3LRHA

Structure of anti-huntingtin vl domain in complex with huntingtin peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
PVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-huntingtin VL domain
publication title A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 27
structure length 109
sequence length 109
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrhA00
3CFCH 4U6YA 4ZPVA 1FN4B 4OUUA 3TJEH 2DQGL 5C07B 1G7JB 1U95B 3AS1A 4M8QA 2VDRH 1JI2A 1H3VA 3IDNB 4QXWA 4GO6B 1H8SA 4KZEL 1MAKA 2ITCA 1VGKA 1KXVC 3DVIA 2QEJA 1NUNB 2IAMC 1MCLA 3TV3L 3HPJB 5L8JB 5I16A 2IFFL 2J5LC 4GS7B 3NCYS 3ARWA 1FZOA 3TN0A 4R9HA 1ZWIA 4HBCL 1A1NA 3HNVL 4CVXA 4TUKL 2EZ0C 3MLXH 4LARL 4P59H 5J56B 2JK5A 3V7MA 1ZANH 4RX4D 3KYMB 2ESVA 3CDFA 1NC4D 5DD5H 4P46A 4G80B 3GSQA 1QBLH 2YA1A 1GPOH 1YEHL 3ETBF 1HNFA 4AYFA 2AK4D 5B3JF 4NZUL 3CH8A 3PP4L 2HLAB 4PR5B 5GS2H 3VWJD 4O02L 1MJJA 4X5XB 4N8VG 5HPMB 1B2WL 3LY6A 3BGFC 4GXVH 5FYKU 2YN3A 1LQSR 1R5IA 3QI9C 3W39A 2Y1VA 4ETQB 3QNZB 3OR6A 3OR7B 4F2MA 3V6ZA 5GGUB 1NFKA 5IHBA 4RX4A 3OKOA 1A6ZB 4RGMC 2A1WH 1WEJL 1NC4A 4WI6A 3STBA 4DTGL 5SX5K 3KPPB 3OMZA 2AK4A 2L0DA 1OL0A 4M6OL 3GI8H 3BDBA 3E6FA 1RZ8A 1HKFA 2X7LA 3UP1A 3VWJA 3JWDC 3OKEB 4NO5A 2WBJA 3LQAH 4PLJD 3VXME 5I17A 1NAKL 2OMNA 5CEXB 2IH3A 1FZKA 3MRMA 1WZMA 4S1RL 5ADPL 3P9MA 4XTRC 3HC3L 1FHGA 5DUPL 3DUSB 4EN3A 2GSIB 3BKCL 1F2QA 4NT6A 3QRFM 4JPWL 3QWOA 4KAQH 3BISA 2UVFA 1X4XA 3AB0B 5D1XB 3H9SE 1KXTB 1Q9LB 2WW8A 1CXHA 4UQ3B 1MHCB 1OPGH 5FO7B 2V5YA 3LN4B 1HSAA 4XVJL 4O2EB 3QEHB 4DZ8A 3ARUA 2COQA 1BWWA 4JFQA 5SX4H 3PWLB 3LN5A 12E8L 2P8PB 1ZLUH 3SKMB 1I85C 3WHXB 3MREA 2OTPA 1IGFL 3U4BL 2FO1A 1TMCB 4U1NB 1M6OA 1I3RB 2VH5H 3DVFA 4LQ1A 4L4VE 4BZYA 1AXTH 3HLAB 3LMJH 4Q9BA 2K9UA 4PB9L 5CHNB 4ELKA 3MRRB 1E0OB 4Z7UE 4YIQB 4UV4H 4QHNA 3V6OE 3U0WL 4HIXH 4XPAL 3KPOB 2R1XA 1JWUB 5I1LA 1FNFA 4QRRB 5GGVY 2IANB 2UYLB 4NIKB 5DJAB 3SDXA 3JWOC 1A6VH 3TVMC 1WF5A 3QAZC 2P8LA 3OKKA 4AMKL 3S36X 4JCMA 3WUWG 3VXQB 4HJJH 3MPCA 3VFPB 1P5UA 5GS0L 1UG9A 5CSZB 4N5EC 4X7SL 1QOKA 2XWBA 4JREB 4XT1C 4PRNA 5CAYB 1DN0B 3OAZH 4KQ3L 4LQFH 4P2RE 4U05A 4WCYH 4FFWD 2GAZB 5L8KB 2ADGB 3UX9B 4RA3A 3VXMB 1Y18B 2CMRL 4WU7A 1T1ZA 4HLZG 4X0KA 4LF3A 3NIFE 3D9AH 1CLZH 1MAMH 3EJYD 1OQXA 3UTQA 3TBYB 5L9DH 1D9KB 3D0VA 1GRWA 3GBML 3WEXA 3R06A 4YBHA 4JFDD 4EDWL 3QUZD 3IAQA 1A9EA 3D39D 5C0RL 1CLOL 1NDMB 3LIZL 5CCKL 3DYMA 3S5LB 3MACL 1AO7E 5IEHB 2V7NA 2GY7B 4E41D 1N64L 1KTRL 1RQ5A 4WTWA 1A0QH 3UZVB 1DN2A 5DVOA 1XIWB 4RBPK 5D96C 4QRSB 4LCUB 4KK9C 2AJUL 1MI5A 5E2VL 5DFTA 3DVGA 3U79A 1A7PL 4ZODA 3WO3B 4D3CL 2CLZB 2JE8A 4BK5A 4HPOL 4L4VB 5LGHL 4C56D 5IHZA 5BVJA 5GSRB 3AROA 4O9HL 4JFDA 3AY4C 4P2OD 3QUZA 3OAUH 3D39A 2R2HB 4NQCD 2EC9T 3CC5A 2XZQH 3QFDB 4E41A 3LEXB 1KEMH 4OLVL 1RIUH 1S5HB 4KUZL 3ZT5A 2VDNH 2Q87A 4WHTB 3RGVD 4ODVL 1LVEA 4YHYB 4ORGA 3FQXA 3S36L 2DQFA 4XCFH 4P2YA 2FEEI 1IGJB 3BGAA 4MGXA 2Z0BA 3EZ8A 1JTTA 5DJ0A 1UXSB 1LP9F 3GSXA 2XRAH 4NC1C 1Q94B 1RIVL 3MRCA 3MLZL 5L2KB 3Q6FA 5E08L 3P0YH 1IKFL 4PJ7E 4PJAF 5EWIL 4C56A 3ZDYE 3PQYE 2OI9B 4P2OA 2FHBA 4IOIA 5CEZL 2F8VA 4HGMA 3WFZA 1T04A 4G9FE 3GO1H 4P2RB 3VWKD 5KAQF 1RU9L 4NQCA 4O51B 4C83B 4JRYB 4J2XA 4DQOH 5EU7E 2KQMA 3TBVB 4UDUA 2CD0A 4GG6A 3DV4B 4RRPA 1XAUA 1LWRA 2UV3A 3FB5B 2DB8A 2NXYC 4WV1A 1NGWB 4HKZB 1TJHL 2ADJA 4N0CC 1BQHB 1JK8A 1ZMYA 3ARQA 2HYMA 2YUVA 1MF2H 3QNXB 4BJLA 1FFPA 2PKDA 2XI9A 1N0XH 5C09B 1XF2B 2V5SA 3S37H 3VWKA 4KMQA 2FJFA 2ESVE 1CR9H 1E6OH 1YEIL 1C5CL 1AGFA 1T0MB 4YHKL 5TGBB 2BY0A 4X6FB 2VL5B 1KC5H 5TE4L 1QEWA 2HJLB 1FFOA 1FRGH 4LSUH 3SGDH 1PFCA 1T0NB 5DUMH 5JZ7C 4N90E 4OFVA 5AUMA 1MCJA 4HD9A 4XRCA 5JTWA 3O3UN 2G9HA 5K93A 1FYTB 2JJSC 5EIIB 1KB5B 3BOVA 3L3GA 4J3SA 5D1QC 6FABL 5SX4I 4HFUH 3RQ3A 3MO1B 5F6HI 3X12B 3ABZA 5K59E 1OTUC 4OT1H 4DCQA 1RZJH 5C6TH 2AK4E 5GZNC 3Q5OA 3CLEH 4OQTH 5B8CA 3FTGA 5GS1A 2DQTL 1ZGLB 2FEDC 2FLBT 2EC9U 3KPMA 3QG6B 4PJ7B 4OGXL 4PREA 2ICWJ 4RZCB 1CLYL 4K71C 1OAYH 3PQYB 5F89B 4PRHE 1KPRA 1UM5H 1YEGH 4K2UL 1J0KA 1NQBA 4ZPVB 4YBLC 3VXSB 1U3HC 4OUUB 4TNVK 1NH6A 4M8QB 4XWOC 2GEEA 2ZKHL 3O3DB 5HDBE 2GJZA 1UYWH 4P9MH 3ALXA 5C0EA 1VGKB 4UDTA 4YDKH 5J9PA 1MFEH 5T1MA 1F3RB 5I16B 3IRZA 5GIRA 2FX7H 1FZOB 3LKRA 1L7IL 3TN0B 1ZWIB 3ES6A 3IFPB 1A1NB 5GRYA 4CVXB 4AEIH 2DQJH 4JHBA 1YEJL 3QXAB 3IS1X 4OB5L 4ZFGH 3FFDA 1EA9C 1KJMA 4XCYA 5I75C 1EO8H 3GSQB 2I60L 1CICD 1QVOA 4DKDC 5FKAA 1SJEA 3B9KB 3ZDZF 1AY1L 1HKLL 5D7KE 5F9WB 4NJ9H 2DI7A 3VG0L 2VSCA 1NMBH 4HFWA 3G6AB 1F8TH 1UQSA 2XZAL 4M43H 1VA9A 5HTSA 4BFEA 4WIQA 3PIQA 2AI0L 1DLHA 1ZV5A 2P8MA 4PJCB 5DJXA 2ZCHH 3W39B 5F6IB 3FO9A 2NX5B 3OR6B 3V6ZB 1ZT1B 2OBGA 3BPNB 5BW7C 3QDGA 3U7YH 3OKOB 1NC4B 1YUHA 5IP4A 4UT9L 3MV11 2FJHA 3U48A 1CICA 2CK0H 3WS6C 2AK4B 5IKCA 3QO1A 3UAJC 3E6FB 3OPZL 3VWJB 4NOFA 3RWDA 1NMAL 5I76A 4OQ1A 5I17B 2VWEE 3F7QA 1LMKA 3QDJD 1WBXA 1FZKB 1Y0LB 3MRMB 3P9MB 5JW4N 5FM5M 3QJFA 1H9VA 5FYJL 3GHEH 1A7NL 4DKAA 3W0WD 1VPOH 5EOTA 1C12A 4NT6B 1FNSL 4JN2A 2FX8L 4NP4L 3QWOB 4MJ5A 5FUZL 4OBSA 1ACYH 1FYHB 5FGSA 3MJ8A 4P5MA 1MNUH 2WP3O 4KV5E 3IAGC 4DGIH 4M1GH 3FB6A 