3LRHA

Structure of anti-huntingtin vl domain in complex with huntingtin peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
PVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords anti-huntingtin VL domain
total genus 27
structure length 109
sequence length 109
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrhA00
4M03A 4MDIA 1WFUA 5ID0A 4HQQL 5EU5B 2BNRE 3QNZB 4HT1H 4DN3H 4MNGE 3OMZA 1MJUH 3BEVB 3VFOB 3VXPB 3N1GC 3BO8A 1GGIH 4LIQE 2EDJA 1OF2B 4PRPE 4TSBL 4KQ3L 3TZVC 5INCB 4OIIH 3QJHA 3VFUA 4N90D 4WY7L 3UTQA 1A6UL 3EYQC 2YZ1A 4ODHH 4KK9C 2NZ9D 2NYYD 4G9FB 1DJSA 4XMKH 5DTFA 3K0WA 4QWWD 1MQKH 5C0AE 4Q97A 2IADB 5L8KB 4O2EB 2FYYB 1YN6A 1QPXA 3HC3L 4ZSOA 3ARXA 2AGJH 3HZMB 4F9LC 1OAYH 4Y2DB 3P0VL 3GSVA 2G2RB 2B0SH 1DBAL 1E4XH 2Q3AA 3S35X 1JF5A 4R0LB 4KUZL 1OP5K 1JGLL 3KR3H 3C5SA 2J5LC 4NP4L 4LLUA 4HX1B 4X5WA 4KTDL 4XHJD 2FGZA 3KYKL 5BRZB 2HFFA 2O61B 1GGCH 4PREB 3AMKA 4ELMF 4HMDA 5A43C 4G6AD 1Y6MR 1F13A 3UPCA 3G6DL 3RI5K 1N6QH 4OZ4B 4Y4FB 4PR5B 5GGUA 3BPOC 2FB4H 2IH1A 5TE4H 2YS4A 1MF2L 4ZUSB 1X5HA 2LU7A 4X9BA 3HE6B 1F58H 4O2FA 3LEVL 1JZ8A 2W65B 2DI8A 1ITCA 1OAZL 4BSWB 4X4YA 4G7YL 3CDGA 1YY8B 1TQBC 4L4VD 2PF6A 3C5ZD 5D1QA 5EC1B 2XWTB 5LAXA 1UM5L 2D0GA 4CVUA 1AR1C 3H42L 4NN5C 1SYSB 5EU7C 4GKOA 2VLKA 4X98A 4MCZA 2R1YA 2EYRB 2YWZA 2D7QA 2B7DT 3Q5TA 3MLRL 3HFML 4BZ2L 2QSCL 3GDBA 4QHLA 1MFBH 2MTPA 3QWOA 1K8DA 4NUGL 1KB5A 4HJ0D 4I18C 1FG2B 1G84A 2F9BT 5E6ZA 4M4RA 4XWGH 1K4DA 2DWEA 1IM9D 3I50H 4NCC1 3GJEA 4LFHD 2NX5D 1V7NL 3DI2B 4IIQC 3KPRB 1JGVL 1MCKA 4XPAH 4X5XB 4JO1H 1AC6A 2YA0A 4BSVB 5GGQL 1PSKH 4YXKL 1KGCE 2E27H 2H9GA 5F96L 5KW9H 4TSBH 4P5KA 3W82A 2UZXB 2VLKB 3DIFB 1S7WA 4L4TD 4Y5XA 2G5RA 3G5VB 4LKXA 5DJZA 3VG0H 3IVKB 1H3WM 2XA3A 3FN0L 4IRSB 4HKXB 4PJXE 4AH2B 4QKXB 4UMGA 4MDJB 1NUGA 1NBYB 2Z35B 4JRYA 3VXSD 4LHUG 3CFEB 5J9PA 1RULH 4QOKD 5ESVB 4DKDC 2NY4C 2XOTA 4HJJL 1JPFA 5D93C 3VXMD 4MJ4A 1T5WA 4IRSC 3BXNB 4GKZA 2CH8A 1DBAH 5FM8A 5T3XE 1YQVH 4B50A 2CRZA 5LXGH 4P5MA 1G7JA 2HLFC 4XAWH 5CGYD 3WFCL 3UJIL 5D7JA 5FYJL 4FTVB 1RZIA 4R3SB 1J88A 1KF9B 5GSRB 2YD2A 2R4SL 2VDQH 3MA7B 4X7SL 1QBBA 1QACA 2X1WL 5CWSA 2R29L 3WFDH 1N26A 1FSKB 3ES6A 2O5YH 4JHAH 5EO9B 5CJXC 4HJGA 4UTAL 3PGDA 5SX4H 3BUYA 3LS5H 2B8OT 3WLWC 3OKOA 3IAGC 1BMGA 2OMNA 3MOBL 4PRDA 4Y2DA 1WT5C 3FONA 5CZVL 1OWWA 1OB1A 2EDBA 4KQ4H 3PWUA 3C6SA 1QO3B 3QUKB 4G8IB 1QYGL 2A9NL 4EDXB 2DQIL 5I1HL 1FNHA 4XBPB 2I26N 5F8QC 1A2YB 5EULV 1AXSB 5IHBA 4WY7H 5BOPA 1CD1A 1OCWL 1UM6H 4H0GA 3HC4H 3LKSA 3IGAB 3OGCA 4W70A 4OCRL 4ZUTA 5C6WH 1T3FB 2X6MA 1RZ8B 1WQVT 5GS0C 1T2XA 4KV5E 3QG7H 3MCKB 4LCUB 3HAEG 2ITCB 4N8VA 4QHMA 4K9EC 4NJAH 2NY7H 4KVNL 4X9FA 4Y19E 5E4EB 4AMKH 1AI1L 1T04B 2GQHA 2Q7NA 1MCWM 3W2DL 3I6KA 3EFFA 4HJGB 4I3SL 3I50L 5C3TA 1F3JB 4XWOD 5J1AA 2XWBB 2W9DL 1ZHNB 2DKUA 5L6YH 5J06A 1HYSD 3FO1A 3IRPX 5HDBE 1Y0LB 4XRCB 4CDGC 1A02N 1T20A 1MRDH 1IM3B 3SOBL 4YEEA 1UXSB 4XPBL 3BQUA 4Q9QH 1U6AL 2PO6A 4AM0A 1H3UA 1MHHB 1WWCA 3O9WD 2SEBB 5J7CC 4MJIE 1FZKA 4BH8A 4ZFOA 1J0JA 1BVKB 3VRIA 2EDKA 2C3VB 3IDIA 4QRUB 1T0PB 5FB8B 4OIBA 3GSXB 2VXUL 1CDHA 2YD9A 1XF5A 1OTUD 1K3IA 3CLEH 3QZWB 3UAJD 3KPLA 4U1NB 4OZHE 1RZFH 5GS2D 4UINH 3OX8A 2Z31A 1GYAA 4G8FA 4GMSH 4XPGH 3DIFA 1M1SA 1EFXD 2OTUB 2PTTA 5CD5D 1DBML 2DM4A 4JRYE 4JFEA 4ZUTB 3IGAA 4OB5H 4KI5F 1OSPH 1W72A 3HFMH 4BZ2H 4MCYA 3PJSB 5DK2B 3LMJH 4UZGA 4G8EA 4HH8A 4P4KB 1H8NA 2O5XL 3KS0J 4G6MH 3S34H 2F5AL 4Z0XA 3O45A 1EAPA 1UWXH 5D1QC 3QUML 1FP5A 1G7MB 1U2CA 5C71A 2E9WA 1FH5L 3BI9X 5JIPA 3CMGA 3S35L 2BZDA 4D2NA 5FHAL 4JQXC 1F3RB 2V9TA 2VIRA 3FOMB 3OKMA 1ND0B 3CFBB 4MCYB 4AEHH 5D2LB 4Y5YC 3WD5L 3CDGB 3LQAL 5DJ0A 3QUMB 5E6YA 4I1NB 1NSNL 1A7RL 1KXQE 2YRLA 1FCGA 5E70A 5GSRA 2D0HA 3ZTNL 3QDGA 1PKOA 1RULL 3UO1L 3L3DB 4I77H 4BSJA 2ICWB 4PJFB 4KDTC 5C0CA 3MJ9A 3G08B 3MLUH 3G6JB 2FX8L 4JN2B 2AW2A 1I4FA 3BW9B 3SY0B 3RQ3A 3MLWL 3GIZH 2PR4H 1HHIA 3MRIA 1P4BH 4L4VB 2YWYA 1FGVL 4PB0H 3DSFL 5C0RL 3X3FL 1NLDL 1CTNA 4FFVD 1FZMA 5F7DB 2R29H 3WFDL 2AEQH 4HIJA 3P11H 4RFOL 5IBTL 3WIHH 4YQXL 1S7WB 4WWKB 1EUTA 2Q7YA 3FO1B 4YGAB 4DKEH 1VFBB 5KS9B 4Z7OE 3PGCA 4QHNB 4LBEA 5K59E 5FYLD 2IPKA 5J11B 5IQ7L 1J0KA 1BBJB 4KQ4L 4K7PH 5IM7A 4PJ9C 3NFPB 3NIGE 3HI5H 4UQ3A 2AEPH 5KOVC 3V52H 2M8XA 5DJDB 4C56D 4HC1A 1RHHB 3ULUL 1S5HA 3KAAA 4HWEL 4KHXH 3VFUB 1WJ3A 1B3JA 3ARWA 3DNKA 1I9IL 3SE3C 3RZWA 3QIBD 1HI6A 5I66A 5LGJA 1NCAL 1G7PA 5JOPD 3SDAD 3ZDZE 5C09D 1BM3H 1HQRB 5IB3A 3TO4C 3X12B 2VISA 3H9ZA 1N0XH 3O9WC 1QFWM 3HPJB 5ID0B 5C0AA 5CCKL 1CDGA 4DVBB 4QCIB 2EE6A 1IRAY 3DO7B 4PJ8A 4RGMC 4P46D 2DYPA 5IHZA 2ITDA 4FXGB 5AWNL 5GJTL 4GRLB 1P53A 4W4OA 3DVNA 3C60A 3L3GA 4JPIA 3U2SA 4M6ML 2DQUL 4PUBL 1WUNT 3SDCC 3QIBB 3UPRA 3F7YA 4XNZB 2MQ3A 4U0RB 1JUFA 1BD2D 2HJLA 2VLRB 3CGTA 5EUKA 2J1KA 2EC9T 4M7ZC 4U7SA 3ZLQC 2IAMC 2UVFA 4MXVE 5IB4B 1LD9A 1XGRA 3I3EA 2CMRH 3D48R 3FQUA 1TETL 3H9SB 3B2VL 5JZ7D 3UYOD 5IWLA 2C1OB 1OY3B 5EU4B 1XZ0B 3PHSA 1T5WB 1RZFL 2MKLC 3MUY1 1RU9H 5AEAA 4TRPH 4R7DB 3W0WA 5D2LE 4CW1A 4GG8A 4JRYB 1PZUB 3ZKSD 2P24A 4H88H 4Y7MA 1UWGH 3B8YA 1JL8A 1X6LA 5HXMA 