 2WX9A 3CI8A 4G68B 1Y20A 4NHBA 5A5XB 2Y5LA 4KHZE 2CZIA 2PVUA 2F6PA 1LAXA 3BIHA 1B2HA 5DEXA 4QBAA 2THIA 4ZEDA 4LVQA 3OOAA 3SETA 2GRVA 4I62A 1DPPA 2DOJA 3OO9A 1P1OA 3V5AA 2F34A 1NV0A 4IR8A 3RT6B 3PPPA 4RPNA 4AB6A 3U94A 4DCXA 4DDDA 1IXHA 5F24A 2VD3A 1G0HA 1NUXA 4ELRA 5B7DA 1FPKA 1DTZA 1VDWA 1D3KA 4P56A 1MS7A 4AB5A 2MKZA 2OX3A 3TCGA 5I3SA 2XXIA 1CNQA 4LZ7A 3JZJA 1OQHA 5IZ3A 1NUYA 3IFCA 4BDNA 3IFAA 4RY1A 5IKBA 3DP6A 5HBCA 4NQ8A 4NF4B 4I40A 1MY4A 4M4GA 3PUYE 2V4CA 2O69A 1FPDA 2H9BA 4O3CA 4X48A 1YXIA 1SBPA 4LQ2A 3S9EA 1QUIA 1JQFA 3GXAA 1NV1A 1MM7A 3H6TA 1MPBA 1MRPA 4JVIA 1H43A 1B9JA 1IXIA 3BFTA 3TKDA 2FBPA 5H8SA
chains in the Genus database with same CATH topology
1M5EA 5I56A 3H4ZA 1HSJA 3TDJA 4EQ9A 1QUKA 4G68A 1ZU0A 2O6AA 2DWAA 4NF6A 4R72A 5AA4B 1QKAA 3IORA 5HPQA 3DP4A 5ICTA 5H8NA 5AE4A 2D5WA 3QUJA 3RY3A 4I1DA 1SD3A 3RGYA 2HAUA 3CR9A 2NUVA 2ZYOA 3JYRA 1SI1A 3MQ9A 3T96B 1MQGA 2F78A 3K1MA 4JBZA 4KR5A 2V3UA 3BKIB 2HXWA 2O1MA 1PBPA 3G3KA 3ILUB 3WAEA 3TTNA 2V3QA 1IXGA 1OMPA 3TUSA 2WKYA 5AA3A 5I59B 4ONYA 2PT1A 4ND9A 4F2OA 1J1NA 4FEBA 4R9GA 1NL5A 1Z7ME 3I5OA 4FE8A 4R6HA 4GQOA 3A3UA 4DXCA 1TWYA 2VP1A 4M1VA 1FQBA 2XX8A 2I6EA 4QF9A 1NMUA 1B1HA 4YB6A 1MY3A 4O3AA 4KI0E 3T9UA 3K1NA 3OD7A 2HZKA 2QSXA 4EDPA 2QRYA 3H6UA 1RKMA 4DCYA 2RC8A 2QMWA 3LSXA 2F6GA 3SERA 4X1BA 4H5FA 2GHAA 1VSOA 3CFXA 4G2ZA 4LATA 3TQWA 1ATGA 1PB9A 2HAVA 5ICQA 4RXLA 4JXIA 5L9MA 4WEDA 2YPNA 1IQ7A 1FQAA 2UXAA 3T22A 1MXYA 3G7WA 2OCUA 4R74A 1LFHA 3FD3A 2V25A 1LB9A 4TQUQ 1LLSA 1B32A 2Q2CA 3H6VA 3B6WA 2ZYKA 2F7AA 3CFZA 5CMBA 3VE1B 1FCKA 1ZTYA 1IXCA 3FXQA 3VFJA 4YMBA 5DT6A 4OVJA 4C0RA 1B7ZA 5CMMA 3PGFA 3K4UA 2D21A 4P0GA 1B0LA 4GWOA 4C1TA 1FTKA 3LC8A 4YKIA 3C4MA 2ONKE 2AYSA 1USYH 5I59A 3MBPA 4PE5B 3QAXA 4LZ5A 4JDFA 3TAJA 1JW5A 2B65A 3P7IA 4U4XA 4Q5TA 1GTKA 4GIZA 2XXHA 5H8HB 2DS9A 2REJA 3IB1A 1DOTA 2RC9A 5DVFA 2HQ0A 3K6XA 3F11A 1BKAA 5ITPA 2QS4A 3C36A 3PD8A 4WKMA 1NNFA 5CC2A 1H44A 1UTHA 4UA8A 3EHTA 4KD5A 4TLLB 4QFKA 2GH9A 3B7DA 3SKPA 3CSGA 3K6UA 5DVIA 5ISUA 5KDTB 4K3FA 1Y4TA 4R2FA 1N04A 3ODBA 3UA8A 1AL3A 4THIA 4RJZA 2DVZA 3H06B 2BJJX 4NEDA 4YB7A 1N84A 2DE2A 3TTMA 4IO3A 3I6VA 4POXA 3V89B 2XXUA 1RYXA 1US5A 3SESA 3N94A 3S9LC 4P0IA 2X26A 4OFLA 3IR1A 3KOTA 3K6VA 4R2BA 1YPNA 4GD5A 1QW0A 4N13A 3GBAA 3OSQA 4BDRA 1YTVA 2XXQA 2H98A 1URSA 1Y3PA 1S7YA 1ZIUA 3PUZE 3FVGA 1VFEA 1OLAA 3PPNA 4H8IA 3C34A 3S9NC 3V8XB 5J1DA 4NE4A 4E0XA 5DVJA 3TCFA 3FVKA 3SEUA 3M8UA 4BDQA 2XD2A 5H8HA 4LA9A 2Y84A 2OK2A 3MVYA 4U1OA 1SW4A 1YCJA 4ZECA 3ILTB 1UIUA 4AQ4A 4YICA 2H99A 3UP9A 2GFEA 4PETA 3DELB 4U2RA 4EQBA 2Z8EA 5L9SA 3K6WA 3T9HB 2QS1A 3N5LA 1A99A 4KQPA 2V84A 1NNPA 4IO5A 4DE8A 3PPRA 2ZYMA 1LGBC 3T93B 4YKJA 4OYVA 1B58A 3HHFA 2PMSA 5I56B 2I3VA 5KDTA 1OIBA 3HSTA 2RF1A 2H25A 2V93A 2QS2A 4R9FA 2KLFA 1WODA 3U8QA 4JSOA 5JTYA 3CG1A 3MUQA 3EHUA 3G3HA 1UIVA 3S4UA 4R75A 4NF6B 4YKKA 1F9BA 1QULA 1XS5A 3KN7A 5H8NB 3H3GA 3O9PA 4KCCA 2QL3A 2YLNA 5IAIA 4KYDA 3O6GA 2W7YA 5EHMA 1CB6A 3VDFA 3K2DA 2NVUB 3VXCA 1BP5A 2O51A 1N0TA 1MM6A 4C1UA 3U72A 3VV5A 3FGSA 2IA4A 2X7QA 5FHNA 1PB7A 4OTEA 4G8NA 4QFPA 3IB2A 5I57B 3PPOA 5FHOA 3FVNA 2VGQA 3EQ1A 1PDAA 1SVXB 2I49A 3ZKKA 3FXUA 4H5GA 3LBSA 1JNFA 1MQDA 1B0HA 3IO4A 4F1VA 3HO7A 3UN6A 1FQEA 3G3FA 4POWA 3QYTA 4NF8B 3Q27A 2E1SA 5AA1A 3O6IA 1T0KA 5FHMA 1H45A 2ESNA 3ZS6A 2DWHA 1B3LA 3MW0A 3H03A 3TTKA 1A8FA 2Y7WA 4HW8A 5AA2D 1N7WA 1XT8A 4NWDA 3Q29A 4JWOA 1R1NA 1SI0A 4G68C 3IOVA 1XVXA 3RT8A 1M5FA 3KN8A 3E13X 4U21A 1DTGA 4FEDA 4EXKA 4FATA 2Z8FA 3U93A 4OETA 3UK4A 3AXFA 1P1NA 2NXOA 1NNKA 2PYYA 2HFBA 1JVXA 3O2AA 4GL0A 4RK2A 2Q9TA 1SW1A 3Q25A 3USDA 3TEPA 5H8FB 3KFMA 1HSLA 3N26A 4XKPA 1Y1ZA 1AOVA 1DPEA 5TU0A 3RPWA 3FXRA 2REGA 4FECA 3MPLA 4F3SA 1P99A 3SEWA 2F7CA 4G8MA 3RLFE 1IUDA 1B3FA 3GZGA 1SDXA 3IK6B 1PB8A 3LUYA 4DXUA 1FW0A 2A5TB 4DXBA 4ZEBA 2I0BA 4MFIA 3TELA 5I57A 3K00A 1N3WA 2ANJA 2I4CA 1OVTA 2AL4A 3Q26A 3U92A 3K02A 2X7PA 4BDLA 3PMXA 3MZ1A 5ELVA 2VHAA 1Y3QA 3DP8A 2I3WA 5TPAB 4MF3A 3RTWB 4WEPA 4NF8A 3MVWA 3FV1A 3VLUA 3B6QA 5JEIA 3V83A 2XXYA 5TP9A 4F2QA 1LBBA 2R71A 4KYSA 4YB5A 4RPOA 4NMYA 1LAGE 5CMCA 5F7VA 1AH5A 4F22A 1XVYA 2P1SA 1M5DA 1UTHB 3IB0A 2RKMA 4FORA 4IY5A 4ZZEA 1Z7NE 4KFQA 4XKRA 3Q28A 4ESXA 5I58A 4RYAA 4DIGA 3RN8A 3R7XA 3KZGA 4QFOA 2I58A 4LZ8A 4LONB 4OFOA 4BDMA 1MPDA 5KCJA 4IGTA 3O28A 2NOOA 3C31A 1MXVA 3OELA 2DXYA 1NNTA 2PX1A 3UIFA 2YJPA 4MBPA 1LB8A 5H8FA 5H8QA 2HZLA 4ECFA 5EHSA 2O1LA 1XOCA 3KEIA 3R26A 5CM6A 3UGWA 2XXPA 3IJOB 2A5TA 1A55A 4MLVA 3TCHA 1VFDA 1Y4CA 4GVOA 4ISUA 5BUUA 3PV0E 3OMBA 4L17A 3IX1A 4F3PA 3CG3A 3EHSA 5CBRA 2ZXTA 3QIMA 5TPAA 1Y1MA 1B7UA 2M8CA 5AA2B 1EU8A 1Y3NA 3JV9A 4QSEA 1R9LA 2Q89A 3ONMA 1URGA 4GLIA 3HCQA 1H76A 1QUJA 3TTLA 4O3BA 3QXMA 1LFIA 3RUMA 4OEUA 3MPKA 1A8EA 3RQTA 1PBQA 1MH3A 3PMVA 1SW2A 3KJ7A 2G29A 1LFGA 3C35A 1MH4A 3O97A 2F35A 4FIMA 2CMOA 5DTBA 1B5JA 1ANFA 5JTYB 5I2NB 3OO6A 1ELJA 1SW5A 3CFLA 2FYIA 2B3BA 3HV1A 4KCDA 1IITA 4DZ1A 2OLBA 1US4A 1A40A 4LP2B 3PD9A 4ELOA 5ITOA 1MQIA 2QPQA 2AIXA 3FVOA 4P11A 4LQ5A 3R6UA 1S9TA 4ZS9A 3THIA 5B70A 3T9XB 2QS3A 5K2XA 2GHBA 3H6WA 3UORA 4ZE8A 1FTOA 3HN0A 4PFTA 1NH7A 1TFDA 1B3HA 4IY6A 4OERA 1JW1A 4KPTA 5FTHA 2RCAA 3HPIA 1I6BA 1MDP1 5CMKA 3A3CA 5AA2A 4QHQA 1PEBA 4Q30B 3VVDA 3TZAA 1GV8A 3A09A 5DYHA 4IO2A 1P1WA 2E0SA 3QK6A 4YKPA 2O68A 2DYXA 3MP6A 4GRKA 2R6GE 2RINA 4R6YA 1D9VA 3ECRA 3C33A 4F3BA 1GGGA 1OLCA 4ZEIA 1LCTA 1FQFA 2UVJA 1B40A 2O7IA 1EZPA 2A5SA 2XXTA 2DE3A 4HCYA 4X9TA 4X1DA 3FJMA 4JSDA 4MLQA 2H5YA 1MXUA 3IOUA 4ESWA 4F3GA 3BFUA 3IL1B 1A7LA 4NF5B 3QSLA 1MXWA 2Y7PA 2XXVA 1R9QA 1B3EA 3FJ7A 3LR1A 3C9HA 5I2NA 4OZ9A 4OEVA 2P0SA 2LAOA 3S9MC 1MQJA 4EXLA 1I6AA 5K2YA 4ZEFA 2DE4A 4F19A 1B5HA 4H8JA 4PFYA 5CBSA 1UQWA 1A54A 3N6TA 2Q88A 4HS7A 4Z7EA 4QFNA 1MY1A 4LUBA 1BLFA 1B5IA 1ZLQA 3PU5A 4H67A 4IB2A 3PMWA 1LBCA 3IO6A 4GF8A 3I3VA 4EF2A 3G3GA 1JEUA 3OEMA 1BIYA 2XXXA 1M5CA 4TLMB 2DSFA 3TYHA 3MP8A 1MG1A 3MVZA 2V3TA 4ZZAA 4U1ZA 4MH5A 3O29A 3W9VA 5KZTA 3FZVA 2VOZA 1JW4A 4XXUA 3FJGA 4RK9A 2XX9A 4QSDA 3LSWA 2DXRA 1VR5A 1IIWA 1NFTA 1SQYA 4IO6A 3MP1A 1N3XA 5I84A 