1FZJA 1YYLL 1P4IL 4G8GE 3C8HA 5IBLD 2OMBA 4B53A 3BZDA 5MEPA 3ARYA 5GGSA 3QHZL 3QUYC 3I3EA 4KY1H 3B3IA 1GGYA 1QLRA 3TBSA 1QHOA 4MAUL 4WTXA 5DEZA 4JM2D 4JFQB 1CFVH 3LN5B 1CGXA 1A4JA 1MI5E 1KNOA 3QDJA 2NY0D 1B3JA 4WO4D 4ZS6C 2BMKB 5HGAB 2ORBL 1DZBA 2BDNL 3MCLL 1M6OB 4YDIL 3W0WA 5KAQG 4LHUD 2B39A 4HXAH 3ZT6A 2AJVL 2RHEA 4OJFH 1UKSA 2R0WL 2GW5A 4JFDE 4MB5A 3D39E 2HKHH 2RJMA 2EDLA 3GMLA 5C08E 4MQ7A 4QHNB 4D9QD 2CPCA 3O2VL 5IMLA 4E41E 3C08H 3MRQA 5I1LB 4JHWH 3OJMB 3BN9D 5EBLA 3G6DH 1PLGL 1D3CA 4ODXA 3SDXB 4CN1A 1RK1A 1NCDL 3Q5TA 4F3FA 4JM2A 2VZOA 1BQSA 2OK0H 2P8LB 4JLRB 3DVNA 4M00A 1JWMA 3SBWC 4X80H 2BOBA 2N4IA 3OKKB 4NN5C 4WO4A 4OM1H 3S8WA 3QIUD 4LHUA 3MGOB 1G6RH 3INUH 2X1OA 3L5WA 5BV7H 4JG1L 5AWNH 5DD1L 4C56E 4FFVD 1RURH 5ALBL 5EG6C 3WN5A 2IQ9H 4J23A 5J6GA 3O4OC 5I30H 3RP1A 3BP5B 5F70A 5FB8B 4U1HB 4X9BA 4WW2A 1T1ZB 4X0KB 5B39G 4LF3B 1TCRA 4JFEB 3UTQB 5C0NC 4Q7DA 1DBKH 3D0VB 4Z95H 3R06B 2XWJA 3C6LD 4ODBD 1A9EB 3HE7C 2EXYC 3QIUA 1NGYA 1IAIH 2PO6C 2YKLL 4NCDA 4D0CB 4U4BA 1EEUA 2V7NB 1YPZB 4H26B 2APWA 1TZGH 4PJEF 2HTKC 4PGJA 4YJZL 4I0KA 3RWFA 1U8NA 4PJ8A 3T04D 3FT3B 3RX5A 5IFAH 3N1FC 4GBXC 2B4CH 1FVCA 1BD2D 3DECA 3UROR 3DVGB 5DFWH 1RHHA 3HAEB 2X1WL 2EDEA 3CFEA 1UB5B 1F4XH 3HZYA 5IQ9A 5BJTA 1TENA 3TFKC 1NCNA 5IHZB 5BVJB 5L2JB 2V7HA 4JFDB 5FA3A 3QUZB 3LQZA 3C6LA 4LAQH 3D39B 2X4QA 4AT6A 1BM3H 4HWZB 3SDCC 3CC5B 3BWUC 1KT2A 2HTLD 2ICWA 3FMGH 4Q9RH 1CQYA 4D94A 2BNRD 1UWEL 4U1JA 4WEBL 4G6KL 4YNYA 1CDJA 2LE9A 3UJIL 4ORGB 1FNGB 1QYGL 3CXDH 4C59B 1MCHA 4X7CC 3KYAA 5EH1A 1S7SB 2A6DB 2KQNA 1BD2A 1FVDA 1GGTA 5DJ0B 1Q72L 5KOVC 3T4YA 2VISA 4YXHH 1DVFD 3MRCB 1BZ9A 1TIUA 1VENA 2ERJB 2X1XR 3Q6FB 1YNLL 1I7TB 1Q9KA 4WFFD 2VLJE 4C56B 4P2OB 4IOIB 3TJHD 1T04B 3C8KA 4NQCB 3MFFA 4QYOB 4HKJA 4LASH 4NWTH 3QCVL 4L8DA 4G6FD 4ELMF 3H42H 2BNRA 1W0VA 1XF3A 5EO0B 4K3JH 1M71A 3RGVB 4GG6B 3IDMA 3QEQD 4K23L 3BKJL 2JLLA 4PJFA 3GJFH 3R0MA 5I71B 4NHCH 4WV1B 5DA0B 1UH4A 1NAMA 1DVFA 2ADJB 4JFPB 2Y06L 4JO4H 1SEQH 3G5VB 3QRGL 4G8IA 2EO1A 3BW9A 5GGTA 5EDXA 5I66A 1FFPB 5IB4B 3DIFA 3EFDH 3N0PB 4NC2B 2MCG1 1AGFB 1JNNL 3ESUF 3VRJB 2Q8AH 1IARB 1QEWB 4TSBL 1FFOB 1NBVH 3QEQA 3RY6C 4WUKH 3B4NA 2BSTB 1CE1L 1VSCA 3ZO0A 4LPVA 3WMSA 2BVYA 3MLUH 2D4DA 3LKNA 1FBIL 4XRCB 5AUMB 1F3DJ 1LE5B 1WT5C 2VAJA 2G9HB 5D7SH 1QACA 5I1DA 2B1HL 3N1PC 4KC3B 2FBJL 3L3GB 4MQXC 1PZUB 1XZ0A 1EHLH 1WSST 2Z31C 4KTEL 1JPTL 4GFTB 2V2TA 3QCTH 1JYVA 1QA9A 2A83A 3QDGE 2YOCA 5IJKC 2DLFL 2FYYA 5F3BA 1IEAA 3WKML 1QFUH 2KKQA 4HGWA 1PQZA 3QULA 5DZOA 2XN9E 4HKBA 4CW1A 4IOFD 5J1AA 2N7BA 5KVGL 1J9CT 2OZ4A 5B8CB 3FTGB 5GS1B 3NIDE 1A6WL 1NMCB 1X3DA 3EYSL 2XFXA 3KPMB 4PREB 3W5MA 4FQXC 4NN7B 2XXMB 1QFWM 3B9AA 3CVHH 4MZ3A 1KPRB 5ID0A 1PSKL 4B7LA 3GI9H 3JV5A 4LCCC 4V2CB 4XC1L 3S98A 3K2MC 4HPYH 2HKFL 4D9LL 4ZUWA 1HYRC 2GJZB 1BZQK 2OJZH 4OLUH 2UVEA 5C0EB 4JHZA 5ECJE 5J9PB 4EXPX 1DQJA 1QHPA 3KGRA 4PJHA 2CO6B 1CFSA 5GIRB 1JUFA 4RDQF 2V17L 1ZS8A 2BJML 1IM9D 1NUFA 2WBKA 3ELAT 5ESQB 5FYKD 5DJ8A 3TA3B 2NZ9C 2WINA 5DURD 5INCA 5HYQA 3FFDB 1X5XA 4GRLC 3SE3C 4XCYB 5CZVH 3VRLF 3VG9B 4NN6C 4JQXC 1U8IB 3VFRB 3QQ4A 4RISH 1FE8L 1QVOB 1SJEB 5HHME 1YNTA 1D5MA 4HUMB 2VDLH 5A1AA 5HI4C 4HFWB 1IAII 2E5EA 4WU5A 1UQSB 4LGSB 5E4EC 4PTTA 3SGJC 4DK3A 2Z9TA 2EXWD 5CJOL 1JFQH 4N8PA 3PIQB 4IRZL 1IM9A 1DLHB 1NL0H 3MTRA 4IDLA 5DJXB 1TJIH 1WWAX 1X6NA 3MNWA 1OWRM 1YEFL 1Z3GH 2CGRL 5T5FH 2AXGB 2VQUA 1EVTC 4NM4L 3HC0A 4GXUN 3BPOC 2JJVA 4MX7A 4NZTH 1U8PA 3IFLL 5IKCB 2J6EA 1OP9A 3LD8C 4TTDC 3ZSSA 1BAFH 3U46A 4YHLL 3BJ91 4LDOB 4XNXH 3T08A 4GAFB 2E9IA 1CWVA 4S10A 3WXWH 4M7JH 1NLDL 1BEYL 3DX6A 5B4MC 3QJFB 1MJ7L 2DDQL 2J8UA 1GGUA 4KKCD 3K8LA 5EOTB 1FL5A 1C12B 2YA2A 3DETD 3HCVA 1P4BH 4JO3L 3L7EB 5DMYA 3V7AG 2AS5M 1T4KA 3P77B 3FB6B 3GDBA 1FZJB 3CAFA 2JTDA 4NNXA 2DIJA 3WCYA 4G7YH 4JVWA 5T1DH 4O58H 5IVXA 5MEPB 4K94L 1F5WA 5GGSB 2QHLA 1N2RA 1JGVH 3T1FA 3ILPB 1JMZA 3SJVD 1S7XA 5MI0B 4UU9A 5F7FA 1A4JB 3C6SA 4ERSL 4KRLB 5LWYL 3GSNB 3QDJB 1BQLL 1UWXK 2E27L 4LPXA 4LSRH 3W0WB 3RU8L 3RDTC 4UAOB 3KLAA 1EUTA 3NPSC 4HS6A 5BQ7A 2HFGH 3A6CH 5I1EL 1CGVA 2HH0L 3GMLB 4MQ7B 1KULA 4G42A 2B2XH 5IMLB 2ZCLH 3DHMA 4JE4B 4LLDA 1CN4A 3MRQB 2AK1H 3ZLQC 5EBLB 3T3MF 2R0KH 1WUNT 4UOJA 2I5YH 3QIBD 2A6IB 4ODXB 3ZE1E 1UH3A 1EVUA 4F3FB 1KJ2H 3SJVA 3HN3A 5DO2D 4JM2B 3UPCA 2BXZA 5KVEH 4R4FL 3BKYH 1KELH 3GSRB 5DHVA 3S34H 1BD2E 2BOBB 2NY0B 4V1DE 4WO4B 1A3QA 2EH8L 2OJEA 4PJIB 4LHUB 1UZ6F 3ZHDA 2ADFH 3L5WB 1IC7L 3HMXL 5DUBA 1BVLA 1FG2A 3CPLA 2LU7A 1V7ML 1UJ3C 4UI2A 1UM4H 4YGAB 4ZFZB 5J6GB 4XNQA 3G04A 4WW2B 2BNRE 2EE2A 1RZFL 3QIBA 3WXVH 5FFLA 3ZKNC 4WJ5A 3QUMH 1MEXL 1XGTA 3V52H 3LDBB 1RIHH 4AG4H 1QFWL 3MV7D 2CDEB 1MCEA 1I7ZA 1ZTXH 1L9NA 5LXGL 1NSNL 3QIUB 2HRPH 3WFCL 1I9RH 2HT2C 4WFFE 1J7VR 5I2IA 4U33A 5EU3A 5F1SA 2R8SH 1NCCL 3MFGB 4PY7A 4ONFH 1SM3L 1KPUA 3MBXH 4HSQA 1LEIA 1OT1A 1BVZA 4LRIA 4WI5A 3WJLA 1U8NB 3QH3A 4M4RA 1EMTH 1INDH 1GVIA 2AGJH 3D3VD 1H3XA 3RAJL 3VFGL 2AV1A 1RHHB 3O6LL 5DMJB 2IFGA 1MFAL 3G9AB 4Y4KC 3CFEB 3T8XA 3HZYB 5BJTB 4XNMA 1WICA 4J8RA 4ZO8A 3RVVC 2V7HB 3MV7A 2JB6A 3C6LB 3LQZB 