3LRHA

Structure of anti-huntingtin vl domain in complex with huntingtin peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
b'PVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-huntingtin VL domain
publication title A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 27
structure length 109
sequence length 109
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrhA00
3C2AH 3VDBA 1IM3B 4P2RA 4BUHA 3MA7A 1PKQE 1BBJB 4RQQA 2QKIA 2BVQB 3FFCD 5MEND 4PJ7E 1HHIB 5JPMA 3TWCL 5DLML 3GFUA 1B4JH 4PJ5B 4WFHD 1GC1C 3QEGH 4HUVA 4HUWB 1JNHB 4H88H 1S78D 1UQSB 4BQCA 3H0TA 4IOIB 4WO4A 4FQXD 4NC1C 3QDGA 5AUMA 3VXQA 3CSYA 3BP5A 4OV5B 3JV0A 5IJKA 1IAIL 3AAZB 5CSZB 1IT9L 2DBLL 3HG1B 5JXED 4JZOB 3MRPB 5C0AA 3O41B 4QY8B 4O02H 5A2JH 2HKFL 3HRZB 1G1YA 1ED3A 2E9WA 1DDHB 3BH8B 3PQYD 3P4MA 4HXBL 4OGXL 1S7UB 1S9WB 4X6CA 3CFEB 4GW5A 3TZVB 3HC3L 7FABL 2EDKA 3SQBA 2AABH 2NNAA 3KLSA 5KG9B 1IEAB 4WTXA 4RMQA 1DBAH 4KVCH 3B9EA 2BVEA 3DX6B 2OS7A 4HAFA 2XXMB 3HI6L 5L88H 3CX5J 4WI4A 3UMTA 3NIFE 3VW3H 3QQ3B 2RAMA 1IKNC 1A7OH 1ZSDB 5F97E 1PG7X 3C08L 2FEDC 5EU6A 4G8GA 1AGCA 4GAGL 4JE4B 1Q72L 3LKNB 3U6RB 1D5MB 4ZAKB 1DLHA 4X6EA 4PV9B 5E2WH 5C0DB 2DN7A 1T04A 4X4MA 2AEPL 4XNXH 2P8LA 4PGEA 3ARBA 4URTB 1OAKH 3LVEA 3DVGA 3P73B 3QULA 4LLQB 3S3PA 1JTPA 3M1BA 5IJVB 2JELH 1FYHB 2M8XA 4DZ8B 5T1LA 4Q58C 1FPTL 4CRPA 1FNHA 3MACL 2WM0A 3B9DA 4NHCH 5EZOL 3MNVA 4WFED 2AERT 4KKBC 3ZYIA 5AEAA 3T4YA 3MJ7A 3I3BA 4UU9A 4L4VD 1O0VA 1F4WH 4MJIB 2FB4L 1FL5B 2HG5A 2RCSH 4XHQA 2PO6A 4BUGA 1JNLH 3E3QE 4N1HB 3A6CH 3EOAB 5DJAA 3ZO0A 2VDQH 3LN4B 2DB8A 4UT9H 5JA8B 1JF5A 1T66C 2J88L 4QF1A 4Z7NE 3I6LE 2C5DC 4RIRB 4OTXL 4M9PA 1A6VL 2WBJB 5EZJA 5J8OA 2WWMC 4Y5VB 1KN4H 3S37X 4U6TA 2Q87A 2E7BA 4JDTL 3I6KA 2Y4SA 3WHE0 4HC1L 1XCTA 3DETC 4HJJL 4KMLB 4Q9BA 1F6LL 3HE6C 1P84K 5F88A 1EHAA 3RX7A 4F7TB 4LVNB 2DWEA 2MCG1 5EOTA 1ERNA 1YEJH 1YMHA 1YDPB 1LEGA 3RJDA 3PDDA 5JR1H 3O9WB 1FP5A 1RZJH 1YEEL 1ZLUH 1OF2A 3G5VB 1BJ8A 5CJXC 3ARGC 4KZDL 1CD0A 1R3LB 3KPTA 3KYKL 1F97A 4HIXL 3FN9A 2FWOA 3MR9A 4ETQB 3ZDYE 2L4OA 3VD5A 1BQLH 2BMKB 2UUDK 4KKCC 2PCPA 1IEHA 5GJSH 4M1DL 4Y0GA 1AGDA 2ZKHH 4N0UE 2F5AH 3WIHL 2VKXA 4HF5L 1WAAE 4NQSB 1UM5H 2VJXA 3V5DB 1F3DJ 2XYCA 3PXHA 3FO9A 1KYOJ 2AKRA 2NXZB 3LKSA 1R5WA 1NEZB 1FAKT 4ZUSB 1C5CH 1IAOB 4RISH 4FP8H 4NQCA 3O45A 4OLUL 4P5TC 4PRAB 5DUBB 3K46A 4GMSH 1J86A 3TLRA 5L2JA 5E9DD 2BK8A 1LP9F 4UTBL 3MCLL 2BNUA 5I16B 1LP9E 4XPAH 3LKOB 4PJEF 5F7YC 4ODUB 1EJ6A 1MCEA 3PL6C 2JJVA 3ZYJA 4PJEE 2HVJA 4LEOB 4OLYH 5ICYA 4RAVB 2GW5A 1KJ2B 3HG1D 3MRJA 3IFLL 5BVJA 3THML 4ERSL 1CXIA 4NM4H 4PGCB 3TO4C 4Z76B 1H3TA 2X89D 3E6HA 5BS0B 4G8IA 2VMFA 5KN5B 3GJFB 4FQPA 2P46B 3MRDA 3EOTL 4O00A 3SJVA 2YEZB 4YFLF 4MB4A 4FZ8H 1OARH 4L29A 4PP2A 3EYOB 4JRYE 4LARL 5LAXA 4FQIH 5ANMB 4AM0B 2CMRL 2Z9TA 5DD3L 3KJ4C 1D9KB 1RIHH 4HCRL 4X6FB 3WNOA 2EYSB 2VZSA 3GHEL 3T77A 5T3XD 3AXLB 5BMFH 2R4SL 3ULUH 3I9GH 4IRSA 5IIEA 3AUVA 2YSSA 1CR9L 3MV9D 1YUHB 4M8QA 3DUUA 2Z31D 3U36B 1BPVA 4KGJA 4ZFFB 1JZ5A 1KOAA 3KGRA 4ZQKA 2MQCA 4C57C 3ARFC 3DI3B 4LKCB 4PJIF 3LDBB 3DV6A 5FOJA 4PJIE 5K9JL 4EDXA 5FB8A 3HMXA 2V5MA 5T5FH 5FYJE 5HDLA 2BNRB 4M6NL 4XTRC 3FMGH 3U7YL 3MTRA 1F4YH 4HJ0D 2YD5A 1SJHA 5ALCH 4YDJB 5E7FA 1QNZL 3C9NA 3LV3B 4KI5D 5CGMA 4JG0H 1X4YA 4EI5A 2NY7L 4QXTB 4KJQC 1SVCP 2DIBA 2Y5EA 4ZFOA 1VGEH 3NZHL 5HDQL 4FXKB 2H6PA 3P30L 1U3HD 4XP9H 2ADFL 4KHXH 5KS9F 1TQCC 2YN5A 2GY5A 4M6ML 1FV1B 3AFLA 5KS9E 1OOAA 2IBBA 2X70A 4WFGD 5L7XL 1BECA 2H2PC 4AEHH 5KVFL 1W0VA 5DK0A 2I9TA 2V17H 2QQQA 5GHWL 2UZYB 4Z7VE 4JZJB 4PD4K 3L3OA 2IPKB 5B4MC 4R4BB 4NRYA 1QPXA 1J0JA 3BZFA 4LVHB 4C56E 3UDWC 4OZGE 4AQ1B 5J13C 1AGBA 4HUMB 2E7CA 3SDDD 1SBSL 1WT5C 5IK3B 3QUML 2ZCLH 4PJHE 2VL4A 3Q48A 3RAJL 1LNUA 2NY4D 4NZRH 4LDOB 5EUOF 1CFVH 3MLWL 2HT4D 4P2OB 1T0PB 3ZT6A 3G6AA 3G08A 3AREB 3S34L 5GS0C 1Y6MR 1IBGL 2X1PA 3JTSA 5IFJA 3VRLF 3ARZA 3MOAH 3VRLE 2XTLA 5FK9A 3TIDB 3WFBH 3O9WD 4OGYH 4NQEA 3PIQA 1WFUA 1A3LH 4JN2B 4PJDB 5IJKC 4LHUB 5DA4A 4WHCA 3TH2T 4X4ZA 1BOYA 3TPUA 5GGQL 1BJMA 4GRLB 3QHZH 1EAJA 2G75A 3MLYH 2GJ6E 3VFGL 1AE6H 2AXGA 5HGHB 1B0RB 2HT3C 4MD4A 3TFKD 3PP4L 1CFQA 1H3XA 1FO0L 25C8H 4JDVA 2IQ9H 5C92A 2JJSC 3DWTA 1U2HA 3HZYB 4G5ZH 3RBGA 2NXZD 2HN7B 5HHME 5CZXD 4WVRA 3OKKA 4D0DB 2XOTA 3AS1A 3K4DA 5E70A 4NN7B 3FKUS 5D7IA 3JSSA 2F5BL 4LU5L 2DI9A 4P0DA 1E4XL 3BPOB 4PJBF 5ITFB 5GSRB 5E99L 2FJGA 1X9QA 3M07A 4YHLL 2CR6A 2MQ0A 4PJBE 4R3SB 1JF1B 4R9HA 3QUZB 1VFUA 4N8CL 3BPNC 5BZDB 5JUEH 4AEIH 1P9MA 1BFSA 1QFWL 3O4OC 3BRDA 1QOKA 5F21B 5KSBB 4PREA 1G7LB 2ZCKL 5EU5A 2MHAA 3ARBC 3WLBA 5HVHC 2GK0A 3V95A 4OF6A 4H8WL 4HPOH 5DD0H 1JNNL 4JB9L 4U3HA 5CBEA 4WFFD 3ZHDA 2G9HA 3G5XA 3T0DA 5JXAH 3RUGA 5F6IB 3I6LD 3QO1A 4P9ML 