3IOTA 4GXAA 1EZOA 5TP9B 1NKXA 4H1XA 4R6KA 4ZE9A 1Y9UA 3W15C 4ELPA 1N7XA 2AL5A 1UTBB 3LSFB 2Y7KA 2NWJA 5M2VA 1DSNA 1URDA 1WVJA 1I69A 3MZ9A 1FTMA 4NF5A 1B1XA 1IZ1A 3KJTA 3E4RA 2B3FA 2UVGA 4OESA 3SEVA 3ZKLA 4PQJA 1MQHA 1TFAA 3TMGA 1JVYA 1FTLA 1H3DA 5I58B 1MDQA 3TTRA 2DP8A 4KYEA 3VLWA 1AIVA 3EN3A 3RTFB 1O7TA 3TFLA 1ZKBA 4F1YA 4JWXA 5KCJB 4GFRA 3VLVA 5A5XA 4G4PA 4GL8A 4U4SA 1KWHA 5L9OA 2RCBA 2ZNUA 5H8QB 3U1OA 4YZZA 3K01A 4H65A 1ZMGA 2XX7A 1B46A 4RNSA 3VXBA 3FASA 4ZEKA 3CSBA 5FTIA 4U23A 3MWBA 3D4GA 4OMBA 2Z22A 1GR2A 4BLAA 3FATA 2G93A 3B6TA 2UYFA 3T9VA 2F5XA 1LCFA 2XHDA 4R73A 3T66A 2F36A 3QUFA 4HTGA 1OVBA 4N6PA 3MAMA 4YMAA 1Q35A 1TXFA 3RNNA 3TPAA 4NF4A 2QJEA 3SEYA 2ZYNA 2CZLA 4XIGQ 3MJNA 4XKQA 1CE2A 1I6QA 2I48A 1UTBA 2XD3A 3DLNA 4G77A 5BWJA 2HCAA 2OZZA 3WAFA 4UACA 4HCWA 1NH8A 2FNCA 5I2KB 3TODA 3CVGA 2H4IA 3SEXA 3LSLA 1XC1A 4OWDA 2Z23A 2UVIA 1JEVA 3M3FA 2FA7A 3KSJA 3IJXB 3G3IA 1S50A 4OQOA 3ZSFA 5CI5A 5HM4B 2ZNSA 4DLDA 4XTCQ 2ONRA 3KGCA 3S2VA 3H7MA 3VVEA 2F7BA 5AA4A 3OXNA 3PUVE 4F29A 1EZ9A 3GLBA 2P2AA 1D4NA 1LAFE 2Y7IA 3MC2A 3CIJA 1OQGA 2PT2A 3PUWE 1O64A 2OJTA 1AMFA 4NWCA 5F1QA 4E0WA 5L8DA 4Q8RA 3D4CA 4F18A 3KSXA 1VE4A 3BBRA 3OEKA 1B6HA 1R6ZA 4IO7A 2HEUA 1MY0A 3CRBA 1LAHE 2UYEA 3KBRA 2ABHA 3IAZA 1QVSA 2XXRA 1TT1A 4XKNA 3VVFA 4IGRA 2VD2A 1P1QA 2DQVA 1Q1KA 2Z8DA 1MY2A 1QKBA 4H0WA 3EF7A 1ZBMA 2OWSA 2DWJA 1B3GA 1FQCA 3L6HA 1BTJA 4Z0IA 1DMBA 4IO4A 1GVCA 2O84X 3MZBA 4GOTA 4OENA 4OXVA 3IOWA 3EPEA 3O6HA 2I4BA 5I2KA 2O7UA 1FQDA 3N6UA 4QFLA 2QMXA 2ZMBA 4U22A 1POTA 4F39A 1MPCA 2F97A 4JB7A 3C32A 4EQ7A 5EYFA 2OWTA 1II5A 1IEJA 2IEEA 4PP0A 1M5BA 1USYE 4YU0A 1EH3A 3K1PA 1MXZA 2DWIA 2RC7A 3E3KA 4EF1A 4F1UA 1QJMA 1L5TA 4YAHX 4H6DA 4G8HA 5JK4A 3M3KA 2ZNTA 3PPQA 4BDOA 3FIRA 1LSTA 2D3IA 5DEXB 3KG2A 2Y7RA 4JWYA 1B51A 3L6GA 1B4ZA 1N76A 1YAEA 4PFUA 2PBWA 3TQLA 4I9DA 2I0CA 3OENA 4I8CA 3O66A 4PFWA 5CRYA 1PC3A 4TOZA 1RYOA 1B7HA 3SDFA 4OFJA 3W9WA 3KOSA 4FAJA 4N07A 4NTLA 4EUOA 3OSRA 2UVHA 4ZDMA 1FTJA 1MXXA 4OHNA 3DM0A 1SYIA 2Q8JA 3FV2A 2R9JA 4ELQA 3E9XA 2ONSA 4WXJA 4F31B 2Q2AA 1HSEA 1B4HA 3MVXA 1XHYA 4FJPA 3K0VA 3M3LA 2XXWA 1O63A 5LOMA 1ZJLA 3GBBA 1SYHA 4QRZA 1P1UA 2DVCA 2F8DA 4QSCA 2ALUA 1JETA 1WDNA 1D9YA 1POY1 3PUXE 3OO7A 3FUZA 2OBGA 4RA1A 4Q0CA 4GXSB 3HHGA 3G3JA 1B05A 3OO8A 3KN3A 1B52A 3CI8A 4G68B 1Y20A 5A5XB 4KHZE 2PVUA 2F6PA 1LAXA 1B2HA 5DEXA 2THIA 4ZEDA 4LVQA 3OOAA 3SETA 2GRVA 4I62A 1DPPA 2DOJA 3OO9A 1P1OA 3V5AA 2F34A 3RT6B 3PPPA 4RPNA 4AB6A 3U94A 4DCXA 4DDDA 1IXHA 2VD3A 4ELRA 5B7DA 1DTZA 1D3KA 1MS7A 4AB5A 3TCGA 2XXIA 4LZ7A 3JZJA 1OQHA 4BDNA 4RY1A 5IKBA 3DP6A 5HBCA 4NF4B 1MY4A 4M4GA 3PUYE 2O69A 2H9BA 4O3CA 4X48A 1SBPA 4LQ2A 3S9EA 1QUIA 1JQFA 3GXAA 1MM7A 3H6TA 1MPBA 1MRPA 1H43A 1B9JA 1IXIA 3BFTA 3TKDA 5H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5E A;  5I56 A;  3H4Z A;  1HSJ A;  3TDJ A;  4EQ9 A;  1QUK A;  4G68 A;  1ZU0 A;  2O6A A;  2DWA A;  4NF6 A;  4R72 A;  5AA4 B;  1QKA A;  3IOR A;  5HPQ A;  3DP4 A;  5ICT A;  5H8N A;  5AE4 A;  2D5W A;  3QUJ A;  3RY3 A;  4I1D A;  1SD3 A;  3RGY A;  2HAU A;  3CR9 A;  2NUV A;  2ZYO A;  3JYR A;  1SI1 A;  3MQ9 A;  3T96 B;  1MQG A;  2F78 A;  3K1M A;  4JBZ A;  4KR5 A;  2V3U A;  3BKI B;  2HXW A;  2O1M A;  1PBP A;  3G3K A;  3ILU B;  3WAE A;  3TTN A;  2V3Q A;  1IXG A;  1OMP A;  3TUS A;  2WKY A;  5AA3 A;  5I59 B;  4ONY A;  2PT1 A;  4ND9 A;  4F2O A;  1J1N A;  4FEB A;  4R9G A;  1NL5 A;  1Z7M E;  3I5O A;  4FE8 A;  4R6H A;  4GQO A;  3A3U A;  4DXC A;  1TWY A;  2VP1 A;  4M1V A;  1FQB A;  2XX8 A;  2I6E A;  4QF9 A;  1NMU A;  1B1H A;  4YB6 A;  1MY3 A;  4O3A A;  4KI0 E;  3T9U A;  3K1N A;  3OD7 A;  2HZK A;  2QSX A;  4EDP A;  2QRY A;  3H6U A;  1RKM A;  4DCY A;  2RC8 A;  2QMW A;  3LSX A;  2F6G A;  3SER A;  4X1B A;  4H5F A;  2GHA A;  1VSO A;  3CFX A;  4G2Z A;  4LAT A;  3TQW A;  1ATG A;  1PB9 A;  2HAV A;  5ICQ A;  4RXL A;  4JXI A;  5L9M A;  4WED A;  2YPN A;  1IQ7 A;  1FQA A;  2UXA A;  3T22 A;  1MXY A;  3G7W A;  2OCU A;  4R74 A;  1LFH A;  3FD3 A;  2V25 A;  1LB9 A;  4TQU Q;  1LLS A;  1B32 A;  2Q2C A;  3H6V A;  3B6W A;  2ZYK A;  2F7A A;  3CFZ A;  5CMB A;  3VE1 B;  1FCK A;  1ZTY A;  1IXC A;  3FXQ A;  3VFJ A;  4YMB A;  5DT6 A;  4OVJ A;  4C0R A;  1B7Z A;  5CMM A;  3PGF A;  3K4U A;  2D21 A;  4P0G A;  1B0L A;  4GWO A;  4C1T A;  1FTK A;  3LC8 A;  4YKI A;  3C4M A;  2ONK E;  2AYS A;  1USY H;  5I59 A;  3MBP A;  4PE5 B;  3QAX A;  4LZ5 A;  4JDF A;  3TAJ A;  1JW5 A;  2B65 A;  3P7I A;  4U4X A;  4Q5T A;  1GTK A;  4GIZ A;  2XXH A;  5H8H B;  2DS9 A;  2REJ A;  3IB1 A;  1DOT A;  2RC9 A;  5DVF A;  2HQ0 A;  3K6X A;  3F11 A;  1BKA A;  5ITP A;  2QS4 A;  3C36 A;  3PD8 A;  4WKM A;  1NNF A;  5CC2 A;  1H44 A;  1UTH A;  4UA8 A;  3EHT A;  4KD5 A;  4TLL B;  4QFK A;  2GH9 A;  3B7D A;  3SKP A;  3CSG A;  3K6U A;  5DVI A;  5ISU A;  5KDT B;  4K3F A;  1Y4T A;  4R2F A;  1N04 A;  3ODB A;  3UA8 A;  1AL3 A;  4THI A;  4RJZ A;  2DVZ A;  3H06 B;  2BJJ X;  4NED A;  4YB7 A;  1N84 A;  2DE2 A;  3TTM A;  4IO3 A;  3I6V A;  4POX A;  3V89 B;  2XXU A;  1RYX A;  1US5 A;  3SES A;  3N94 A;  3S9L C;  4P0I A;  2X26 A;  4OFL A;  3IR1 A;  3KOT A;  3K6V A;  4R2B A;  1YPN A;  4GD5 A;  1QW0 A;  4N13 A;  3GBA A;  3OSQ A;  4BDR A;  1YTV A;  2XXQ A;  2H98 A;  1URS A;  1Y3P A;  1S7Y A;  1ZIU A;  3PUZ E;  3FVG A;  1VFE A;  1OLA A;  3PPN A;  4H8I A;  3C34 A;  3S9N C;  3V8X B;  5J1D A;  4NE4 A;  4E0X A;  5DVJ A;  3TCF A;  3FVK A;  3SEU A;  3M8U A;  4BDQ A;  2XD2 A;  5H8H A;  4LA9 A;  2Y84 A;  2OK2 A;  3MVY A;  4U1O A;  1SW4 A;  1YCJ A;  4ZEC A;  3ILT B;  1UIU A;  4AQ4 A;  4YIC A;  2H99 A;  3UP9 A;  2GFE A;  4PET A;  3DEL B;  4U2R A;  4EQB A;  2Z8E A;  5L9S A;  3K6W A;  3T9H B;  2QS1 A;  3N5L A;  1A99 A;  4KQP A;  2V84 A;  1NNP A;  4IO5 A;  4DE8 A;  3PPR A;  2ZYM A;  1LGB C;  3T93 B;  4YKJ A;  4OYV A;  1B58 A;  3HHF A;  2PMS A;  5I56 B;  2I3V A;  5KDT A;  1OIB A;  3HST A;  2RF1 A;  2H25 A;  2V93 A;  2QS2 A;  4R9F A;  2KLF A;  1WOD A;  3U8Q A;  4JSO A;  5JTY A;  3CG1 A;  3MUQ A;  3EHU A;  3G3H A;  1UIV A;  3S4U A;  