1TXKA 2Y5TA 1FCCA 1P6FA 3ARGC 4AT6B 5CKAA 5C9KA 4BZ1L 5IT2H 1KT2B 2ICWB 3VE0B 2DM2A 1BFTA 4U1JB 4RDQG 1I9IH 4PG2C 2BNQD 3OXSA 4OZHA 1QRKA 1LO4H 4P2QB 1YYML 3JV4A 5JQ6H 3LSOA 3T3PF 3ZDXE 3D3VA 1FVDB 2ZJSH 5ICXA 4BA8A 1EO7A 4NRYA 2VISB 3QQ9D 5IVNA 1BZ9B 1KJ3L 2VLLA 1RPQA 3GBNH 3VFMA 2QL1A 1F02I 3D87B 5EO1A 3K46A 4O5LH 5FGRA 3C8KB 2ADIB 3PGCA 3MFFB 3OG6B 2ARJB 5MP6H 4I0PC 5HYIA 2B5IC 4M62H 4HIEA 4KXZH 3NCFB 5A3ID 1OCWL 2BNQA 2EDOA 4GAJH 1HZHL 4NKDA 3EO9H 1UVQA 2VXSL 3MR9B 3MNVA 4DAGH 4F7EA 4PJFB 4PJHE 3MROB 3MLYH 5BOPA 4RFNC 2BSED 3MZGB 1A14H 1DVFB 3IT8D 1TJGH 5L88H 4G8IB 4OCWH 1ZHLA 1MCWW 5GXBB 1ZEAL 3BW9B 5I66B 1F6FB 4YXLH 3HRZA 4UNTA 2PTTA 3DIFB 5L6YL 2XTJC 4JPVL 3MRGA 3EYQD 4G6FB 2JCCA 3IDYC 2HA1A 3CDYA 1CDIA 3HFML 5EBWB 5KG9A 1HOCA 3QEQB 4F80A 5JNYA 4GKZA 1PX4A 2ID5A 2O5ZL 3LKNB 5IHLB 4X6CA 3DX9A 4DZBA 2IJ0C 4GW4A 1RZKL 4KJQC 1SYVA 5KS9A 1JTPA 3X17A 5I9QB 2AABH 3B9DA 5E7BA 4FTVA 4XPTL 1H3PH 1XZ0B 1FPTL 5EZJA 4JRXB 5FYKE 3UTPD 4X6DA 3W2DL 3CFIC 4GMSL 4H1LG 5DLML 4BSVA 2A83B 5B21A 1MLBB 5DVNA 4F37K 4HJ0D 4OF3A 3RI5K 1NCWL 4LIQL 4HGWB 1PQZB 4AJ0A 3QULB 1P69B 4M9PA 5T1LB 4YFLF 4HKBB 4CW1B 3ARDC 5J1AB 1PG7X 1T03L 1U42A 5EC1A 1S5IL 3KLDA 3EBAA 5K9JL 3CGTA 1X5ZA 1CXEA 1JP5A 1KENL 1CZ8H 5KN5B 1EFXD 1A7RH 1FO0L 1X5KA 3C9NA 4F58L 1U2HA 2J8UE 3GRWL 3ZKXC 4HK0B 4UT7H 2OTWB 2VXVL 3LH2L 1G9ML 3QB7C 4ZUWB 4RFOH 3WIHA 4FG6D 2P45B 5CILL 2O5YH 1N5YH 5BMFH 5IBUB 5TE7L 5HDQH 5FAAA 4MB3A 4PJHB 3M8OL 5C0GA 1CFSB 4DGVL 1OOAA 1JUFB 5FCSH 1ZS8B 2AW2A 2Z4QA 3SKOA 2IPTL 1L0XA 3O2WH 1EFXA 3MJ7B 1YY9C 4EUPH 5E2UH 2MCPH 2AEPL 2WINB 5INCB 2WIMA 4NC1E 3PL6C 5HYQB 4OSUL 1NEZA 2OLDA 5C92A 2EH7L 1OT2A 4ZO6A 4UTBL 3TWCH 4ONOA 2NY2C 3T0EA 5KSUA 1ZKAA 1YNTB 1DBJL 1D5MB 4N9OB 3UO1L 3C5JB 2ZUQC 4LCIL 5EZOH 4P23C 4TRPH 4WU5B 25C8L 3IKKA 5DVKA 3BZ4B 1HSBB 1B0WA 2Y25A 1QR1A 4LK4A 4TUOA 3SJVE 4JR9L 1IM9B 1XGUA 2CKBL 3SDAD 2APVA 3KYNA 3MNWB 4P9HL 2DKSA 3LB6D 2IGFH 4MJ4A 5DURB 4GXUM 2IADA 3HE7A 4GOSA 2MHAA 1LO2L 4JPKL 4MX7B 4WTZG 3SO3C 2QQNH 1U8PB 5IWLC 4KDTA 1OAXL 3D1MC 3NIGF 1SJXA 4XX1E 5KANG 4YE4H 3ZTNH 5FYLL 2P7TB 3U46B 1PD6A 4LP5A 4D9RD 3IJYB 4HX1A 1CXKA 2QHRL 2X5PA 3NIFF 1R5WA 4MHHG 2IEPA 1BBDH 2F8XC 3SDYL 5DMIH 3DX6B 2VOTA 3ARED 2J8UB 4NCC2 3QIWD 3SDAA 2AJZA 3HCVB 1EGJL 4NNPH 1CGSL 2V5MA 4C55A 1T4KB 4PUBH 1RZKC 5JA9A 1JGUH 2HWZL 5ICZA 4Z8FH 3ARSA 2OQJA 1DUYA 1V3MA 5IVXB 4OZFA 1N2RB 2ZOKA 3FO1B 1AR2A 2N1KA 4FQ1H 3MUZ1 1ADQH 3VD4A 1S7XB 4UU9B 4GAGL 4UNUA 3O6FD 2EDWA 1J10A 3C6SB 1O0VA 4POZD 1G7QA 4ONGH 1F4AA 4HDIB 4LBEA 4XVSL 5DK0B 3AREA 4JY6A 4QY8A 3V4PL 2B7DT 2E6PA 3QIWA 5I19H 1SQ2N 1UA6L 4HEPG 2FX9H 1FH5L 3KLAB 4ZO7A 1ROWA 5F96L 3GJFK 4HS6B 4YR6A 2KZWA 4UILH 5D7LB 1R0AL 4DFHA 3WFEL 3FOMB 3TBTA 4JQIL 5A2IH 1NAMH 4G42B 4ORZC 1C1EL 1AQKH 3KJ6L 4LLDB 3ZMRA 4S1QL 3T0BA 4G6MH 5HBBA 1I7UA 5GGTH 3S9DB 1OF2A 4HUVB 3P9WB 4NYLA 1XCQA 1VFAB 5DHVB 4YHIB 3D3VE 1GIGL 4PJ7F 2DTML 2NLJA 2W0FB 3W82A 3ZDYF 5I8KH 5AZEH 2OL3H 3AM8A 3SE4A 4IDJH 5DUBB 1IGML 2GYSA 3JWDH 5FGCB 1BVLB 3NH7L 3VFWA 3QPQC 3NTCL 1NFDB 2E9WA 4H20L 2GTWB 3ULVD 2Z8VC 4WWKC 4U7KA 4KMTH 3RVXC 3ARTA 4XNQB 3G04B 1JNHB 1G7MA 2BNQE 3RL1B 5LQBH 4R3SA 4WJ5B 4XMLL 1XGTB 4AQOA 3KYKL 3LZFH 2H9GA 1UEYA 3BD5A 3EYUH 1I7ZB 4LEXL 3MV8D 1MCPL 3LPGA 4PBXA 5EU3B 5MHSD 4PY7B 5C0AD 1KPUB 2IALA 1J05A 3TJEL 2VDRL 3WFBH 1LEIB 1S8DA 3DSFH 5HHOD 4QRPD 3QH3B 5KSAD 3C8DA 5HGDB 4XPGH 2JCCE 4NPYB 2A9MH 4LEOB 5C71A 3ILQD 2ZUTA 1AHWB 2AV1B 1A7QH 5D2NA 4JKPH 3JVGC 5DGQA 1MY5A 3T8XB 1KUMA 4XNMB 3WFHA 3QUKA 4X6CE 4X8XA 4J8RB 5EO9A 2MWCA 3VXUD 3VXRD 3S5LG 3MV7B 3MLXL 4OI9A 1W72A 1F3JA 4P59L 2A6KA 4FTVE 1L9MA 2DJ4A 3MV8A 3JWOH 4W4NA 1ZANL 4WRLA 1MCWM 2L7UA 5K59F 4X6DE 5DD5L 5C0AA 2D31A 1F4YL 1IQDA 1QBLL 1GPOL 5DSCA 5GRVL 5HHOA 3JTTA 4OI8A 3OXSB 4KK6D 4QRPA 5KSAA 4OZHB 3HUJE 1DUZA 3JV4B 4FQPA 2GJJA 2F53D 2YPLD 4NRYB 4GKNB 3GUTB 4OGZA 2XACC 3ARFD 4WI9A 4GXVL 1Q1JL 3VXUA 5INDB 3VXRA 1GGBH 1MWAL 5EO1B 3KS0J 3ROLA 1BREA 3PGCB 4QOKD 5HDBF 3T77A 1YN7A 3D2UD 2WQ8A 3UTPE 2A1WL 2JJWA 1J1XH 1XGRA 1MQKH 3VFNB 3MA7A 1KJVB 1WBZA 1ZHNA 2WMPA 4XPBH 3I6KA 4HUXA 2BNQB 4KGLA 2ATKA 4RGOH 4Q9QH 1UVQB 3WNPA 4NDMB 3MNVB 3PHQA 4R4ND 1DE4A 4NKIH 4F7EB 3M07A 1UH2A 4YK4C 1NGXB 3LQAL 2F53A 4BQCA 3ALWA 2YPLA 3BP4B 2JF1A 5C9JA 2IPKA 3RNQA 3GM0A 2R9HC 3ARFA 2DQUH 3HNSH 1TPXC 1ZHLB 1CQKA 1ES0A 1FL3A 3SE8H 2A38A 4YZFE 3BQUC 4KAQL 4KJPC 4QOKA 4PS4H 4BKLA 3D2UA 5JIIA 3MRGB 2DYPD 3T09A 1RZGB 2JCCB 5A2KH 3V0AC 3IXTA 3T0EE 4W4OA 1OPGL 5KG9B 2PYED 1HOCB 4KRPC 4Y8AA 4S1RH 2AEIT 4GKZB 3WO4B 4S2SA 4HLJA 4YHNA 4H88H 3SDXF 4X6CB 1FG9C 3DX9B 4TULH 4J1UA 4Y2DD 5CIPH 2GT9B 3C2SA 4GW4B 3CCHA 5CKGA 4DZBB 1SYVB 5KS9B 5I8EA 1G7IB 3P4MB 4WW1A 5IVOA 4XVUD 1Z0MA 2VH5L 4JJ5A 2HFTA 4XGZB 1AXTL 5C0JA 3LMJL 4XVJH 1QO3A 1C08A 4B41A 3RY5A 2DYPA 1I8IA 3PDOA 5C7XH 4UV4L 3A67H 4HIXL 4HIIA 4EEEA 2XV6B 2PYEA 1ED3B 3EYOA 4K3HA 3EOAA 2FSEA 3OGCA 4XXCC 1A6VL 1XGPA 2H2SC 4Y2DA 5CD5D 2BFVH 4PGEA 3PV6A 2E7CA 1NCBL 1EEYB 3VFTA 4HJJL 1OTTC 4KV5F 1P7HL 3GBLA 4ZDHA 1P7QD 3WJJC 4ALAH 3QHFH 4H0HB 5JW4Q 