4IRSA 2O5ZL 3MR9B 2ADIA 4TVPE 2XA8H 3OAYH 4LGRB 1QA9A 4G9FD 4RMRA 1FIEA 2UWEE 4JE4B 4YR6B 4G6ML 2BX5A 3GHEH 3PV6B 4JCMA 3L5IA 3C6LD 1T1XB 3P2TA 2MSPA 5JIIA 1WZ1H 3BO8B 1ACYH 4YZFE 3H9SD 3UP1A 1UJTA 3VXQA 1A8JH 2R23A 4UTBL 3QXAB 3ZSSA 2OR7A 3TVMA 1RZGA 2E9IA 3TNNB 4RFNB 3QUZC 4PY7A 4KJYA 5DSCA 5TE7L 3GMMA 2ICEB 4NC1C 3ROLB 1EXUA 1NFDE 4Y19D 5FXCH 3UTPE 4WJ5A 4Z7WA 5CEXB 4X6EB 5D7LE 5C08E 1KNOB 3MUGA 4OD2B 4XP9H 1WEJH 4JQIH 1N59B 4CW1B 1I1FB 3WUWA 3ZL4H 4FXKA 3FMGH 2BVQA 1JPST 3SKJL 3FZUC 4NKOA 4XBEL 1HCVA 2VQUA 1I9RH 3IJHB 4FABH 1D5ZB 2IBZY 5EU4A 2Z91B 4YAQB 3HUJB 5ERWA 1EEZA 1BLNA 2DQHL 4X0KA 1NC2A 3BRGC 4APQC 1IZJA 4KKBD 4KTYA 1NCWL 2EEDA 4G8GB 3TO4D 3WFEH 2AI0H 3HZYB 4YX2L 4BFIB 2HKFH 2XPGB 1QR1A 3SDCA 1NH6A 5C0FA 1AE6L 4OGYL 1QPPA 3MR9A 1R5VB 1AQDA 5BRZA 1ONQA 3GSWA 1Y18B 3S4SG 3QIUA 4LLUB 3C8HA 5SWZE 3SGKA 1AD0A 5C70A 2MWCA 1KYOJ 5IQ7H 1PKQB 2PETA 2DJSA 4LARH 2F58L 4KKAD 1I9JL 5HI3D 1W72L 5CP7B 1U8QA 1UM4H 2DI9A 4I2XB 5IB4A 3WO3B 4PBVC 2VR5A 2DQIH 3M1BB 4QXUL 3GUTA 1T1YB 5DUMH 2HVKB 3RKDC 2QQQA 2FO4B 4CU8A 1DE4B 3D85A 4MWFA 5MEQB 2P5WE 5DJ8B 1C5CH 4NQSB 4LL9A 2NY5L 5BCAA 4NKMB 1HXMA 1FZOA 1CVSC 4LPCA 4HBCH 1Q8MA 4I48A 4AIZA 5EBLA 5IV2A 4Y19A 3VXPA 4ALAH 3MV8E 1OTSC 3AB0B 1F97A 4HLJA 4J3XA 1W8NA 1N0LA 5D7SH 4PUBH 3TJHD 2A83A 1QFUL 4HAFA 4ZYKB 4S0SD 3EYOA 3STLA 4GLRI 1QD0A 3BGFC 5KVDL 1S9WA 4QF1B 5H94A 1E6OH 5D2NE 1WIUA 4WHYH 3QPQC 4OJFH 5BS0A 3I6GB 3FTGB 3B5HA 1WICA 4B0MM 3S5LG 1HDMB 2VDPH 5C9JB 1A3QA 2BY1A 2R8SL 5DFTA 3T1WA 4AENA 4H25B 4D3CL 5I1KH 4ETQB 2EIEA 1E4KA 3QUYD 3V0VB 4TNWK 2RGSA 4LBEB 4FNLH 4KV5F 4D8PA 5C0BB 5CBAA 1KJMB 5L2JA 4NT6A 1IVLA 1GHFH 1T1ZB 2Q7YB 1JRHH 5KVGH 4JM2A 4PRPD 5DDHB 4TRPL 3GJFA 3HR5A 2CKBL 1MRFH 4QRRD 2Z92A 2JCCF 5AYUH 4PRHE 1T03H 4P48A 1KCRH 4Z78A 5CD3A 1AXTH 1U3ZA 3EDFA 5E2VH 3EOYG 5C07E 4LRNH 5IB5A 1R3KA 4MX7A 1AKJD 1HKLL 4HC1L 1RUPL 3SQOL 1DANT 1P6FA 4G8GE 4LGPB 3HG1E 4F3FA 4G6JL 3GI8H 3U6RA 4WI7A 2AK1H 5I71C 1DBBL 3G5ZB 2YPLA 2EE3A 4IRJD 5A16A 2VLLB 5E9DE 4PGDA 5B3NA 5DS8B 3BZ4A 5IVOA 3IDJB 5ISZE 2DBJA 3HE7A 4EXPX 2D7PA 2WUBL 3TA3D 3B2UD 5ANMA 3U82B 1F6AB 4Z7OF 5DJ0B 4XX1G 2J4WH 4KY1L 1NCNA 1OGTB 2VZSA 4DK6A 3PWLA 4MLIA 1A6UH 3HLAA 4X7DC 5SWZA 3RZCB 5DURB 3HB3C 1MJ8H 4J1UA 2D7MA 4WUUB 4KKNA 1JPSH 4J6RL 1YEIH 3QUXA 2E9BA 2Z93A 4S1RH 3T65A 3P9MB 3V8CA 4NWTH 5I0DA 1NAKL 2B0SL 1DBJH 5HGAB 3C2AH 5CEZH 4G8EB 3MUHL 2AI0L 4IRJB 1IGIH 5BZDA 2P7TB 3EOBB 5E2UH 2ESVB 3VXSA 4URTB 4ODTL 2UWEB 3C08L 1AE6H 2GJ6B 2CD0A 1WBXB 1UXSA 3BE1H 1XEDA 1N7ML 1QSVA 4JN1L 3LZFH 4ODWA 3QI9D 1DVFB 2G9HA 2BRRH 4Y0GA 5CINH 1E27B 2H8PB 3ULUF 4FFZH 1HNFA 3TIEB 5IMOB 5DLML 4D8PB 5CBAB 2OI9B 3MLZL 1SMAA 2BCKA 3K46A 4QT5A 2GTZA 2VDKL 5GISL 2MCPL 1YEJH 2R0WL 3ME0A 4OTXL 3KR3L 5IMKB 4NM4H 4ELKB 4X6DA 1NAMB 1ORQA 4N8VB 2YC1A 3NACL 4B5EA 3OPZL 1S7RA 4RMVA 5IVXA 3QUYA 4HZLA 4LQ1A 5E5UB 3GGWB 1U8PA 2FBJL 2DKSA 2G60L 1JZ4A 1DN0A 4AG4H 1IEBA 4R4FH 3AUVA 4MQ7B 1AGBB 2YEZB 3RL2B 5M7QA 4PRPB 3WNPA 2VDRL 1GH7A 3FO0L 2BC4A 5HHQA 2VL4A 1OP3H 5BMFH 1YYMH 4AQOA 5E8DH 3QUKA 4ZD3H 1J8HD 1A3RH 1MPAH 2XWBA 1JNNH 1OB1B 2VQTA 1U36A 5J13C 1AHWC 5DGRA 4C56A 1SJHB 5CEZD 3GMQB 4IMLB 2ICWJ 2F5BH 2J6EH 4BFGA 3UPAA 2ENSA 4U0QB 5CBEA 3FL7A 1A7QL 1N2RA 3HS0A 3OKEA 4ZXBA 1DUZA 5IJVA 4NKMA 4XC3L 5DFVC 3EHBD 1GOGA 4M6MH 2V7HB 4R2GC 2YSSA 3OR6B 4WFEE 3O6ML 4QTIL 4AJ0A 3RVUD 1RZ8A 3JTTB 4P2OD 1R3JB 2RHEA 3K8LA 1IAOA 2GHWB 4NQCB 1ZLVK 1RI8A 1G6RL 1AR1D 5I8KL 3VI3F 4RRPA 1LDPL 5FV1L 1NC4B 4P2YA 2HN7B 4N0YH 5C07D 4MXWH 4RFEA 3SGJA 5K9QI 1XCQB 4GMTH 1CL7I 3WS6A 5EU6E 4ODXA 3C6SB 5JOFA 5IVXB 2PNDA 4YBHA 5GRVK 1TQBB 1MLBA 4O2CA 4Y4FC 3GJFH 3FQXB 5E9DA 3RWIB 2M1KA 3QDME 1NAMA 4S1SL 3RHWK 3RWJB 1F90H 3LKOA 5SV3A 3TNMB 2VYRE 4J2XA 3NCBB 3UTOA 2OS7A 1BOGA 2DM3A 4EDWH 5FYKU 3HKFA 5JHDA 2ZUWA 4XNMA 4U6XA 5FYKL 5IESL 1Q0YH 1PFCA 3MLYH 2AABH 4YDVB 1A4JA 1T4KA 3ZHDA 4JPVH 4RDQG 5C09B 1I3VA 3L6FA 3PL6D 3KJ6L 4H20L 2HAZA 3GMOB 4I0PA 4P99A 2AJXH 1LEGA 5DJAA 4BFBD 5KOMC 4YHZL 4RMTA 1KIQA 1Q9WB 5E0QA 2ADJA 3ROOA 4X6CE 4XCCL 1RQ5A 3M17B 1AQKL 1KJ3H 4N9GB 4JJ5A 5C0JB 4FA8A 2AK1L 2QSVA 3TV3L 3I84A 3DYMA 3TYFB 3QIWA 2GTWB 1YJDC 4JO3H 3VWKC 1IBGL 3I6GA 1Y6NR 1SJEA 1NC2D 1JI2A 5FDWB 3MLSL 3W9EA 1JTPA 2NY2C 3EFDH 1PYWA 4UNTA 5EZLA 5MEPB 4PJCE 1HOCB 2J4WL 4RGNC 4RQQA 2CKNA 3HMWL 4NKDA 1S9WB 4QF1A 1H3TA 1RUAL 2VRAA 5EORL 1KLGB 1ZTXH 2EEAA 3TN0A 2FGWL 3BIAX 1J1PL 3LQMA 4HIEB 3BD4A 1MLCA 3T2NH 2KPNA 2NTFA 2AKRB 3O8XA 4Y4KD 4HFUH 3QXAA 3QG7L 4F7TB 3DUSA 4KC3B 3ILQD 2Y5TB 4IIQA 3GJEB 4TVPH 2V5TA 2X4NA 1HYRC 4XH2B 5TF1H 4JO4L 3OAUH 4PJFE 4P3CL 3U30C 4NCDA 1IC7L 1FDLL 3B5GA 3HZVA 5HDQL 5JDSA 4QRTA 2W9DH 2AXJA 2EXYD 4MJ5B 4YDVA 4QEGA 1ZHLA 3OHXB 5DRXA 5F3BA 2W38A 3W0WB 3U0PA 2CIKB 1FL3B 3WHE0 3IAQA 1TZHB 2IMMA 3BEWA 4XVTL 1JYXA 4HHAB 4U0RC 4XP6L 1UXWA 1MELA 2NZ9C 4X80H 3HHRB 4NBYB 3RUGA 2Z92B 1WF5A 4LPXA 1NLBL 4PJIE 4R2GD 3OXSB 3DRQB 1EO7A 3C09B 32C2A 2FR4A 2A73A 1NMBH 3ALWA 4P5TD 3MCG1 1ZS8B 3BVNB 3TC9A 3IF1B 1A6VH 4TNVK 3CFDB 2HTKC 4RFEB 5CIPH 4I4WA 4N5ED 3WNNA 4JY6B 