4R75 A;  4NF6 B;  4YKK A;  1F9B A;  1QUL A;  1XS5 A;  3KN7 A;  5H8N B;  3H3G A;  3O9P A;  4KCC A;  2QL3 A;  2YLN A;  5IAI A;  4KYD A;  3O6G A;  2W7Y A;  5EHM A;  1CB6 A;  3VDF A;  3K2D A;  2NVU B;  3VXC A;  1BP5 A;  2O51 A;  1N0T A;  1MM6 A;  4C1U A;  3U72 A;  3VV5 A;  3FGS A;  2IA4 A;  2X7Q A;  5FHN A;  1PB7 A;  4OTE A;  4G8N A;  4QFP A;  3IB2 A;  5I57 B;  3PPO A;  5FHO A;  3FVN A;  2VGQ A;  3EQ1 A;  1PDA A;  1SVX B;  2I49 A;  3ZKK A;  3FXU A;  4H5G A;  3LBS A;  1JNF A;  1MQD A;  1B0H A;  3IO4 A;  4F1V A;  3HO7 A;  3UN6 A;  1FQE A;  3G3F A;  4POW A;  3QYT A;  4NF8 B;  3Q27 A;  2E1S A;  5AA1 A;  3O6I A;  1T0K A;  5FHM A;  1H45 A;  2ESN A;  3ZS6 A;  2DWH A;  1B3L A;  3MW0 A;  3H03 A;  3TTK A;  1A8F A;  2Y7W A;  4HW8 A;  5AA2 D;  1N7W A;  1XT8 A;  4NWD A;  3Q29 A;  4JWO A;  1R1N A;  1SI0 A;  4G68 C;  3IOV A;  1XVX A;  3RT8 A;  1M5F A;  3KN8 A;  3E13 X;  4U21 A;  1DTG A;  4FED A;  4EXK A;  4FAT A;  2Z8F A;  3U93 A;  4OET A;  3UK4 A;  3AXF A;  1P1N A;  2NXO A;  1NNK A;  2PYY A;  2HFB A;  1JVX A;  3O2A A;  4GL0 A;  4RK2 A;  2Q9T A;  1SW1 A;  3Q25 A;  3USD A;  3TEP A;  5H8F B;  3KFM A;  1HSL A;  3N26 A;  4XKP A;  1Y1Z A;  1AOV A;  1DPE A;  5TU0 A;  3RPW A;  3FXR A;  2REG A;  4FEC A;  3MPL A;  4F3S A;  1P99 A;  3SEW A;  2F7C A;  4G8M A;  3RLF E;  1IUD A;  1B3F A;  3GZG A;  1SDX A;  3IK6 B;  1PB8 A;  3LUY A;  4DXU A;  1FW0 A;  2A5T B;  4DXB A;  4ZEB A;  2I0B A;  4MFI A;  3TEL A;  5I57 A;  3K00 A;  1N3W A;  2ANJ A;  2I4C A;  1OVT A;  2AL4 A;  3Q26 A;  3U92 A;  3K02 A;  2X7P A;  4BDL A;  3PMX A;  3MZ1 A;  5ELV A;  2VHA A;  1Y3Q A;  3DP8 A;  2I3W A;  5TPA B;  4MF3 A;  3RTW B;  4WEP A;  4NF8 A;  3MVW A;  3FV1 A;  3VLU A;  3B6Q A;  5JEI A;  3V83 A;  2XXY A;  5TP9 A;  4F2Q A;  1LBB A;  2R71 A;  4KYS A;  4YB5 A;  4RPO A;  4NMY A;  1LAG E;  5CMC A;  5F7V A;  1AH5 A;  4F22 A;  1XVY A;  2P1S A;  1M5D A;  1UTH B;  3IB0 A;  2RKM A;  4FOR A;  4IY5 A;  4ZZE A;  1Z7N E;  4KFQ A;  4XKR A;  3Q28 A;  4ESX A;  5I58 A;  4RYA A;  4DIG A;  3RN8 A;  3R7X A;  3KZG A;  4QFO A;  2I58 A;  4LZ8 A;  4LON B;  4OFO A;  4BDM A;  1MPD A;  5KCJ A;  4IGT A;  3O28 A;  2NOO A;  3C31 A;  1MXV A;  3OEL A;  2DXY A;  1NNT A;  2PX1 A;  3UIF A;  2YJP A;  4MBP A;  1LB8 A;  5H8F A;  5H8Q A;  2HZL A;  4ECF A;  5EHS A;  2O1L A;  1XOC A;  3KEI A;  3R26 A;  5CM6 A;  3UGW A;  2XXP A;  3IJO B;  2A5T A;  1A55 A;  4MLV A;  3TCH A;  1VFD A;  1Y4C A;  4GVO A;  4ISU A;  5BUU A;  3PV0 E;  3OMB A;  4L17 A;  3IX1 A;  4F3P A;  3CG3 A;  3EHS A;  5CBR A;  2ZXT A;  3QIM A;  5TPA A;  1Y1M A;  1B7U A;  2M8C A;  5AA2 B;  1EU8 A;  1Y3N A;  3JV9 A;  4QSE A;  1R9L A;  2Q89 A;  3ONM A;  1URG A;  4GLI A;  3HCQ A;  1H76 A;  1QUJ A;  3TTL A;  4O3B A;  3QXM A;  1LFI A;  3RUM A;  4OEU A;  3MPK A;  1A8E A;  3RQT A;  1PBQ A;  1MH3 A;  3PMV A;  1SW2 A;  3KJ7 A;  2G29 A;  1LFG A;  3C35 A;  1MH4 A;  3O97 A;  2F35 A;  4FIM A;  2CMO A;  5DTB A;  1B5J A;  1ANF A;  5JTY B;  5I2N B;  3OO6 A;  1ELJ A;  1SW5 A;  3CFL A;  2FYI A;  2B3B A;  3HV1 A;  4KCD A;  1IIT A;  4DZ1 A;  2OLB A;  1US4 A;  1A40 A;  4LP2 B;  3PD9 A;  4ELO A;  5ITO A;  1MQI A;  2QPQ A;  2AIX A;  3FVO A;  4P11 A;  4LQ5 A;  3R6U A;  1S9T A;  4ZS9 A;  3THI A;  5B70 A;  3T9X B;  2QS3 A;  5K2X A;  2GHB A;  3H6W A;  3UOR A;  4ZE8 A;  1FTO A;  3HN0 A;  4PFT A;  1NH7 A;  1TFD A;  1B3H A;  4IY6 A;  4OER A;  1JW1 A;  4KPT A;  5FTH A;  2RCA A;  3HPI A;  1I6B A;  1MDP 1;  5CMK A;  3A3C A;  5AA2 A;  4QHQ A;  1PEB A;  4Q30 B;  3VVD A;  3TZA A;  1GV8 A;  3A09 A;  5DYH A;  4IO2 A;  1P1W A;  2E0S A;  3QK6 A;  4YKP A;  2O68 A;  2DYX A;  3MP6 A;  4GRK A;  2R6G E;  2RIN A;  4R6Y A;  1D9V A;  3ECR A;  3C33 A;  4F3B A;  1GGG A;  1OLC A;  4ZEI A;  1LCT A;  1FQF A;  2UVJ A;  1B40 A;  2O7I A;  1EZP A;  2A5S A;  2XXT A;  2DE3 A;  4HCY A;  4X9T A;  4X1D A;  3FJM A;  4JSD A;  4MLQ A;  2H5Y A;  1MXU A;  3IOU A;  4ESW A;  4F3G A;  3BFU A;  3IL1 B;  1A7L A;  4NF5 B;  3QSL A;  1MXW A;  2Y7P A;  2XXV A;  1R9Q A;  1B3E A;  3FJ7 A;  3LR1 A;  3C9H A;  5I2N A;  4OZ9 A;  4OEV A;  2P0S A;  2LAO A;  3S9M C;  1MQJ A;  4EXL A;  1I6A A;  5K2Y A;  4ZEF A;  2DE4 A;  4F19 A;  1B5H A;  4H8J A;  4PFY A;  5CBS A;  1UQW A;  1A54 A;  3N6T A;  2Q88 A;  4HS7 A;  4Z7E A;  4QFN A;  1MY1 A;  4LUB A;  1BLF A;  1B5I A;  1ZLQ A;  3PU5 A;  4H67 A;  4IB2 A;  3PMW A;  1LBC A;  3IO6 A;  4GF8 A;  3I3V A;  4EF2 A;  3G3G A;  1JEU A;  3OEM A;  1BIY A;  2XXX A;  1M5C A;  4TLM B;  2DSF A;  3TYH A;  3MP8 A;  1MG1 A;  3MVZ A;  2V3T A;  4ZZA A;  4U1Z A;  4MH5 A;  3O29 A;  3W9V A;  5KZT A;  3FZV A;  2VOZ A;  1JW4 A;  4XXU A;  3FJG A;  4RK9 A;  2XX9 A;  4QSD A;  3LSW A;  2DXR A;  1VR5 A;  1IIW A;  1NFT A;  1SQY A;  4IO6 A;  3MP1 A;  1N3X A;  5I84 A;  3IOT A;  4GXA A;  1EZO A;  5TP9 B;  1NKX A;  4H1X A;  4R6K A;  4ZE9 A;  1Y9U A;  3W15 C;  4ELP A;  1N7X A;  2AL5 A;  1UTB B;  3LSF B;  2Y7K A;  2NWJ A;  5M2V A;  1DSN A;  1URD A;  1WVJ A;  1I69 A;  3MZ9 A;  1FTM A;  4NF5 A;  1B1X A;  1IZ1 A;  3KJT A;  3E4R A;  2B3F A;  2UVG A;  4OES A;  3SEV A;  3ZKL A;  4PQJ A;  1MQH A;  1TFA A;  3TMG A;  1JVY A;  1FTL A;  1H3D A;  5I58 B;  1MDQ A;  3TTR A;  2DP8 A;  4KYE A;  3VLW A;  1AIV A;  3EN3 A;  3RTF B;  1O7T A;  3TFL A;  1ZKB A;  4F1Y A;  4JWX A;  5KCJ B;  4GFR A;  3VLV A;  5A5X A;  4G4P A;  4GL8 A;  4U4S A;  1KWH A;  5L9O A;  2RCB A;  2ZNU A;  5H8Q B;  3U1O A;  4YZZ A;  3K01 A;  4H65 A;  1ZMG A;  2XX7 A;  1B46 A;  4RNS A;  3VXB A;  3FAS A;  4ZEK A;  3CSB A;  5FTI A;  4U23 A;  3MWB A;  3D4G A;  4OMB A;  2Z22 A;  1GR2 A;  4BLA A;  3FAT A;  2G93 A;  3B6T A;  2UYF A;  3T9V A;  2F5X A;  1LCF A;  2XHD A;  4R73 A;  3T66 A;  2F36 A;  3QUF A;  4HTG A;  1OVB A;  4N6P A;  3MAM A;  4YMA A;  1Q35 A;  1TXF A;  3RNN A;  3TPA A;  4NF4 A;  2QJE A;  3SEY A;  2ZYN A;  2CZL A;  4XIG Q;  3MJN A;  4XKQ A;  1CE2 A;  1I6Q A;  2I48 A;  1UTB A;  2XD3 A;  3DLN A;  4G77 A;  5BWJ A;  2HCA A;  2OZZ A;  3WAF A;  4UAC A;  4HCW A;  1NH8 A;  2FNC A;  5I2K B;  3TOD A;  3CVG A;  