3DECA 3O4LE 2Q7YA 4P49A 1T1XB 1KELL 4NKOB 2A6IA 3MRRB 2DQEL 4MMXC 4M3JA 2BVPB 5D70H 5TH2B 3QIUD 4IRJD 3QXAA 2GY7B 1U93B 2VYRE 5CCKH 2NY3D 2PO6C 3DURB 5GSVA 3N50A 4S1QH 4MCZB 5CIPB 2DD8H 1AHWC 1TTUA 3O2DL 3KDMA 3NMEA 2V5RA 1VPOH 2BNRD 4M00A 2R23B 4DKFH 3V0VA 5CMAB 1RUKL 4G8FA 4WNQB 3T0XA 1CD1A 3WDJA 1KPUB 2A6KA 2O61A 1E28B 5FCUH 5EC2B 5C9KA 5HI5D 1QBLH 3OKMB 4PRIB 1R24A 1KF9B 5EZIL 2YD7A 3HHRB 5IGXL 1H3PL 1B6DA 2DLHA 4D0BA 2ZWLT 4FABL 2YPLA 1CXHA 1FE8L 1E27B 1PAMA 1RD6A 5DUPL 5GRVL 3MOBH 2D0GA 3MLSH 3U46A 3HFML 2FBJH 2R2EA 4MHHG 2DKUA 4L3EB 1A1NB 1FVEB 2MSPA 3IU4H 1ZA6A 1ZHNB 1P4IL 2Q3ZA 3RWDB 1RIVH 3HS0A 1HNFA 5CINL 4KRLB 1IC5L 1F11B 5KSUB 5F1SA 1YPZB 2Y36H 3RZCD 4YHYB 1MHPL 1WIOA 3RPIA 3Q3GA 5E4EC 1RUMH 5A2KH 4N0CC 4JKKA 2E9JA 1A5FH 4OM1L 3W39B 2XNAA 2WBKA 3H7LA 3T1FB 1OAXL 2H3NA 1NFDE 3V4VL 1EPFA 4IRZH 4F7PA 1C1EH 3BN3B 3OHXB 4XAKE 3L95A 2H32B 5CWSA 1CDCA 4X9IA 3MODL 4JRYD 2NX5B 3R8QA 3STLB 5IBLC 1ADQH 5IMKA 3X3FH 3CFBB 4W4OA 4G6FB 3UZQA 4OF3A 3AU1A 1QSFE 4Y4KA 1TJHL 5GGTA 4K3HA 3CH1B 3TP4A 1SJEA 5CP3H 5A43C 2ENSA 2ZSVB 4G42A 4GRLD 4PRBB 4ZUTB 1KXVC 2A0LC 3PJSA 3IFPA 1NCDL 1SY6L 2YS4A 4B50A 3D3VA 5FF6B 1JPTH 2HFFA 3VXRB 2J4WL 5ACZB 3U82B 3NH7L 1KTLA 3S36L 1TITA 1N0LA 3FAWA 2VXSL 2ATPB 3D18B 2V7HA 1LK3H 4Y2DD 5C6TL 1NDGB 3MXVH 5D2LB 3V8OA 5IBUB 2FGWH 3FCTA 5E2JA 1S5IL 4IRSC 4PS4H 3IDMA 1OAYH 3P9WB 4GAYB 4NNPL 4XBEH 4YO0B 2OL3A 4F2MB 1KC5H 1AGEA 4X83A 3STBA 1W72B 4U3XA 1P7HL 1DLFL 1LO5A 3O6LL 4OFDA 2MQ3A 1U8QA 1HNGA 1VGKA 2CGRL 1L0QA 5D7LB 5MERB 2XQYK 1QBAA 2R56H 3QDJA 4PJGF 4Z7WB 4WENB 4NKMB 4JDZA 4MQSB 3OKOB 4OIIL 5EBLA 1AD9A 4WW2B 5DHYA 4C56D 3ARWA 5BCAA 4WUUB 4GXUM 3CFCH 4XH2A 2AJ3B 5L8LB 1CS6A 5A40E 4F37K 1OAZH 3GSQA 4LSPL 3WO3B 1K5NB 4QO1A 4JR9H 3EHBD 5HPOA 3TA3D 4ZUUB 4MXWL 3CSPA 2VXVL 1QRNA 1YJDC 1NC4D 4G6MH 1CFSA 3CLEH 2FJHB 1UB6A 3MGOA 4Y1AE 4X4XB 3P77B 5D93B 1GGIL 3QFJB 4LLWA 3KG5A 1T22B 3ZTJH 2PYEB 4P4KB 3CZFB 3JVGC 4CADA 4DFHA 3QUYD 3V0WL 1KEML 5TE4H 1ZHBB 5EPMA 2N4IA 5I8KH 1G9MC 1BD2B 4UOW1 4WTWA 4A6YB 3EJYC 3B2UC 5D2NB 1I7TA 1P7KB 2UZIH 1DQJA 4IHOA 1IEBA 5F7DB 4RMRA 3QCUH 1CI5A 4E41E 2R2HB 4KAQH 4PGZA 3WS3A 5C6WH 5J1AA 2DKMA 1DQTA 1JGEB 3QH3B 3BKMH 1BGXL 3MNWB 4OZIA 1QLRB 5E7BA 2A1WL 4KUZH 4PGDB 4KVNH 2HP4A 1IL1B 4Z78A 5I1IH 4YGVB 5HHMD 3TYFB 6CGTA 4R96A 4V1DE 4ZODA 4M7ZC 2M1KA 2EXYC 2ZNXA 3QEHB 4C83B 4XZUB 1EXUA 1UVQB 3EBAA 3BE1L 5CGTA 4X98B 4HMCA 5LCVH 4W6XB 1GGBH 4NKDB 1EEZB 4DN3L 1NCCL 2PXYA 3KPPA 3PWPE 1LD9B 4P4RA 1QD0A 2BRQA 5ID1A 3G6DL 4X7SH 1VFOA 3IDJB 5ESVB 2WNGA 5FYKL 3FOLA 2PW1A 4U1JA 4UILL 1UJ3C 5D93C 5L0QB 3L7EB 3TJHC 2GTZA 1JYVA 1NGPL 4PV8A 5JW3H 4P9HC 2NX5D 3L3GA 5HI4C 3O0RL 4UV7H 1RURL 3U0PA 3QI9B 1HSBB 3O4LD 2V2XB 5TF1L 1BFTA 4JANA 2GFBB 3QXDB 4PG2C 4XMPL 3OKLB 5CJ8A 4GRMA 4WI6A 1FQ9C 1YYMH 5JQ6H 2X9YA 1K6QL 3P0YL 1LE5B 4HW6A 1S7WA 2I25N 2FX9H 2MFNA 4Q6IB 5C71A 2W65B 5BZWA 2E3VA 5E8EB 1Q94B 2W0KA 2EDHA 3K1KC 5I1EH 1MAKA 2BY1A 4RGMB 2VDKH 5HHXH 2ATKB 3GRWA 3TPKA 1PYWA 2BSRB 3UO1H 3D87B 5LWYL 4LCWA 3U4EA 5IMMA 3VFTA 1MFDH 1QO3B 4UINH 1HIMH 3SY0B 1Q0YL 1HXYB 2IFFL 1MFCH 1TTGA 5HGAB 3RZWA 2XKUA 4X8JA 1SYSB 2WUCL 3FQTB 1OCWL 2VDML 3MO1B 5HJ3B 1B4RA 4OCMC 4N9GA 4U7MA 5EU7C 2ESVB 2Y1VA 3RX5A 1YC8A 3ZL4H 4KMTL 3O6FD 4X9FA 3QQ9C 3Q1SH 3KNBA 3TNNB 2GCYB 1TQBC 2AEIT 3MV7D 5T1MA 4EUPA 4Z5RB 1P53A 5F44A 1XGYL 5MI0C 4I0PC 3RA7H 4S1RL 1P84J 2PYFB 1G0XA 2CSPA 3T4AB 5K59F 4TOYH 2DICA 5K59E 1AXIB 1QA9B 1QYGL 2ID5A 5DEFB 2BVTA 2YD6A 2A2QT 1V3LA 4XBPB 1HCVA 1I8KB 4KRNA 4NZTH 2DTML 4N0YH 4YGAB 4WUUD 3CXDH 4M4PA 5EFIA 3V79C 2XA3A 3O11B 2CDFA 1A7RH 1A7PH 4JFXB 3BZEB 4YHML 2HJFB 4O58L 3VD9A 3DRTB 2PW2B 4I9WE 3BEWB 5KSAB 1FDLH 2VH5L 3ECBA 4M5ZL 4O2EA 4WUKL 5DJDA 2NR6D 1IAKA 5HHQA 3CMOL 1X5ZA 4L3AA 3WEXA 3BPCA 2R0ZL 4FTVA 1F2XK 4JJHA 4WTZG 3TO2B 4D9RE 1U8MA 3ILPA 1J05A 1J1OL 3VI3F 3LH2H 1VKXA 3BQUB 5HHVL 2F19H 3IKKA 5BRZA 4G3YL 1U8IB 3D0VB 2GJZB 1MHEB 4M61B 4ZPVA 4MJ6A 1VFBA 2KPNA 1RUAH 2DKSA 1BD2D 4AG4L 4L8SA 3RFZC 1AFVL 4JREB 4R0LB 1I1RA 4J8RB 5I8OH 2V2WB 2OZ4H 1A1MB 1UM4H 4YHKH 3HB3D 2FZ3B 4FHBD 5E8NA 1JZ8A 3GB7A 4P23D 2W9EH 1JWMB 1MI5A 3BKJH 5AYQA 4AH2A 1FBIH 1I3GL 1P6FA 2O5ZH 3E1F1 2MPAL 5J12C 4W4OC 2X05A 1N3NB 1S9XA 3DRQA 3H7BA 4QEGA 5FA3B 5T3ZL 4NC1E 3NOIA 3BGFC 2P45B 3GHBL 4ZTOH 3WD5H 5HHOA 3MLXL 4XWGH 2R1XA 2QADC 1K3IA 3LKPA 4L4JA 5BVPL 1PW3A 5CEXB 1ROWA 3LQAH 5F1IA 1BJ1H 1I8IA 3INUH 4GW4B 3AVEA 1QFOA 4NWTH 3S35L 1CK0L 3GMQA 2YUZA 3V4UH 5F1OB 1FRGH 4YBLB 1NLBH 5E2VH 5AD0B 4K07A 3BT2H 3SKMB 4M7JH 3JWOH 5I1LB 1DL7L 1JN6A 5F9WC 4ORGA 1WBYA 4Q2ZB 4XNYL 3EYQD 4HPYL 3VXME 1OM3L 2Z35B 2R1YA 4OIBA 4KQ3L 4LLYB 1MH5B 2A6DA 1ZWIB 4HH8A 4ZOCA 5A1AA 5BO1H 3PWJB 2DMBA 2FHCA 