3GJFB 4LQFL 4WCYL 1YNKH 2NY4C 2C3XA 5EIVA 3E6HA 5C0GB 4MAYD 2Z4QB 3SKOB 2MFNA 3D9AL 3MLRH 3S4SG 1CLZL 4YBQC 1E27A 4R2GC 1QKZH 5A43C 2H6PA 2EYRB 2Z92A 4HKXA 1BFVH 3SKJL 5DK3A 1NEZB 3T0XA 2R15A 3MJGX 1X4ZA 5FYJU 5KSUB 3BRGC 1P7QA 3DI3B 5JLZA 4I2XA 1KSRA 4OD3L 4FFZL 1A0QL 5CSBA 2EYSA 1CU4H 3LN9A 5TDPA 2P1YA 5ERWA 1JZ3A 2DAVA 4MAYA 4TUOB 2LAGB 1J87A 2FCBA 1XGUB 2VABA 3KYNB 3OJDA 3LIZH 3RIFK 1I3GH 3TT3H 4YX2H 4MCYA 4GKSA 4PD4J 4P5TB 1A5FH 1N64H 2IADB 3OAUL 1W0WA 3AMLA 4GSDH 4JFXA 5DMKA 4HJGA 5DS8A 3ZHLA 4ZFOB 2XZQL 4WHYH 4AENB 1KEML 1RIUL 2Z8SA 2P24B 5C3TA 2VDNL 4HX1B 1RFDH 1R5WB 4L1HA 1SY6A 1NGPH 2FH6A 4XCFL 1M7IB 3TLRA 1FIGH 5FDYA 2XRAL 3U4AA 2AJZB 4XVTH 4X83A 4WNQA 1D5XA 3AS0A 5IB1B 5E24E 1JF1A 2ZNXA 3P0YL 4HZLA 3F7VB 2XQBL 3H8NA 2OQJB 2QSQA 1H3UA 3G6JA 3TZVD 2PXYD 4Z7WA 2EIZA 1DUYB 3I50L 1P4LA 1I7RA 4DVBB 4NUGH 4DQOL 4U3HA 2ZOKB 4IS6A 2P5WD 1D5IH 3EYVB 3TYFB 3RVUC 2WBWB 8CGTA 1F58H 4K3EH 5A40E 2E9JA 4URTB 1DQDL 1G7QB 5F88A 5E08H 3FCTA 3V8CA 1FORH 5T3ZD 4OZIB 4LBEB 5D2NE 3AREB 1BIHA 4MD4A 4QY8B 3QIWB 2W1NA 2ZCKH 2GJ6D 3KXFA 2YPVL 4W6YB 2HT3C 3K74B 4YR6B 2YBRB 3TBTB 1MF2L 2DTSA 1N0XL 4JFZL 3TZVA 2PXYA 2R29H 1AJ7H 3S37L 5MHSE 5C0AE 4I0PA 1CR9L 4HMCA 1E6OL 5CJ5A 2DLTA 5HHOE 1KC5L 2P5WA 4GUPA 4O2CA 1OF2B 4QRPE 1FRGL 2VITA 3O6FB 4LSUL 4PRBA 4NYLB 2CUHA 1XCQB 2ITDA 5DUML 4KI5D 4UOW1 4PJ5D 1OTSC 1B4RA 4KH2A 2NLJB 3GMQA 5HDLA 3VFWB 3VXUE 1WIPA 2VR9A 3VXRE 3IB4A 3HI1B 1S9VA 4YHKH 4YFEA 5TE4H 4HFUL 1CGYA 5JDSA 1K4DA 2VDPH 4OT1L 3RIAK 1S9YA 1RZJL 2GITB 4IRJC 5F7WC 5E8EA 4HF5H 5C6TL 5CP3H 1G7MB 3CLEL 4OQTL 4MA8L 4R3SB 3HI6H 3PG2A 4MA1C 2AJ3A 4ZAKD 3K4DA 3MV9D 3W81A 4PJ5A 2EDTA 4MQTB 2ZSVB 3MV01 2F53E 3ULUD 3KWWA 1UWGH 2YPLE 4YC2B 3JV6B 3LS5H 2P48B 1OAYL 4HIJA 3KNBA 1UM5L 1A64A 4Q9CA 3QZWA 4H0GA 1MHHB 1J05B 2IALB 2QLVB 2LV4A 4LVOB 5B3JE 1S8DB 3DTXA 4OLYH 1UYWL 4HWUA 4P9ML 4QOKE 2Q1EA 4GS7C 1CD1A 3CMGA 2DQTH 4YDKL 3GKZA 1MFEL 4PP1D 4I8DA 4KJWD 2ZUUA 1CLYH 2AQ1A 3Q1SH 4ZAKA 3MV9A 1HIMH 1T6WA 3WFHB 3QUKB 2FIKA 1XR8B 5EO9B 3K1DA 1MCRA 3TC9A 3OV6A 4AEIL 2DQJL 1F3JB 2ZKHH 4ZFGL 3MJ9A 2A6KB 5SWQA 3MV8B 1PG7W 1CS6A 3S3SA 1RK0A 4GG8A 5H37H 3UBXA 5C0AB 1EO8L 4OCNC 1IQDB 4KROC 5DSCB 5F7NC 5HHOB 3I02B 3JTTB 4QRPB 5KSAB 2J8OA 4QHKJ 4XWGH 1DUZB 2BVOA 4NJ9L 2RR3A 1Z9OA 2B20A 2VZ1A 3NIDF 1NMBL 2PYEE 1F8TL 4ENED 3BZFA 4M43L 5HVHC 1NANH 2NR6C 3L1OH 4P57A 3VXUB 1KIQA 3MBED 2ZCHL 3VXRB 1C16A 2XIDA 3E2HB 3AUVA 1J11A 4APQC 5IW1A 1YN7B 1NLBH 3U7YL 3EO0A 4OTXH 4NFCA 1XGRB 1ZHNB 5K9KA 2CK0L 4HUXB 1K3ZA 1NBYB 4KKBC 1LDSA 2ATKB 3LEVH 4U6TA 2J2ZA 3PHQB 2BNUA 5EU4B 1DE4B 1KXQE 2AI0H 4EDXA 1NFIA 4JVPA 4I0CC 1H15A 3BPLB 1A3RL 5ITFA 4KKLC 4XHJD 3VDCA 3ARFB 3QJHB 3KPQA 4LAJH 3GHEL 1VPOL 4Y16D 3MBEA 1ES0B 1FL3B 2FATH 3IJSA 1FZMA 4N5ED 1MNUL 4QOKB 4DGIL 4M1GL 3D2UB 4RRPG 3OB0H 3SPVB 1NMAH 2HN7A 2Y6SC 4I2XE 3LKQA 3UPRA 3PV7A 4KY1L 3OKYA 1MCSA 3CJJA 1QSEE 1H5BB 4S2SB 5FYJH 4PV8A 4YHNB 5IMKA 4J1UB 1CFVL 4JM2F 5D71H 3CCHB 4DUWA 4NP4H 3WDIA 4ZD3L 1KYOJ 4OZFH 5I8EB 1CG9A 4FQHA 1TVDA 4R96A 3CZFA 3EHBD 1WCBA 1YDPA 1YYLH 2JJTA 4HC1H 4Y16A 1VESA 5EZLA 2FWOB 4CDHA 5B38A 5C6PB 1G7HA 4HXAL 1CFQA 2DQIH 5GZOD 4OJFL 3NA9H 4TNWK 5C0JB 2VLRD 3QHZH 1QO3B 2CUMA 1R3JA 1C08B 1F97A 3NACL 2HKHL 2DYPB 1I8IB 4MNQE 4UV7H 1MIEH 5A2JH 1V3KA 4OM0H 1HXYA 3C08L 4AK1A 1YY8A 2PYEB 4JHWL 3OGCB 2MMXA 3G6DL 4WW2F 4CL7A 5LKNA 1XGPB 2Q3AA 3LEYH 5EUOA 1X5IA 4Y2DB 2OK0L 4PGEB 3PV6B 2V9QA 5D5MA 4NQSA 2D3VA 3VFTB 1AXIB 1BOGA 1OLLA 4OM1L 2EKJA 1GCFA 2FLRT 1G6RL 3INUL 3QWQB 2CLVA 3WUZA 5BV7L 5AWNL 3QXDB 4RGND 1RURL 4QWWC 2VLRA 4OFKA 4Z7WE 1PEWA 3P30H 2IQ9L 2EC8A 4ZUTA 1R3HA 3PGDA 2GKIA 3E6HB 3UXFA 5DD0H 1S9XA 3CSYA 4PLNC 4RCAA 3UTTD 2OR7A 5ISZB 3ESVF 3L3JA 1E27B 4PRPD 5E6IC 1DBKL 2H6PB 3U7WH 3AU1A 4Z95L 2Z92B 4HKXB 1I8LA 2OX5A 3KXFE 3S7GA 4PGDA 4Z7NE 1IAIL 4LSSH 4DN4L 1XIWC 3P3YA 5FHBH 4NO0D 5JLZB 4I2XB 4NGHH 1AXSA 1FNEA 1TZGL 1CGWA 5E03A 4IJ3B 3ZE1F 3QFJE 2EYSB 5IFAL 3G9VA 5TDPB 4K8RH 3T0DA 1BJ1J 2NY5C 2P5WE 4MAYB 1AKJD 2IWGA 2VABB 2XQYK 4PFEA 3UTTA 3OJDB 4JM4H 1F4XL 4K7PL 4PRPA 4MCYB 1JCKA 3V6OC 3GSOA 4PD4K 4NQEE 4LPCA 1XMWA 4HLZH 4LAQL 2QSVA 5J0BA 1W0WB 2Z35B 4JFXB 3CXHJ 5DMKB 4KTDH 4RIRA 4Z0XA 3C5SA 1BM3L 1DJSA 5EBMB 4HJGB 1AD9B 5DS8B 4DVRL 3X3GH 4NO0A 1ZLWH 5GS0D 5C0CE 2XTJE 3S35X 1MAJA 4XXDB 3CXDL 2QQLH 1ORSA 3L3OA 4Q58C 5E99H 5HI3C 3MRDB 1JPFA 1IGCH 1QRND 4PJFF 1AKJA 2OI9C 1D5XB 4KI5E 2G5RA 3ZL4H 1J0IA 4AEHH 1JF1B 4HZLB 5IG7A 5BCAA 1MFNA 2HVKA 3S96A 3G6JB 5EPMB 4Z7WB 1T83C 2Z8WC 2AKRA 1WWCA 3THMH 2C3GA 1NANI 4LASL 4NWTL 5JHDD 2ARJQ 5C6WH 5DWUH 4IS6B 3H42L 1VEOA 3VXTA 1M7XA 4K3JL 3TEUA 4P4KB 1DBMH 3QDMD 1Z6JT 3MUJA 5F88B 1PAMA 3FCTB 3WNNA 1Z0NA 4YUEH 1CIUA 2FEDD 2X05A 1CD0A 4NHCL 3MV9E 3OXRA 1JNLL 2P42B 3V6BR 4JO4L 1SEQL 1HDMA 3GEWB 4DKFL 5F1NA 5J6HB 4FHBD 2VLME 1DQQA 3TZVB 2PXYB 5DJYA 3EFDL 5JPNA 4L3CA 5J8OA 5JHDA 3R0NA 2Q8AL 3MRKA 2P5WB 3MLPA 4GUPB 1B88A 3ZDXF 1NBVL 5ESAA 2DLIA 2VITB 1IQWH 1D6VH 3LPFA 4PRBB 3RKPA 1YJDH 4WUKL 2Q7YB 1RSFA 2Y06H 4KZDH 3TP4A 3MLUL 5CZKA 3RVWD 3ZKMC 3O6KH 3LHPH 4ACPA 