2H4I A;  3SEX A;  3LSL A;  1XC1 A;  4OWD A;  2Z23 A;  2UVI A;  1JEV A;  3M3F A;  2FA7 A;  3KSJ A;  3IJX B;  3G3I A;  1S50 A;  4OQO A;  3ZSF A;  5CI5 A;  5HM4 B;  2ZNS A;  4DLD A;  4XTC Q;  2ONR A;  3KGC A;  3S2V A;  3H7M A;  3VVE A;  2F7B A;  5AA4 A;  3OXN A;  3PUV E;  4F29 A;  1EZ9 A;  3GLB A;  2P2A A;  1D4N A;  1LAF E;  2Y7I A;  3MC2 A;  3CIJ A;  1OQG A;  2PT2 A;  3PUW E;  1O64 A;  2OJT A;  1AMF A;  4NWC A;  5F1Q A;  4E0W A;  5L8D A;  4Q8R A;  3D4C A;  4F18 A;  3KSX A;  1VE4 A;  3BBR A;  3OEK A;  1B6H A;  1R6Z A;  4IO7 A;  2HEU A;  1MY0 A;  3CRB A;  1LAH E;  2UYE A;  3KBR A;  2ABH A;  3IAZ A;  1QVS A;  2XXR A;  1TT1 A;  4XKN A;  3VVF A;  4IGR A;  2VD2 A;  1P1Q A;  2DQV A;  1Q1K A;  2Z8D A;  1MY2 A;  1QKB A;  4H0W A;  3EF7 A;  1ZBM A;  2OWS A;  2DWJ A;  1B3G A;  1FQC A;  3L6H A;  1BTJ A;  4Z0I A;  1DMB A;  4IO4 A;  1GVC A;  2O84 X;  3MZB A;  4GOT A;  4OEN A;  4OXV A;  3IOW A;  3EPE A;  3O6H A;  2I4B A;  5I2K A;  2O7U A;  1FQD A;  3N6U A;  4QFL A;  2QMX A;  2ZMB A;  4U22 A;  1POT A;  4F39 A;  1MPC A;  2F97 A;  4JB7 A;  3C32 A;  4EQ7 A;  5EYF A;  2OWT A;  1II5 A;  1IEJ A;  2IEE A;  4PP0 A;  1M5B A;  1USY E;  4YU0 A;  1EH3 A;  3K1P A;  1MXZ A;  2DWI A;  2RC7 A;  3E3K A;  4EF1 A;  4F1U A;  1QJM A;  1L5T A;  4YAH X;  4H6D A;  4G8H A;  5JK4 A;  3M3K A;  2ZNT A;  3PPQ A;  4BDO A;  3FIR A;  1LST A;  2D3I A;  5DEX B;  3KG2 A;  2Y7R A;  4JWY A;  1B51 A;  3L6G A;  1B4Z A;  1N76 A;  1YAE A;  4PFU A;  2PBW A;  3TQL A;  4I9D A;  2I0C A;  3OEN A;  4I8C A;  3O66 A;  4PFW A;  5CRY A;  1PC3 A;  4TOZ A;  1RYO A;  1B7H A;  3SDF A;  4OFJ A;  3W9W A;  3KOS A;  4FAJ A;  4N07 A;  4NTL A;  4EUO A;  3OSR A;  2UVH A;  4ZDM A;  1FTJ A;  1MXX A;  4OHN A;  3DM0 A;  1SYI A;  2Q8J A;  3FV2 A;  2R9J A;  4ELQ A;  3E9X A;  2ONS A;  4WXJ A;  4F31 B;  2Q2A A;  1HSE A;  1B4H A;  3MVX A;  1XHY A;  4FJP A;  3K0V A;  3M3L A;  2XXW A;  1O63 A;  5LOM A;  1ZJL A;  3GBB A;  1SYH A;  4QRZ A;  1P1U A;  2DVC A;  2F8D A;  4QSC A;  2ALU A;  1JET A;  1WDN A;  1D9Y A;  1POY 1;  3PUX E;  3OO7 A;  3FUZ A;  2OBG A;  4RA1 A;  4Q0C A;  4GXS B;  3HHG A;  3G3J A;  1B05 A;  3OO8 A;  3KN3 A;  1B52 A;  3CI8 A;  4G68 B;  1Y20 A;  5A5X B;  4KHZ E;  2PVU A;  2F6P A;  1LAX A;  1B2H A;  5DEX A;  2THI A;  4ZED A;  4LVQ A;  3OOA A;  3SET A;  2GRV A;  4I62 A;  1DPP A;  2DOJ A;  3OO9 A;  1P1O A;  3V5A A;  2F34 A;  3RT6 B;  3PPP A;  4RPN A;  4AB6 A;  3U94 A;  4DCX A;  4DDD A;  1IXH A;  2VD3 A;  4ELR A;  5B7D A;  1DTZ A;  1D3K A;  1MS7 A;  4AB5 A;  3TCG A;  2XXI A;  4LZ7 A;  3JZJ A;  1OQH A;  4BDN A;  4RY1 A;  5IKB A;  3DP6 A;  5HBC A;  4NF4 B;  1MY4 A;  4M4G A;  3PUY E;  2O69 A;  2H9B A;  4O3C A;  4X48 A;  1SBP A;  4LQ2 A;  3S9E A;  1QUI A;  1JQF A;  3GXA A;  1MM7 A;  3H6T A;  1MPB A;  1MRP A;  1H43 A;  1B9J A;  1IXI A;  3BFT A;  3TKD A;  5H8S A; 
#chains in the Genus database with same CATH topology
 2ZZV A;  2B4L A;  1M5E A;  3KC1 A;  5I56 A;  4N15 A;  3H4Z A;  4MCO A;  1HSJ A;  3TDJ A;  4EQ9 A;  1KA1 A;  1QUK A;  4G68 A;  1ZU0 A;  2O6A A;  4OVP A;  1XI6 A;  2DWA A;  4PF6 A;  4NF6 A;  4R72 A;  5AA4 B;  1QKA A;  3IOR A;  5HPQ A;  3DP4 A;  1FPJ A;  5ICT A;  5H8N A;  5AE4 A;  2OWZ A;  2D5W A;  3QUJ A;  3RY3 A;  4I1D A;  1SD3 A;  3RGY A;  2HAU A;  3CR9 A;  1NV6 A;  2NUV A;  2ZYO A;  3JYR A;  1SI1 A;  3MQ9 A;  3T96 B;  1MQG A;  2F78 A;  3K1M A;  4JVD A;  2Q74 A;  4JBZ A;  4N6K A;  4KR5 A;  2V3U A;  3BKI B;  2Y5K A;  1FSA A;  2HXW A;  1FJ6 A;  4OVQ A;  2O1M A;  1PBP A;  3G3K A;  3ILU B;  3WAE A;  3TTN A;  2V3Q A;  1IXG A;  1OMP A;  3ISP A;  3TUS A;  2WKY A;  4DI3 D;  5AA3 A;  5I59 B;  4ONY A;  2PT1 A;  4ND9 A;  4F2O A;  1J1N A;  4FEB A;  4R9G A;  1NL5 A;  1Z7M E;  3I5O A;  4FE8 A;  4R6H A;  2PFY A;  4GQO A;  3A3U A;  1FBE A;  4DXC A;  1TWY A;  2VP1 A;  4M1V A;  1FBC A;  1FQB A;  1FTA A;  2XX8 A;  2I6E A;  4X04 A;  4QF9 A;  3GYY A;  1NMU A;  1B1H A;  4YB6 A;  4OA4 A;  1MY3 A;  4O3A A;  4KI0 E;  3T9U A;  3K1N A;  3OD7 A;  2HZK A;  2QSX A;  4EDP A;  2QRY A;  3H6U A;  1RKM A;  4DCY A;  2RC8 A;  2QMW A;  3LSX A;  1FBP A;  4GBV A;  2F6G A;  3SER A;  4X1B A;  4H5F A;  2GHA A;  1VSO A;  3CFX A;  4G2Z A;  4LAT A;  3TQW A;  1ATG A;  3KC0 A;  5I5P A;  1PB9 A;  2HAV A;  5ICQ A;  4RXL A;  4JXI A;  5L9M A;  1IMD A;  4WED A;  2YPN A;  1IQ7 A;  1FQA A;  2UXA A;  4I3E A;  1MXY A;  3T22 A;  3G7W A;  5EQ7 A;  2OCU A;  2BJI A;  4R74 A;  1LFH A;  3FD3 A;  1NV3 A;  2V25 A;  1LB9 A;  4TQU Q;  4GBW A;  1LLS A;  1B32 A;  2Q2C A;  3H6V A;  3B6W A;  2ZYK A;  2F7A A;  3CFZ A;  5CMB A;  1IME A;  3VE1 B;  1FCK A;  1ZTY A;  1IXC A;  3FXQ A;  3VFJ A;  4YMB A;  5DT6 A;  4OVJ A;  4C0R A;  2GQ1 A;  1B7Z A;  5CMM A;  3PGF A;  3K4U A;  2D21 A;  1KA0 A;  1NV7 A;  4O7M A;  4AS4 A;  4P0G A;  1B0L A;  4GWO A;  4PC9 A;  4C1T A;  1FTK A;  3LC8 A;  4YKI A;  3C4M A;  2ONK E;  2AYS A;  2WYK A;  1USY H;  5I59 A;  3MBP A;  4PE5 B;  3QAX A;  4LZ5 A;  1FPB A;  2PCR A;  4JDF A;  3TAJ A;  1JW5 A;  2B65 A;  3P7I A;  4U4X A;  3FXB A;  4Q5T A;  1GTK A;  4GIZ A;  2XWO A;  2XXH A;  4I3Y A;  5H8H B;  2DS9 A;  2REJ A;  3IB1 A;  1DOT A;  2RC9 A;  5DVF A;  2HQ0 A;  5ET7 A;  3K6X A;  4HXV A;  3F11 A;  1BKA A;  4OVS A;  4N4U A;  5ITP A;  4XFE A;  2QS4 A;  3C36 A;  3PD8 A;  4WKM A;  1NNF A;  4PGP A;  5CC2 A;  1H44 A;  4PCD A;  1UTH A;  4UA8 A;  3EHT A;  4KD5 A;  4TLL B;  4QFK A;  2QFL A;  2GH9 A;  3B7D A;  3SKP A;  3CSG A;  3K6U A;  4PF8 A;  5DVI A;  5ISU A;  5KDT B;  4PAK A;  4K3F A;  1Y4T A;  4R2F A;  1N04 A;  2QVU A;  3ODB A;  3UA8 A;  1AL3 A;  1JP4 A;  4THI A;  4RJZ A;  2DVZ A;  3H06 B;  2BJJ X;  4NED A;  4YB7 A;  5I7I A;  1N84 A;  4MAG A;  2DE2 A;  3TTM A;  4IO3 A;  3I6V A;  4POX A;  3V89 B;  2XXU A;  1RYX A;  1US5 A;  2P3N A;  3SES A;  3N94 A;  3S9L C;  4P0I A;  2X26 A;  4OFL A;  5ET5 A;  3IR1 A;  3KOT A;  3K6V A;  3T1B A;  4R2B A;  1YPN A;  3CHG A;  4GD5 A;  1QW0 A;  4N13 A;  3GBA A;  3OSQ A;  1FBH A;  4BDR A;  1YTV A;  2XXQ A;  2H98 A;  1URS A;  1Y3P A;  