3GDBA 3TC9A 3OJDB 1NGWA 1CFTA 1QACA 3MXWL 1N26A 2FX7L 3P4NA 5I1JH 3VGAC 4MA1B 1JZ6A 1Y6NR 2JTDA 3LHPH 4QHMA 5CEZL 3C2AL 4UDUA 1ETZA 3V7AE 1LDPH 2L7JA 4H5SB 3U0TA 1RUPL 4RAUA 5C8JB 4NO2B 4E42A 3DYMA 1JK8B 1OPGL 4QOKA 4OCRH 2X4RB 4L4TE 4JPKL 1FC1A 4PYGA 5T33H 2HTLC 4Y1AD 3VXSB 3I3DA 5DUMH 4GKSA 5HYEA 3O3AB 4PD4J 1T1YA 1L0YA 3EJJX 3QEGL 3QDMB 1XCQB 1JRHI 3X13A 1CDBA 1BAFL 3JUZA 3HR5B 4RCAA 3D39B 5D7KE 1EH9A 3UYPA 1INDL 3T08A 5DI8A 3OR7B 2W0PA 3QFDB 4FFYH 3W0WE 1AP2B 5DMJB 4E41D 3QIWD 3QIBC 3MV11 5HHNA 2QHLA 4GBXA 3MUZ1 1CDYA 4L8CA 1NBZA 3Q6FA 5I15H 2VLRB 5KJRH 4W4NA 2AABL 4JVPA 2VAAB 5CJ5A 1BF2A 1TPXB 4DWHA 5LGJB 1DBAL 5TQ0L 1MRFH 1XZ0A 3HPLA 4UBDC 4EDWH 5I8CB 4AENB 4N9OB 2G60H 1KB5B 3IAPA 5DJCB 2QR0A 3VXPB 4YHIA 5L88L 2ZOLB 3TM6A 1A7OL 4PB0L 2VZUA 1DBJH 3D1MC 2XZQH 4XVSL 3LD8C 3Q2CA 2XY1A 1OD9A 1KB9K 4HIEA 4Y16D 1N8ZB 4FS0A 3UTQA 3EDEA 3HUJB 3UC0H 1ZT7B 4PJ9D 4YBQD 3UTSE 3L7FA 3V6ZB 3PWPD 2FHFA 3GIVA 3S4SB 4Z0XA 1OAKL 3T09A 2Z92B 4BH8A 2HLAB 3DTXB 2Y07H 4P5KA 4N0RA 4ZSOA 1CIUA 2JELL 3VMOA 1AQDB 3JUYA 4JKLA 4I18C 2WINA 1NAMB 1MAJA 2HLFC 3BQUD 3WN5A 2OR8A 4HWEH 4GG6B 1JHTA 3FZUC 2VZVA 1UKSA 4HAGA 2VDRL 2A83B 1NGZB 1B90A 4XPHH 3QPQD 3TVMA 2PXYC 1MCWM 4NT6B 1KT2B 4OZFB 5MP6L 4OIAA 4MJIE 1A21A 1N5YL 4GW1A 1JZ3A 2O5YH 4FXGB 4PRPB 4X4YB 1QSEB 1OTSC 2A77H 2IQAB 2NXYD 2OMBA 1JNLL 3SDYH 1J0IA 1MQ8A 3A6CL 1J8HB 5IMLB 4MXQC 1QG3A 2MCPL 5DJXA 2YPKB 3HC0A 5C0IB 4H1LB 2IAMB 2XA8H 2YRZA 1JMXA 3BWAA 1DANT 5EU3B 4EIGB 3BVNB 5C09E 1KCVH 4MD0B 1HYSC 5FHBL 1NBYB 4G43A 4HUXB 1PLGH 3ESUF 4NZUL 3NA9L 4OKDA 4UT6H 4PLNC 2B4CC 1PG7H 1DEEB 3RHWK 4LASH 1UWGL 5EUKB 4Z7UE 2GSIB 5C07A 5ISZA 4ELMB 4D8PB 2JLLA 1RZGB 3HLAB 3U7WL 1CD8A 5K93A 2XXCB 5GRZA 3ES6B 3OB0K 4ODVH 5TJWK 3P9LA 1AR1C 3AM8A 4U6VL 5DJ6A 4ZD3H 2PTVA 1T21B 4PR5B 2NZ9D 3RBSA 1HINH 2APTA 3ULSA 3UPRB 3ZE1E 1BQLL 4PJFE 2HAZA 2NY1B 4LGPB 1TVHB 2IC2A 3L3IA 5D7JC 4KDWA 2ICEA 3VWJB 2ZKHL 4Q0XH 2F5AL 3KYMA 2Z8SA 2XPGA 2EDEA 1E4KA 5GRVK 3S6CA 3VD7A 3WFCL 3REVB 1CXEA 4RISL 4FP8L 3MCG1 3C6SA 4Y88A 3ZTJG 5B8CA 5C08B 4D9RD 3VXSD 4NO5A 4GMSL 2A74A 2FJFA 3MQIA 3TBYA 1G7PA 2QSCH 1FLTX 4XPAL 3GSNH 3ZDXF 2C3XA 4PJCE 2EDJA 1EFXA 4YR6B 4OLYL 5I76B 1RK0A 3O3BB 1AXSA 5HDBE 3S37H 3RGVC 2JF1A 1K4CB 4QRRE 4W81A 3I50H 4RWYL 4YNYA 4QHNA 5CZKA 3B6SB 4N1CA 1KEGH 4ZO7A 5ESQA 5MENA 2E8ZA 2CIKB 5D5MA 3ZE0F 3K80A 2DYPD 4NNXA 1OARL 3BP7B 4PJXA 5C2BH 4LPYA 4O9HL 5HY9A 3ELAT 4OZ4B 1X5AA 3VXUE 2YRLA 4MD5B 1DCLA 1CWVA 4JFFE 1TZHA 1RIHL 4M7KH 4FQXA 5HGDB 4C4KO 5CD3A 3RWGA 3C09B 4QT5B 4XRCA 2K1MA 2KQNA 2VDLL 2XACC 2DJUA 1MLCB 1NCNA 4I77L 4TUKH 1PBYA 5F7KC 4I0CC 4Y5XA 2CXGA 1N5AB 1H5BA 2D2OA 5KOVC 3O3DA 1E4WH 1I9EA 4NHUA 3UAJC 4LP4A 2D31B 4MAYC 4L8SC 4MZ3A 5EBWA 2HKHL 2H1PH 1HQ4A 3IXTA 4M1GL 4RGOL 1DJSA 2CUMA 1Q9LB 5I9QC 2CJUL 4YJZL 1HILB 4X7TB 1FNEB 4JFOB 3FMGL 1JPGA 3IJYA 5DMIH 2UYLB 4ZNEA 3QB7C 4AL8L 1F4YL 5ALCL 5D6CB 3VXMD 4LBEA 2UWEB 3QNYB 4GSDL 3NCCB 3X14B 2R2CA 1VGEL 4IBLT 1P69B 1RHHB 2KKQA 1G9EA 2CLZB 1QRKA 2J6EH 4XP9L 4KHXL 4HWUA 4DGYH 5C0AE 2CKBA 4ODWA 1ADQA 2FEDD 1U8PB 3DXAE 6FABL 4FQHA 4DK6A 1VB9A 2V17L 5DGRA 2P43B 3VFNA 5CP3A 5L8JB 4QHUA 3VFWB 2ADIB 4PRPD 3P3YA 1ZT4A 3IU3A 1R3KB 4APQC 4G80B 4OD1H 4JFDE 2AJXH 3QCTL 4ZFZA 4WI7A 5EBMA 1AQKH 2OLDA 3Q5OA 1U8OB 1TETH 4G8GE 2ADGB 2OQJB 4MAUH 5D7KD 1HXMB 4CAGA 2ZZUT 1CDJA 3PV7A 4MNHB 3MNZB 2FEEI 4AIZB 1CFVL 4X4ME 3W0WD 4OBSA 5E5MA 3QHTC 4K9EH 5CEYB 2AJSH 5B3JE 4HIHB 4Y5YB 1UYWL 1REIA 3RX8A 1NMCC 1XGQA 3WFBL 1I8MA 4OGYL 1MJJA 4PJDF 2ADJA 1UFUA 1T66D 3FQWA 1TJGL 1ND0B 2VL5A 5DQ9B 3QPXL 2WWMD 1BFVH 2WIIB 2D9QB 2VQ1B 3WYRA 4HZAA 4P46A 3VD3A 3K2UH 3QHZL 1R0AL 1FFNB 5KVEH 2G2RA 2NY1D 1AE6L 1MFBL 4P2RB 4Y19B 1UEMA 3SGEI 1T4KA 1VERA 4KK9C 2FX8L 3QZWB 4KDTC 2Y06H 3DETD 1G7HB 2C26A 3UTSD 1ACYH 1VACB 3L1OL 4O2FA 3HE6D 3MREB 3K8LA 1QLEH 1NL0H 4HUVB 4GRWB 4WO4B 3MPCA 4G9DB 3VXQB 3QDGB 1WLHA 4UNVA 4ZXBA 5I66B 4H20H 3DYOA 4DCQA 3RTQC 1I75A 4YEEA 3OXRA 3DO3A 5BXFA 2FR4B 5JUEL 4I13B 1ED3B 5CGYC 5KSBF 5FV1L 1M05A 3K0WA 3P2TA 2IH1A 4Z7QF 1FFPA 1NSNH 3NGBB 4X6CB 4RA3A 5SV3A 4WWKA 3VMNA 1DVFD 4HSQA 1YEFH 4HPOL 5DD0L 3SDAB 1IGIL 4XX1E 1ES0A 1GXEA 3ME0A 5EZLB 3SQOH 1VCAA 5JXAL 5E2TH 2ED7A 4P5TD 3S8WA 3WN5C 1NEUA 1P4BL 2IANA 1AR2A 3VJ6A 3PGFH 4JO2L 5EU6B 1JGUL 1ONQA 5C09D 1TCMA 3PL6D 4QGYA 3LZFH 1DLHB 1KN2H 4M3KB 2R0WL 4JN1L 5EIVA 1T04B 2EH8H 2OR9L 1F3JA 3BH9A 5C9JB 3RWJB 5IW1A 4NKIH 4XC1L 4N8VG 3TO4D 4JRXD 1NAKH 3DVGB 3QULB 1NDMB 5ERWB 5F3BA 1YEGH 5SWSB 2LU4A 2W1NA 4QRPE 3RDTA 3M1BB 4HH9A 3MRIB 5T1LB 2O26U 3PHSA 4X5LA 5IB2A 1LE9A 4NQCE 2XWBB 1DQMH 4DKFL 3EDKA 4TVPE 4LL9A 1NGXB 2AJZA 3MNVB 2W60A 3MLVH 1AD0B 4R2GC 2X1OA 4PRIE 5DJ8A 4Q9RH 2P5EA 1RZIA 5T1KA 