5D7SL 3V4VH 2GJ6B 1LK3H 2KDGA 5JXED 3GMQB 1OW0A 2UUDK 3BH8A 5HY9A 1EHLL 1JNNH 4LU5H 3QCTL 2MPAH 5CJXA 1BFSA 5JDSB 1FNHA 2VDMH 4GW1A 1K4DB 2AJXH 1U3JA 1S9YB 1QFUL 1OLZA 1FC2D 2F5BH 4GLRH 5CEZD 1PY9A 1FBIH 3NGBB 3F58H 3MCKA 1ZE3C 4BH7B 4PJHF 5KVMC 4EOWH 2AJ3B 4R7DA 5E8PA 4PJ5B 2FBJH 3DUHA 4LHUG 4C58B 3GGWA 3KWWB 5IB3A 1JPTH 1QQDA 2HLFD 3P0GB 2ICES 1KLFA 4HIJB 3CVHL 1FLRH 4JGMA 3KNBB 5EU7C 5JXEA 3DHJA 4LFHG 4OD2A 3DX8A 5K33A 3GI9L 3NFNA 5E00A 2EIEA 3BPCA 2GFBB 4HPYL 2AQ2A 4FQJH 1BFOA 4EUPG 1CBVH 3DTXB 4ZNCD 4OLUL 1LO0H 5KSBB 4A6YH 2BY1A 1CD1B 3TN0C 1KGCD 3P11H 3WDHA 2UWEA 1P2CA 4TN9A 3ZYIA 3TCXA 4ZAKB 1T6VN 1ZK9A 5HYSB 2NNAA 2FIKB 4F9LA 5E6ZA 1S3KH 2WIIA 4NZDA 2HKFH 4D9LH 3QI9B 4LSDA 5SWQB 1MJ8H 3BIBX 4NQDD 1RK0B 3UBXB 4JHAH 5CZVL 2VDKH 1AR1D 4HGKC 4HK3J 2YXMA 2CRMA 3RUGA 5GPRA 5T3XE 1VERA 3NCBB 5FO8A 3LOWA 1DFBH 1X9QA 4IIQA 2VDLL 3GSWA 4C54A 4PRAA 2H2PD 3WYRA 5DQ9A 2O61A 2R0ZH 4KK8D 4JQVA 4WDIA 4P57B 1JFQL 4K7FA 4NFBA 3BPNC 4QHLB 2J8UF 4BYHA 1NL0L 2CRYA 1KIQB 1TJIL 3I84A 4ZS6D 5D5ME 4LCWD 1Z3GL 5T5FL 1Z5LA 5IW1B 5F93C 2VERN 4NQDA 4OFDA 3W9DA 3VFVA 1CVRA 3WLWD 3STZA 3EO0B 3VWJC 2VN7A 5HYJD 1EJOH 1YQVH 1ZSDA 2WBJC 3L5IA 5IVXF 3TH3T 1BIIB 1RAMA 1BAFL 4EDXB 2ATPB 2BNUB 4IRZH 2QADD 4XNXL 1NFIB 3BSZH 4EN3C 1SMOA 1H15B 4JRWA 3EYFA 5ITFB 3WXWL 4M7JL 4Y5XA 4RQQA 3KPQB 5D7JD 5SV4A 4NM4H 5CINH 4IBLT 1MPAH 3MBEB 3NA4A 4R97B 3WE6A 1BGXH 1P4BL 4Z5RB 3B9EA 3IFLH 2PF6A 3AFLA 5IIEA 3I3BA 4LCWA 1FZMB 1HXMA 4U6HA 2EDJA 2HFFA 5DYOA 1PVHA 3IDGA 4O00A 2G5BA 5HYJA 4G7YL 5T1DL 4D0DA 2FIRT 4O58L 2HN7B 4JDVA 4ZSOA 3QO0B 2O26U 4KK5D 3UPRB 4PLJC 3X11A 3RKDD 2A0LD 1WFNA 5KSVA 3CK0H 5DJ6A 3U2SB 1J0ZA 5IMKB 1QUNA 5IESH 4XBGA 3DMMD 4LSPH 2X70B 4FQHB 4PGCA 1KYOK 3IFNL 4R96B 2FJGB 3CZFB 5D7JA 1WCBB 3HB3D 4LSRL 1YDPB 4Y16B 5EZLB 4MJID 5B38B 3QA3B 1X5LA 4PRPE 4WVRA 3FQUA 4U2YA 4IRSD 4K7PY 3OZ9H 4MD5A 3TIEA 4HWBH 2HFGL 2D0HA 1FCGA 3A6CL 3KYOA 5DMGD 3H0TB 3R4DA 2B2XL 1NDGA 2ZCLL 1HXYB 5E2WH 5F72S 2YS4A 5C0DA 1YY8B 2AK1L 2R0KL 2I5YL 4X4ZA 4M6ML 3C5ZD 4Y4HD 2EDFA 1KJ2L 3KLHD 3RU8H 2IPUK 5EUOB 5KVEL 4XCEA 3BKYL 1KELL 4OGAD 2R1WB 1RULH 4XP6H 4O2FA 1IAMA 5D5MB 3S34L 3DMMA 1UADC 4M48H 5DD3H 1BOGB 2EECA 4OF0A 3DRQA 4MJIA 2ADFL 1OP5K 2H32H 3WFDL 4HCRH 4IRSA 2APTA 2VLRB 4G7VH 4L4TA 4FQQA 1T1YA 2JELH 3CDGA 4NKQB 3DYOA 3JSSA 1UM4L 5F9JA 4MCZB 4ZUTB 4EKXA 1R3HB 3PGDB 4NZJA 1OAKH 1TVBA 3CSYB 3L9RB 3C5ZA 3WXVL 4Y4HA 1KN2H 3TPKA 1T3FA 3K7UA 3QUML 3S97C 4KQ4H 4HHAA 3V52L 1WTLA 3L3JB 2E6QA 3AU1B 3RWHA 1RIHL 4AG4L 2YRPA 2OR9H 1FGVH 1ZTXL 1OWWA 4PGDB 2HRPL 3QQNA 4FFWC 3GB7A 43CAA 2YPKB 4RGNB 5IBUG 4LSQH 1WGOA 3DWTA 2R8SL 4LHQB 4ONFL 1AXSB 3PP3K 2NW2A 4WI3A 4ZG1A 3EJYC 5JHDE 1EMTL 2W07A 1INDL 4TTGA 5CWSA 2EE9A 1BPVA 4JFYB 3QUZC 3UTTB 5LXGH 3CD4A 1V05A 4JAMB 4MZ2A 3C09B 2A77H 1OM3H 1FN4A 3VA2C 3HR5A 1A6UH 2IMNA 5MEOA 1I1FB 4X6BA 2DKMA 3V8OA 4RIRB 1T80A 3C5SB 4Z0XB 1U2CA 3I6GA 3CXHK 5F7HA 5IT2L 4NO0B 3FRPA 4FMFA 1WZKA 3VFGH 3HPJA 1I9IL 3F62A 3K4ZA 1GZQA 4JFHD 4X9GA 1LO4L 1ORSB 4WFGD 1GGIH 5JQ6L 1JPFB 1QFPA 1VCAA 5IJVB 2ZJSL 4P2OC 5SV3A 2HRLA 4GW5B 5JIKA 1C7TA 3GBNL 2HVKB 2FBOJ 3VMOA 4O5LL 1IGTA 4OZGB 2AKRB 3G08A 4D2NA 3TGXA 1ZXQA 2FB4H 4QRTA 4TVPH 4PR5A 5MP6L 1K6QH 3MCG1 2JCCF 3VXTB 4M62L 3BESR 3PWJA 5ACMA 3SO5A 4WV1C 3ARVA 4GAJL 1KJ3H 1ZT4B 4U1IA 3EO9L 1EEQA 1C5BH 3F7YA 4DAGL 3V0WH 4F15C 1QRNB 1TNNA 4X6CF 3MLYL 2OCFD 4P99A 1A14L 1IL1A 3OXRB 2VDOH 43C9B 1TJGL 4LSTL 4O4YH 3VWKC 1HDMB 3SKNA 3WUWA 3O3BA 4WI2A 4OCWL 3OKMB 4X6DF 4YXLL 4PYHA 1X4YA 5DJYB 4YDVB 1EUUA 2L4OA 5JPNB 1QSZA 4JO2H 4L3CB 5JHDB 1CYGA 2MKWA 1I8KA 4LVNB 1VADA 4RFEA 3MRKB 4BSWB 3OKEA 4NCC1 5ESAB 4PJ9D 3QDMB 2DLHA 2Z91B 2GSIA 1MHEA 3BRFA 4TUJA 2ZUXA 2HMID 5FHAH 2AABL 5L6YH 4JPVH 1H3PL 5HY9B 1LE9B 3GK8H 5D1XA 4UQ3A 4YBLB 3EW3B 3HFMH 5FO7A 2JJUA 4N0UA 1B6DA 5I0DA 4AEEA 3LN4A 4NQDE 3IDXH 4GW1B 1F45A 3QEHA 4QRRD 5B8CC 5GS1C 2Q86A 2YEZA 3B2UD 5E8DH 3MCKB 1RZKH 1HK6A 4LKXA 4M3JA 2NY7H 4NN7C 4PJ9A 5ETUA 5T3XH 3RY4A 4R7DB 5E8PB 4AZ8A 4U0RB 2OTUB 1CZ8L 3GGWB 1U8LB 3WHE0 5IB3B 4KMLB 3W2DH 1J0JA 4BQ9A 1A7RL 4S0SD 1RUMH 3VDAA 3AXLB 3HLAA 4XX1G 2HJFB 3I2CH 4YZFF 3RWEB 4OD2B 3NFNB 5E00B 4UT7L 3OBAA 5CHNA 1MIMH 4Z7VA 4JGUA 5E8OA 4LCWE 1BFOB 3KPOA 4RFOL 3FN0H 1JWUA 4QRRA 1TCMA 1LILA 2O5YL 3IETA 4NQXA 4ZPTA 1N5YL 5E7FA 2YC1A 2UWEB 4TTDD 4NBZB 5JO5B 4ZSOE 2AEQH 5HDQL 3K80A 5CFHA 1FO0H 2NCMA 1D9KD 5CEYA 5TF1H 4F58H 8FABA 1TQBB 2NNAB 1W8NA 4Y5VA 2D9CA 5TDNA 3VFPA 2VXVH 5GS3A 3O2WL 2WIIB 3JUZA 5CSZA 1U8MB 3K2UL 5D6DA 5E2UL 2MCPL 4Y5YA 4UOW0 2XT1B 1VKXA 5HI5D 1AE6H 1UGNA 4L3AA 1J1OH 2GAZA 4M61B 1JYWA 3RUGB 3TWCL 4DGVH 1AGDA 1F4HA 4IIQB 3GSWB 5J57B 4WHDA 3RJDA 5EZOL 3O41A 1PW3A 4PRAB 2IPTH 4TRPL 3A6BH 5DQ9B 1D9KA 2AEPH 4WDIB 4WHYG 4R7NB 2Z93A 3EDFA 4K7FB 4OSUH 4XP9H 4CVWA 1EAJA 1DBBH 1NDMA 2IGFL 2VKWA 3TO4D 5IEHA 1CICC 1Z5LB 3QXVA 1ZLVH 1CVSC 5FEBA 4NQDB 1XEDA 3W9DB 4MJIE 3STZB 1IGYB 2BCKA 4J6RL 2QQNL 3FFCE 4L4TE 1ZSDB 3HHRB 1MCQA 2X4PA 4QRSA 5GRUH 4YE4L 3ZTNL 3VGBA 3HTLX 2VXQH 1WCQA 2CQVA 5IOPB 2CLZA 4MDIB 3EYFB 5L2KD 4Y5XB 