2FBJH 3FT2A 1LHZA 2DQFB 4G42B 1AKJB 5H35B 4YJZL 4GMSL 2P45B 4KFZC 3BP5B 3H7LA 5IT2H 1VGKA 1NCCL 7FABH 1UCBH 1LDSA 2A1WL 4QNPE 1A1MB 1RZJL 4MVBD 3PWPE 3GM0A 1GGTA 4FG6C 3P4OB 1JWMB 5FAAA 5D1ZD 3HNSH 1KTKE 5E99L 4L9DA 5HGBB 2XY2A 4NJAL 1MCLA 4WV1C 4LVNB 4L8CA 1LK3L 1GZQA 4ETYA 1YNTB 3E8UH 4F57L 1OARH 4PJIB 3KPSA 4ZYKA 4YDJB 1QFWI 4RISH 4AK1A 1L7TH 1MCDA 3E3QE 2ERJB 5BVPH 1HQRA 1MJUL 4WWKC 4RX4A 5EN2A 3NZ8A 3F65A 1NCTA 5EFIA 4Z7WB 4HPOH 1DQDL 4GOSA 4HFWB 4R7NB 5C8JB 3FO2B 4JB9H 2ED8A 1AIFB 5DQDL 3VFSB 4LCWE 5EORH 4CMMB 2P8LA 3NIFF 4OLZL 1DR9A 3SJVE 4JFFA 2J8HA 2XZZA 3VWKD 4CJ1A 2WP3T 4OM1L 3VWJC 3WLBA 5KAQG 4NDMA 1GZPB 3ZDYE 4AT6B 1MUJA 1TJIH 3PV6A 5J6GB 4Y2OA 3H3PH 3IU4H 1KTLB 1HQ4A 1NANI 1S7VB 1PKQA 2CR6A 4ZOBA 5F7DA 3KXFD 4TUJA 3LEXB 1OTSD 4LFHG 2AJ3B 3BP7A 4JZOB 1S8DA 5EB9A 3QIUB 2BDNH 4KXZH 3WIIH 3P9LB 1YZZA 2KUTA 3UC0L 2DD8L 3KJ6H 2P7TA 5I8OH 1DQLH 3RHWF 1Z9MA 1I7TB 5HYJE 1FZJA 1A7NL 4LEXL 3QNXA 2D7TL 4X6CB 4POZD 3VI3E 4LPVA 3HMXH 2FX8H 2NY4D 1VKXA 3DYPA 4R90H 4YNYB 5EBWA 3SN6N 4U6YA 5D70H 1SEQH 2FATL 5ACMA 1Q72H 3HUJA 3VD7A 4LF3B 1CGWA 1OLLA 1AHWB 3NN8A 5F70A 1N5YL 4K3JH 4XVUC 3HI1A 2F8OA 4RIRB 3SKMB 3DX8A 1QSFA 3ARFB 3MV01 1KCVH 3CFJB 2D03H 1RJLA 2XY1A 3VU2A 1FNAA 4KROB 4P5TC 2NX5E 3IDMA 4GSDH 3RNKB 5I1LA 3MLTB 4HFUL 3OXRB 2VAJA 5D1QD 3EYUL 5IHZB 2Y06L 2P8PA 1S9YB 5D5ME 1LO5A 5T1DL 2I9LA 3O4LB 3O45B 2XZAH 4ZQKB 5D7JC 3CDYA 3DYOA 1FZJB 1KB5H 2MQCA 3QFDB 1NCBL 3F8UB 1AY1L 3NFNA 1R3KB 1I9IH 4Y8DC 4YXHL 4I0PC 1JGVH 4JFXB 3VXSE 4CNIA 3VI4E 3MRCB 4Y1AA 4K94C 3C8DA 4A2LA 3O3DA 1QA9B 1KJVB 1N0XL 5EO0B 4CVWA 5DRZA 5FK9A 2VNCA 4UDUB 1RUKH 3L3JB 3QI9B 2OZ4H 4PJXA 5DO2C 5DI8B 5I74C 4N0UE 2FB4L 4HKBA 2DTML 5F9WC 1EHXA 1MUJB 4TOYH 5KS9A 3B2VH 2R2EB 1EFXB 4YBLC 4ZFGL 4JKWA 2WBJD 2AK4A 2R0WH 1VENA 3FAWA 3N9GH 5IFJA 3X3FH 4YBQC 1FNSH 1KXTB 5GS0L 2PO6B 4AM0B 3I9GH 4G9DA 4U4BA 5DURD 4BQBA 3DBXA 3VXUB 4BH7A 1RU9L 2IBGA 3MJ6A 1T5XA 5EFIB 1PX3A 1MCEA 4NQEB 5L7XL 2BDNL 5ESAA 3QEHA 1ZLUH 2VDNL 4MZ3A 5CJ8A 1YY9D 1MFBL 1IEAB 1NUNB 1X9QA 2I9LB 3O4LA 3P4NA 1D5IL 3VI4F 2E7CA 2L0DA 1EIBA 3V7AG 1OTTD 3HRZB 4P2OA 2IG2H 4JRXB 3IXTA 5HI5C 2DQDL 4K94L 5JHLH 2DLEA 1KCLA 1I1RA 5C0DB 3TJEH 2MNUA 3BH8A 2VABA 4JHZA 2PW1A 1JGDB 2GK2A 3QHZL 1MFNA 5DD6A 3DX8B 3K4ZA 2OP4L 5IOPB 5IBUG 2OL3L 2MHAA 1OD9A 4OKVA 1FGNH 1YYLL 3MV7D 3OR7A 4I4WB 3QEGH 5EPMB 1QLRA 5IHLB 3GUTB 1KCKA 1I8KA 2NY3C 1E4KC 3H0TA 3EZJB 1T5XB 4M1CD 4RNRB 3IF1A 2V9QA 4M1GH 3DBXB 4PJHF 3VXUA 4NN7B 1YMME 1I9RL 3BGMA 1WWBX 2Y25A 2W59A 1OHQA 3HG1D 3OKNA 2BNRB 2XN9B 2X10A 1RMFL 2OR9H 2PXYA 4Z18A 5ECJE 1PY9A 2EKSB 4RWYL 3EOTH 4Y2DD 1CDJA 3VXOB 1ONQB 1PY4A 1EX0A 1XGYL 4OGXH 1AQDB 1KJ2H 2BOCA 2GSGA 4YO0B 4ZAKC 5AZEL 5FK9B 4RZCA 4GXUM 3L5WB 3RWCB 1FLRH 3X11A 2KZWA 3HMXA 4OGYH 3CVIH 1CGSH 5DEFA 3O3DB 2ICWI 1YN7A 1ZVSB 5FA4A 1A7NH 1BIHA 5D5MA 4B53A 1BFSA 1QLEL 5E6IC 3KNBB 5I6XB 4PV8B 5JZ7C 1XF5B 3JXAA 3J7HA 1MWAL 1RJZA 3RNQA 4EI6A 5DXWA 2GFBB 3AM8A 4YDLC 3BW9A 1BBDL 5DD3L 4QO1A 1BFOA 4UB0L 1IQWH 2OSLA 4TVPD 1Q72L 2D3VA 1MCNA 5C07B 4DN4L 1SEQL 5JO5A 3WL9B 1MHHA 1R0AH 5CILH 2CR3A 4OLEA 5D1XB 4EN3B 1UQSA 4I5BB 4K3JL 2CGRL 2EH8H 2EC8A 4PRHB 3MRFA 4TUKL 4M5YL 4P9HH 4UOJA 3ULVD 1E4WL 3NZ8B 3QUXD 2R0LH 1Z5LA 2FX9L 2F53B 4EOWL 3SBWC 4ZG1A 5CFHA 4D9QD 2B4CH 4OCNC 4EN3C 4QOKE 1U8NA 4GG6E 2DICA 3GMMB 4FQ1H 1A1OA 1HE7A 4ZUWA 4YH6A 4HIIA 4RIRA 1SEBA 5L8LB 5SX5K 5HD8C 5GRUH 4J4PD 2ZCLL 4LSUH 1VDGA 1CLOL 4XPTH 1ZEAH 2L4OA 4EEEA 1AC0A 3GMOA 3MNZA 2J8UE 4YGVB 1R24B 4YHIB 3QHZH 1Q0XL 1YY9C 2NX5B 4UU9A 3O2WH 2UZIL 4KTEH 4AEEA 1LNUA 4V1DA 1KACB 2YPKB 4Y5VA 4TSAL 1QBLH 3U0WH 3IDXL 1CCZA 2A73B 3LEXA 2BFVL 1JHKL 3D9AH 3T77B 4YIQA 5D8JH 1N64H 3DO3A 4LRIA 4TOYL 4MAYC 3U1SL 1TENA 4TYUA 1BZ9B 4RCAA 4U1NA 4APQD 1XZ0A 2R8SH 2HKFL 1YDPA 3TO4B 3EJZC 4IJ3B 1KTLA 4S1QH 5L8JB 2XV6B 1NAML 1IC5H 5DGQA 3WLBB 5GS0H 1HSBA 2W0LA 5GGRA 2HJFA 1I9EA 2JLLA 1J1XL 1O0VA 5HGHA 3PXJA 1Z9OA 5EUOF 4CMMA 1MFAH 4JANA 4QTHA 4PJBF 3BSZL 3K8KA 1BZ9A 2F8XC 3V5KB 1IAIH 1DQQB 1JNLH 1PEZA 1MJ7H 4RGMB 5E2JA 2NY3B 1WISA 1MLCB 1JRHL 3BESR 3C60C 2F74A 3MROA 1JF1A 5JOPE 5I9QB 3AREB 5I74B 3QEQD 2VLJD 1UCTA 3KXFA 4Q2ZB 4WEMB 2FD6L 3O3EB 3QDGE 5IFHL 3P77B 3QEGL 3QXWA 3B4NA 1AFVH 1F11A 3QUYB 4DGIH 4H8WH 6FABH 3GSNA 4Z95L 1JZ5A 2Z8WC 5C6PB 3V0AC 1P7QA 5HGGS 1IEHA 4ELKA 5IR1A 4HMEA 3QXDB 5C0EA 5KVFH 2R56L 4XBPA 3NFPA 1NBVL 5DMKA 5HGDB 1HZHH 3F6IA 2FCBA 4PB9H 3NIGF 3PWUB 5CHNA 4JZNA 4Z7QE 5DJ2A 4ZO7A 1R3LA 1RD6A 3D39B 2NW3B 2Z8VC 3C2SA 2DQEH 1CBVH 3UYRH 3MMEB 1CYGA 4KY1H 4ODWB 2AJUL 1C1EH 1YNKH 5C7XH 2EDDA 2DBLL 2NLJA 4OZIB 3ORJA 1AXTL 2ESVA 3ES6B 4WCYL 3QUXC 3FO9B 1XF3A 4X4YB 1EO8H 1R6VA 3QIUD 3JWDC 4M43H 5I1CL 3MA7A 3RY5A 2IALA 1Q9OB 2NY1C 4EN3D 3OKDB 5CEZE 4LIQH 1OAQL 4FQPA 4ORGA 1UKSA 4QRTB 2OK0L 4ZUSA 3P9MA 4MA7L 5GZOD 4Y88A 5D8JL 3LH2H 4XMPL 3VDAA 1HIMH 1MCJA 4BELD 1XCQA 3K4AA 1H3XA 2L7UA 4WO4D 3CC5B 5C0ND 3MZTA 3VDCA 3NTCH 3FQTB 2B4CC 2FATH 1QFOA 3RL1A 4MMZC 5IVZB 3ULSB 5HBBA 1IAOB 4OM0L 1IGFH 5ANME 4N68A 1JBJA 4OLUH 3JWNC 4YFLF 4NIKB 5D7KE 2FECL 4FHBD 