1S7Y A;  4OAN A;  1ZIU A;  3PUZ E;  3FVG A;  1VFE A;  1OLA A;  3PPN A;  1RDY A;  4H8I A;  3C34 A;  3S9N C;  3V8X B;  5J1D A;  4NE4 A;  4E0X A;  5DVJ A;  3TCF A;  3FVK A;  3SEU A;  3M8U A;  4BDQ A;  2XD2 A;  5H8H A;  5IZ3 B;  4N8Y A;  4LA9 A;  2Y84 A;  4N6D A;  2OK2 A;  3MVY A;  4U1O A;  1SW4 A;  2FHY A;  1YCJ A;  4ZEC A;  3ILT B;  1YZ0 A;  1UIU A;  4AQ4 A;  4YIC A;  2H99 A;  3UP9 A;  2GFE A;  4PET A;  3DEL B;  4PDH A;  4U2R A;  4EQB A;  4GWU A;  2Z8E A;  5L9S A;  3K6W A;  3T9H B;  2QS1 A;  3N5L A;  1A99 A;  4KQP A;  2V84 A;  1NNP A;  4IO5 A;  4DE8 A;  3PPR A;  2ZYM A;  1LGB C;  3T93 B;  4YKJ A;  4OYV A;  1B58 A;  3HHF A;  2PMS A;  5I56 B;  1EYI A;  2FVZ A;  2I3V A;  5KDT A;  1OIB A;  3HST A;  2RF1 A;  4O8M A;  2H25 A;  2V93 A;  4NN3 A;  2QS2 A;  4R9F A;  2KLF A;  1WOD A;  2KQZ A;  3U8Q A;  4JSO A;  5JTY A;  3CG1 A;  3MUQ A;  3EHU A;  1IMB A;  3G3H A;  1UIV A;  3S4U A;  4R75 A;  4DI4 B;  4NF6 B;  5IZZ A;  5LDZ A;  4YKK A;  1F9B A;  1QUL A;  1XS5 A;  4MNC A;  3KN7 A;  5H8N B;  3H3G A;  1FPF A;  3O9P A;  4KCC A;  2QL3 A;  2YLN A;  5IAI A;  4KYD A;  3O6G A;  2W7Y A;  5EHM A;  4PDD A;  1CB6 A;  3VDF A;  3K2D A;  2NVU B;  3VXC A;  1BP5 A;  2O51 A;  1N0T A;  1MM6 A;  4P47 A;  2XXK A;  4C1U A;  3U72 A;  3VV5 A;  4HE1 A;  3FGS A;  2IA4 A;  4H46 A;  2X7Q A;  5FHN A;  1PB7 A;  4OTE A;  4G8N A;  4QFP A;  3IB2 A;  5I57 B;  3PPO A;  5FHO A;  3BIG A;  3FVN A;  2VGQ A;  1AWB A;  3EQ1 A;  1FJ9 A;  1PDA A;  4PFB A;  1SVX B;  2I49 A;  3ZKK A;  3B50 A;  3FXU A;  1NV4 A;  4H5G A;  3LBS A;  1JNF A;  1MQD A;  3FBP A;  1B0H A;  3IO4 A;  4F1V A;  3HO7 A;  3UN6 A;  1FQE A;  3G3F A;  4POW A;  3QYT A;  4NF8 B;  3Q27 A;  2E1S A;  4PAF A;  5AA1 A;  3O6I A;  1T0K A;  5FHM A;  1H45 A;  2ESN A;  4MEV A;  3ZS6 A;  2DWH A;  1B3L A;  3MW0 A;  3H03 A;  3TTK A;  1A8F A;  2Y7W A;  4HW8 A;  5AA2 D;  2XWI A;  1N7W A;  1XT8 A;  4NWD A;  3Q29 A;  4JWO A;  1R1N A;  4HE2 A;  2HHM A;  1IMA A;  1SI0 A;  4G68 C;  3IOV A;  1XVX A;  3RT8 A;  1M5F A;  3KN8 A;  3E13 X;  4U21 A;  1DTG A;  4FED A;  4EXK A;  4FAT A;  2Z8F A;  3U93 A;  4GX6 A;  4OET A;  5ET8 A;  3UK4 A;  3AXF A;  1P1N A;  2NXO A;  1NNK A;  2VT5 A;  2PYY A;  2HFB A;  1JVX A;  3O2A A;  4GL0 A;  1EYK A;  4P1E A;  4RK2 A;  2Q9T A;  1SW1 A;  3Q25 A;  3USD A;  3KBZ A;  3TEP A;  5H8F B;  3KFM A;  1HSL A;  1LBW A;  3N26 A;  4XKP A;  1Y1Z A;  1AOV A;  1DPE A;  5TU0 A;  3RPW A;  3FXR A;  2CZK A;  2REG A;  4FEC A;  3MPL A;  4F3S A;  1P99 A;  3SEW A;  2F7C A;  2XWV A;  4MJO A;  4G8M A;  3RLF E;  1IUD A;  5A5L A;  4N81 A;  1B3F A;  3GZG A;  1SDX A;  3IK6 B;  1PB8 A;  3LUY A;  4DXU A;  1FW0 A;  2A5T B;  4O7I A;  4DXB A;  2JJK A;  4ZEB A;  2I0B A;  4MFI A;  3TEL A;  5I57 A;  3K00 A;  1N3W A;  2ANJ A;  2P3V A;  2I4C A;  1OVT A;  2AL4 A;  3Q26 A;  1NUZ A;  3U92 A;  1NI9 A;  3K02 A;  2X7P A;  4BDL A;  4NG7 A;  3PMX A;  3MZ1 A;  4XF5 A;  5ELV A;  1FPE A;  2VHA A;  1Y3Q A;  3DP8 A;  2I3W A;  5TPA B;  4MF3 A;  3RTW B;  4WEP A;  4NF8 A;  3MVW A;  3FV1 A;  4O94 A;  3VLU A;  3B6Q A;  5JEI A;  3V83 A;  2XXY A;  5TP9 A;  4F2Q A;  1LBB A;  2R71 A;  4KYS A;  4YB5 A;  4RPO A;  4NMY A;  2FIE A;  1LAG E;  4NAP A;  5CMC A;  5F7V A;  1AH5 A;  4F22 A;  1XVY A;  2P1S A;  1M5D A;  1UTH B;  4PTK A;  3IB0 A;  2RKM A;  4FOR A;  4IY5 A;  4ZZE A;  4NF0 A;  1Z7N E;  4KFQ A;  4XKR A;  3Q28 A;  4ESX A;  2Q8M A;  5I58 A;  4RYA A;  4DIG A;  3RN8 A;  4G61 A;  3PTY A;  3R7X A;  3KZG A;  4QFO A;  2I58 A;  4LZ8 A;  4LON B;  4MMP A;  4OFO A;  4BDM A;  1MPD A;  5KCJ A;  4IGT A;  3O28 A;  2NOO A;  3C31 A;  1MXV A;  3OEL A;  2DXY A;  1NNT A;  4KXP A;  2PX1 A;  3UIF A;  2YJP A;  4MBP A;  1LB8 A;  5H8F A;  4LN5 A;  5H8Q A;  2HZL A;  4OVT A;  4ECF A;  5EHS A;  2O1L A;  1XOC A;  2PFZ A;  3KEI A;  3R26 A;  5CM6 A;  3UGW A;  2XXP A;  3IJO B;  2A5T A;  1A55 A;  4MLV A;  5FBP A;  3TCH A;  1VFD A;  1Y4C A;  4GVO A;  4ISU A;  1BK4 A;  5BUU A;  3PV0 E;  3OMB A;  4L17 A;  3IX1 A;  4F3P A;  3A29 A;  3CG3 A;  3EHS A;  5CBR A;  2ZXT A;  3QIM A;  2FIX A;  1Y1M A;  2VPO A;  5TPA A;  1B7U A;  5IM2 A;  1KZ8 A;  2M8C A;  5AA2 B;  1EU8 A;  1Y3N A;  3JV9 A;  3MYU A;  1R9L A;  4QSE A;  2Q89 A;  3ONM A;  1URG A;  4GLI A;  3HCQ A;  1H76 A;  1QUJ A;  2KR0 A;  3TTL A;  3LV0 A;  4O3B A;  2QVR A;  3QXM A;  1LFI A;  5ESY A;  5LTC A;  1FBF A;  3RUM A;  4OEU A;  4UAB A;  3MPK A;  1A8E A;  4N17 A;  3RQT A;  1PBQ A;  1MH3 A;  3PMV A;  1SW2 A;  3SZP A;  3KJ7 A;  2G29 A;  2WEF A;  2QVV A;  1LFG A;  3C35 A;  1MH4 A;  3E79 A;  3O97 A;  2F35 A;  4FIM A;  4GX4 A;  2CMO A;  5DTB A;  1B5J A;  1ANF A;  3NOH A;  5ET6 A;  5JTY B;  5I2N B;  3OO6 A;  1ELJ A;  1SW5 A;  3CFL A;  2FYI A;  2B3B A;  3HV1 A;  3HFU A;  4KCD A;  1IIT A;  4GWW A;  4DZ1 A;  2OLB A;  1US4 A;  1A40 A;  4LP2 B;  2VPN A;  3PD9 A;  4ELO A;  5ITO A;  1MQI A;  2QPQ A;  2AIX A;  3FVO A;  4P11 A;  4LQ5 A;  3R6U A;  1S9T A;  4PE3 A;  1QGX A;  4ZS9 A;  3THI A;  5B70 A;  3T9X B;  2QS3 A;  3RYD A;  5K2X A;  2GHB A;  2DDK A;  3H6W A;  3UOR A;  4ZE8 A;  1FTO A;  3HN0 A;  4PFT A;  5IGA A;  1NH7 A;  1TFD A;  1B3H A;  4IY6 A;  4OER A;  1JW1 A;  4XEQ A;  4KPT A;  5FTH A;  2RCA A;  3HPI A;  1IMF A;  1I6B A;  1SPI A;  1MDP 1;  5CMK A;  3A3C A;  5AA2 A;  4QHQ A;  4P8B A;  1PEB A;  4PGN A;  4Q30 B;  3VVD A;  3TZA A;  1GV8 A;  3A09 A;  5DYH A;  4IO2 A;  1Q9D A;  1P1W A;  2E0S A;  3QK6 A;  4YKP A;  2O68 A;  2DYX A;  3MP6 A;  4MNI A;  4GRK A;  2R6G E;  2RIN A;  4R6Y A;  1IMC A;  1D9V A;  3ECR A;  3LUZ A;  3C33 A;  4F3B A;  1GGG A;  1OLC A;  4ZEI A;  1LCT A;  4MX6 A;  1FQF A;  2UVJ A;  1B40 A;  2O7I A;  3ROJ A;  1EZP A;  4X8R A;  2CZH A;  2A5S A;  2XXT A;  2DE3 A;  4HCY A;  4PBQ A;  4X9T A;  4X1D A;  3FJM A;  4JSD A;  4MLQ A;  1FBG A;  1NV5 A;  2H5Y A;  1MXU A;  3IOU A;  4ESW A;  4F3G A;  3BFU A;  3IL1 B;  1A7L A;  4GWY A;  4NF5 B;  3QSL A;  1MXW A;  2Y7P A;  2XXV A;  1R9Q A;  1B3E A;  3FJ7 A;  4P1L A;  4QXD A;  3LR1 A;  3C9H A;  5I2N A;  4OZ9 A;  4OEV A;  5EQ8 A;  2P0S A;  