5GSRA 5E0QA 4BK4A 1LO2H 1MVUA 2Y36H 2HAZA 5ANMA 3WE6B 5I8OH 2R2HA 4NNPL 1JF6A 1F90H 4G3YH 5JOPD 3MC0A 4LCWB 5IIEB 3TO4A 4PUBL 3H3PH 1HXMB 3QFDA 5DF0A 3WKNA 1JGUL 2HFFB 5DYOB 3IDGB 4LDEB 2Y4SA 4X5LA 5HYJB 3ET9F 5MI0C 4ZSOB 3GKWH 4JDVB 5K9OA 2NY3D 5KSVB 5DVLA 1MH5A 2K3TA 1UXSA 5DJ6B 5HHVH 2QADB 4J3OC 1ZAGA 1Q94A 1OSPH 3OAYH 4OCXH 4UAOC 5L2KA 4ONGL 4PGCB 3EOBA 5D7JB 5I19L 1UZ6E 3O8XD 3AAZA 4PG9B 3EJZD 4UZGA 3FQUB 5IBLC 4C83A 5CZXD 3TIEB 4UILL 4FA8A 3DGGA 1U36A 2WWMD 5IB2A 3KYOB 3TBVA 1NAML 5DC4B 2J12B 1NDGB 1AQKL 4JM2C 3BIKA 5C0DB 3UYOD 3O4OB 4M4PA 4G6ML 5GGTL 3FB5A 2NY0C 4WO4C 4XCEB 4O2FB 5F96H 2ED8A 3DMMB 2ENYA 2EYTA 5F1OB 5KJRL 1R0AH 3WN5C 3O8XA 1XF2A 3QNXA 5I8KL 3DRQB 5IHUH 5CSGA 5AZEL 1HHIA 4IDJL 1C1EH 5DJDB 4ZUVA 3JWDL 4IRSB 5IW6A 3NAAH 1T0MA 5TGBA 4FQQB 3BN9C 3CDGB 4WW2C 1JMXA 2ZWLT 5IGXH 5F9JB 1HYSD 3ULVF 3FO2A 4KMTL 1OVZA 4MLSA 4XCCH 3KLSA 3LDBC 3OJVC 1VFUA 3C5ZB 4GBXB 4Z18A 4Y4HB 1EK3A 2FR4A 5LQBL 2X44D 1T3FB 4JFHE 4N8VB 1AQDA 3QIUC 4HHAB 5DGRA 4JDZA 4WFGE 1KB5A 3LZFL 4MA7H 3V4UH 3RWHB 4FFVC 3EYUL 1P1ZA 4WEUD 2RGSA 3MO1A 1S7VA 2LU4A 2VZUA 3GB7B 2QBWA 3VXPB 5ABDE 1CF8H 5LVEA 4QGYA 3WFBL 2NW2B 4LDLB 3DSFL 1TETH 4XPGL 2A9ML 5H37G 2EE6A 5BVPH 4F7CB 5DHYA 2C7UA 1A7QL 1JPGA 2PYFB 3C6LC 3C60D 4JKPL 5F89A 1A6PA 1EBPA 4YO0A 1MCPH 3VXSA 5FDWA 1NGQH 3HR5B 3L3HA 3O3DA 2AXHA 3B9KD 5MEOB 4X6BB 2HG5A 3JWOL 5J06A 4XMPH 3I6GB 2CRZA 1FDLH 4Q97A 4N0UE 5J1SC 1QSFD 1GZQB 4DK6A 2D2OA 4J3TA 3IFPA 2X89D 1FAKT 5H8DA 4UINH 3QXAA 1JTOA 3KHQA 2NX5D 2IBBA 4B5EA 3C60A 4UIKH 3VCLA 1CLCA 4KJQD 3LKOB 1C8PA 2HTLC 5D1ZD 1GGBL 3NFPB 1F4YH 1OAUH 1IGTB 3WNKA 3G08B 3B9KA 5MEQA 4Z7VE 4QRTB 3RIFF 1JGEB 3MODL 1J1XL 5E95B 1MQKL 1OSZA 4NZRH 4XPBL 3HMXA 3G6AA 3PWJB 4QRRE 1T0PB 2IANE 4DUVA 4RGOL 4U1IB 1DVFC 4Q9QL 4LVEA 3F7YB 2X89A 4NKIL 4PJCA 1Q1JH 1DEEA 1MWAH 2J6EL 3QWRD 2NX5A 4Y88A 2BERA 3TJHC 4JZNB 1IL1B 4JVUA 1ZT1A 1WITA 1M7DB 2DQUL 3HNSL 3SKNB 3WUWB 3O3BB 2XKNB 2XY2A 5D1ZA 3SE8L 4Z77A 4OZFG 2D7QA 2DQDL 3PXHA 1MVFA 3OB8A 4KU1A 2DWEA 4PS4L 1FJ1B 4XHQA 5A16B 3S6CA 4JZOA 1I8KB 1VADB 4RFEB 4J12A 4E5XA 1PBYA 2X4OB 1ODAA 2H45A 5I9QC 1Y0LA 5ICYB 1IGIH 1VFMA 1WISA 4H88L 1RJLA 5B39A 5FF6A 1BLNA 4XC3H 3LAFA 1MHEB 4TULL 4TUJB 4MNGA 4KGJA 2A6JA 1S7UB 2BVQA 3MRLA 3QWRA 4M7ZB 2W91A 4FQXB 1UT9A 5B3NA 2NY1D 1CFNA 5ENWA 1JZ4A 2QQKH 1KG0A 3TNMA 4JGJA 4N0UB 1MRDH 5DZLA 4PPTA 2OS7A 5C7XL 3L95B 2YEZB 2Q86B 3A67L 1FAIL 4LKXB 5ETUB 4PJ9B 1U6AH 5HGAA 2BMKA 3MA9H 1EZVY 2BFVL 5DC9B 3S88H 1TZHB 5ANME 4Z7VB 1IFHH 5E8OB 4UB0H 4DEPB 2I24N 4ALAL 4NN6B 3MYZA 3QHFL 3BKMH 3IETB 4IOFC 4X4ME 4FRWA 4NQXB 4YDLC 4ZPTB 2YC1B 4N0YH 1YNKL 4JKKA 4JFED 4F7PB 4RWYL 2DBLH 4JLRA 4H1LH 5CEYB 1NCBH 8FABB 5I18H 4Y5VB 5TDNB 4HAFA 3RIAF 1NKOA 3MLRL 4NOBA 3MGOA 5L2KE 2N56A 5HHPB 5HGGS 1QKZL 3WIFB 4Y5YB 1VKXB 2BHUA 3BIAX 4CN4A 1BFVL 4KRMB 2FECL 1R6VA 4LLYA 5JOPE 3NIGE 3T1WA 4JRYE 3BP5A 5FB8A 1AGDB 1N6VA 2ZUSA 4U1HA 4YDJA 1S78D 4OFYD 1BP3B 3O41B 3LD8B 1FC1A 4JFEA 3EFFA 1CU4L 3KG5A 4KVNH 2KPNA 4GKOA 5HD8D 2Z93B 2EDHA 3SKJH 1FVEA 4U1KA 4OD1H 1I3GL 3TT3L 4YX2L 3ZE2E 4D0CA 1G7PA 5I6XB 1YPZA 4H26A 1A5FL 1NCUA 4G6JH 4OD3H 4W81A 5C09E 4FFZH 1BWMA 2BCKB 4Z7WF 4GSDL 2EEBA 3FZUD 1KIUA 3EJJX 3FT3A 2X4PB 3B43A 3BEVA 4RAUB 1MRCH 4PLOB 2EXWC 4OFYA 5I74B 1II4E 3HAEA 4M7KL 1S9WA 1RFDL 1UB5A 4XNYL 1NGPL 3U6RB 4X99A 2M1KA 3GHBH 5GRJH 5L2JA 1FIGL 2FZ3A 1MVUB 4XVTL 5I1CH 1FYTE 5ANMB 3VA6A 2YZ8A 3O6MH 4AIZB 5LJYH 3TO4B 4Z7NF 4HWZA 4KI1A 1A21A 3GMPB 4HG4J 4ZYKA 3H9ZA 5C2BH 3LRHA 1Q9WA 2Y5EA 1VHPA 3MLWH 1FNGA 4OF6A 1KIRA 3EIFA 3GRWA 4QRQA 5K9OB 1S7SA 2A6DA 4NUGL 1A7BA 3MLSH 1MH5B 1D5IL 1F58L 4K3EL 4KKCC 2CJUH 3DETC 5DQJB 1I7TA 2VXTH 1FORL 1WBYA 3EOBB 3U7AA 2XQBH 3AAZB 2ZCKL 1Q9OA 3MNZB 2W9DH 3VXSE 2AERT 3I50H 4QYOA 2PNDA 4RWHA 4TOYH 4HIHA 5FM4A 3DGGB 4EZMA 1SHMA 5IB2B 1LO3H 5HGBA 5EO0A 2R29L 3RGVA 1AJ7L 1Q0YH 3OKLB 4BM7A 1A8JH 3BIKB 5ADOH 5CJBA 1DQDH 2VIRA 4OFIA 3MRBB 2NY3B 4P2CG 4G43A 3MLVH 4M3KB 4EJ1C 4OCYH 1PY4A 3UTSD 2W92A 3S3PA 4S0TD 4JFPA 2YPVH 2BK8A 4KI5F 5FYLD 3NMEA 2EYTB 3G5VA 1I4FB 3P2TA 2NMSA 3O8XB 1D6EA 2E7LC 4JFZH 3ZZ1A 4Y19D 1HHIB 5IB4A 3NBNA 3RRQA 1T7VA 4ZUVB 4R6UA 5IW6B 2YUXA 2VZ3A 2CKBA 1P53A 3VRJA 4QRUA 4X9FA 3QIBC 3FO2B 3OKNA 5DO2C 4CMMB 2VDPL 2BSTA 2XXCB 4B0MM 4TNWF 2YK1H 1R5VA 4HF5L 2OP4H 4AH2A 1G9NL 1AH1A 1LE5A 2FR4B 3HI6L 3UTSA 1AQDB 2X4TA 2BVUA 5F6HJ 4CU6A 4JDZB 4PJCE 5KW9H 2MQCA 2DD8H 4EVNB 1P1ZB 4OCMC 1UWGL 2NX5E 4Y7MA 3LS5L 1S7VB 4Y19A 2YD9A 3MOBH 4LRIC 3WJLC 4XNUL 3O3AB 3U36A 5AEAA 1B0GB 1FNLA 1I1AD 4X9HA 1EGJA 3HE6D 4OLYL 3LS4H 5EUKA 4MA8H 1HE7A 4NSKA 5HXMA 4B50A 3Q0HA 4M5ZH 3REVA 5DHYB 4Z7QE 3ULSA 4YHZH 5EORH 4AIXA 2C7UB 5HYEA 5AG8A 1JPGB 1KB9J 1J86A 3Q1SL 3N1QC 3TA3D 3CX5J 4YO0B 3C87A 5TDOA 5C8JA 1HIML 4P3CH 1G84A 5BS0D 5FDWB 4G6AD 5IUSA 4GRWE 2AV7A 5J12C 4ZOBA 5AYQA 3GNML 3L3HB 2C3HA 2HG5B 4ZOEA 1O7SA 1CDHA 3VGEA 3FT2B 4HQQH 4WFED 5EOCH 1N0LA 1I1AA 4FABH 3HE6A 2UY7A 3M45A 1P84K 4HWEH 2B5IB 2ZUVA 4QNPE 4XWGL 4MXWH 3T0WA 4OZ4A 4TSAH 3NCYP 5ESQA 5F9OH 3C60B 3VCLB 3RWGA 3TA3A 1MFDH 2OM5A 