4UU9B 4RMVA 4XP4H 2F54B 5D1QA 3B2VL 2I5YL 3BP4B 3G04A 5J11B 3LY6A 2W9LA 5B3NA 4YE4H 1HDMA 2Z91A 3EO9H 4XPTH 3SJVE 3MOBL 2MNUA 2VXUH 4PGJA 5E6ZA 1P2CA 2FBJL 4AJ0A 3LN9A 1I7UA 1QFWI 3L5IA 2FLRT 4QF1B 4XTRD 3UROR 1A02N 3DLQR 3AM8C 5EZJB 1G6RH 2W0FB 1V5JA 4KKLC 3PF2A 3QAZB 2UY7A 2FH8A 1KLUA 4M43L 3OR6A 1G7QA 2LE9A 1RIVL 4OD3H 5LBSH 4KJQD 5DQDL 5I73B 2J5LB 4YDLB 1YPZF 5EWIH 3I6KB 3HI1A 1KPVA 5FKPA 3V7MA 4DVBA 2X4SA 1RUML 3UX9B 1A5FL 4RMTA 4RBPK 5GRYA 4YUEL 2H2PD 3SCMC 4U6XA 3RP1A 5SWQB 4PJ7A 1C1EL 1OF2B 3Q5YA 1EEYA 1MCLA 5B8CC 2ZUUA 5B4MD 1GYAA 5JHDA 4CN1A 4MA3B 3VXUD 2FWOB 3MR9B 4XP6H 5MEOA 3X3FL 5J6HA 3ULVF 4JFFD 3PGDA 1KUMA 1VFAA 1V8HA 4KGLA 3VA2C 5BJTB 2F74B 1N6VA 1NANH 2HTKC 3UPAA 1E6OL 4OI9A 4Z95H 1S3KL 4KRPB 1AGDB 3KLHC 5C0RH 5F8QC 4AYFA 4P2RD 3OAZK 3FO9B 5DWUH 2JCCF 3TT3L 1MIMH 1JGLL 1JPTL 3OPZH 2JCCE 2XN9B 3QDHA 4OCYH 5GS0D 5HYSG 4MDJA 4M62H 3T2NL 3QNXA 1LK3L 5JOFA 1A47A 2E8YA 3DX7A 5D2LF 5L2JB 3VFVA 1XH3A 3MXVL 5AAWA 4OCSH 4HBQA 1F58L 2FGWL 3W11C 1BWMA 3A6OA 2R1WA 5ICYB 4Y5XC 2OBGA 4GXVL 1BZ7A 4Q6YA 3SN6N 3MRJB 1OAYL 5EO0A 1SBBA 4TNVK 5IESH 5CBAA 2HH0H 4OAWA 5C0AD 1KC5L 3E6HB 5HVWA 5I1CH 4G7VH 3KLAB 2CLVA 5K33A 2D03L 3O3EB 5GGSY 2HRPH 3DVNA 1YN7A 1NJ9A 3IYLW 3MZGB 2HT3D 3TF7C 2D7NA 5FEBA 9CGTA 2FH6A 4WHTB 4WV1B 1JI1A 3DV4B 1EV2E 3OJVC 4Z7WF 5DZOA 1FNLA 4OGAC 3VCLA 2ZUWA 5IHUH 5IT2H 3LMJL 2CH8A 4RMUA 4F3FB 4NQEE 5DJZA 4WW2F 1YQ2A 4MXVE 2DQDL 5CLWA 5L2KB 3CC5B 3T65A 3ORJA 4M8QB 3DUUB 2EE6A 5EU6D 3FFDB 4G8GD 1T0MB 4I2XA 4J3WA 2QEJA 1M7XA 4ZQKB 1IGML 4JR9L 3S97C 2V7NB 2VLJA 3DV6B 3WXWL 1P7QB 2BOBA 4EDXB 5FB8B 3QBTB 4DZBB 3TNMA 3ARBD 4G6ML 1GGTA 3F7PC 5DFTA 2DLFH 4B53A 3PG2A 4XXDA 2DDQL 1SJHB 4OFYD 1Z9LA 2F58H 5DRXA 5T1LD 1T0NB 3DSNA 4N8VA 5D7IE 4EI5B 3KPSB 1T6WA 2YWZA 1KGCE 2B1HH 4F58L 3O6KH 2H6PB 3QISA 4HS3A 5DMGC 5TE4L 1YY9C 2IBZX 3ARDA 3HZMA 2D0HA 3WL9A 3QEUA 2UZIL 4KK8C 4LIQL 3MRNA 3MBXH 2I9TB 1FFOA 3QCUL 3WFHA 1UB5A 4HIIB 3MLZH 2FATH 2AVGA 1J87A 4F7MA 3LEYL 3G5YA 5HGBB 5K9QI 4RFOH 2PO6D 1MWAH 4KK6C 4NRYB 5B39A 4KUZL 4LMQE 4KVNL 1OB1B 3BZFB 1E6JH 5C0CB 1PFCA 2AJYH 4JFQB 4YZFE 3RUGE 1I85A 5FCSH 2OXHA 5I74C 1JFQH 1GZQA 2WK2A 4R97B 3B9KC 3IDIA 4NUGH 5IHLB 2A6JB 3CDCA 2NZIA 1N4XH 2VRAA 3MLUH 5GIRB 2P8PB 4P46C 3WDIA 1LNUB 1MJ8H 4FQLH 3CAFA 4HEPG 5LCVL 4UUJA 1GGBL 3CFKA 1TCRB 1GSMA 5EU7E 3G6AB 3RIAK 3KPRB 2E9BA 1X3DA 2I27N 1WAAA 5IB3A 3JTSB 1GC1H 2X4QA 3NIGF 5IFJB 4CVZA 4NO0D 1KB9J 5T3XL 3P11L 32C2A 2F53A 5E6IA 5FK9B 1XIWB 4CNIA 3OKNA 1RY7B 1FL3A 2YHGA 5I71C 3PIQB 5IVZA 1CLZL 3FAXA 1RU9L 4DKAA 4JHAH 1W0WA 4J4PC 4CMHC 4H26A 3RI5K 1CBVL 3FN3A 3OX8A 5JMRA 3TPUB 3FO2B 1LP9A 3IKCA 3E2HC 2G75B 3VE0B 4QTHB 3VXOB 4R26L 3RZCA 3L5WA 4PJEA 1J10A 2AXGB 3CVIL 4JFHE 2EIBA 5TDOA 4MD4B 5JQ6L 1YYML 4JM2A 1CFQB 1OTUC 4BSVA 3HZKA 1A4JA 3CJJA 4I3SL 2FX9L 1RJZA 3N06B 3N1FC 5H37H 1KACB 4QRPD 5I1EL 3S88H 3QUXC 4J7RA 4X5XB 5HHXL 5ETUA 1RVFH 1MHHA 4NQCD 4NCC2 4WI2A 4X5WA 1MFDL 4PJ8C 1HIML 4TVPD 1T5XA 5IBLD 3AGVA 4QRSB 2AQ3A 5D72L 2Z8WC 3MBEC 1PEWA 1OT1A 1EHLH 4W6YB 1AY1L 3EW3B 5DRWB 4MJ2A 2EDXA 5EU5B 3ZT5A 1LDSA 1H9VA 3ZKMC 2N7BA 1RZ8A 3N0PB 3WLBB 3BDYH 2GK0B 3K2MC 2AW2A 1XR9A 1CT8A 1JHLH 1JPFA 3ZL4L 3RDTC 1R6VA 3DMMB 2A0LD 3Q1SL 4PJIA 3ZHLA 3SJVD 4LLMB 5H2BB 3MFGB 2R4RL 1ZT1A 4NNYA 5CBEB 2NW3A 4BQ8A 2G9HB 2QSVA 3G5XB 3CSBA 3B8SA 3J8F7 4TOYL 3S96A 3GMMA 4OZHE 2O5XL 1ZLUK 3C5ZA 4DOHB 2Q7YB 1D5ZA 1RJYA 4NZTL 1DBBH 1ZHKA 1T1ZB 4EZMA 5F9JA 1OP9A 5ESAA 4JKPH 4IRSD 3CXDL 4F15B 3QXAB 2VIRB 4DW2L 4YHPA 5KS9A 1BFOA 5CUSL 1A7PL 1A7RL 1H3GA 2BDNL 3UJTH 4LLVA 1KENH 3WO4B 3D3VE 2OCFD 2HT2D 5E00A 3BJ91 4XPBH 3AB0B 3EO0A 4NIKB 5GGUB 4Z7VA 1JV5B 2ED8A 5J6GB 1Z3GL 3RVWC 2IADB 4JFEA 1TZGH 4G8FB 1CD1B 3CPLA 4JAMB 4OT1H 1BX2A 3LH2L 1FN4B 3DI2B 2EICA 4MA7L 2DM3A 3I02B 1GIGH 5EOCH 3EOYG 1DUZA 3P0VH 3OXSA 4OF5A 4EN3B 3UZVB 2YPLB 2J8UB 4AT6A 4K7PL 1GVIA 2XWJB 2VKWA 1DQDH 3K7UA 1OLLA 2LVCA 4QRUA 4MQ7B 5I8OL 2OZ4L 1OW0A 1NFIB 4JGUA 4Y4FC 5DHXB 3QDJE 3BKJL 4NO3B 1FBIL 3T0EC 2O5ZL 3SKNB 4LAJH 5J89A 3PHQB 3CUPA 4LVEA 1HWHB 2IMMA 3ZSSA 1HHGA 1GRWA 3REWB 3WUZA 4ZTOL 1H15A 3RPIB 3Q3GB 1OSZB 5D1ZC 3OZ9H 3P4OB 2GJ6A 2HVKA 1U41A 3LQAL 1KCRH 1EAPA 3MROB 4UAOB 3INUL 1K85A 1QRNE 4RFNB 4NWTL 1K2DA 1KTDA 4F7PB 3PHOA 3PV6B 3L95B 1FRGL 1NLBL 5CWSB 5E2VL 3BT2L 4M7JL 5AAMA 3F65A 3PABA 4GT7A 4DKDC 5IMKB 4KZEH 3QRGH 2BNQE 3BMVA 4L8DB 4PRDB 4Y4KB 3MRCB 4NQED 3W9DA 2P7TA 5BO1L 4Z8FH 1SJEB 2X4PA 1GZPB 1M6OA 2EXYD 1RZFL 4PJBA 5JW4M 5F6HI 4G42B 4K7FB 2CPCA 3IFPB 5E0QA 5ILTL 4QKXB 2HFFB 1U0QA 1I3UA 5IROA 1X6NA 1XR8A 2BZDA 4MVBC 3PGCA 1A1OA 4OCRL 3WIFA 5GRJH 1DBKH 1ZLSH 5T33L 2AXHA 4LLDB 1C08B 2ARJA 5DUML 4KV5E 5F7HA 3BYTA 5DS8B 3TJHD 1ZTXH 4IIQB 4GKNB 