2LAO A;  3S9M C;  1MQJ A;  4EXL A;  1I6A A;  5K2Y A;  4ZEF A;  2DE4 A;  4F19 A;  1B5H A;  4H8J A;  4PFY A;  5CBS A;  1UQW A;  1A54 A;  3N6T A;  2Q88 A;  4HS7 A;  4N91 A;  4OVR A;  4Z7E A;  4QFN A;  1MY1 A;  4LUB A;  1BLF A;  1B5I A;  1ZLQ A;  3PU5 A;  4H67 A;  4IB2 A;  3PMW A;  1LBC A;  3IO6 A;  4GF8 A;  3I3V A;  4EF2 A;  3G3G A;  1LBY A;  1JEU A;  1YYZ A;  3OEM A;  1BIY A;  2XXX A;  1M5C A;  4TLM B;  2DSF A;  3MST A;  3TYH A;  3MP8 A;  1MG1 A;  3MVZ A;  4P3L A;  2V3T A;  4NX1 A;  4ZZA A;  4U1Z A;  4MH5 A;  3O29 A;  3W9V A;  5KZT A;  3FZV A;  4MHF A;  2VOZ A;  1JW4 A;  4XXU A;  3FJG A;  2CEY A;  4RK9 A;  2XX9 A;  4QSD A;  1K9Y A;  3LSW A;  2DXR A;  1VR5 A;  1IIW A;  4PAI A;  1NFT A;  1EYJ A;  1SQY A;  4IO6 A;  1D9Q A;  3MP1 A;  1N3X A;  5I84 A;  3IOT A;  4GXA A;  1EZO A;  5TP9 B;  1NKX A;  4H1X A;  4R6K A;  4ZE9 A;  1Y9U A;  3W15 C;  4ELP A;  1N7X A;  2AL5 A;  1UTB B;  3LSF B;  2Y7K A;  2NWJ A;  5M2V A;  1DSN A;  1URD A;  1G0I A;  1WVJ A;  1I69 A;  3MZ9 A;  1FTM A;  4NF5 A;  2HPG A;  1B1X A;  1IZ1 A;  4AS5 A;  3KJT A;  3E4R A;  3T0J A;  2B3F A;  2UVG A;  4OES A;  3SEV A;  3ZKL A;  4PQJ A;  1MQH A;  1TFA A;  3TMG A;  1JVY A;  1FTL A;  1H3D A;  5I58 B;  1MDQ A;  3TTR A;  2DP8 A;  4KYE A;  3VLW A;  1LBZ A;  1AIV A;  3EN3 A;  3RTF B;  1O7T A;  3TFL A;  1ZKB A;  1LEV A;  2R8T A;  4F1Y A;  4JWX A;  5KCJ B;  4GWX A;  4GFR A;  3VLV A;  5A5X A;  4FBP A;  4G4P A;  4NGU A;  2WBB A;  4GL8 A;  4U4S A;  1KWH A;  3RPL B;  5L9O A;  2ZZX A;  2RCB A;  2ZNU A;  4MNP A;  5H8Q B;  3U1O A;  4YZZ A;  3K01 A;  4H65 A;  1ZMG A;  2XX7 A;  1B46 A;  4RNS A;  3FAS A;  3VXB A;  4ZEK A;  3CSB A;  5FTI A;  4U23 A;  3MWB A;  3D4G A;  4OMB A;  2Z22 A;  1GR2 A;  4BLA A;  3FAT A;  2F3D A;  2G93 A;  3B6T A;  2UYF A;  3T9V A;  2CEX A;  2F5X A;  1LCF A;  2XHD A;  5J16 A;  4R73 A;  3T66 A;  2F36 A;  3QUF A;  2WBD A;  4HTG A;  1OVB A;  4N6P A;  3MAM A;  4YMA A;  1Q35 A;  1TXF A;  3RNN A;  3TPA A;  4NF4 A;  1FRP A;  2QJE A;  3SEY A;  2ZYN A;  2CZL A;  4XIG Q;  3MJN A;  4XKQ A;  1CE2 A;  1I6Q A;  2I48 A;  1UTB A;  1RDZ A;  1DCU A;  1FPI A;  2XD3 A;  3DLN A;  4G77 A;  5BWJ A;  2HCA A;  2HXR A;  2OZZ A;  3B8B A;  3WAF A;  4UAC A;  4HCW A;  1NH8 A;  2FNC A;  5I2K B;  3TOD A;  3CVG A;  2H4I A;  3SEX A;  3LSL A;  1XC1 A;  4OWD A;  2Z23 A;  2UVI A;  4HE0 A;  1JEV A;  3M3F A;  3E78 A;  2B4M A;  2FA7 A;  3KSJ A;  3IJX B;  3G3I A;  1S50 A;  4OQO A;  1DK4 A;  3ZSF A;  5CI5 A;  5HM4 B;  2ZNS A;  4DLD A;  4XTC Q;  2ONR A;  3KGC A;  4N8G A;  3S2V A;  3H7M A;  3VVE A;  2F7B A;  5AA4 A;  3RPL A;  3OXN A;  3PUV E;  4F29 A;  1EZ9 A;  3GLB A;  2P2A A;  1D4N A;  1LAF E;  2Y7I A;  3MC2 A;  3CIJ A;  1FBD A;  1OQG A;  2PT2 A;  3PUW E;  1O64 A;  2OJT A;  1AMF A;  4NWC A;  1RDX A;  5F1Q A;  4E0W A;  5L8D A;  4Q8R A;  5EQA A;  3D4C A;  4F18 A;  3KSX A;  2L5V A;  1NV2 A;  1VE4 A;  3BBR A;  3OEK A;  1B6H A;  1R6Z A;  4IO7 A;  2HEU A;  1MY0 A;  3CRB A;  1LAH E;  2UYE A;  2WYP A;  3KBR A;  2ABH A;  4GX3 A;  3IAZ A;  5EYH A;  1QVS A;  2XXR A;  1TT1 A;  4XKN A;  4H45 A;  1LBV A;  3VVF A;  4IGR A;  2VD2 A;  2XA5 A;  1P1Q A;  5T3J A;  2DQV A;  1Q1K A;  2Z8D A;  1FPL A;  1MY2 A;  1QKB A;  4H0W A;  3EF7 A;  1ZBM A;  2OWS A;  2DWJ A;  1B3G A;  1FQC A;  3L6H A;  1BTJ A;  4Z0I A;  1DMB A;  4IO4 A;  4PBH A;  2O84 X;  3MZB A;  4GOT A;  4OEN A;  1GVC A;  4OXV A;  3IOW A;  3D1R A;  3EPE A;  3O6H A;  2I4B A;  4MIJ A;  5I2K A;  2O7U A;  1FQD A;  3N6U A;  4PFR A;  4QFL A;  2QMX A;  2ZMB A;  4U22 A;  1POT A;  1K9Z A;  4F39 A;  1MPC A;  5IZ1 A;  2F97 A;  1INP A;  4JB7 A;  3C32 A;  4EQ7 A;  5EYF A;  2OWT A;  1II5 A;  1IEJ A;  2IEE A;  4PP0 A;  1M5B A;  3QMF A;  2F3B A;  1USY E;  1FPG A;  4YU0 A;  1EH3 A;  3K1P A;  2ZZW A;  1MXZ A;  2DWI A;  2RC7 A;  3E3K A;  4EF1 A;  4F1U A;  1QJM A;  1L5T A;  4YAH X;  4H6D A;  1NUW A;  4G8H A;  5JK4 A;  3M3K A;  2ZNT A;  3PPQ A;  4BDO A;  3FIR A;  1LST A;  2D3I A;  5DEX B;  3KG2 A;  2Y7R A;  4JWY A;  4P9K A;  1B51 A;  3L6G A;  3U65 A;  1B4Z A;  2XWK A;  1N76 A;  1YAE A;  4PFU A;  2PBW A;  3TQL A;  4I9D A;  2I0C A;  3OEN A;  4GWZ A;  4GWS A;  4I8C A;  3O66 A;  4PFW A;  5CRY A;  1PC3 A;  4TOZ A;  1RYO A;  1B7H A;  3SDF A;  4OFJ A;  3W9W A;  3KOS A;  5EYG A;  4FAJ A;  4N07 A;  4NTL A;  4EUO A;  3OSR A;  1LBX A;  2UVH A;  4ZDM A;  1FTJ A;  1MXX A;  4OHN A;  3DM0 A;  1SYI A;  2Q8J A;  3FV2 A;  5DW8 A;  2R9J A;  4ELQ A;  3E9X A;  2ONS A;  4WXJ A;  4F31 B;  2Q2A A;  1HSE A;  1B4H A;  4PFI A;  3MVX A;  1XHY A;  4FJP A;  3K0V A;  3M3L A;  1DBZ A;  2XXW A;  1O63 A;  5LOM A;  1ZJL A;  3GBB A;  1SYH A;  4QRZ A;  1P1U A;  2DVC A;  2F8D A;  4QSC A;  2ALU A;  1JET A;  1WDN A;  1D9Y A;  1POY 1;  4JVC A;  3PUX E;  3OO7 A;  3FUZ A;  2OBG A;  3EKI A;  4RA1 A;  4Q0C A;  4GXS B;  3HHG A;  3G3J A;  1B05 A;  3OO8 A;  5EQ9 A;  3KN3 A;  1B52 A;  2WX9 A;  3CI8 A;  4G68 B;  1Y20 A;  4NHB A;  5A5X B;  2Y5L A;  4KHZ E;  2CZI A;  2PVU A;  2F6P A;  1LAX A;  3BIH A;  1B2H A;  5DEX A;  4QBA A;  2THI A;  4ZED A;  4LVQ A;  3OOA A;  3SET A;  2GRV A;  4I62 A;  1DPP A;  2DOJ A;  3OO9 A;  1P1O A;  3V5A A;  2F34 A;  1NV0 A;  4IR8 A;  3RT6 B;  3PPP A;  4RPN A;  4AB6 A;  3U94 A;  4DCX A;  4DDD A;  1IXH A;  5F24 A;  2VD3 A;  1G0H A;  1NUX A;  4ELR A;  5B7D A;  1FPK A;  1DTZ A;  1VDW A;  1D3K A;  4P56 A;  1MS7 A;  4AB5 A;  2MKZ A;  2OX3 A;  3TCG A;  5I3S A;  2XXI A;  1CNQ A;  4LZ7 A;  3JZJ A;  1OQH A;  5IZ3 A;  1NUY A;  3IFC A;  4BDN A;  3IFA A;  4RY1 A;  5IKB A;  3DP6 A;  5HBC A;  4NQ8 A;  4NF4 B;  4I40 A;  1MY4 A;  4M4G A;  3PUY E;  2V4C A;  2O69 A;  1FPD A;  2H9B A;  4O3C A;  4X48 A;  1YXI A;  1SBP A;  4LQ2 A;  3S9E A;  1QUI A;  1JQF A;  3GXA A;  1NV1 A;  1MM7 A;  3H6T A;  1MPB A;  1MRP A;  4JVI A;  1H43 A;  1B9J A;  1IXI A;  3BFT A;  3TKD A;  2FBP A;  5H8S A; 
#chains in the Genus database with same CATH homology