1JV5B 3L1OL 5E9DD 5BS0A 2NTFB 3FQNB 3O4LD 2WLZA 1U8IA 3VFRA 1EXUA 5EN2A 1BECA 1RJYA 5MEQB 3BO8A 1NLBL 2VSDA 4OTXL 2ZG3A 1OSZB 5IM7B 1J18A 3TESA 1QSFB 3IDYB 4HXBH 5IV2A 5A2FA 3QQ9C 3SDXE 3LEVL 1OP3H 1WAAA 1DEEB 3MRFA 1H8OA 5L0QC 4PJXA 4XNZB 3C2AL 2AXGA 1FFRA 5E8NB 1NC2D 5E9DA 1GZPA 3TBWB 3O4LA 1QPXA 5D1ZB 5CGMA 4Y1AD 4PY8I 2FATL 2EDXA 4Z77B 2NY5H 5H2BA 2GK0A 1L0YA 3B8YA 2F9BT 2DWEB 5A3IC 2FL5B 3CVIH 4KUCD 2X10A 2XZZA 5D9SA 2BVTA 4JZOB 3WO4C 4E5XB 4ONHA 1A3RH 3ARPA 3B6SB 1J5OH 4OCSL 1IJ9A 2CXGA 4JFEE 3HZKA 1RJLB 4WENB 5FF6B 5B39B 1BLNB 2AJYH 4LOUD 3VH8A 5D71L 4MNGB 3L7EA 3SY0B 4GRWB 2A6JB 1JHTB 2BVQB 3MRLB 5D5MF 1G9NC 1SEBA 3P77A 3FB7A 1NKRA 1RZ7H 1NC2A 1I1YA 4HC1L 3N9GH 1CFNB 5ENWB 5JIHA 3EYQC 1KTDA 2EDKA 4Y1AA 2DQIL 1KG0B 1YPZE 3TNMB 3NA9L 5IVZA 5KANI 3ILPA 4UV7L 1MIEL 4TSCH 4OM0L 5BRZD 2QJDA 4ZD3H 2VLKB 4MHHI 1JPSH 3GSNA 3P4NA 4BZ2H 3LEYL 1FFQA 5DD6A 4R90L 2V9TA 3F65A 1MJUL 4S11A 1HHGB 2NY1B 3NACH 4HJ0C 1CT8A 1YEDA 5IF0A 1CDGA 4N0FB 1T20B 4NBXB 4GRMA 1JGDB 1GJIA 1A02N 2A6IA 3I85A 4I3RH 1LD9A 3P30L 5CGYD 3WS3A 4HZAA 2FRGP 5GJSH 5BRZA 3GSRA 2FO4B 5DD0L 3W5NA 1L7TH 4PJIA 5CGTA 3ARBD 4I4WB 5SX5H 1MQ8A 3SGDI 3QZWG 1SBBA 3U1SL 3T0EC 3U7WL 1GXEA 4OI7A 5DEFA 1XGYH 4FG6C 3DURA 4LLYB 4NQCE 4ZFZA 2D7NA 1KB5H 4LSSL 4J3UA 4JFFB 4YDJB 5FHBL 3OX8A 4LSVH 1ND0A 4LPWA 4NGHL 1K8IA 1BOYA 4GG6E 1FSKB 3EFFB 3WD5L 3OF6D 4K8RL 4MSWB 3BMWA 3DO7A 3MUGA 2CDEA 1FVEB 2KUTA 1B4JH 3H9YA 4U1KB 1YECH 3ARBA 1M4KA 4JM4L 4DN4H 3UBXG 1G7PB 4KDTC 1GOFA 3SDDD 4YPJA 1OD7A 2XOTA 4X5WB 2RCSH 2ED7A 2G60H 3QQ3B 4CAGA 4KTDL 3UJJH 5I1IH 1KCRH 2B0SH 1QD0A 35C8H 4M1DH 4P2QD 3MSPA 3BX7C 3BEVB 3X3GL 1YMMD 4PRDB 3O2DA 1W72L 5J11B 1FL6A 5HHNB 1S9WB 4MXVE 1A47A 3SDAC 2QQLL 4K7PH 3LB6C 3OF6A 4X99B 4D8PB 5E99L 3NCCB 1IGCL 3SGKA 2FZ3B 2H41A 3QDHA 3UTSE 5TQ0H 1UB6B 3QP3A 4X6EA 3ZL4L 4AEHL 4KKAD 1NUDA 5FV2A 4ZYKB 4DVRH 4ZFFA 4E0RA 1DDHB 3VE0A 4HG4K 3SDDA 4MD0B 5BO1H 4OIAA 4YFLI 1Q9WB 1FO0B 3OGOE 1HILA 4CDGC 1HCFX 4WHCA 3THML 4QXGH 1KIRB 4RMSA 4QRQB 1MCOH 2R4RH 4P2QA 2QKIB 4QO1A 4AIOA 1I8MA 3T2PA 1YMMA 5DWUL 5GRVK 1KLUB 2YD3A 3AREC 3QIWC 1DBML 1IC4H 2XNAA 3B2VL 4LLAA 4YUEL 1WBYB 2EDDA 3VFSA 4MB4A 2XQYG 4Q0XH 5E5MA 2LU3A 1Q9OB 1IKNA 2ADIA 1JYNA 3BI9X 5J89A 2QR0B 1LGVA 5C1MB 1A6AB 2ARJA 2PUQT 4HIHB 1OARH 1KPVA 4BQ6A 5HGBB 4KHTH 3KVQA 1JJUA 4WWKB 4KVCH 1A2YA 2VIRB 3MR9A 3T4AA 1RJZB 4U1MB 1CCZA 4G43B 3MROA 1X5JA 3T0AA 1WV7T 1IQWL 1D6VL 2K1MA 1DL7H 1JNLH 3AM8C 1YJDL 4XPFH 3SE4C 4KZDL 5B38G 4IMKA 4FZEL 4JRXD 4DKFH 5CUSL 4OIBA 1D6EB 3O6KL 4PBWD 3LKPA 3LHPL 1V8HA 3PWPD 4RBPH 5F7EL 1LK3L 3V4VL 3U9PH 5BS0E 3GSUA 5FM8A 3NFSH 1QBAA 2CKBB 2YD2A 4QRUB 4LU5L 4JB9H 5DC0A 1RMFH 2MPAL 4L8SA 5T1LD 5HHXH 1KOAA 4I1NB 1IMHC 5EBWA 3BEWA 3OKNB 2VDML 2AJXL 4WFEE 1N59B 1TQCB 2F5BL 1HQRA 1R5VB 2UWEF 4AH2B 3DI2B 3F58L 4BQBA 1F42A 3RHWK 4YC2C 3UTSB 5E5UB 4EOWL 1VFBB 2X4TB 4JO1H 4J4PD 2EO9A 1WAAE 1ZLUK 2P49B 2AVGA 1XR9B 4JRXA 4K8RC 1NBZB 4Y19B 3ULVC 1FLRL 3PWPA 4LVOC 5ALCH 5E9DE 1MLBA 4L3ED 5LCVH 3U0PA 4PJEB 2GSGA 4XP1H 3U36B 2VB5A 6CGTA 4FQJL 5T1LA 3RUGF 1CBVL 1DEDA 5EUKB 1WLHA 1LO0L 2I25N 5D2NC 4A6YL 2OSLA 1JGLH 4NSKB 1QBBA 1Q8MA 3P11L 3REVB 3ULSB 5KN5A 2J3SA 1JE6A 5E4IA 1KB9K 5TDOB 2NYYD 5C8JB 4J4PA 3CX5K 4HK0A 3RPIA 1HHJA 4BH8A 4LGRB 2OTWA 2AV7B 1S3KL 4HMEA 4WY7H 5DJZA 4ODTL 4L3EA 3UMTA 1CFTB 1MJ8L 5KSAC 1FFNB 4JHAL 1WWBX 1I1AB 2VDKL 3HE6B 5KZCD 3ILQC 3OAZK 1DFBL 1TFHA 2ZPKH 1YMHA 4OZ4B 3SCMD 3WSQL 1RUAH 1BBJA 3QDJE 3MJ7A 2R0ZL 4AQ1B 3RWGB 1BQUA 3W0WE 5BS0B 2DICA 1AD0B 4Q6IA 1EXUB 5EN2B 5ACLA 4ODSH 1RJYB 4ELMB 3N50A 3BO8B 4Y2OA 2IC2A 2DKUA 4KK6C 3C5JA 3L6FB 1EJOL 1YQVL 5LAXA 3BZ4A 5IV2B 1HSBA 4L9DA 2VDQH 3RVTD 1QG3A 3ARFC 2KL6A 5BRZE 1V7NH 3SCMA 3BSZL 4NNYB 3MRFB 5FK9B 1B9ZA 4PJXB 4CVUA 5E1HB 3IKCA 5E9DB 1GZPB 3HAEH 4PJIE 1QPPA 5CINL 1MPAL 3Q3GB 3O4LB 4UIMB 1YJDC 1BGXL 1SY6L 5JUEH 5H2BB 2GK0B 1G7LB 4W4OC 2EDYA 3BDXA 4RA0C 2XA8H 1IEHA 2P7TA 3HG1D 4D9QE 1B90A 5D9SB 1FGNH 3IJYA 4R4NC 4ONHB 1F4WH 3QR2A 3VFOB 1T2QH 3PHSA 2EKSB 4H8WC 3SOBH 3UJTH 3CK0L 3HZKB 1CL7H 4P48A 5I1AA 5HJ3A 3VH8B 5IESL 2FHFA 4POUB 4LSPL 1SEBB 2NXZD 3R1GH 3FB7B 1NC2B 2WSKA 1MCBA 4WUUD 5D7LD 5DA4A 4X7FC 1I1YB 2P5ED 2XZCL 5EC2B 4Y1AB 1KTDB 3CU7A 4I48A 5T5NF 1BJ8A 3QUXD 2IG2H 3OZ9L 2MKLC 3KPNB 4M03A 5IVZB 5HPOA 4HWBL 1JBJA 3FO1A 2R2BA 3HG1A 3MZTA 3RA7H 4I18A 1YZZA 4Y2DC 5E2WL 2NY4B 4N8CL 3P4NB 4HDIA 3IFNH 1T1WA 4BELD 1KF9B 5DK0A 4XVUC 4KTYA 4Q74A 1MFCL 1NCAH 1RULL 4XP6L 5DD6B 2I27N 2L7JA 4I3SH 4M48L 4X7EC 4FQLH 5DD3L 4WUUA 5D7LA 3FOMA 1V3JA 1CT8B 2P5EA 1YEDB 2PN5A 5IF0B 4U1LA 3QUXA 4HCRL 4GRMB 4MWFA 1J12A 2GTZA 4G7VL 2JELL 1LD9B 4M6MH 4IM8A 2MNUA 4HUVA 4FFYH 3WS3B 3N85L 4P2QE 4XMKH 1HI6B 5BRZB 1VFAA 2A74A 5CD5C 1YMME 4LLQB 1OAKL 4YHIA 5JW5A 4JDTH 2W0FA 1KN2L 1TTGA 1U0QA 4KQ4L 2A73B 3WFDH 1AGEA 2X40A 4YGVB 5DEFB 1PG7H 2OR9L 4Z7UA 3RWJA 3KPTA 1FGVL 1R3LA 2E7LA 1NFDA 4MMXC 3DURB 2GTWA 2YR3A 4IJ3C 5F7DB 1H0DA 1T7XA 1WIOA 2WNGA 4LSQL 3OX8B 1ND0B 1JNHA 1K8IB 1E4KA 3F12A 3MLTA 5D8JL 4MAYC 5TFSH 3CNKA 3RL1A 2XY1A 2CKNA 1LHZA 3V5KB 3HMWH 