3QDME 1HSAA 3DVFA 2COQA 2ZPKH 3DROA 4U05A 2QL1A 2BY3A 1KGCD 3IDMB 1MFEH 4TRPH 3H9YA 3O4LA 2OL3B 1BQUA 1YEIH 1AGEB 5E2UL 3RNQA 3W5NA 1U92A 5F8RC 4P2QB 1HZHH 1S8DB 3PWVA 4ZS7H 1MY7A 3BW9B 4POUB 1N59A 5DEGA 5IMOA 1VGKB 5HPMA 4OV6F 1HI6A 4XNZC 2X7LA 3SDCA 1CICC 2X4OA 4JDZB 5KJRL 1Z5LB 1Z9MA 2H2SD 3ZE2F 4NGHH 2EIZA 3VXNB 4NDMB 3JXAA 4QHLB 5EBLB 5SX4I 1AD9B 5DHYB 3K8MA 1MRFL 4EDWL 1Q1JH 4IJ3B 4JJ5A 3OG6B 2Q86A 4K7PY 1NC2A 2BERA 3ARDC 2GK2A 3GSQB 3T8XB 1NGYB 2XTJC 2XZQL 3BXNB 4LSVH 4BH7B 4JO4H 4MDIA 4EQ2A 3UC0L 1AGFA 2YBRB 5F71A 1CFSB 1I8LA 3O6FA 2CUIA 1MEXH 1UB6B 3MGOB 4NQDA 3HE7A 4ZTPL 5JNYB 1G0DA 5M94B 3QQ9D 3QXUA 4LLWB 1TNNA 2Y07L 2AK4B 4DEPC 3SO3B 1YEDA 4CADB 3IRPX 3O2VH 3SKUD 1I9JH 3RWFA 2NQCA 3KXFB 4GG6F 2R8SL 4MHHI 1L9NA 4GG6E 2YUXA 5GS0H 4MNGE 5KZCB 2EDLA 5KVGH 4OQTL 3SBWA 1JUFB 4F37F 4UNTA 1MRCH 3WS3B 4U3CA 1R3JA 3OKEA 5J1AB 1UKTA 3LCYA 3D6GA 2LTQB 4S1DC 4OZIB 2O5YL 1NFDA 2PETA 2W0LA 2I9LB 4TULH 5E1AA 5FUOH 1FZMA 3EDDA 5E6IC 2WLZA 2A77L 3SDYL 2R69L 2C1PA 3VH8A 4JVUA 3QG7H 2C9AA 4U6YA 2XA8L 4LQ1A 3E6FA 3FB5A 3DGGA 5BW7C 1F90H 4HG4K 1QSFA 4FQQA 4GAJL 3VA6A 3VFMB 5TDNA 3HKFA 2VLKB 1M4KA 3BKCH 3R4DA 1PLGL 1FORH 3GBLA 1RZ7L 4FFWC 3UTZB 4P4RB 1PG7L 5HYJE 5ID1B 4LASL 4P2YA 3S5LA 1JWSA 2VDPH 3FOLB 4MX7A 3T0BA 4ELMF 4U1JB 2KH2B 2YWYA 3WCYA 1A2YA 4YWGH 4P23A 3VWKB 3MRFB 4FTVE 2AS5M 3TN0B 4ENEC 4MQTB 3UTPE 4ODVL 4PJAE 2VTFA 2WQ8A 1TVBA 1FJ1A 5DXWA 2BVUA 4P48A 4ZD3L 3WUWG 3PNWB 4Y4KD 1OP5H 4EI6B 1ZAGA 1HINL 4NKQB 4OLEA 3IDNA 5BV7C 1NMAH 1P4LA 4GRMB 2J2ZA 4V2BA 4XVTL 1Q0XH 2QADD 3MLTA 1FZJA 1S7WB 2ZUQC 2XZCH 3DHMA 1NLDH 3D3VD 3JV4A 1LVEA 4XCEB 5L9DH 3QEQB 5FHAH 4LLUB 1T3FA 4ONHA 4FQCH 4HZLA 4EBQH 4RNRA 3U4EB 3GI9H 3RPKA 1UWEH 3VFTB 1C12B 4JM4H 5D1XA 2Y6SD 2ZUXA 3C5ZC 2HA1A 4PJGA 1I9RH 1RPQA 2QSCL 1A7BA 5BOZG 3GSNL 3N9GH 3WE6A 3MJ6A 4N9GB 4BZYA 5JPNA 1ZEAL 3DIFB 3S37L 1UENA 1RJLB 1IGCL 5F7FA 3V6BR 3PDGA 5JO5A 1NFKA 2A9MH 3AS2A 3TCXA 1M7DA 1N0XH 5MEPA 4CGTA 3GKZA 3CCHA 3ZKNC 43C9B 4YHZL 1HHJB 2GUOA 5KSVA 1RFDH 2B39A 4U1KA 3G9VA 3QDJD 3BAEL 2HTLD 2R15A 3W2DL 1M1SA 3PWUA 4M7KL 3EYFA 4MCYB 3OAUH 5BQ7A 1A6TA 4OB5H 4I4WA 3FO0H 5F6HJ 2CDFB 4BSJA 2LAGB 1EVUA 3KLDA 1G6RA 1I1YB 1IQDA 1XEDA 2H1PL 2ENYA 1IQWH 2J3SA 3MFFB 1OW0C 5D4QA 3ECBB 4O2EB 5I1DA 1IAKB 1FNSH 1QRND 3RWHA 5HHQB 3MLRH 3WEXB 3MRMB 1Q9WA 3BPCB 5JZ7D 4R7DA 5C0JB 4NZJA 1U8MB 3ULVL 1J05B 1WCBA 2AI0L 5DMIL 2UWEF 4G6JH 4RGNB 4KY1H 1VKXB 5IUSA 4QYOB 3GBMH 4NOBA 3WS6C 3FT4B 5BRZB 2BNQD 3NCJL 3LEXB 1WBXB 4QTIH 4KI1A 4V1DA 4UBDD 4HX1A 2ERJB 2OP4H 3UBXG 5SWZE 2P1YA 4ZPVB 4MJ6B 1U8KB 1VFBB 4NQUA 5FECB 5GPRA 1XT5A 1A4KA 1FCGA 2Q20A 3WHXA 4JFPB 4PJ9A 2WWKT 1JGDA 2BOCB 4HWZA 3WHE1 3PWPA 4TVPH 2WSKA 3MA9H 2VC2L 5E8NB 2YA0A 5H37G 1MI5B 1NCWL 1O5DT 4AIXA 2DQJH 4XMKL 1S9XB 3DRQB 4YDVA 3H7BB 4ZNCD 2UZXB 1KLGA 3H42L 2B5IC 1HEZA 4CVUA 1W72L 5JDSB 2VABA 2R1XB 2I26N 2VDOH 1B9ZA 2HLFD 3V7AG 3ZKXB 5IW6A 3LKPB 5KVDH 4MAUL 1CTNA 1WBZA 5F1IB 3T3PF 2PXYD 3GMQB 5IROC 1BVKA 1X7QB 4K9EL 2AJSL 1IGJA 5ICZA 3QXTA 1FL6B 2IH3A 5TE7H 4HV8B 1WBYB 1OTSD 4WI5A 4JY6A 4U4BA 4NPYA 3GSUA 2AV1A 4MXQD 1OQOA 5L8KB 5AG9A 1F4XH 3LB6C 5FM4A 4RDQG 4JRWA 3JV6A 2BSTA 4YK4B 1XF2A 1NGWB 1CFTB 1RI8A 2Q8BH 3RVVD 5DR5H 1BFVL 5KVMC 3OAYH 5I8EA 1K8IA 3H9SE 1ZGLB 1HYSD 4NFBA 4LEXH 5KVEL 4QHMB 3G6JE 4UDUB 1ETZB 4LSRL 5A16A 2C3GA 3B5GA 1ORQA 4RAUB 5TGBA 3SDCC 1ACYL 4QOKB 3DX8A 3UPCA 4GRWF 4U1MB 1NL0L 3VI4F 3U30C 3UCRA 4XNQB 4LCWD 3X13B 1ZHLA 3VI4E 2P8MA 1ORSB 3OSKA 5I30H 4CBPA 1AR1D 4UDTA 4PRHE 4X8XA 1UCBL 4WW1A 1U8HA 4H20L 3GMNB 2XT1B 4TUOA 3VGFA 3ARUA 3BSZH 3CVHA 5DI8B 1YJDH 4CMMA 2MKWA 5DQJA 1G7IB 4GS7B 4MQXC 4NN5B 4CL7A 1CD9B 3EYSH 4OF7A 3WXVH 1I8LC 4NYLA 3QDAA 4X6CF 4GBXB 5D7JD 4E5XA 3IDYC 2NY6C 3Q6FB 1YMMB 5ISZE 2NY2D 1YEFL 3TIEB 2XIDA 1BEYH 1EO8H 2XZAH 3HPLB 4WU5B 2R2BA 1H3UA 3MZTA 3SQOL 1LILA 1X5IA 4U1SB 5E2TL 4YDKH 3F7QA 3STZA 1JPSH 4KJYB 1I3RA 3SBWC 4Z6AT 2OI9C 2VSCA 3LZFL 3L3HA 4DKEH 1KN2L 5GGRA 4ZS6C 2EH8L 1P5UA 1YEHH 3RGVD 5J0BA 3W9EB 2AJVH 4NKIL 4OSUH 1EX0A 5IB1A 4Z0XB 2QQKL 4BH8B 2Q7NA 4Q9QH 1YEGL 4IMLB 1JYWA 2VISA 1FIGH 3C6LA 1DQQA 8FABA 2DYPA 1QQDA 3IDGA 4ZSOB 4JFYA 4YDIH 4FTVD 2WINB 1LK2A 3UTPD 4BJLA 1Z9OA 3V8CA 3SE3A 4HK0B 1JHTB 1UXSA 4K2UL 2ZCHH 1XGUA 4JKWA 1NKOA 4F9PA 1MCPH 1YC7A 1YECL 3C5SB 2BC4A 3TVMB 1C5BH 4LKXA 4XI5C 4X80H 5F93C 1T5WA 4UB0H 4PGBA 4GS7C 4KUCF 5F3HA 3UAJD 2EIDA 1PKOA 1CGYA 4RZCA 3PUCA 1SEBB 1CLYH 1JBJA 1INEH 1HYRC 3EO9L 3L9RA 1WSST 4XPTL 4P9HH 5D5ME 5JW5B 4CW1A 2ORBH 1CL7H 1UZ8A 3MLPA 4I3RL 3GMOA 5DJXB 1GHFL 2W92A 2AXFA 4FQ1H 1X5FA 2YA1A 1C5DA 3KR3L 4HWBH 1BVZA 3BWAB 2EC8A 2EYTA 2DWDB 5D7SH 3PWLB 3NFSH 1FZOA 3M8OH 5LBSL 4LSQH 5HHOD 5EWIL 4PLJC 1IKNA 1KJMA 