4XNXL 1LNUB 4LP4A 1MREL 2GUOB 5IG7A 3UTSB 4Y5XB 1B90A 1S78C 3O8XC 3SCMA 3MCLL 4IMLA 4JPWL 2Z4QB 2WINB 4FZ8L 2ZJSL 4M1DH 1B0GA 4MAYD 2XZAL 5F7KC 1I8KB 4TQEL 3W2DH 4KI1A 1CXFA 1FL6A 1ZHKB 1OP5H 3MV9E 2FWOA 2YKLL 3QDHA 4UBDC 2YRZA 1MJ8L 2PCPA 1K8DB 3GHBL 1LEGB 3OJ2C 3Q0HA 5DJAB 1DZBA 4JG0L 5KTEL 3WYRA 2AQ1A 1RUQH 4FXLA 3K81A 3Q1SL 1SYSA 4K9EL 1JNNL 5I8KH 4HIXL 3E6FA 1K6QL 1TJGH 2LFGA 3QB7C 5A3IC 4FQCH 4GRWB 1HHKB 4RAUA 3U1SH 4ETQA 4NC2B 1FAKT 4DGYH 1T7VA 1AGEA 3S36H 1J0HA 5GHWH 3ARQA 4IS6B 4K2UL 4KI5C 1E27A 4PJGF 2W65A 4J8RA 3OL2A 3BKCH 1UEYA 4JFOA 5T33H 3WNKA 1JNJA 1J87A 1KIRA 3DARA 5EOCL 3TYGL 3EHBC 1IM9B 4PV8A 1QEWB 4XCYB 5ELIA 1P4LB 5EC2A 4JHAL 4W6XB 4OLVL 5CINL 5C09E 4DZ8B 2AJUH 3T1FB 1BIIA 1A0QL 3F58H 4JFDA 1CFTA 2OX5A 3O41B 5C2BL 1L0QA 4NQVB 3N1QC 3SCMC 4PRAA 5I2IB 2A83B 4YHPA 4DFIA 5FOJA 3CVHA 2KDGA 5CZVH 2X4SA 1ZHNA 1RZ7L 1MPAL 3VFVA 1XIWB 3UTTA 1FYTD 4ZSOE 1KN4H 4O02L 4M9OA 1INQA 4PJ9B 4LLQA 3IFNH 4ZUVA 2MJWA 1RFDH 1I85A 3GMPA 4YUEH 4FFWD 3REVA 3KJ4B 4OFYD 2H26A 4ONHB 3S9DB 5KZCB 1EFQA 3GSNH 1NANH 2XKUA 4MSWB 1JN6B 1CT8A 1OSPL 1K4CB 4LMQE 4M4PA 2A0LC 3O81A 1AFVL 5DTFB 3R1GH 4OIIL 4NUJA 3EYVB 1E28B 2CO6B 2YEZA 3BPNC 1I8IA 5DT1L 1WTGT 4P9ML 1F3DJ 1VPOH 2IQAB 1FIGH 5MHSE 4JCLA 3QJHB 1F4XL 5F7EL 4BK5A 3TV3H 1MEXH 1MQKL 4LLMB 5A2JH 1UKQA 3MV7E 3V5DB 5D7LD 1CXKA 3Q6FB 1BOYA 4P2CG 3BPNB 4GH7B 3B3IA 2NQCA 1OOAA 1BREA 3X17A 3RVUC 5DF0A 5TJWK 4ZOEA 2ZKHL 4DW2H 1IEAA 3T0EA 1I1CA 3N1PC 1A1NA 5HI5D 1J5OL 1GGBH 2JELL 4JRYD 2F53A 3RWGA 3RTQC 2NZIA 4S10A 3CMOH 1DVFA 3SO3B 2BXYA 1D5XA 2FJHB 4XI5D 3RWHB 2OL3A 4GBXD 3OJDA 5GPRA 4MQSB 3KPMB 3NABL 4YHZH 2Q86A 4S1SH 4I5BA 2BNQA 5TDPB 1INDH 4RAVA 2V2TB 1J05A 5E00A 3VGGA 5IMLA 4M7LL 3HNTH 4WI3A 5GIRB 3VXRE 5LWYL 3O3BB 5IESH 5ESVA 1KELL 3OKLB 1FGVH 1QKZH 4PB0L 4S1DD 5CILL 4HKBB 2FJHA 5D6DC 3OZ9H 2HFGL 4Q9BA 4WW1A 1FRGH 3TVMC 3JWDH 1T21B 4L9LC 3GBML 3X11B 4RMWA 5EG6C 4OLVH 3RIFF 1EXUB 5IK3B 2UUDH 1QQDB 5GS2H 3WHXB 1RIVH 3MRCA 1XMWA 4ZUUB 2IMNA 3IXAB 4PY7B 5KSBB 3CXHK 3V6OA 3TVMB 5E99H 4P46B 2IPTH 3BPCA 4N8CH 5GRUL 1PZ5A 4ZPVA 3WJJC 3IDGB 3G5ZA 3VXRD 3MLXH 4CN4A 4O5LL 4LSSH 5BV7B 4R7NA 5C8JA 3F5WA 4L3CA 3WN5C 3DUUA 1TNNA 1NCAH 3EYVA 5I1LB 5F7HA 2HVKA 2EE2A 1BM3L 4C4KO 3NAAH 3TLRA 3BIKB 1S7TB 2VLMD 2NR6C 4NZTH 4LRIC 5FGBC 3D25B 1ZGLM 1C5BH 2I5YH 5D1QB 5EC1A 4HEME 3LQAC 1MAJA 4JQVA 4J4PA 4L4TE 3PGFL 1CDBA 2BVEA 2YD6A 4NFDA 4JDTH 4PGZA 5I17B 1RIUH 4U6YB 3WEXB 3DX7A 3O2VL 1RJYA 3V6ZB 3RAJH 3LRGA 4JAMA 3D3VE 1W8OA 3AGVA 2YD4A 1FL5B 3CIQA 3TA3A 1NEZA 5B38B 2XFXA 1QLFA 2MQ0A 5SWSD 5CEYB 4BQ9A 3UTPD 4L3EA 2VE6A 1AO7E 1RZKC 4LAJH 4OFYA 3ARUA 5E2UL 3SDDC 4P2QA 4WI5A 4IOFC 3LN4B 2JK5A 1G1YA 4J3OC 4APQA 4YHYC 1S8DB 3P30L 2FL5B 4D9LL 3DX7B 3LOWA 4X0KB 1CLCA 3MV7A 4NPYB 1H3GA 3QRGH 2XTJB 2I27N 5FUOH 3R4DA 4FQQB 4L8SA 5CMAA 1HHHA 1S5IL 4PS4L 1F42A 4ISVB 3U0PB 2ZNWA 3BIKA 4NBZB 4D0CA 1KENH 2FJFA 4QRRA 3CFKA 4PTTA 1U0QA 2AXGA 5GRXG 2XA8L 4NO2A 5JW3L 3IFLH 3ROLA 3B9DA 2PCPB 4IEFB 4M8QA 1ZSDA 4AEFA 4NKQB 1DLFH 3IETB 1CL7H 4X7CC 1JFQH 4LSTL 2VDRH 1HHGA 1GCFA 5EN2B 5E4IA 3RU8L 5DMIL 4F7TA 3L3OB 1J0YA 4MMXC 2RBLA 4LQFH 4JO1L 5DC4B 4ISVA 4OCSL 5EZOL 2R56H 4OCXH 1XCTA 2HKHL 3MBEC 2VUOA 2FLBT 4HPOL 5T1KB 4UT7L 2NY4B 2X5PA 5FFLA 5H37H 2IH3A 5J11C 2XN9D 5KSUB 1J0IA 1QOKA 4PTUB 1T89C 4BQCA 4HF5H 1OT1A 3RGVB 4LMQI 1MOEA 3QFJB 2V7NB 4PLJD 4YE4H 3CH8A 4NN6C 3KDMB 1P7HL 4W81A 4MAYB 2VLJB 3QEQB 1KPVB 4XP4L 1BQHA 3QH3B 4PJ7E 5JNYA 1HXYB 3X3GL 3LS5L 4N8VG 5M95B 8FABB 4Y4KC 4F8TA 4NZJA 3T08A 2Q86B 1QP1A 3OB0K 3ARVA 4C58B 5FIEA 4CVZB 1YEJL 4UAOC 1CK0H 1ZS8A 1U8HB 4OF0A 5DJCA 4YFDB 4OCWL 3C8KA 1CFVL 5DR5L 5D2LA 3GBMH 4KKLC 1UXWB 1IGJA 4Q6IA 4XPGL 2FJGB 2HT2D 3ZKXC 3TNMA 4HG4K 4JPIB 3U2SB 2Y6SC 2FEEI 1EMTL 3L9RA 4PGBB 5L0QC 4J3WA 4PTUA 2FX7L 3O2DA 3VD9A 3MXWH 4POZC 4W4NA 1KG0B 2W07A 4PJAE 4OF7A 2EYSA 5I1GL 3U46A 2UUDK 4PJHA 5F1IB 1XH3A 4LCYA 4O5LH 3BN9D 5IR1B 1E28A 2Z8RA 1ZVHA 1AGDA 4L9LB 2XTJD 3HC4L 4I8DA 1VA9A 1CU4L 5FM5O 1EGJL 4NFCA 1MRDL 2E8ZA 4M8QB 5CJQL 4POUB 4PV9B 2ZUVA 5LG1A 3O3EA 1MCIA 4PY8I 3ARFD 4AEHL 1CGYA 4FQLL 2I9TA 3AREA 4PJ9A 4YC2C 1BZ7A 4MQXD 1MFCL 5HYQA 2R1XA 5INDB 3SDDB 4MA8L 5FYJE 3P4MB 5D7JD 3HAEH 4ODBD 3RAJL 4P2OC 1HHHB 1OTTC 4ODSH 5DVKA 1V8HA 4QXGH 4L8SB 3QSKB 5GHWL 1QVOA 3V5KA 2SEBA 1YMMB 5ICYA 4MQ7A 1NFIA 5GGTA 3MLUL 4JANB 1X5GA 1P9MC 1VESA 5K59F 4RWYH 1P84K 5L9DL 2GJ6E 3DTXA 1T0MB 1FFPB 4LDLB 4MB3A 3IU3B 2NY0B 8CGTA 5L7XH 1MH5A 5DMGC 1U8IB 1I4FB 1RK0B 2PXYC 2ADFH 2JE8A 3ARGA 4PGEB 1OTUC 4U1IA 1KOAA 3OBAA 1NEZB 4OQTA 1JIBA 3ZYOA 5C0CB 4L4TA 3MGTA 1YDPB 2XG5A 4L5FH 3CLEL 1KN2H 5IMOA 2HYMA 4R9HA 1SY6A 2GAZB 5CD5C 1H5BC 3LD8B 3WFZA 5GJSL 5H2BB 3S97C 4DWHA 1P4BL 1EERB 3CDFA 1FNLA 1A6VL 3PL6C 1IE5A 1ED3B 1S7UA 1Z0MA 4XP1L 1EPFA 4V1DB 1H5BA 1BZQK 2GJ6D 1FNEA 3MFFA 4CN6A 3QXUA 1M71A 4NGHH 3BZEB 5EU6D 4FQJH 1DCLA 4O58H 4F8QA 1HI6B 4F9PA 1EZVY 4PJ5B 3WV0A 2RIKA 3NOIA 5EIQA 3VXUE 5GZNC 1RURH 4TULH 3VMNA 4HCRA 4U6HB 1JYVA 3SCMB 5FHAH 4JPKH 4X6DF 4RGND 4ZPVB 2QSTA 1OSZB 1MFDL 2OP4H 5GGVH 4DAGL 