4PJFE 3VFUA 3DO7B 3MUGB 2DIAA 4L1DA 2VXUH 1LEGB 3ARBB 1AO7D 1CXLA 1MCCA 1OM3L 2A77L 1YEEH 4NJAH 4LCYA 4UBDD 4PLKD 1CDBA 2F8OA 3WL9B 2R56H 1A6UL 1TZIA 2P44B 5HGDA 4NPYA 5J3HD 4LEOA 2KH2B 1VGEH 1PDKA 4HULB 2VYRE 2V2WB 1AHWA 1FL6B 3CUPA 4U49A 3QEQE 1RUPH 5IMMA 3DUUA 4BQ8A 5JORA 1WC7B 1ORQB 1GGIL 2Q76A 3G5XB 2C3WA 4X6EB 1AO7A 2W59A 4JRXE 1B0RA 3MMEB 4ZFFB 4E0RB 3SDDB 4BUGA 4OCRH 3PWPE 3FT4A 1HILB 5AYUH 2VKXA 5FOBA 2FB4L 4TVPL 4EBQH 1I8MB 1YMMB 3QNYA 1K6QL 1T5WA 1G6RA 1A9BB 5JIPA 2QV2A 2ZSWA 3GUTA 4GKNA 1OHQA 3VDBA 2XNAB 1LDPH 1C5BL 2IBZY 3V0WL 5INDA 3VFSB 1MCDA 4KWUA 3MXVL 4G9FD 5E5MB 1K8DA 3TZVC 2PXYC 2VDOL 3NCJL 3SEPA 4O4YL 1T66D 4F57L 5C0IA 3L5XL 4BFIA 5DRZA 3VFNA 1KJVA 1KPVB 3BMVA 3MRIB 3QXTA 4JO2L 5H94B 1IC1A 1JVKA 4RAHA 1A2YB 1D5BA 4NDMA 3T4AB 1J1PH 2ICCA 1NGXA 2X9XA 5TH2A 5J1TC 4RMTA 3BP4A 1N7MH 3PE9A 3MOAH 1CD8A 4LSTH 4R4BB 1AI1H 1VFOA 3ZTJH 1K4CA 5D93B 2DOCA 3BYTA 3S4SA 2BSSB 3IVKA 4PBVC 3MRJB 1KACB 4G9FA 3LKPB 2ESVD 5FHAL 5C3LD 1OY3B 1R3IH 4GAYA 4P46D 3GSUB 4Z7VF 1CL7I 3GK8L 1RZGA 4L8SB 3NGBC 3BEWB 2Q3ZA 4I9WD 4N90D 3IDXL 4KI5C 1HQRB 2FDBP 5E8DL 2GT9A 1JZ7A 1A1OA 2NY7L 2BZDA 5T3XL 1G7IA 3P4MA 1QTYT 3O3EB 5T5NG 4MQSB 2F58H 3GSNH 1AFVL 4XGZA 1A3LH 1RUML 3PWPB 3U0PB 2YHGA 2WP3T 3I2CL 5DFVD 5I1GH 2GSGB 1JI1A 3GIVB 5CJ8A 1MIML 2CR6A 1IEBB 5IR1A 3U83A 1P7KA 2VUYA 3H7LA 3FN0L 4KROB 3VGFA 2OSLB 1ED3A 3X3FH 1G1YA 2WBJD 4ZAKC 2EEAA 3JTSA 2XG4A 1IBGH 2AEQL 5DRNA 4PB0H 4PRHD 2E9BA 3ULUC 3HZVA 3ZKQD 5TE6L 3KPSD 1EEYA 4EN3D 5TF1L 3KHOA 5IMOA 4P4RA 5HVHB 3RPIB 1HHJB 4BH8B 4FMKA 1KTLA 3T65A 1W0YT 3FAXA 2CLRA 1HHHA 5DJZB 3S3JA 3PJSA 4ZXBD 4L3EB 1A6TA 1AE6L 4V2BA 3VW3H 3KJ4B 1J8HD 3GJFA 4APQB 4P0DA 4Z78A 3RZCD 1J1OL 1CK0H 5JW3H 5IVXE 4PP1C 4KJWC 2DQHH 3HG1E 3CLFH 2XICA 3VD5A 3WNLA 1YMHB 3V2AR 2EDRA 5KVDH 3U82B 1BBJB 4PRHA 3A6BL 3X14B 3K2UH 3KPSA 4P5TD 4MS8D 1EO5A 2EYRA 3L7FA 4XP9L 3CDCA 1DBBL 4GH7B 2ENSA 1F11A 5GGRA 4Q6IB 4I77H 4AM0A 3FRPG 5C0BD 5D7KD 4ZXBA 4WUUE 5D7LE 1ZGLP 2P5EE 1J8HA 1IRAY 5ITBH 5M95B 4JKLA 3RZCA 5KZCB 5LAXB 4F9PA 2D03H 3KPRD 5GRUL 4CJ1A 4ENEC 4S1DD 1UXWA 3REWB 1WVZA 2VXQL 4DKEH 3SCMB 5F1IA 3MBEC 4N1EA 5SWSD 4MVBD 4R97C 5GHWH 5H35A 4P5TA 3O2DH 2YUWA 3IKCB 3N06B 2M26A 4R0LA 3OG4B 2VTFA 2Y36L 4J6RH 5I8OL 2EEDA 5FGCE 1F90L 4G3YL 5KOMC 3DNKA 5JHLH 5C0BA 3H3PL 4ZFOA 4QTIH 1NFDE 4KDVA 4XI5D 3U9UA 4AENA 1YN6A 4NRZA 2P24A 1KCUH 4M6AA 3QCUH 3CVHA 3SQOL 1CXIA 5LGJA 1EERB 3GKWL 5IQ7H 3KPRA 3UCRA 1M7IA 1YA5A 4NO3A 4XHJC 2RAMA 1U8OA 4YEEA 5HHVL 5I1AB 5HJ3B 1OSPL 2JJTC 3PGFH 4Y16C 4OCXL 5IB1A 5SWSA 1KIPA 1URLA 4Y4FD 2DQCH 5DR5H 3ZE2F 5GQBA 3F7VA 3NCEB 3KR3H 4G8GD 1ZT7A 1FV1A 3TNNA 2CUIA 4I48B 2O5XH 2OXGA 4OLEA 1CI5A 4DVBA 5K9QG 2R2BB 1OGAD 3HG1B 2Q6WA 3EYVA 3TYFA 4X4YB 2GUOA 4I18B 1MI5D 3P0VH 2W9EH 1T1WB 4ZTPH 4OZIA 3O9WD 2E3VA 3EHBC 4KXZI 1DP0A 5DHXB 2YD6A 5GZOC 4Y4FA 2NXZB 2WQRA 3MV7E 5DQDH 5C08D 4M93C 4WUUB 5E6IB 3EAKA 2YBRA 3H9SB 4G8GA 2P5EB 5IHUL 1N8ZB 2LVCA 1HEZA 4TPRH 4U1LB 1T2JA 3QUXB 4MWFB 2R4SH 1JIBA 2GTZB 3NAAL 2JB5H 3GMRB 1ZA6A 1GHFH 3CZJA 3HKFA 1OGAA 5IGXL 2ICEA 1XT5A 4OZHE 3O6FA 4ISVB 1DBAH 4U6XA 4XCCL 2A74B 5EULV 3BUYA 4G5ZH 5JW5B 5KJRH 3CX2A 3KPLB 1WJ3A 1I8LC 3T2OA 3O9WA 2IF7A 5HDOA 1AGEB 4NQTA 4MA7L 3V4UL 1YQ2A 4EI5D 4RGNC 3HI1A 5D72H 1MELA 4Z7UB 3RWJB 5C08A 1R3LB 5FKPA 1SJHB 3EOTH 2YUZA 1PJ9A 1H0DB 2GITA 4TYUA 3F12B 3MLTB 5KVFH 1CF8L 1HWGB 3IXAA 1TETL 4S1SH 5BVPL 3C09C 5GJTH 3VFUB 2ZSVA 3L5JA 1K9TA 1DLFH 3JV6A 5I73B 2YMXH 4PJGA 2OZ4H 2Y7QA 3WV0A 4LCYB 4EI5A 2HT4D 1MHHA 3VMPA 1NGQL 2O93L 4P5KA 1TZIB 3RGHA 3L3KB 3K8KA 3NABH 4XMPL 1FDLL 5DT1H 1UWXH 2V2XB 1DQLH 5ILTH 1I3UA 5LBSL 3ZYOA 5ID1B 3CUPB 2DWDB 2J8HA 4FXKA 4XB7A 5IMMB 4X7TA 3DUUB 4M02A 5JORB 1XR8A 2Q76B 2R1YB 1LK2A 4PJCF 2Q20A 4FQ2H 5I15H 4UINL 2AXFA 3VD7A 5KS9E 4UIKL 1AO7B 2MSPA 4H25A 4WGVB 1B0RB 3O0RH 1KJ2A 2CIIA 1OAUL 5GS0C 3FT4B 3I02A 5FOBB 3RTQD 2BY3A 4FQIH 5JPMA 3QNYB 1T5WB 4YPGA 1G6RB 1EIBA 2ZSWB 4NZRL 3VGAB 4I9WE 4Z7QF 5BV7B 5D2LA 4CADB 2FD6L 2VLJD 2E7HA 3GJEA 1SBSH 2WV3A 1JZ6A 1GGCH 5I1HH 3MOQA 4GRWF 4HMDA 1K8DB 2DMCA 4L9LA 1K85A 5C0IB 4YXKH 4WI7A 3MODH 5FYKH 4BFIB 2EE3A 5DRZB 4LVNC 3QUMA 4PGBA 3OL2A 1NBYA 4K9EL 3O45A 3RTQA 3RL2B 2D7OA 5D7IA 1D5BB 4QNPF 3ISWA 3FB8B 4HW6A 4JZJA 4FXLA 5EU4A 2F5AH 5TH2B 2J6EH 2VLJA 5JQHC 1IGIL 3QJHA 2D4FA 1OW0C 1K4CB 1R3KA 4XC3L 1QBMH 1YEKH 3S4SB 1H3GA 3KPSE 3IVKB 4U6YB 1IC5H 4G9FB 2DQDH 2ICWI 4GAYB 1DSFH 3EDEA 4FNLL 5CJXC 4LRNH 4ZNEA 1TTFA 2EICA 4MXQD 3SPVA 1RUKH 3PWVA 2ITCB 2QQKL 3CSBA 5CJQL 2CR3A 4FQCH 1AGCA 1J8HE 1MRDL 1H5BA 4YHPA 3W11D 4U0RC 4ZOCA 1BQHG 3AC0A 3UC0H 3RVWC 1A1OB 5BOZG 1U6AL 1P9MA 3Q48A 5JXEC 3MA9L 4NHUA 2FWOA 2JK5B 1HWHB 3QDGD 1EBAA 2AJSL 1KCVH 3S88L 2ESVB 4P46B 2DLGA 3ZE0E 1IFHL 1PEZA 1RI8A 2XN9D 4HUNB 5IR1B 1CGTA 5C0BE 4UB0L 1SMAA 1FAIH 1P7KB 4GT7A 5E2TH 1MJJB 3BKML 1TQBC 3U30C 3ECBA 3JTSB 1KEGH 4N0YL 4F9LC 4OLXH 5DRNB 2DBLL 5ISZD 3KPRE 1MHPH 3HZVB 1T89A 2HLFC 3LQMA 1R5IB 9CGTA 5IMOB 5I18L 4EQ3A 4P4RB 4U1GB 5SWSE 1KTLB 2GI7A 3FN3A 3ORJA 5D6CA 4F2MB 3T65B 3RFZC 5DHVH 2CLRB 1HHHB