 1M5E A;  5I56 A;  3H4Z A;  1HSJ A;  3TDJ A;  4EQ9 A;  1QUK A;  4G68 A;  1ZU0 A;  2O6A A;  2DWA A;  4NF6 A;  4R72 A;  5AA4 B;  1QKA A;  3IOR A;  5HPQ A;  3DP4 A;  5ICT A;  5H8N A;  5AE4 A;  2D5W A;  3QUJ A;  3RY3 A;  4I1D A;  1SD3 A;  3RGY A;  2HAU A;  3CR9 A;  2NUV A;  2ZYO A;  3JYR A;  1SI1 A;  3MQ9 A;  3T96 B;  1MQG A;  2F78 A;  3K1M A;  4JBZ A;  4KR5 A;  2V3U A;  3BKI B;  2HXW A;  2O1M A;  1PBP A;  3G3K A;  3ILU B;  3WAE A;  3TTN A;  2V3Q A;  1IXG A;  1OMP A;  3TUS A;  2WKY A;  5AA3 A;  5I59 B;  4ONY A;  2PT1 A;  4ND9 A;  4F2O A;  1J1N A;  4FEB A;  4R9G A;  1NL5 A;  1Z7M E;  3I5O A;  4FE8 A;  4R6H A;  4GQO A;  3A3U A;  4DXC A;  1TWY A;  2VP1 A;  4M1V A;  1FQB A;  2XX8 A;  2I6E A;  4QF9 A;  1NMU A;  1B1H A;  4YB6 A;  1MY3 A;  4O3A A;  4KI0 E;  3T9U A;  3K1N A;  3OD7 A;  2HZK A;  2QSX A;  4EDP A;  2QRY A;  3H6U A;  1RKM A;  4DCY A;  2RC8 A;  2QMW A;  3LSX A;  2F6G A;  3SER A;  4X1B A;  4H5F A;  2GHA A;  1VSO A;  3CFX A;  4G2Z A;  4LAT A;  3TQW A;  1ATG A;  1PB9 A;  2HAV A;  5ICQ A;  4RXL A;  4JXI A;  5L9M A;  4WED A;  2YPN A;  1IQ7 A;  1FQA A;  2UXA A;  3T22 A;  1MXY A;  3G7W A;  2OCU A;  4R74 A;  1LFH A;  3FD3 A;  2V25 A;  1LB9 A;  4TQU Q;  1LLS A;  1B32 A;  2Q2C A;  3H6V A;  3B6W A;  2ZYK A;  2F7A A;  3CFZ A;  5CMB A;  3VE1 B;  1FCK A;  1ZTY A;  1IXC A;  3FXQ A;  3VFJ A;  4YMB A;  5DT6 A;  4OVJ A;  4C0R A;  1B7Z A;  5CMM A;  3PGF A;  3K4U A;  2D21 A;  4P0G A;  1B0L A;  4GWO A;  4C1T A;  1FTK A;  3LC8 A;  4YKI A;  3C4M A;  2ONK E;  2AYS A;  1USY H;  5I59 A;  3MBP A;  4PE5 B;  3QAX A;  4LZ5 A;  4JDF A;  3TAJ A;  1JW5 A;  2B65 A;  3P7I A;  4U4X A;  4Q5T A;  1GTK A;  4GIZ A;  2XXH A;  5H8H B;  2DS9 A;  2REJ A;  3IB1 A;  1DOT A;  2RC9 A;  5DVF A;  2HQ0 A;  3K6X A;  3F11 A;  1BKA A;  5ITP A;  2QS4 A;  3C36 A;  3PD8 A;  4WKM A;  1NNF A;  5CC2 A;  1H44 A;  1UTH A;  4UA8 A;  3EHT A;  4KD5 A;  4TLL B;  4QFK A;  2GH9 A;  3B7D A;  3SKP A;  3CSG A;  3K6U A;  5DVI A;  5ISU A;  5KDT B;  4K3F A;  1Y4T A;  4R2F A;  1N04 A;  3ODB A;  3UA8 A;  1AL3 A;  4THI A;  4RJZ A;  2DVZ A;  3H06 B;  2BJJ X;  4NED A;  4YB7 A;  1N84 A;  2DE2 A;  3TTM A;  4IO3 A;  3I6V A;  4POX A;  3V89 B;  2XXU A;  1RYX A;  1US5 A;  3SES A;  3N94 A;  3S9L C;  4P0I A;  2X26 A;  4OFL A;  3IR1 A;  3KOT A;  3K6V A;  4R2B A;  1YPN A;  4GD5 A;  1QW0 A;  4N13 A;  3GBA A;  3OSQ A;  4BDR A;  1YTV A;  2XXQ A;  2H98 A;  1URS A;  1Y3P A;  1S7Y A;  1ZIU A;  3PUZ E;  3FVG A;  1VFE A;  1OLA A;  3PPN A;  4H8I A;  3C34 A;  3S9N C;  3V8X B;  5J1D A;  4NE4 A;  4E0X A;  5DVJ A;  3TCF A;  3FVK A;  3SEU A;  3M8U A;  4BDQ A;  2XD2 A;  5H8H A;  4LA9 A;  2Y84 A;  2OK2 A;  3MVY A;  4U1O A;  1SW4 A;  1YCJ A;  4ZEC A;  3ILT B;  1UIU A;  4AQ4 A;  4YIC A;  2H99 A;  3UP9 A;  2GFE A;  4PET A;  3DEL B;  4U2R A;  4EQB A;  2Z8E A;  5L9S A;  3K6W A;  3T9H B;  2QS1 A;  3N5L A;  1A99 A;  4KQP A;  2V84 A;  1NNP A;  4IO5 A;  4DE8 A;  3PPR A;  2ZYM A;  1LGB C;  3T93 B;  4YKJ A;  4OYV A;  1B58 A;  3HHF A;  2PMS A;  5I56 B;  2I3V A;  5KDT A;  1OIB A;  3HST A;  2RF1 A;  2H25 A;  2V93 A;  2QS2 A;  4R9F A;  2KLF A;  1WOD A;  3U8Q A;  4JSO A;  5JTY A;  3CG1 A;  3MUQ A;  3EHU A;  3G3H A;  1UIV A;  3S4U A;  4R75 A;  4NF6 B;  4YKK A;  1F9B A;  1QUL A;  1XS5 A;  3KN7 A;  5H8N B;  3H3G A;  3O9P A;  4KCC A;  2QL3 A;  2YLN A;  5IAI A;  4KYD A;  3O6G A;  2W7Y A;  5EHM A;  1CB6 A;  3VDF A;  3K2D A;  2NVU B;  3VXC A;  1BP5 A;  2O51 A;  1N0T A;  1MM6 A;  4C1U A;  3U72 A;  3VV5 A;  3FGS A;  2IA4 A;  2X7Q A;  5FHN A;  1PB7 A;  4OTE A;  4G8N A;  4QFP A;  3IB2 A;  5I57 B;  3PPO A;  5FHO A;  3FVN A;  2VGQ A;  3EQ1 A;  1PDA A;  1SVX B;  2I49 A;  3ZKK A;  3FXU A;  4H5G A;  3LBS A;  1JNF A;  1MQD A;  1B0H A;  3IO4 A;  4F1V A;  3HO7 A;  3UN6 A;  1FQE A;  3G3F A;  4POW A;  3QYT A;  4NF8 B;  3Q27 A;  2E1S A;  5AA1 A;  3O6I A;  1T0K A;  5FHM A;  1H45 A;  2ESN A;  3ZS6 A;  2DWH A;  1B3L A;  3MW0 A;  3H03 A;  3TTK A;  1A8F A;  2Y7W A;  4HW8 A;  5AA2 D;  1N7W A;  1XT8 A;  4NWD A;  3Q29 A;  4JWO A;  1R1N A;  1SI0 A;  4G68 C;  3IOV A;  1XVX A;  3RT8 A;  1M5F A;  3KN8 A;  3E13 X;  4U21 A;  1DTG A;  4FED A;  4EXK A;  4FAT A;  2Z8F A;  3U93 A;  4OET A;  3UK4 A;  3AXF A;  1P1N A;  2NXO A;  1NNK A;  2PYY A;  2HFB A;  1JVX A;  3O2A A;  4GL0 A;  4RK2 A;  2Q9T A;  1SW1 A;  3Q25 A;  3USD A;  3TEP A;  5H8F B;  3KFM A;  1HSL A;  3N26 A;  4XKP A;  1Y1Z A;  1AOV A;  1DPE A;  5TU0 A;  3RPW A;  3FXR A;  2REG A;  4FEC A;  3MPL A;  4F3S A;  1P99 A;  3SEW A;  2F7C A;  4G8M A;  3RLF E;  1IUD A;  1B3F A;  3GZG A;  1SDX A;  3IK6 B;  1PB8 A;  3LUY A;  4DXU A;  1FW0 A;  2A5T B;  4DXB A;  4ZEB A;  2I0B A;  4MFI A;  3TEL A;  5I57 A;  3K00 A;  1N3W A;  2ANJ A;  2I4C A;  1OVT A;  2AL4 A;  3Q26 A;  3U92 A;  3K02 A;  2X7P A;  4BDL A;  3PMX A;  3MZ1 A;  5ELV A;  2VHA A;  1Y3Q A;  3DP8 A;  2I3W A;  5TPA B;  4MF3 A;  3RTW B;  4WEP A;  4NF8 A;  3MVW A;  3FV1 A;  3VLU A;  3B6Q A;  5JEI A;  3V83 A;  2XXY A;  5TP9 A;  4F2Q A;  1LBB A;  2R71 A;  4KYS A;  4YB5 A;  4RPO A;  4NMY A;  1LAG E;  5CMC A;  5F7V A;  1AH5 A;  4F22 A;  1XVY A;  2P1S A;  1M5D A;  1UTH B;  3IB0 A;  2RKM A;  4FOR A;  4IY5 A;  4ZZE A;  1Z7N E;  4KFQ A;  4XKR A;  3Q28 A;  4ESX A;  5I58 A;  4RYA A;  4DIG A;  3RN8 A;  3R7X A;  3KZG A;  4QFO A;  2I58 A;  4LZ8 A;  4LON B;  4OFO A;  4BDM A;  1MPD A;  5KCJ A;  4IGT A;  3O28 A;  2NOO A;  3C31 A;  1MXV A;  3OEL A;  2DXY A;  1NNT A;  2PX1 A;  3UIF A;  2YJP A;  4MBP A;  1LB8 A;  5H8F A;  5H8Q A;  2HZL A;  4ECF A;  5EHS A;  2O1L A;  1XOC A;  3KEI A;  3R26 A;  5CM6 A;  3UGW A;  2XXP A;  3IJO B;  2A5T A;  1A55 A;  4MLV A;  3TCH A;  1VFD A;  1Y4C A;  4GVO A;  4ISU A;  5BUU A;  3PV0 E;  3OMB A;  4L17 A;  3IX1 A;  4F3P A;  3CG3 A;  3EHS A;  5CBR A;  2ZXT A;  3QIM A;  5TPA A;  1Y1M A;  1B7U A;  2M8C A;  5AA2 B;  1EU8 A;  1Y3N A;  3JV9 A;  4QSE A;  1R9L A;  2Q89 A;  3ONM A;  1URG A;  4GLI A;  3HCQ A;  1H76 A;  1QUJ A;  3TTL A;  4O3B A;  3QXM A;  1LFI A;  3RUM A;  4OEU A;  3MPK A;  1A8E A;  3RQT A;  1PBQ A;  1MH3 A;  3PMV A;  1SW2 A;  3KJ7 A;  2G29 A;  1LFG A;  3C35 A;  1MH4 A;  3O97 A;  2F35 A;  