3WV0A 2RHEA 3NAAH 4G8EA 1H0DA 4O5LH 5C07B 1IM3A 5GGVL 1MAMH 1IGYA 3GNMH 4XAWL 3TJEH 5FIEA 2BVQA 1S7RB 3CK0H 4D9QD 5D1XC 4L4TA 1MUJB 1F8TL 1JYNA 4PJ5A 5DJ6B 3IDUA 4HUWA 1JNHA 5D96C 1UACH 4IOIA 4IOFC 1AO7E 3ULSB 2VSDA 3F58L 1MVUB 4OV5A 2VUYA 3O8XC 5AWNH 4LFHD 1YZZA 1T20B 5LGHH 4JZOA 1GOHA 5GS1B 3L3IB 4J3SA 2J8OA 1MRDH 5IHZB 3CLFH 3KHQA 4QY8A 3CH8A 3KYMB 5F89A 3W0WA 1ZS8A 5C0RL 2XG4A 2YD3A 3T2PA 1DDHA 1QFPA 3RHWF 5DWUL 3GM0A 5F7LB 1MIML 3OPZL 5F1NA 1S9VB 1S7UA 1S9WA 3JTTA 5DO2C 4QOKD 2UVEA 3CFEA 4M62L 3TZVA 1QUNA 4NO5B 2A74B 2FJFB 3C87A 3TBYB 1BQHG 1G7PB 1VFMA 1QFHA 2NY0C 3KPOA 5GGSB 3UTTE 4HBCL 4HHAA 5JIHA 4XT1C 3NACL 1MCKA 1MQKL 1RK0B 1AXSB 5SWZD 3QQ3A 1ZSDA 4XPFH 4YNYB 3L5XL 3LKNA 4G7VL 4RMWA 4ZAKA 5ESQB 4CUCA 5MENB 3FFCB 2PN5A 5LGKA 3TBSB 5FGCB 1FLRH 4KK9D 4PTUB 2AV7B 4GBXD 4NNXB 4PJXB 3IVKB 3P73A 1F00I 2Q8AH 5HY9B 5GRUH 4LLQA 1PDKA 3H3KA 3SE9L 1F13A 5IJVA 4ZMAT 1TZHB 4JQIH 4FQXB 12E8L 5CJXA 3ARGA 2QV2A 4Y4HC 1GOFA 4X9HA 1KIQB 5ABDE 2IGFH 3MCKA 4M93B 1H5BB 1U95A 3O3DB 5T5NG 3PQYB 1HQ4B 3IXTB 3X3GH 5CGYD 1FAIH 3DUSA 3TBWA 4MJIA 1FL5A 2CK0L 1H3VA 2Z93B 3HNVH 1EUTA 5GGTH 4CN4A 4FQ2H 3EOAA 3U4AA 1QP1A 1LMKA 4JPIB 4KROC 1NMBH 4LCUA 3KPSE 3JBG7 1F4HA 4P5MB 3U4BH 4LCIL 5BOPA 1U8LB 5DZLA 5LVEA 2E6PA 5JHLL 4CU8A 1MFNA 5CJOL 4Y5VA 4BA8A 3QRFM 3BX7C 4YPJA 3NA4A 4M8VA 5IVXB 2V2TB 1UH3A 3QYCA 3CGTA 2HWZH 3A0OA 5GGVY 4EOWL 4FQHB 3TVMD 3MBXL 1DR9A 4IDJL 2R0KH 3TO4A 3VFNB 2FATL 3L6FB 1C7TA 1A0QL 4F7TA 1WJ3A 1BBDL 4RFOL 2HFEB 2XG5A 1RJCA 3FB7B 1MWAL 1ZT4B 3IU3B 4LRNL 4X6DB 1YDPA 1S78C 3O6MH 1E6JL 3V52H 3VD4A 2AJYL 1MCRA 3G5VA 3B4NA 3BRFA 1JFQL 4K71B 5CKAA 4GKOA 4YXKH 4ETQA 1N4XL 2EEDA 4NQXB 1N7MH 1J5OH 4YQXH 1MJ8L 2BMKA 3GI8H 4L4VB 5M95B 5IOPA 1ODAA 4XPGH 2YK1L 5E5MB 4XP1H 5HGGS 5IWLA 1MCBA 4G6AC 2D7TH 3ARFA 4NQSA 1GC1L 1KPRB 4DTGH 3FB6B 5DT1H 5ISZD 5DVLA 1I1AC 3RIFK 1KB5L 2DQCH 3KVQA 4P3DA 3HMWL 1XGQB 1NEZA 3GMLA 2VXQH 5CJQL 1Q9KB 2R39A 3MV8E 2ADJB 3LN5B 4LVOB 2VL5B 4OJFL 4PRAA 4TSCH 2VWEC 3MRGA 4BK5A 1NPUA 2C4FU 2YKLH 1JF6A 2P5EE 3FTGA 3K4ZA 2LABA 3X12B 4LEOA 4RAVA 2B2XL 1KJ2A 1CE1H 4QRRA 3SKJH 4JHWH 3BIBX 4JQXC 2VO5A 4XX1G 4O2FB 5BS0A 3OG4B 3U2SA 4ZFGH 1BREA 3GJFA 2W07A 5DDHA 2Y5TA 3EFDL 1NAML 1FGVL 2HMIC 4ELKA 3PXJA 3M17A 1JL8A 2XRAH 2RFXB 4AM0A 4ZXBB 2FECL 4OFIA 3GBNH 4JFFA 1D9KA 3RU8H 4DCQB 1LEKA 4X6FA 4LSUH 2V6HA 3C60C 1U36A 3AXLA 1EGJL 2Y9RT 1WT5A 3U83A 1EFXD 2HTKD 4WEBH 4HG4J 5DYOA 1A6UL 2IH1B 5DRNA 1YYLH 4Y89A 3KLHD 4R4NC 1OAQH 4WWKB 3C6LC 1BP3B 4MA8H 3ZYOA 5C6PB 3VFOB 5C0BE 3WNLA 5J9PB 2ARWA 5E9DB 1ZVYA 1V7MH 2UV3A 2Z4QB 5JHDE 3T0EE 3DGCR 1E4JA 2IANB 3SE3C 2SEBA 3CIQA 4IDLA 4QXTA 1ONQB 3GO1H 4F9PC 1FHGA 4OI7A 1WQVT 4XNMA 4JKPL 2CDGB 1FV1A 3BH9B 3QHFL 3N1QC 5ACLA 3BMWA 4DGIL 1KCLA 3DXAA 5F3BB 1R3HB 2NTFA 3LIZL 1KENL 5FGSA 2JIXA 4M48L 1VHPA 4P99A 2WZPD 4XPBL 4YX2H 1ZANL 2JJSA 2Z8VC 1EMTH 4WHYH 1XGTA 4RAHA 1TZGL 1OL0A 4N0FA 4R4BA 4Y8AA 2W60B 4BFGA 1QFUL 4OGAD 4JFDA 5FYKE 3QNZA 2VDNH 3LPFA 1GIGL 2B4CH 4U1GB 2ZUTA 5T1KB 1NGQH 3RKDC 1AO7D 3MV9B 1KNOB 4EXKA 2J8UF 4M5YH 5D1QB 4BFIA 2Z31B 2PUQT 4YC2C 1I4FA 2AGJH 3GRWH 4HXAL 1F5WA 4HFWB 1HDMB 2Z91B 2YXMA 4Z7OF 3H8NA 3LS4H 4P2OA 1YN6A 5FA4A 3DVIA 3DSFH 3A6BL 3PP3H 1I7UB 1URLA 1JHKH 5EDXA 4LQFL 4OFYA 2VR9A 2LVEA 5JTWA 2VXTL 3TIDA 1KLUB 4LPWA 5HSFA 1G7QB 4KQ4H 2DQGH 3BDBA 3ZKSD 2BHYA 3QUKB 3BEVB 1U3HB 1YNLH 4JN2A 4TNWF 1RV6X 3UTTD 4LHUA 1JCKA 3IF1B 3H9HA 4XVJH 2XQBH 3VGDA 1YY9D 4DVBB 4EUPH 5IB4B 5I18H 4I2XE 4U0RB 1TNMA 3HCVA 2IG2H 3RY5A 3MUJA 2VLJE 2FSEB 3I84A 4KK8D 5HGHA 4CU6A 1KCRL 1B0RA 1PKQB 4U6XB 2DQIL 4PJ7B 2DQHL 3K4AA 1XF3B 5DLMH 3TZVC 3WIIL 1Q9OB 4RWHA 1AHWA 3DJ9A 4RSVA 4KK6D 2CIIA 4KPHH 5MEOB 4HWNA 4KZEL 4Z77B 2HN7A 1HCFX 3CDYA 1UA6H 3PGDB 2OK0L 1VFAB 1N2RA 4ODTL 3SDDB 1IAIH 5ITFA 4Z8FL 3LSOB 1UADC 5GSRA 3ALWA 4WU7B 4HKJA 4R3SA 1JF1A 5K9QG 2NY4B 4XVUC 1WC7B 2KDGA 4P46D 1QKZL 3DX9A 2XTJE 4ZAKC 1Y18A 5I1AB 3RNKA 5KSBA 4HXBH 1G7LA 3ZTNL 1ZKAA 3CXHK 4G9FE 4NO0A 4KTYA 3RWCB 3HI5H 3S3JA 5JOFB 5GRJL 2I60H 1DBKL 5HVGB 1ZLSL 4ALAH 3VFVB 1XH3B 4LCYB 2OJEA 1J1XH 1ZTXL 1T03L 1GCFA 3FRUA 4LHQB 3HI6H 2ZPKL 4ZXBD 3QXVA 1BZ7B 2XZZA 4J4PD 4WI3A 2QLVB 4OAWB 2VR4A 5CBAB 1T1XA 1Q72H 4NKOA 4XCCL 1VSCA 2R29L 5C7XL 5C0FA 2CLVB 1BMGA 1N64H 1IC7H 1YN7B 4ZS7L 2AEPH 1NJ9B 1C16A 1OTUD 1U93A 3EYUH 4MS8D 4EIZC 3DURA 4QRPA 4WWKD 5FM5M 2F53E 4MCZA 5CIPA 3VCLB 5FO9B 3QUXD 1FPTH 4NGHL 4XCYA 1D7FA 5CLTA 4XMLL 2R23A 2VE6B 5CMAA 3VFUA 4WNQA 4BZ2L 2WBJC 3EFFB 1E28A 3T65B 1A3QA 2IAND 4Y5VC 3OKMA 4PRIA 3D9AH 3JWDL 3HAEH 4UIKL 5IR1A 4LPXA 5T3ZE 4TNVF 4X99A 4KTEH 3RRQA 3WSQL 2FB4H 4FG6C 3EIFA 2HJKB 3ZKMD 3MJ8A 4LVNC 4NRZB 4YAQA 4XXDB 1IILE 3RDTD 1CLOL 5DRXB 2VN4A 3DBXA 