1BFVH 1SJHA 3PWLB 5DD1L 1ZV5A 5F7LB 4KHXL 5GJTH 4LEOA 1T89A 1CF8H 4PBWD 3QFJE 3ALXA 2LAAA 3IDJA 1INEL 4O51A 2J5LB 1QQDA 3RUGE 2Z31B 4Z7NE 2Y23A 3KLAB 4JY5H 1JPSL 5HDBF 3KG5A 1WC7A 2VH5H 4D3CH 4X7FC 1G6RA 5D2LF 3I85A 3BRFA 3BXNA 4GKZB 3PWJB 1UWEL 5KN5B 5D1XC 2GTWA 4QY8B 1PG7X 3GSXA 1UZ6F 4GQPH 1INDL 4H26A 4K55A 5DHYA 1ORQB 5GIRA 4PJ7F 2DIAA 2R15A 3EO1A 4ZFOB 4BH8B 1NMBL 1OAUL 3BP6B 2F53D 3G08A 1JTTA 5B3JE 3KNBA 5CJXA 3BN9C 2FZ3A 3IU4L 1HHKA 4Q58C 3SGJC 3QO1B 4I0PB 2APFA 3HE7C 3G5XB 3G5VA 3HR5B 4LKXB 2LTQC 2BOCB 3E3QC 5K9QG 4JFHD 1GC1C 3CFIC 1YEKH 5FUCE 4IRZL 1YEGH 5DWUL 2BJML 3RY4A 4GW5B 2EKSA 5IQ9B 3ARPA 1LO0H 3EOBA 5CJOH 5C0EB 5DO2D 1QFWH 3QAZB 4LSUL 1SVZA 1MJJA 3FT3A 2YUZA 5KJRL 1YEHH 1FNGB 4Q6IC 3N85H 3SPVA 5KN5A 4QHLB 1L7TL 1T6VN 1BP3B 1VEOA 2X4TB 3B2UC 1M71B 3V5HB 3RTQB 1WC7B 4U3CA 4U1SA 4LVOC 5IG7B 4P4KA 1A2YA 4LPUA 5LAXB 2K7QA 3UMTA 1EH9A 2Q8AH 5A1AA 3GJFK 1I8MB 4S1RL 4I2XE 5DMGD 1WT5A 4P3DB 5C0CD 2MPAL 3SDXF 5EOQH 2HVJB 4JZJA 5E4EC 3SDCD 4PGDB 4M5ZH 3HE6A 2VXSL 4WFFD 4ELMA 5KVFL 5FO8A 3TBYA 3CC5A 3PWNB 1ZANL 1ZLVH 3PP4L 3U6RB 3O6MH 1QBML 1R3IL 4OZ4A 4NHCH 4N9OB 3H2WA 1MFDH 5MENA 2A9ML 3QPXH 3X14A 5I15L 3KLDA 2HMID 2ZUQB 5C0GB 3MLPA 2DQEL 4AL8H 1CR9L 3UDWA 2C3HA 4ONGL 2PYFA 4MNQD 4FQ2L 4M6OH 1B2WH 1NGQL 4G6FD 2R0KH 3QPQD 1WIOA 2VDKH 3H9HB 3QJFB 1NFIB 1JYWA 3HUJF 1N5AA 3ZKMC 2H32A 4R0LA 4NO3A 4GRLC 2DB8A 5B8CA 5B4MC 5JXEC 4YIQB 1E4XI 2IAMB 3UBXB 2QV2A 1UWEH 5L2JB 4LSQH 1YC7A 2BK8A 4PFEA 3OB0H 3GSWB 4OFVA 3LV3A 4CU7A 3ISWA 4JDZB 1HIML 2ATPA 1EBPA 2QL1A 43C9B 1CLZL 4PYHA 4R4BB 5T3ZH 1R5IA 4PJ5D 1BF8A 3HZKB 3PXHA 2XI9A 4P59L 5I9QC 5HHVL 2AV1B 4NRYA 1I3RB 1SJVA 1IGFL 3BZFA 5GSVA 3OGCB 1OF2A 5TH2A 4CADB 1N6UA 1EO5A 2F8VA 1F6FB 3EYQD 3LHPL 3Q2CA 4XC3H 2OR8A 3ILPB 2Y06H 2P5EE 3DROA 4JPWH 2BVQB 4WW2B 5IW3A 3SKOB 1RUMH 5DHVB 4U1LA 3MA9H 3FONB 1GGIL 1FO0A 4WI4A 4MCZB 1DQQA 1E6JH 1Z5LB 4LAQL 5F6HI 4PJXF 2YXFA 4WJ5B 2EZ0D 2H2PD 3QCVL 2W0PA 1UQSB 3WJLA 5GS1B 4D0BB 3A67L 1U8LA 3NN8B 3MODL 1DQML 4BYHA 3HE7B 3S7GA 4K3HA 1AGDB 1EHLH 4I0PD 1V3MA 3AFLA 1XH3B 5CP7A 2JKXA 4IOIB 4BZ1H 5EIIA 1ZWIA 3ARBB 2H3NB 4OGAD 5L2KA 2I60H 2CIIB 2VN4A 3ESVF 1CXLA 3CU1A 3DMMB 3TBSB 1D6VL 4WCYH 3D39D 1VFOA 1S7XB 2VB5A 3SKUD 4ZXBC 1GHFL 4R7DA 4HUWA 5C08D 2YPKA 2WUCL 4OV5A 3WS3A 2AJ3A 4JDVA 2NY2B 1U93A 3I75B 2NLJB 2PXYB 4KK5D 1T22B 4AH2A 1KCSL 4DK3A 4ONOA 2P43B 5JW4R 3GJFB 3AAZB 4L29A 5D7IA 3ARBA 4ELME 1S7VA 4BA8A 2NW3A 5CAYB 2QSQA 1AP2B 2HMIC 3D2UA 3BJLA 4WHTA 3U79A 3FRPG 3O4OC 4S0TD 4XCEA 2DQDH 4K94H 5DMKB 3ARBC 5EZIL 1OARL 1BPVA 2Z91A 1OQOA 3HMWH 4YAQA 3CK0H 4JFZL 1P4IL 1UB5A 4U7KA 1C08B 2WLZA 1YNLL 4KMTH 1MREH 1K2DB 1QTYT 1RZJH 1V3KA 4HCRH 4QXTA 5MEOB 5TPWL 1S9VA 3RGVA 4JGMA 2C7UA 2RAMA 3SDYL 4FZEH 1L9MA 3H9YA 1XR9A 4EOWH 4FXGA 1YEEH 3FN0H 4PRHA 3STLB 2K7PA 1PVHA 3TT1H 4M7KL 1PBYA 1JF1B 4JREB 1UWXK 2VXSH 3UBXI 2VDLL 1DBBH 2C3XA 1FE8L 3EKCA 4Z77B 3VRLE 1EDQA 3RP1A 5IB3B 1SHMA 3WXWL 4X6DE 3RGVC 4O2FB 5IROA 1JWMA 3HG1A 4OV6F 4EI5C 3EOTL 3WJLC 1JZ3A 4PJ5E 2GW5A 4XP6H 1EK3A 2UV3A 3LRHA 2AV1A 3ARDD 4IMKA 4HUXB 4NRYB 4TPRH 5J3HC 3SDAB 1YUHA 5DJXA 1YPZA 1KCRL 2WQ8A 3PWPD 1FIGL 1MCCA 1AJ7H 3DRTB 3QUYC 4KRNA 5H8DA 3QISA 1X5YA 4V1DE 1ZGLP 4XNUL 3D0VA 1RZKL 1TJIL 5BW7C 3FRPA 3PGCB 3ZT5A 2LE9A 2O5YL 1S3KL 1AR2A 4XNYH 32C2B 4F7CB 3QI9A 5EOCH 1KLUA 1WZLA 4P2RA 4YUEL 5CUSH 1KJVA 2OQJB 3T77A 3GSVB 1U93B 3I75A 5FYJH 1DDHA 3WFCH 1KC5L 3WS3B 5IWLC 2R39A 4NQXA 4HUWB 2B1AH 4L4VA 5HHVH 3UEZA 3T0BA 1L0YA 3JWDL 25C8L 4MJ5A 4MVBC 3RIAK 5JPNB 1NGYA 4AIXA 5CEYA 4UTAH 2XQBH 5FO9B 4LSPL 1YUHB 2X41A 1WLHA 4QRPD 3IT8D 3FB7A 3D85D 1LO5B 3DVGB 5D71L 3WJJA 4JAMB 3RVWC 4UV7H 3EZ8A 5BMFL 1ZLUK 2Y5TA 2PW1B 5D70L 5L2KE 3WEXA 3QDAA 3ULVE 3IAPA 5GZOC 2X1QA 4GRLA 4HUNB 1JCKA 4MXQC 2A9NH 4YPGA 4P2OB 1VACA 3HAEB 2XACC 4GAJL 1SEBB 2YD7A 3WDHA 5C0AB 4K8RL 5TE6L 3MLXL 4NN7C 3TN0B 5E95B 2G60H 5HHMD 1QR4A 3WUWB 4CVXA 2W92A 3RIFK 1QRNE 3DXAB 4MAUH 4JM4H 4J4PC 1B0WA 5IFHH 4RFNC 1PJ9A 5AG9A 1DQMH 1YEFL 1EHNA 2RJMA 3MGAA 3C87A 3MJ9H 3T0AA 5SWSB 1AD9B 4GJTB 4HWBH 3L1OH 1GOHA 3TT3L 4NWTL 3UTTD 1EAPB 5FM5M 1X4YA 2A6JA 1EEUA 1MHEB 1I7TA 4P9HC 4XPHH 1LO4L 1TVHB 3DMMD 2ZCKL 4MD0A 3QDJB 3TN0D 5GS3A 1NMAH 4GXVL 3S35H 1QKZL 4E5XB 4PJAF 2VERN 4G3YL 4OFKA 3O3AB 5AD0B 1A4JB 1T4KB 5IEHA 1A7PH 1F8TH 4TUJB 3HC0A 4OIAA 4OZHA 4ZFOL 4PJCA 3VXME 3V8OA 4UT6L 4ZAKB 1CFSB 1IGYB 4YO0A 3QIWD 2ARJB 4YXLL 1WVZA 3LV3B 4OV5B 1Q9LB 4HK3N 3MOBH 3B3IB 3K1KC 4L3AA 3BH9A 4HGWA 5KZCD 5E9DB 2ZP0T 3BJ91 4I77L 3GI9H 5HHOA 3MV8D 3PDOB 5TGBB 5E00B 1ZLSL 1D5IH 3OTTA 1LP9E 4I18B 3ARDC 1TXKA 1N5AB 4PRNB 4HS6A 1G6RB 3B9KA 2BNQB 2JIXB 1ULVA 2ESVD 3LDBC 4PBXA 3TVMD 5HY9B 3S36X 3QDGB 4XBGA 1MCSA 4HCRL 3FN9A 1DP0A 3T4AB 1K4CA 4GS7C 5BV7C 3EFDL 2VQ1B 2VSCA 3CFJA 4LEOB 4A6YL 3FB5A 2CLVA 3LMJL 2CPCA 2YSSB 3OR6A 4HV8A 4Y5YA 3IFOB 1NUFA 2IFFH 3UPRB 2BSRB 5FO8B 4BKLB 2MPAH 1KJ3L 5TDOA 3AS0A 1XIWC 2VZOA 4P2RE 3C60B 1FN4A 4U6HA 2IJ0C 3U9PL 4LHJB 4HXBH 4P57B 1SYVB 4QCIA 3PP4H 4X6CA 4G6AC 1CFQB 3BT2H 2E8YA 4PRAB 3ILPA 4JO4H 1KYOK 3U48A 