4FIM A;  2CMO A;  5DTB A;  1B5J A;  1ANF A;  5JTY B;  5I2N B;  3OO6 A;  1ELJ A;  1SW5 A;  3CFL A;  2FYI A;  2B3B A;  3HV1 A;  4KCD A;  1IIT A;  4DZ1 A;  2OLB A;  1US4 A;  1A40 A;  4LP2 B;  3PD9 A;  4ELO A;  5ITO A;  1MQI A;  2QPQ A;  2AIX A;  3FVO A;  4P11 A;  4LQ5 A;  3R6U A;  1S9T A;  4ZS9 A;  3THI A;  5B70 A;  3T9X B;  2QS3 A;  5K2X A;  2GHB A;  3H6W A;  3UOR A;  4ZE8 A;  1FTO A;  3HN0 A;  4PFT A;  1NH7 A;  1TFD A;  1B3H A;  4IY6 A;  4OER A;  1JW1 A;  4KPT A;  5FTH A;  2RCA A;  3HPI A;  1I6B A;  1MDP 1;  5CMK A;  3A3C A;  5AA2 A;  4QHQ A;  1PEB A;  4Q30 B;  3VVD A;  3TZA A;  1GV8 A;  3A09 A;  5DYH A;  4IO2 A;  1P1W A;  2E0S A;  3QK6 A;  4YKP A;  2O68 A;  2DYX A;  3MP6 A;  4GRK A;  2R6G E;  2RIN A;  4R6Y A;  1D9V A;  3ECR A;  3C33 A;  4F3B A;  1GGG A;  1OLC A;  4ZEI A;  1LCT A;  1FQF A;  2UVJ A;  1B40 A;  2O7I A;  1EZP A;  2A5S A;  2XXT A;  2DE3 A;  4HCY A;  4X9T A;  4X1D A;  3FJM A;  4JSD A;  4MLQ A;  2H5Y A;  1MXU A;  3IOU A;  4ESW A;  4F3G A;  3BFU A;  3IL1 B;  1A7L A;  4NF5 B;  3QSL A;  1MXW A;  2Y7P A;  2XXV A;  1R9Q A;  1B3E A;  3FJ7 A;  3LR1 A;  3C9H A;  5I2N A;  4OZ9 A;  4OEV A;  2P0S A;  2LAO A;  3S9M C;  1MQJ A;  4EXL A;  1I6A A;  5K2Y A;  4ZEF A;  2DE4 A;  4F19 A;  1B5H A;  4H8J A;  4PFY A;  5CBS A;  1UQW A;  1A54 A;  3N6T A;  2Q88 A;  4HS7 A;  4Z7E A;  4QFN A;  1MY1 A;  4LUB A;  1BLF A;  1B5I A;  1ZLQ A;  3PU5 A;  4H67 A;  4IB2 A;  3PMW A;  1LBC A;  3IO6 A;  4GF8 A;  3I3V A;  4EF2 A;  3G3G A;  1JEU A;  3OEM A;  1BIY A;  2XXX A;  1M5C A;  4TLM B;  2DSF A;  3TYH A;  3MP8 A;  1MG1 A;  3MVZ A;  2V3T A;  4ZZA A;  4U1Z A;  4MH5 A;  3O29 A;  3W9V A;  5KZT A;  3FZV A;  2VOZ A;  1JW4 A;  4XXU A;  3FJG A;  4RK9 A;  2XX9 A;  4QSD A;  3LSW A;  2DXR A;  1VR5 A;  1IIW A;  1NFT A;  1SQY A;  4IO6 A;  3MP1 A;  1N3X A;  5I84 A;  3IOT A;  4GXA A;  1EZO A;  5TP9 B;  1NKX A;  4H1X A;  4R6K A;  4ZE9 A;  1Y9U A;  3W15 C;  4ELP A;  1N7X A;  2AL5 A;  1UTB B;  3LSF B;  2Y7K A;  2NWJ A;  5M2V A;  1DSN A;  1URD A;  1WVJ A;  1I69 A;  3MZ9 A;  1FTM A;  4NF5 A;  1B1X A;  1IZ1 A;  3KJT A;  3E4R A;  2B3F A;  2UVG A;  4OES A;  3SEV A;  3ZKL A;  4PQJ A;  1MQH A;  1TFA A;  3TMG A;  1JVY A;  1FTL A;  1H3D A;  5I58 B;  1MDQ A;  3TTR A;  2DP8 A;  4KYE A;  3VLW A;  1AIV A;  3EN3 A;  3RTF B;  1O7T A;  3TFL A;  1ZKB A;  4F1Y A;  4JWX A;  5KCJ B;  4GFR A;  3VLV A;  5A5X A;  4G4P A;  4GL8 A;  4U4S A;  1KWH A;  5L9O A;  2RCB A;  2ZNU A;  5H8Q B;  3U1O A;  4YZZ A;  3K01 A;  4H65 A;  1ZMG A;  2XX7 A;  1B46 A;  4RNS A;  3VXB A;  3FAS A;  4ZEK A;  3CSB A;  5FTI A;  4U23 A;  3MWB A;  3D4G A;  4OMB A;  2Z22 A;  1GR2 A;  4BLA A;  3FAT A;  2G93 A;  3B6T A;  2UYF A;  3T9V A;  2F5X A;  1LCF A;  2XHD A;  4R73 A;  3T66 A;  2F36 A;  3QUF A;  4HTG A;  1OVB A;  4N6P A;  3MAM A;  4YMA A;  1Q35 A;  1TXF A;  3RNN A;  3TPA A;  4NF4 A;  2QJE A;  3SEY A;  2ZYN A;  2CZL A;  4XIG Q;  3MJN A;  4XKQ A;  1CE2 A;  1I6Q A;  2I48 A;  1UTB A;  2XD3 A;  3DLN A;  4G77 A;  5BWJ A;  2HCA A;  2OZZ A;  3WAF A;  4UAC A;  4HCW A;  1NH8 A;  2FNC A;  5I2K B;  3TOD A;  3CVG A;  2H4I A;  3SEX A;  3LSL A;  1XC1 A;  4OWD A;  2Z23 A;  2UVI A;  1JEV A;  3M3F A;  2FA7 A;  3KSJ A;  3IJX B;  3G3I A;  1S50 A;  4OQO A;  3ZSF A;  5CI5 A;  5HM4 B;  2ZNS A;  4DLD A;  4XTC Q;  2ONR A;  3KGC A;  3S2V A;  3H7M A;  3VVE A;  2F7B A;  5AA4 A;  3OXN A;  3PUV E;  4F29 A;  1EZ9 A;  3GLB A;  2P2A A;  1D4N A;  1LAF E;  2Y7I A;  3MC2 A;  3CIJ A;  1OQG A;  2PT2 A;  3PUW E;  1O64 A;  2OJT A;  1AMF A;  4NWC A;  5F1Q A;  4E0W A;  5L8D A;  4Q8R A;  3D4C A;  4F18 A;  3KSX A;  1VE4 A;  3BBR A;  3OEK A;  1B6H A;  1R6Z A;  4IO7 A;  2HEU A;  1MY0 A;  3CRB A;  1LAH E;  2UYE A;  3KBR A;  2ABH A;  3IAZ A;  1QVS A;  2XXR A;  1TT1 A;  4XKN A;  3VVF A;  4IGR A;  2VD2 A;  1P1Q A;  2DQV A;  1Q1K A;  2Z8D A;  1MY2 A;  1QKB A;  4H0W A;  3EF7 A;  1ZBM A;  2OWS A;  2DWJ A;  1B3G A;  1FQC A;  3L6H A;  1BTJ A;  4Z0I A;  1DMB A;  4IO4 A;  1GVC A;  2O84 X;  3MZB A;  4GOT A;  4OEN A;  4OXV A;  3IOW A;  3EPE A;  3O6H A;  2I4B A;  5I2K A;  2O7U A;  1FQD A;  3N6U A;  4QFL A;  2QMX A;  2ZMB A;  4U22 A;  1POT A;  4F39 A;  1MPC A;  2F97 A;  4JB7 A;  3C32 A;  4EQ7 A;  5EYF A;  2OWT A;  1II5 A;  1IEJ A;  2IEE A;  4PP0 A;  1M5B A;  1USY E;  4YU0 A;  1EH3 A;  3K1P A;  1MXZ A;  2DWI A;  2RC7 A;  3E3K A;  4EF1 A;  4F1U A;  1QJM A;  1L5T A;  4YAH X;  4H6D A;  4G8H A;  5JK4 A;  3M3K A;  2ZNT A;  3PPQ A;  4BDO A;  3FIR A;  1LST A;  2D3I A;  5DEX B;  3KG2 A;  2Y7R A;  4JWY A;  1B51 A;  3L6G A;  1B4Z A;  1N76 A;  1YAE A;  4PFU A;  2PBW A;  3TQL A;  4I9D A;  2I0C A;  3OEN A;  4I8C A;  3O66 A;  4PFW A;  5CRY A;  1PC3 A;  4TOZ A;  1RYO A;  1B7H A;  3SDF A;  4OFJ A;  3W9W A;  3KOS A;  4FAJ A;  4N07 A;  4NTL A;  4EUO A;  3OSR A;  2UVH A;  4ZDM A;  1FTJ A;  1MXX A;  4OHN A;  3DM0 A;  1SYI A;  2Q8J A;  3FV2 A;  2R9J A;  4ELQ A;  3E9X A;  2ONS A;  4WXJ A;  4F31 B;  2Q2A A;  1HSE A;  1B4H A;  3MVX A;  1XHY A;  4FJP A;  3K0V A;  3M3L A;  2XXW A;  1O63 A;  5LOM A;  1ZJL A;  3GBB A;  1SYH A;  4QRZ A;  1P1U A;  2DVC A;  2F8D A;  4QSC A;  2ALU A;  1JET A;  1WDN A;  1D9Y A;  1POY 1;  3PUX E;  3OO7 A;  3FUZ A;  2OBG A;  4RA1 A;  4Q0C A;  4GXS B;  3HHG A;  3G3J A;  1B05 A;  3OO8 A;  3KN3 A;  1B52 A;  3CI8 A;  4G68 B;  1Y20 A;  5A5X B;  4KHZ E;  2PVU A;  2F6P A;  1LAX A;  1B2H A;  5DEX A;  2THI A;  4ZED A;  4LVQ A;  3OOA A;  3SET A;  2GRV A;  4I62 A;  1DPP A;  2DOJ A;  3OO9 A;  1P1O A;  3V5A A;  2F34 A;  3RT6 B;  3PPP A;  4RPN A;  4AB6 A;  3U94 A;  4DCX A;  4DDD A;  1IXH A;  2VD3 A;  4ELR A;  5B7D A;  1DTZ A;  1D3K A;  1MS7 A;  4AB5 A;  3TCG A;  2XXI A;  4LZ7 A;  3JZJ A;  1OQH A;  4BDN A;  4RY1 A;  5IKB A;  3DP6 A;  5HBC A;  4NF4 B;  1MY4 A;  4M4G A;  3PUY E;  2O69 A;  2H9B A;  4O3C A;  4X48 A;  1SBP A;  4LQ2 A;  3S9E A;  1QUI A;  1JQF A;  3GXA A;  1MM7 A;  3H6T A;  1MPB A;  1MRP A;  1H43 A;  1B9J A;  1IXI A;  3BFT A;  3TKD A;  5H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...