3O9WC 4N8VB 4L3EA 2J88H 3L3JB 1ZVSA 3GMPB 1A6VH 3BZ4B 5FM5O 2FEEL 1ZHNA 2P44B 4K94C 3HZMB 3QEUB 1UWXH 4JDTH 2P5ED 5T1KD 4R7NB 4DGVL 5GS0L 3QIUB 4IRJB 3BHBB 5KSUA 5KVGL 1CIDA 1YPZA 1UXWB 5D1QD 1IC4H 5IWLC 4U1LB 2RGSA 2NY3B 1YA5A 3D25B 4OZIF 3GSXA 3BGAA 3D85D 5EA0L 5HXMA 1MNUH 3T1FA 5B39B 2NXZC 5FGRA 5JORA 4NQTA 1BHGA 5B38G 5CEZE 3RVWD 2H32A 3KYKH 1G9NC 1GZQB 1SMOA 4HIXH 3STLA 2BJML 3LPWA 3CDFA 3ROOA 1F90L 2JK5B 4PTTA 1IC1A 2HJLB 3GGWB 2C3HA 3B9VA 4M1DH 1FORL 4N0UB 3WIHH 1KFAH 2ZSVA 4HF5H 5CAYB 2X4QB 3PDOB 1FYTE 4CVZB 1S7XB 2VDPL 4W68A 3RVTD 5F7NC 2APFA 5FF6A 1HHHB 4MZ2A 2JCCA 3ZLQC 4CNIB 3DPBA 3OKNB 4YWGL 5ACZA 2W38A 4JFEE 2X6MA 4OLWL 4OLUH 3D18A 5JHDD 4LSTL 3MV01 1D9KC 1NDGA 3T0ED 1WZ1L 5DURB 4UTBH 1CLCA 4PY7B 5LQBH 3LKQB 3JVGA 1LP9B 3IKCB 1GJIA 3RZCB 3L5WB 1HK6A 3R0NA 3NN8A 4R4FL 5TDPA 2O93L 3N85H 1KV3A 4KJPD 2E7HA 5TDOB 5DFVD 4XCNA 1SQ2N 4ERSH 4JM2B 5FO8A 2GI7A 4YO0A 4ODHL 4F2MA 2BY0A 1A4JB 4RFEA 1RJZB 2XZCL 1VDGA 3LDBC 1EEQA 5EUOE 1NLDL 4YBHA 3RIAF 3B43A 1AI1H 3I6GB 5J1SC 3PWNA 5ADPH 5L9DL 5FHAL 4JRYB 5ETUB 4FQCL 4CVXB 3O3UN 1MHHB 2D7PA 2CMRH 4X5WB 5DD3H 1IM9A 4JM4L 5MERA 4LF3A 1J1PL 4Z7WA 1T5XB 4MJ5B 3OKOA 1I9RL 3FONB 5HYSB 1M71B 5FYKD 2CK2A 4WW2A 3RI5F 2AJ3A 1IGTB 3RGHA 1EERB 3N9GL 4HT1L 1IVLA 3CU7A 1K5NA 3ROLA 1XR9B 5C0GB 4PJIB 4ZUUA 2DAVA 1N0XL 2BCKB 4JZJC 4J1UA 4KK5C 1ZT1B 3F7YB 3U7YH 1T7WA 3ABZA 2FJHA 4Y2DB 3BIAX 4MVBD 3HN3A 2M26A 1UJ3A 4X4XA 3P77A 5E8PB 2EE2A 3EJZC 4LVHC 3GJEA 4P4KA 4Z0BH 2NY5L 4PPTA 5CP7B 1RJYB 2VLLB 1R5IA 1ZHKB 2Q6WB 3NZHH 5F9JB 5ESAB 2D3VA 1EA9C 5GRWA 2ADFH 1ZHBA 3LQZB 3K74B 4OM0L 4M6MH 3FO0L 4YHPB 5F9OH 4A6YA 5L7XH 3GM8A 4ESKA 5D2NA 4HWBA 4PG2A 4LLVB 5F7DA 3C5JB 2R2HA 4P2OC 2VLJD 1IQWL 3TEUA 3EO0B 4Z7VB 3AREC 1JGEA 4HFUH 15C8H 3QH3A 1NUNB 3FQNA 3MNWA 1QLRA 3CPLB 5EG6C 1CICD 4WY7H 5CD5C 4PGDA 3NPSB 1FNGA 1U58A 1XGRB 4KY1L 4JO1L 5I19L 4C56B 1IL1A 1RULL 1WF5A 2BSSA 3GBML 4OZGB 4YGVA 1LO3L 4QTIL 2FIKB 3OXSB 3QUMH 3QEHA 1OVZA 4AT6B 4PJHB 2YR3A 4C83A 1UVQA 4U1IB 2NPLX 4GRLC 3ARDD 3RAJH 3TA3B 5AYUH 5LXGL 1ITBB 2P5WE 5DD5L 3IETB 3I75B 4LCCB 2XTJD 4QRUB 1R5VA 4NKDA 5AZ2H 1NC4B 4LLAA 3S34H 1LD9A 4QNPF 3RVXC 3MA9L 1SEQH 4UTAH 3IDJA 4G9FD 4MB3A 1FSKB 2BVOB 1BZ9B 5GS2D 5HVFB 1S7QB 5K9OB 4XBGA 4I0PA 4D3CH 5A3IC 2ICES 1BJ1J 4NN7C 4L3CA 3QUYB 3L7EA 1I9IH 3QXWA 3GIZH 1LWRA 3BPOC 1UGNA 1QHOA 3HR6A 5IF0A 5B38A 1UG9A 3QUZC 2A38A 3QI9A 4L5FH 5KVDL 2GJ6B 5IVNA 5DC0A 2GFBA 3QXDA 3OKLA 5E6YA 4N1EA 5KAQF 3GSNB 1FO0H 1LE5A 5JW4Q 4NQDE 1D6VH 4Q6IA 4S1DD 5F7EL 2W65A 4BM7A 1D5BB 3WJJC 2H9GA 1I3VA 4XGZB 2F53D 1OGAE 5E6ID 2WUBL 1LO4H 5HHMB 3FHAA 2VLME 2BSRA 4LU5H 1F4XL 5F6IC 5IKCB 3RWEA 1E4XH 5FO7B 5DTFB 3QG6B 4NN6B 2IPTL 1OD7A 4YHLH 5E99H 5AZEH 1HXYA 1M6OB 1FNFA 4PJBB 5DURD 4D9LH 3HC4L 1GGUA 3FQXB 1II4E 3HMXL 3FRPA 5I0ZA 3EHBC 4P57B 3SKOB 3FQTA 4LEXL 4HDIB 3MO1A 4C58B 5T3ZD 3ULUF 5EORH 2ZCKH 4BFBD 4JM2D 2ESVA 4FFWD 2WP3O 3ARQA 3BUYA 3AMKA 1A1OB 3WIFB 5KW9H 3BI9X 3TNNA 4ZFOL 1JNNH 4Z5RA 3LRHA 4M6OH 3UJIL 2CKBH 4WHYG 1MCHA 3T4AA 1HSAB 3BOVA 5EU4B 5IQ9B 3DROB 4ENED 4YHNA 4OZHA 5DEFA 5D8JL 3TCLA 5I30L 5DD6A 2C3VB 3O4LB 1EBAA 4XBPA 1KELH 3TYGH 1U92B 2DQEH 3GSVB 3MRHB 1YJDL 2BFVH 3ZT7A 1N59B 3F5WB 2YXFA 5DEGB 5IMOB 3O11A 1RAMA 1L4IA 4QRTB 5DC9B 4JFXA 1HI6B 2HJFA 2X7LB 2PW2A 1V3MA 1MCOL 3BEWA 5KSAA 5FYJD 3VRJB 5KBNC 1BEYL 2JB5H 1EO8L 1KULA 1CGWA 4IM8A 5EIIB 3TO2A 3VXTB 3U0WL 4UIMA 2Q86B 4PB9H 3C5ZD 4H0HB 5DD1H 5EZIH 1JPSL 2LFGA 5IGXH 4KU1A 1U8IA 1H3PH 4YHYC 3D0VA 4EUPG 2GJZA 1MHEA 4M61A 1KCSH 3T3MF 4NUJB 3EO1B 1OAUH 2CUHA 3KS0H 2OSLB 2X4UA 5DUPH 3R1GH 1AGFB 4UZGA 3O6FB 2B0SH 4OSUL 3HE7B 3MV7B 1FYTD 4BZ1H 5FUZL 4Q9QL 1CU4H 4R0LA 2G5RA 3MMEA 1X5LA 1FIGL 3UJJH 1A1MA 1B2WH 5ID0A 3ZKND 1JPST 1YEDB 1CGSH 1NKRA 4JFED 4YDIL 4ZPTA 1MOEA 3RWFB 2PTTA 4PJGE 5I75B 2W91A 1Y6KR 3FO1A 3OKYA 1P4IH 5GXBB 4EVNB 2ARJQ 3ULVC 5CINH 4I0KA 1IC5H 1RMFH 3ILQC 4N90E 1MHPH 4CKVX 1XFPA 3OKEB 1L0XA 4UB0L 5KTEH 2VITA 4OM1H 1A6PA 4MNQE 1OAXH 2R0LH 1NFDB 2OTUA 3D69B 3V4VH 5E1AB 1CLYL 1FZMB 3GKWH 3QIBA 2VUOA 2C1PB 4P9HL 3MJ9A 2ORBL 3VH8B 5AD0A 5I1LA 3MODH 2WIMA 4FQ1L 1X5KA 1MIEL 1JTTA 4Q2ZA 3E6FB 3FB5B 3ALPA 3DGGB 1BM3H 2BNQA 2Z35A 1QSFB 4FQQB 4LLYA 1MH5A 5D7SL 3N1PC 3OB8A 1VADB 5IV2A 1NCAH 3M8OL 3PWJA 4QCIB 1U8NB 3OJDA 2Z0BA 2BX5A 3IT8D 4MSWB 1YY8B 2GJ6D 2J8HA 7CGTA 1SY6H 1A9BA 1KG0B 1OT2A 3SGDH 1MAML 1OSPL 4H5SA 4P23B 4HMEA 3NH7H 4HKZB 2DQTL 1A6AA 3NIDF 1JK8A 4ZO9A 2VXSH 3QWRA 5C6TH 1WGOA 3HZVA 4QRQB 3JWNC 2JKXA 4I18A 4WW2C 1HH9A 3QDMA 1XCQA 1UACL 5DVKA 1I1CA 5E03A 2VQUA 3HR5A 4NNPH 3VFRB 5AWNL 5K9KA 2YPVL 5KAQG 5LGHL 1BVLB 1WFOA 4IS6B 4ZUVB 4HUUA 1MRDL 3CLFL 1DLFH 3QFDA 1AP2A 3O6LH 2MTPA 1T80A 2EE9A 2CGRH 1Y0LB 