2VISB 1M7IB 4NM8H 5HHPA 4TPRL 2COQA 5IB1A 2KQMA 3WD5H 4M93C 3E1F1 5FGCE 3T0WA 1LP9F 4LHQB 4WIQA 3QHTC 1ED3A 3OSKA 1S7UB 3V0WH 4PJ8C 1HWHB 4HS3B 5F72S 2PTTB 3WKML 2J8UB 3QULB 2BSTA 3GBLA 4WU5A 1EAJA 1R5WA 4H1LB 1W0WA 1KSRA 2FR4B 4N0CD 4XP4H 3U4EA 1R5IB 3F7VA 3EYSH 3LS4L 5IBTH 2F54B 2W9EL 4HDIA 3K2UH 2AK4B 4KUCF 3ZHKA 3FAXA 2NCMA 4KHTL 4QT5B 1NGPH 2W0FA 4HHAA 1F4YH 2AV7A 2DJ4A 1KGCD 5F9WB 3SE9L 2XTJE 1JRHI 4PRIE 3HI5L 4BQ6A 4OB5L 2BVOB 4KDWA 4Z0BH 4HLZH 1WWAX 2DQTH 5JW5A 5DR5H 3C6LB 4KJQD 1G0DA 2NW2A 1P4LA 1MCPH 2B20A 1F45A 4YQXH 3WIHL 5D96C 4OT1L 3RWEB 4IRJC 4Y16C 2YZ8A 4NRXB 4JHBA 1TETH 3MLRH 1A4KB 4WU7A 2A6IA 4QOKB 4KRLB 4HKXA 3E2HB 1WCBB 1A6TB 3ULUC 1FYTB 4KRPC 3KLAA 4L8CB 3CXDH 5IGXH 1RSFA 5SWZB 3RWDA 1A1MA 4QXTB 5GRJH 4FQ1L 4ZFZB 4Z7UA 2FX7H 3QYCA 5CJQH 4R8WH 4WENB 3VRJA 3SKMA 4MJ2A 5JTWA 1A3LL 3FT2B 4KI5E 2FWOB 5SX4I 4NUGH 3X3GH 1ZHBB 1QBLL 1NDGA 4OZFA 1FAIL 4XCEB 5E2TH 4OKDA 4YHLH 2P4AB 1BWWA 1KG0A 4XPHL 2QHRL 2EXYC 5BW7A 4R26H 4K3DH 3JV4A 2DQJH 4PGJA 3ZDXE 2D31B 1Z3GL 1FNEB 3L7EB 4GKNB 3JTSA 3PIQB 4HWNA 1FJ1A 3HNVH 1BQUA 3ECBB 1CVRA 1T22A 3BP4A 5EO1A 3U30B 1XGUA 1PW3A 2NY6C 5SV4A 4Q7DA 4MHHG 2N7BA 3BPOB 4GT7A 4JHWH 3IJSB 2OXHA 1HHJB 1OGAD 2XG4A 2WM0A 5DDHA 5E6ID 5FGSA 5IROC 4CRPA 3NA9H 4IOSD 3SGEI 4LOUD 1B88A 2N7AA 4K7PL 5CLWA 2E7LC 4PJAA 4ZS7L 3RX5A 1JGUL 1CIDA 3WSQL 5HGDA 5I1GH 3NCFB 4WV1A 1UC6A 3LS4H 8FABA 1IAIL 5I30L 1UG9A 2CGRH 2EH8L 5E94A 4K7PY 4KHTH 4PJDA 3QH3A 1NCDL 4WW2C 2LAGB 3F12B 1BGXH 1HINL 5MERA 5IBLD 2IPUK 1FVDA 2A77H 4G9FE 3KDMA 4QGYA 43CAB 4YDLB 2P47B 4X4ZA 3WO4C 4X5WB 4G8GD 1IAMA 2Y36H 4W6WB 1FBIH 1F3DH 4XVJL 1CD9B 4OZIA 4XGZA 4EBQL 5ICXB 2AVGA 4OZGA 1OAXL 1QVOB 3DETC 1JVKA 4PJ8D 4U1HB 3EYOB 4FZEL 1IC4L 3MRLA 2XQYK 6FABL 5I1EH 4WU7B 1F4XH 5J13B 5EA0L 5EUOA 5TFSL 4U1LB 1CQYA 5INDA 2RCSH 4XNQA 4YDJA 4UIKL 4WTWA 1FE8H 4A6YA 4EVNB 2VKWA 4MZ2A 4N8PA 1UEMA 2YA2A 1U8PB 3GRWL 5GRZA 3IKCA 2VL5A 4PJ5A 5A2KH 4X8XA 5LGHL 4KKBC 3LKSB 4X98B 5JLZB 5T1MB 1QHOA 2FJFB 2DBLH 4G42A 3MFFB 5DVOA 3LKNB 2XXMB 1BJMA 1IJ9A 4MA3B 1CI5A 2XWTA 4FTVD 4NZUH 3U0TB 1D5MA 4M48L 5IHUL 4MDIB 2LV4A 3O4LE 4FQQA 1OAKL 4V2BA 4GKSB 1EBAA 3LKOB 3ZDZF 3RZCD 3ELAT 4O00A 4YHLL 4YHML 4ZTOL 4Q9CA 3V79C 2KKQA 3OXSA 4H1LA 4H88L 1A6AA 2VC2L 5DMYA 5JXEA 3MV9D 3IJSA 4MNQA 1Q1JL 1G7HB 4KRPD 2IANB 2X1PA 4Y4FA 3VXSB 1WK0A 2ENYA 5BZDB 3JUZA 3KHQA 4MA3A 3O6LH 2PXYD 1KCVL 2HG5B 4PJGB 1U8IA 2ARJQ 5IJKC 1FPTH 4WO4A 1SQ2N 3MNZB 5D93B 2NXZB 5ICZA 1NC2B 3DX9B 2ZUQC 1CLYH 1JI1A 3I02B 4YDKL 4LVHB 5CJOL 2FNBA 3H6JA 1ZHBA 5TDOB 1FG9C 1JK8A 4LARL 3O9WA 3G6AA 4HBCL 5JUEL 3G6JF 1ZLWK 4U1MA 1NCBH 1LWRA 4OM0H 1ORSA 5C6TL 3TWCH 4L8BA 5JHLL 1MNUH 1PQZA 5KS9E 5FDYA 1KPRA 2QEJA 4GRWH 3SDDA 4KPHL 4S2SB 3KXFE 2YKLH 1WITA 4OI9A 2X4OA 1ADQH 4JY5L 4MAUL 1IEBB 4X4ME 1ITBB 1MCHA 5I19L 3BOVA 4WI9A 1JPTH 3PQYE 4BSVA 3PDOA 1BFVL 3ARZA 5DD1H 4TVSa 4U1KA 4JDTL 4NRXA 4R97B 5H37G 4FQCL 3D69A 3NGBB 3UYRL 2YHGA 3UTZB 1T1XA 3UO1H 1OGAA 5E6IA 3UZVB 5E94B 3RA7L 2FHCA 4P2QD 5EU5A 1WZKA 1ZT4A 3AS3A 1QFHA 3N9GL 5I73C 2H2SD 4LCWB 5IQ9A 3QWOB 1U8MB 2FBOJ 3I6LD 5I1IH 4C57C 2Q76A 4RZCB 2VZUA 5C0IB 1CS6A 3GIZL 3F62A 3G5XA 2EIZB 4Y8AA 3JWOH 4HUKB 1U58A 5I8EA 1FLRL 4YBQD 2BNRA 5E8PA 5I1DA 1I1YA 2Y07L 1CGSL 5C07A 3F7VB 3P11L 3VDBA 4FNLL 1XF4A 3RPIB 3BDBA 1CE1L 1MIEL 1W0VA 3CSPA 1W0WB 5CP3A 1CXIA 5FHBL 3T2PA 3EJZD 5FA3A 4JVUA 1IQWL 3BKJH 4FG6D 1F5WA 4XCFH 4KUCD 1KEML 3QWRD 1T03L 1NLDH 5FOBB 3TN0C 4NQCA 3SDXB 4JVWA 2XRAH 4XC1H 5DUBA 1SBSL 1K8IB 3PWVB 2VLKD 1RJYB 4WI8A 3V6FA 1I3UA 3FT4A 5F21B 4K07A 2YXMA 3V5DA 3BPLB 4XWGL 3GSOB 3SGDH 4AIZB 5IV2B 2ZG1A 4LQFL 3F7PC 2QQNL 3SQBA 4DKAA 3HB3D 2MCPH 1BJ1J 4V2CB 4W6YB 3RZCC 1JZ7A 2GK0B 4YHNA 1TVBB 1RMFH 2OR9L 5FO9A 2J3SA 5MEQA 1I85C 5E2WL 4O2EA 2AS5M 3IRZA 3T4AA 5A2IH 5J89A 2A6DB 3TO2B 4CU6A 1ROWA 5I66B 2BHUA 2ZSWA 3VD4A 1KTDA 2MHAB 3RL2A 5ACZA 4GXUN 4NQXB 5AZEH 1U8QB 4M1GL 4PJBB 3A6CL 2OYPA 3ZTJH 3TM6A 2D7OA 3MTRA 1H3PL 3T4YB 1MIML 2AQ2A 3VWJA 3GMPB 1S9KC 3SGEH 4LCCC 4DCQA 4NO2B 1UT9A 5IFJB 5FYKE 3RJDA 3EGSB 1G9NL 1FYTE 1TNMA 2VABB 4TSAH 4NHCL 3BPCB 4TN9A 1TDQA 4P4KC 2IPKB 2BNRD 4GBXA 4MA8H 2D9CA 2WQRA 3QNZA 4U2ZA 3LDBB 1E6JL 3C09C 2Z0BA 5HHNB 3CVHB 2ATKB 2QHLA 5LXGL 3G04A 4M7JH 3T09A 3WHXA 1R5VA 2DKMA 4PLJC 3NCJH 1F4YL 5HDOA 1XIWD 2OI9C 1R3HA 1YJDH 5C9KA 1GL4B 2BSSA 4NZRH 4P4RA 3C08H 3FQNB 4NPYA 3HC0B 1DSFH 3UROR 2EC9U 5E2VL 3VFRA 3IU3A 2J8UA 2DQGH 5GGTH 4QHKJ 3WE6A 2WUCH 3BUTA 3LPGA 1XGQA 1A64A 1ZAGA 1UB6B 5JW4M 4KDTA 1N64L 3IFNL 4NOFA 1HKFA 3WFHA 1D5ZA 5BQ7B 5DJ6B 2H2SC 4LLYB 3BMWA 4NQUA 3UTTE 1FL5A 3G04B 4OLXL 4MLSA 4RAUB 4FQXA 4QRQA 4OQTH 3JZ7A 4GAGH 3CJJA 3KYNB 3PUCA 1AD9A 1OW0C 1EEYA 3GB7B 1B4JH 2EIZA 1D5XB 1S7QA 3UJJL 3L3KA 1A6WL 3NZHL 3GO1L 4I48B 2XKNB 1S9VB 3FB6A 3JVGA 5MEOA 3NA4A 1ZGLB 1U8MA 3MBXH 4F7PB 4PJBA 3QXTA 4WI6A 4BZYA 1A6ZB 2VIRB 4GRMB 1X4XA 2N1KA 4PLKC 2ZCLH 2EDYA 3L5HA 4LASH 1M7DB 1TZGH 2XTJC 4XAKE 2Q8BL 4HWZA 3QFDA 4JKPH 2EDHA 3VG9B 4LLMA 1E4JA 3RDTD 2DLTA 4HK0B 5IVXE 3UX9B 2X4QA 1UACH 5FECA 5L88L 1C8PA 1RAMA 2HA1A 3SKJH 5GRYA 3U9UA 4JPKL 1RK1A 2R0ZL 3MLTA 2DF3A 4EIZC 2YA1A 2LQRA 5A2FA 3MLSH 1B0RA 5BZWB 3SDYH 1LQSR 2HH0L 3STZA 4HUUA 2BOBB 3NFSL 1C5DA 5FUZH 3STBA 3DMMA 4P5TA 1AHWA 2FH6A 2JB6B 3ALPA 1J1PH 3PABA 4GMTL 1T21A 2K3TA 5B22A 3T0EC 4OI8A 2BNQE 3FKUS 3KPTA 3LIZH 2ZUTA 1KV3A 5D96B 3BHBA 4WEBH 3RKDD 1L7IH 3LH2L 1NCWH 3O6KH 4PJGA 4XMPH 1MI5D 2C3WA 3IJHA 2X9YA 5I1DB 3FO9A 1HDMA 5LJYH 3T1FA 2MKWA 5DK0A 4F15C 2IANA 4JO3L 1NFDA 3FO2A 5SWSA 1AJ7L 3HI6L 4HFWA 5TPWH 1NJ9B 3KYKH 4X6EA 1FO0B 2IH3B 4ODHL 3T0EB 1H0DA 2W60B 5E1HB 4X7TA 4KRPB 5JXED 1VACB 4RWHA 1T80A 1IT9H 2B2XH 3QXDA 3E6HB 1HZHL 5TE7H 4PGCA 5EOCJ 5ETUA 3J8F7 4DZBA 1UYWL 5LGJB 4FS0A 4UDTB 2UY6A 2CRIA 2YPVH 1CF8L 2VL5B 4Y1AD 3ILQC 4LLDA 5C92A 1QZ1A 2C1PB 4G7YH 5D7SL 2GY7B 3WFBH 4ORZC 2DL9A 3Q6GL 2NXYC 1HK6A 2FGWH 5HDQH 1DE4A 4WFHD 3QXVA 4UQ3B 5JPNA 5CZKA 5BRZE 1D5BA 2VH5L 2OM5A 4HH9B 2BMKB 3DV4A 4FMFA 4UV7L 2ATPB 3MXVL 4D0CB 1GVIA 5HVHC 4OJFL 3S98A 4OCXL 2PW2B 2OK0H 2EXWD 4WWKA 5LKNA 4KJPC 1BD2E 3GKZA 5EU3A 1BJ1H 4OZGB 4HZAA 2BSED 1ZVYA 4WUUE 1HH9B 4EI5D 4H0HB 2MCG1 1II4E 1FL3A 4JFEE 1JHLL 1K5NB 5B39A 1VGEL 2AEIT 2OJZL 3P0YH 4HAGA 3RI5F 3UXFA 3GSUB 4X7EC 4H20H 1A7PL 1F8TL 1YEFH 2UZYB 3P4LA 4N90E 3EJYD 5GGTL 2EZ0C 1TJHH 2QKIB 1P6AB 3L95A 2EDNA 1S7SA 5GS1C 4M62L 5MENB 2XWJA 3ET9F 4EQ3A 4F58H 1QR1B 3MREA 4WV1B 3SDAA 5EIIB 1NCCH 4LVEA 5F1KC 5EC2B 4TNVF 1NMCC 7FABL 5JXAL 1QEWA 4XCYA 2X89A 3QIBA 3TBYB 4PJAB 3HG1B 5HTSA 4QYOA 3BVNA 4P2RD 4JZJB 3RDTC 5DJYA 3ULVC 1O7SA 1PLGL 3RDTB 5ILTL 3E8UL 4F57H 1U8LB 1PGRB 2Z35A 5D9SA 5HYEA 1M4KA 4PD4K 3EDEA 4RMQA 4CN1A 5F7UA 3VFMB 5D72L 4CBPA 1S7TA 4KPHH 4OCMC 5IT2L 4KK6D 2QLVB 5DMIH 2VWEE 5T1KD 2O5ZH 1Z0NA 3LAFA 3MRDB 3W9EB 2AJSL 1I3GL 1N4XH 5CHNB 3MFGB 1ZT1A 5I19H 2AEWA 4LVNC 3IDGA 1MJJB 3FT3B 4A6YB 4EVNA 1CE6B 4IIQB 3UTZA 3C5JA 1CIUA 1Q9WA 1FDLH 1IAKB 1UGNA 3VMOA 5TH2B 4IRSD 1QG3A 4KZEH 4H1LG 4Y4HC 3VXNA 2Y5EA 1CU4H 4YR6A 4G8FB 3KPQA 2ZKHH 4DW2L 1IFHL 1PG7L 5B8CC 4RRPG 2YPLD 4Y4HB 5LCVH 1JHTA 4WNQB 2UVEA 2ZNXA 1X5LA 2AJZA 3KPSD 4NFBA 1EVUA 2R2BB 3V6OE 1CICB 2YD8A 5K9OA 3RL1B 1FVDB 3U7WL 4HJJH 1MCOH 2GFBA 2GCYA 3QDJD 2NNAA 2HRLA 4QY8A 4JJ5B 5C0JA 1MVUB 3WS6C 4MD4A 3MRRB 2H1PL 1KPUA 1XR8B 2OJEA 3QA3A 2NXYD 1YMHA 5EWIL 5D5MB 3H9HA 4RGOL 1I7RB 3DX9A 2BXZA 4J3UA 4R97C 4Y4KB 1BEYH 1S7SB 3EO0A 5HYJB 1IM3A 3RWHA 3MACL 4ZO9A 4JFFE 3ZYIA 1Q9OA 1JHLH 1TTGA 4LCIH 4NSKA 3VXOA 2HFGH 3MXWL 3P73B 4OF6A 1MHPL 2R1WA 3T3MF 4C54A 1XGUB 1HWGB 4GS7B 1RUPH 2HT3C 4QNPF 3SQOH 1G7HA 1DUZB 4O02H 3FOMA 4U05A 1SM3L 4FQJL 2EDFA 4K7FB 5GISH 1PKQE 4Z7VE 3S96B 3IFPB 3FQXA 3RWIA 3ZT7A 5I75B 4F7EA 4GW1B 2IPTL 3DGGB 4AMKL 5DQ9A 4QRPE 3H0TB 4M7LT 1U41A 4DVRL 1N5YH 4PJIF 3U4BL 4LAQH 4KROD 1AO7B 3LKNA 3WFBL 1GGBL 5L0QB 3VRJB 4GQ9H 1YNLH 4KMTL 3EDDA 1W72B 1SYVA 4N5UA 4Y1AE 3MODH 2UWEF 4UV4L 2PYEA 3BH8B 5E8DL 3ARYA 5LBSL 2BVPB 2FHFA 1FYTA 5T1DH 4IDJH 1FAIH 3IJYA 4L4TB 2X44D 2C5DC 2CLVB 5L9DH 4LLWB 1QSFE 4PJFF 2VQ1A 3P73A 5ESAB 1EA9C 1RVFH 2CDFB 4XZUA 2CJUH 2Q6WB 1JJUA 2DMKA 4NO3B 4JM2D 4PRPA 2EH7H 4NO5A 5DD0L 5K9JH 1BIIB 2VZTA 1BX2A 3VD5A 4NWUL 5D1XA 4KJWC 4LPTA 4PRNA 2EDTA 3WL9A 3MLZH 3BP6A 5I18L 4U6TA 1NGWA 2CKBA 3M45A 3VH8B 5ABDE 1Y0LA 2HJFB 3LPFA 3BH9B 4HGWB 1RIUL 3F12A 2ORBH 4OD3H 2AJZB 3G9AB 1AGCA 1MI5A 4FQXC 3DHMA 1NBYA 3EFFB 3SE8H 2E7HA 4ZAKA 3KGRA 3TCXA 3CK0L 2PN5A 3R0NA 1S5IH 1L9NA 2BVPA 1U3HB 3S5LB 3O2DH 4P4KD 2IQ9L 4ZPTB 4HUUB 3MRBB 3MLVL 3LB6C 1YEDB 1FC2D 3MACH 2JIXD 3TJHC 1U3JA 3BAEL 1BJ8A 2I24N 3MJGX 4EXKA 4JFDD 1I3GH 4E42B 3FFDA 2HT2C 4K71B 3IFLL 4G7VL 3OKNB 4NYLB 1QFWL 5I1JH 1CICD 5E9DD 4LCYB 3PGFH 1U8KB 2IG2L 4PJHB 5F1IA 2X4QB 3QQ9D 2Q8BH 5FECB 3DGGA 4LNVA 3DV6A 2C4XA 1BBDH 4OCSH 2R1YB 2OMBA 4NQDB 3D18B 3AM8C 2GUOA 1XGPB 5E8EA 2EKJA 2MOVA 4Y5YB 4WDIA 4E42A 4G5ZL 4M5YH 4AYFA 4YPGB 1ZA6B 4YFEA 4JFQB 5LQBL 2IAND 4MHHI 3VGAC 1G6VK 1G1CA 1W0YT 3LKRA 3EIFA 2ED7A 3V0VA 2FHBA 4WUKL 3H9SE 4KU1A 4EN3A 1MWAH 4X8JB 2R2HB 4R2GB 5DJ6A 5D4QA 2XWJB 3WFHB 1BQHB 3ZE1F 5F8RC 2VZVA 1BVKA 3VRIB 2CUHA 3SCMD 4KAQH 2DQCH 2VLRE 3ZHLA 2DQUH 3CZFA 3WE6B 1K5NA 3ARDA 5B39B 3W0WD 3P30H 4D9LH 1RZJC 2CJUL 1FFQA 3C5SB 2R4RH 1KULA 3C9NB 1LO0L 1MHPH 1CFSA 5HYSA 3M8OL 1KT2B 3VG9C 1FLTX 4POYA 5AD0A 2OCFD 3JSSA 3LKQA 5I1EL 5EUOE 4E0RB 1UJ3B 5FYKD 4U1JA 3X13A 4F2MB 4AT6A 2C4FU 4ZSOB 5EZJA 1NDMB 2ZOLA 4Y5XC 2XZQL 1CLYL 2Y72A 4OFDA 1JNHA 3NIDF 4JM2C 1IT9L 2B2XL 3C5JB 5T3ZL 5C9JA 1CDYA 3JV6A 4Z7VF 4OQ1A 3VFGH 2P48B 2P8LB 1DL7L 3GBNH 3TF7C 1ZT1B 3MRQA 1ZTXL 3CNKA 15C8H 3CUPB 4YHOL 5AZ2L 1T1YA 3Q6GH 5J6HB 4EUPG 1S9XB 1EMTH 3MGOA 2VN7A 1MAML 1WAAA 4UUJB 4EDXA 1IKFH 2F74B 4NHUB 4ZD3L 1TCRB 4DGVH 4PJIA 4P57A 3QI9C 3TBWB 3L9RB 4AL8L 1IGTB 1UADC 3C2AL 3ABZA 3IXTB 2CK2A 2WBJB 1H15A 4HKZA 4BKLA 4PG2C 1WBZB 1DBKH 3TH4T 4GBXC 5DUBB 1MHCA 3NPSB 3BP5A 1D6VH 3KYAA 3SDAC 1LE5A 2W9LA 4C83B 4JY6A 5DQDH 3L95B 5CCKH 2PO6C 5BXFA 5B38A 4DFHA 5T3XD 3ZE2F 1MWAB 3CFDA 1HSBB 3A6BL 1G7LA 3V4PH 1KCSH 2QADB 4UOW1 1AP2A 4N0YL 3UZQA 1P2CA 4AEIL 2YN3A 2APXA 5ERWB 3DRQA 3R0MA 3TESA 1AGFA 3SBWA 4P5TB 3GHEL 4NZDA 1JPFB 2VXVL 3RIAF 2R2BA 1Y18A 1N59A 4K23H 4ONFL 4OD2A 1P4IH 3OHXA 4TSCL 4XB7A 3AMLA 5DC9B 3IVKA 3QQNA 2NX5A 4UU9B 4HXAL 5I8OL 3R8QA 4PV9A 1EO8L 4P5KB 3TIDB 2H9GB 1U95A 3PQYA 4JFYB 4DGIL 2FIKB 3ZKNC 1MCRA 2G75B 3DUSB 2R23B 3L3OA 1ZLWH 5ETUB 3QDGD 4JEGB 1EJOL 3BQUC 2DDQH 3QCUH 5E24E 4N1EA 1DFBH 2JJTC 3GSRA 2NY0C 3T3PF 4LHUD 1NEZG 3S4SB 3KYMB 1TZIB 1LK2A 4X9HA 1XR9B 2J6EA 5IEKB 1IMHC 4NM8L 3TPUA 4HIHB 4HS8L 4PGBA 3MUGB 3MV11 4H8WL 3OKKB 1UM6L 3G5YB 3DXAA 2R9HC 4GG8B 1FC1A 2Q87A 1IQDB 5AZ2H 4Z95H 1PQZB 5KVMC 3N0PB 2FJGA 5DUPL 4L8BB 4QRQB 4ZTPH 1MIMH 2ED9A 2ZUSA 4U1MB 1QNZH 2HWZL 4NKIH 2D4DA 1AGFB 1GC1H 1RZGB 3T8XA 4DGVL 2C1OA 2DQHH 2AGJL 5J0BA 1FFNB 5J56B 4I3SH 5DQJA 1JE6A 5F9JA 5CGTA 5EBWB 3AXLA 4YNYA 1Q94A 4TQEH 4O4YH 3VFRB 4P2QB 4LGSB 5GS0D 4PG2A 3N1FC 3NTCL 3VCLB 2I25N 4NC1E 3GZKA 3DJ9A 5MEND 4X83A 5KTEH 3QQ3B 3IDUA 3KLHD 5JQ6H 2WBJA 5ISZB 3BP7B 1OAQH 4JZOA 2QTEA 1S7XA 1JWUB 1VFUA 3A6BH 5T5FH 1DQJA 3QCTH 5I17A 3ZE1E 4Z7VB 1QUNA 1EJ6A 3BD5A 2BP3A 2GSIA 5ITFB 4HT1L 4DN3L 5KVEL 2G2RA 1D5MB 2WV3A 1WAAF 4KJQC 1TZHA 3BEWB 2PO6D 1W72H 3BFOA 4DAGH 2YBRA 3HE6C 2XT1B 2DIJA 4L3EE 1I7ZB 1HHGB 5EPMA 1B6UA 1GJIA 4IM8A 2ZWLT 3T0DA 1LE5B 2GK0A 4CUCA 4H0IA 2V7HA 3I3DA 3MRGB 3MBED 4N0RA 5DD6B 5IF0A 4M3JA 4RA3A 4ZUVB 1IAIM 4HMCA 5LBSH 4DZBB 2R69L 4UNUA 4PGCB 5GGVL 3TT3H 1T66C 1J7VR 4R96B 4CMHC 1EEYB 3IXAA 3GO1H 3CLFL 1FH5H 1OW0A 5MHSD 4E9LA 2AK4E 1QFUH 1C16A 4AIOA 4WEUD 1I1AB 1YJDL 3O4OB 1Q9KA 4I9WE 3VGHA 3B9EA 3CZJA 5CJ5A 5HGBA 2OL3H 4XGZB 1FSKC 2ZZUT 3MRMA 4FQHB 5JORB 3GGWA 4OGZA 5D1XD 5GSVB 5FDWA 2P5WB 2WWKO 5D2NB 4BH7B 2Z31C 1PEWA 5FV2A 4LKCA 4P4RB 4IS6A 1B2WL 1NGQH 3JV6B 1ERNA 1X7QA 1EGJA 3WSQH 1G9ML 5GGSB 4JDZA 5TDNA 1F58L 4EUPA 1T2JA 1NDMA 4GW5A 4G3YH 2CSPA 5T33L 2A9MH 3L6FB 3BQUD 3NCCB 4GAYB 4I0CC 4K23L 1IGMH 2DIBA 3QO1A 2ID5A 2IQ9H 2XNAA 4LPWA 3TA3C 1CTOA 3C9NA 5EOTB 1GOFA 4Z7QF 5TE4L 4EBQH 2AQ3A 3DXAD 4Q9RH 3L7EA 5FO7A 1BQLH 5DRXB 5F3BB 1KEGH 3S34L 1A9EB 3FB8B 4N0FB 1D9KD 5FKAB 5I1JL 2X4RA 2RB8A 4HKJA 5ALBH 2R2HA 4M5ZL 4OSUH 5JOFB 5F7MC 5E08L 2WINA 1LGVA 3MRKA 1PG7W 3N1MC 4ZQKA 1K9TA 1SJXA 1UFUA 1LEKA 1NL0H 1LP9B 1SBBA 1KB9J 1DFBL 2X4NB 4FFVC 1MRCL 1M6OB 5FYJU 4DKFL 5HI4C 2D0FA 1TITA 5KW9L 4MQXC 2DLHA 2VR9A 1ZA6A 5DMJB 1G7IB 3ARRA 2CDGA 4M6AA 4OLYH 4RX4D 5HVWA 2B5IC 4K3EL 2CK0L 4NO0A 4HULB 3QEUA 3ZTNH 4ZTPL 4ODTH 4RBPH 5DUPH 5A16B 5DA0B 1RIVL 4LF3A 2CQVA 5J1SC 1LO4H 3A67H 2A6IB 3L3KB 1GC1L 3I2CL 2X09A 1NPUA 4BUGA 3BKYL 3EBAA 1G7MA 2NY7L 4KVNH 5TF0A 2IGFL 3N50A 3TYGH 2OBGA 5GGRY 2VTFA 1J8KA 2ZUUA 4NQED 4HJ0C 2P5EA 5I16A 4ODUA 1BX2B 4X4XB 4J7RA 3P9LA 4HZLB 4NO5B 4Z7UF 3MYZA 5AUMA 4GRWF 2OTUA 4D9QE 4B41A 5J3HD 3LKPB 3NCYS 4H5SA 2AP2A 2CDFA 5C0IA 1HH6B 1R3LB 1BD2B 3PV7A 4R4BA 2VDOH 1N8ZB 4EUPB 3GFUA 2CMRL 3GI8L 1JV5B 2FZ3B 2VOTA 5CSZA 2EDEA 3I6KB 4YDKH 3T0EE 2DLFL 4YWGH 3ZZ1A 3NACH 5ENWA 3VH8A 3ULUH 4Z76B 3P0YL 3QULA 4WU5B 1A5FH 1FZKB 1PLGH 4NQEE 4OUUA 3CSBA 1F11B 1A9BB 1MNUL 1WBXA 2HRPH 2N4IA 4JFZH 2IF7A 1CD1B 4IRJA 3BWUC 4R4FL 3SJVA 5HHPB 1I7UB 3V6BR 2QBWA 1U8JB 2JJUA 4KVCH 5CGYC 4RMUA 2P8MA 5B3JF 1X5IA 1OWRM 3WLWD 1JN6A 3QZWG 5BO1L 1EVTC 1H8SA 1ZEAL 4GW1A 4PYGA 2HFEB 5GQBA 4LPYA 2UYLA 1WZ1L 1BAFL 1D7FA 1MQ8A 2C9AA 1GZQB 1PDKA 4U49A 1IAII 2VDLH 5D7LA 5CBEB 4WUUA 4LU5L 3PGDB 2ITCA 1H3VA 3MCKA 4LCUA 3H3KA 3V6FB 3QCVH 3R8BB 4QTIH 5FM4A 4FN0A 3O6FC 2FO4A 2Y4SA 1EHAA 3QAZC 4NSKB 4HD9A 2PTVA 5HHQB 3ZTJG 1L4IA 1NCUA 2GT9A 2VLLA 1AO7A 5HY9A 2JJTA 4NC0B 2CK0H 5FCSH 1DN0B 2JIXA 3FMGL 2DI7A 1G9MH 4MNQB 2RFXB 3SDDD 3AY4A 3VD3A 2X4RB 4HKJB 4Z76A 5FKAA 1RZKH 5KSVA 2JTDA 5E8OB 3CX5K 2QQKH 3PHQA 4JO2L 4PJ7B 3MBEB 4ZOCA 2BNUA 5FUOL 1A7OL 2YK1L 1F4WL 3MV8A 3RRQA 3BUYB 5E8PB 2GTZB 4RGOH 5EWIH 1IGML 1MCPL 3FQRA 1UZ6E 3JTSB 4XWOC 2V2WA 2HT4C 3KJ4C 4PJCF 3SDCB 1JGEA 2Y36L 2AABL 4HG4J 2J8OA 1I8LA 1BQLL 4NT6B 3CU7A 4I0KA 5AUMB 4D0DB 1UZ8B 4Y16D 3GMRB 4CVZA 2GKIA 3FFCE 4X5XA 4OLUL 4ODUB 3CX5J 4AENB 5I30H 4X5LA 3BISA 5E8NB 1V7MH 1NL0L 1P7QB 4LKCB 2GCYB 4OAWB 4F9LA 2VZ1A 5E56A 4MNHB 5IMMA 3GSNB 2LVEA 3BX7C 2DWDB 3Q3GB 1JHTB 4DEPB 3R06B 4XT1C 1FORL 2R1XB 3VFPB 3GK8L 4MDJA 3UJJH 1KBGL 3OG6B 4R8WL 3MRLB 2CUIA 5DK3A 1A14H 1KLGA 4J1UB 3HCVA 4Y16B 2X4OB 1IC4H 4IMKC 1FQ9C 4YEFA 3VE0B 5LCVL 3QUMH 4M00A 5JO5B 1SJEB 2A1WH 3RFZC 3TNNA 1JZ6A 5C86A 1P5UA 1ORSB 1JTOA 3E2HC 4OAWA 1J10A 3BZ4B 1IBGH 3QT2A 2QADC 2ZOKA 2QQLH 1CE6A 4NOBA 1FZOB 5IF0B 5BRZD 2YPLB 3MOAL 4Y4HD 5HPMA 3DVGA 5C1MB 2BVTA 1HEZB 5F1NA 4DGYL 4CKVX 3VFTA 4TTDD 4ORGB 5E1AB 2ZG2A 3QNYB 4NRZB 3RX7A 2HG5A 5C0RH 1JGEB 1EGJH 2YOCA 1JWSB 1U42A 2JF1A 3BDXA 5I71B 1RUQL 4UNVA 2OTWB 1T1WA 4I2XA 4LCCB 4DQOH 4LOUC 4EUPH 5JHDB 2EECA 3LCYA 5HYIA 1BOGB 2OQJA 5I76B 3PNWA 4JGUA 1SM3H 2V5RA 4GKNA 5AAMA 5I6XC 1KJ2A 1NEUA 2W1NA 4KDVA 4HQQH 4P3CH 3MBEA 4Z7VA 4ERSH 2A77L 4QRSA 4F7CA 3K7UA 2D4FA 2E3VA 1U8HA 1R5WB 4BUHA 3PDDA 4NP4H 1UM4L 2DLIA 1IC1A 2IADA 3VA2C 1LK3H 4H25A 3U0TA 1IC5L 1XF1A 1LMKA 1G0XA 4X80L 2HTLD 5CLTA 2VLJA 3QEQA 4YHIA 3H42H 3MJ7B 4HX1A 4YC2B 3OGOE 3AXLB 1AH1A 2FEEL 3L3IB 1JGDA 3V6ZA 1Q38A 2X1XR 1ZT7B