4ONHB 1T2JA 5J1TC 5TQ2L 1Z2KA 4RNRB 4GQPH 3KJ6L 2K3TA 5EO9A 2VLRA 4LFHG 2AK1L 5DGQA 4P4KC 2VAAA 1WWAX 4OIIH 3MGTB 2GSGB 4ODXB 4IEFB 1HQRB 4FFZH 4F57H 1S7SB 2YOCA 3LB6D 5DA0B 4BELD 5I8CA 4AENA 3ZMRA 5FYJU 4I8DA 5DJCA 3WE6B 2ZOLA 2P24A 4GMTL 4NM8L 5JPNB 5D2NC 4OCXL 5CSGA 5EN2A 4XPFL 5JO5B 5FOBB 2P5WD 3LS5H 3KWWA 4EXPX 3GSOA 1N8ZA 5F96H 3V6ZA 4HMDA 3EOBA 2RB8A 2JE8A 1S7TA 3S4SA 3SDCD 4Y1AB 2HLAA 2Q8AL 1SYVA 5GRUL 1CVSC 1AXTL 2ICWA 4L8BA 4L9LB 4MLSA 3EYFB 5DJ2B 2FYYA 1AQDA 1WVZA 1CDGA 1KEMH 5IEKA 1NAMA 1T7YA 2IGFL 4I4WB 1NC2D 3GMRA 3CU1A 4TTDD 2WMPA 3RQ3A 3VG9B 3NTCL 4GG6A 1QBMH 4TUJA 1G6RB 4MNGA 1S7VB 4E41B 1IKFL 2A83A 3QIWB 4JPWH 4K3JL 1NGZA 2RQ8A 1RUQL 3X3GL 3OGCB 5D7JA 4NT6A 1KT2A 4OZFA 3OTTA 2DQUL 4JO3H 1Q9WB 1EGJA 1A14L 4NQDD 1FGNH 1NANI 3HE7D 2NY6D 3HNVL 2LU7A 3QT2A 5GGTL 1WCBB 1ZA3B 3EYQC 1QSEA 2RJMA 4X4YA 2VERN 5L0QC 1WFTA 1J8HA 5IMLA 1CG9B 3CXHJ 1NMBL 2VLMD 2YPKA 4V1DB 4ZG1A 3KYOB 3BPLB 4CVWA 4H1LA 2VWEE 2IAMA 2IALA 4ZUWA 3U4BL 1K4DA 5HBBA 5FDWA 3QI9C 5IVXF 1RZKL 1A4KB 4Y16B 4HUXA 4LSSL 3WHXB 3C8DA 4PJ9B 4HWZB 4DN3H 1NCCH 3PWPB 3RGVA 3NCFB 5J7CC 2D7QA 4CN6A 2DRUA 5HYJA 1DEEA 2R0KL 4ZS6D 4Q6IC 1KIUA 35C8L 5EUKA 5FYKH 2AP2A 1BLNA 1MCJA 4RGMC 4X6DF 4ELMA 3U9UA 4XAKD 2OMNA 1CDUA 1ZLVH 1NGPH 2OL3L 3NFPB 3ES6A 4HS6A 2XWTA 4N5EC 4PJAA 1MREL 1HWGB 4OCNC 1L9MA 3O0RH 3VI3E 5I2IB 2VABB 4I5BB 1QSFD 2VNCA 1T21A 4PR5A 5IW6B 5TF1H 1SM3H 4YXKL 4GUPB 1WBZB 4XMPH 1J5OL 1P1ZA 4Z9KB 1J18A 2N56A 1K6QH 3CX2A 1BVKB 4MAYA 3VWJA 1IGJB 3MJGX 2NXYB 2A73B 5CS7A 5ICZB 3BO8A 2IH3B 4DTGL 3U1SL 3GSUB 2DQCL 3REVA 4K3DL 5LWYH 3V5KB 1KCKA 2VXQL 1T6VN 3WFDL 1KIRA 1Q0YH 1L6XA 2KZWA 2BSTB 2IFFH 4TSCL 5C08A 2AEQL 1JNJA 5C70A 2EZ0C 1HOCB 2YKLL 5I8EB 5E8OB 4DFIA 2A9NH 3I2CH 1OCWH 2VDMH 4QWWC 3S9DB 3WUWB 1MLBB 2LQRA 4PLJD 5I76A 3WNPA 4WEUD 5DVNA 1ORQB 1K4CA 1J11A 2DBJA 1QLFA 3DX8B 1ZLWH 3VGHA 4PRNB 5DRZB 3UTOA 5KSAC 1KJVB 4X6BA 4ONFH 3HAEA 2CIKA 2BSED 4GXUN 4JY5H 1A9EA 1ZHLB 3SE8L 1B6UA 3BUTA 1G6VK 2P8MB 2XRAL 5D1XD 4OZ4A 1QYGH 4MD5A 4K3EH 3BQUC 3LEVL 4APQA 5TFSH 5F9DC 2GT9B 3GSWB 5HGDA 3MRKB 4LSUL 4IOFD 4CMMB 1KBGL 1RK1A 1A3RH 4QT5A 5EH1A 1MLCA 4N90D 2W9DL 3SDXF 1OY3B 2EDNA 5GS2H 3O8XD 1N5AA 3GSRB 3SDXE 4NYLB 5H94A 3RL1B 4E5XB 2D31A 3CFDB 1IAIM 2IBGA 4MYWB 4KJWC 5E56A 4JREC 4R0LC 3L3KA 5DVMA 1FIEA 1BWWA 2VH5H 4M5ZH 1FZKA 4LIQE 1Q9LA 3HPJB 4MA8L 2R0ZH 3QQ4B 4X7TA 1FNEA 4HC1A 4X7EC 5DO2D 1MJ7H 1B4JL 4PJ5E 3WFZA 1V7ML 2UYLA 3F6LA 2V5YA 3T2QA 4H88L 4H25B 3QNYA 2YN3A 1MWAB 3GO1L 4A2MA 5SWZA 4EEEA 5C0EA 3HG1E 4D94A 3L3HB 1OP5K 2CLZA 4NSKA 4AG4H 1YNKH 4O02L 4YLQT 5I0DA 1U8PA 1AFVH 4ZYKB 4JLRB 3UBXI 4YH6A 8FABB 4KDTA 2DYPB 3IDGB 4NJ9H 4XP5H 4YBLC 4K8RC 4JFYB 3UZEA 1I1FB 1H8SA 3QJHA 5E94B 2EDOA 1EMTL 3VFWA 2MPAH 3KPMA 3WIHA 2ADIA 1UCTA 1R3KA 2FL5B 4KVCL 5T3ZH 2XKNB 4G80A 1DUYB 1UXSB 5T3XE 2B4CL 3GHBH 4V1DD 2JB6B 1XGPB 3MLXH 3R06A 4UT7H 3LKRA 4XHJD 5DSCA 3VW3L 4M5YL 5SX5H 3RTQA 4PGBB 4M6AA 5BVPH 2ADGA 2AGJL 2OQJA 4MA1C 2FECI 3GRWL 4RZCB 1T2XA 4MNHA 3UBXB 5E2WL 1CK0H 1CF8H 4YXHH 4XNXL 3MGAA 3LS4L 4GJTB 3DSFL 5CEYA 4DQOH 1DL7H 2AXFB 1GAFH 1JHKL 4KI5F 4HIHA 3VXMB 4XNYH 3C8HA 1QVOA 5BV7H 5HYQB 4KQ3H 1MSPA 4QXWA 2NW2A 1U8JB 5KANG 4KQ4L 1YEKH 4KROD 1PZ5A 3LOWA 5IM7B 4NHCL 3GUTB 1ND0A 1YNLL 2I07A 3IFOA 4HGMA 3MXWH 2FX7H 4DN4H 2IBZY 4XVJL 2XQBL 2WIIA 5FYJH 1F45A 3H9SA 2VQ1A 1QSZA 4LP5A 1FFNA 4HCRA 3G6JA 2IG2L 5CEZH 4Y19A 1F4WL 1IGYB 2YD9A 1V3JA 2RCSL 4PJ7F 1RUPH 1XF4B 3QZWA 2ITDA 1G7HA 1OPGH 1VACA 4YIQB 4L4TB 4JPKH 3MREA 2VDQL 2GAZA 3TBTA 4UT9L 1TPXC 3F7RA 5I1HH 4KPHL 1D5XB 1UA6L 3ZYZA 4LOUC 4G9DA 1BAFH 1N6UA 3B8YA 1K8DB 3QJFA 4PRHA 5I66A 1KN4L 1INDH 2FCBA 3QO0A 3TT1H 4C55A 2H26B 5F89B 3W0WB 1ZS8B 4RX4A 5D9SA 1PQZB 3CFJA 4FRWA 2FR4A 2WAHA 3H3PH 1BIHA 3SHSA 3FOMB 5E08H 1LO0H 3B83A 3MX0A 5F1NB 3L3DA 3JTTB 4G6AD 1YEJL 3HI5L 5INDA 3DO7B 2Q3AA 2I60L 3SDAA 4ALAL 5JR1L 1I1AD 2GYSA 1IFHH 1RZJL 5TQ0H 2CRZA 3R8BB 1TZIB 3KPOB 3KPQA 1J1XL 4HHAB 5EZLA 5F7WC 3NIFF 2Q76A 5CKGA 4XWOD 4PB0H 1X5GA 4XVSH 3EDJA 5GJSL 4U6HB 3FQRA 1N64L 1IC7L 3UTSB 3HE6B 2F8XC 1F4AA 5C9JA 3RWJA 1UM5L 4OUUB 1T83A 3EYUL 5ERWA 3QUMA 1NDMA 3WJLC 5SWSA 1YQVH 4O51A 4I9WD 3SCMA 1QBBA 1T7VA 4ISVB 3ARSA 3MRIA 5EC1A 1C5CL 4Q9CA 1I7RB 1HE7A 2HMID 3ARGB 2XWBA 3RWIA 1T89C 2IAMC 1NGXA 4KHTH 3MCKB 1F02I 4OFKA 1U95B 3P9MB 5M7QA 1AD0A 1GGCH 3C60D 2VDRH 3D9AL 4HLJA 3HNTH 3V5HB 3ZDXE 4JQVA 2V9QA 3RVUC 2F54A 3DUSB 3OAYK 4KTEL 3G5ZA 3TBWB 1TENA 5HTSA 5MP6H 4NM4L 3BP4A 1FVDB 4OKVB 5BS0E 1N5YH 4CJ1A 4O2CA 3V6FA 4HIJA 1DVFB 4R4ND 3C6LD 4NCDA 4FZ8L 2ZNWA 3ZE0E 2MCPH 4WFFE 3MYJA 3ARYA 2ZOKA 4Z7NF 4FQIL 4LCUB 4HKXA 5ANME 4F7CA 1S9KC 4P5TB 2H45A 4C54A 1FO0A 4XNUH 2W0FA 2YZ1A 5IP4A 1UJTA 5C09B 1OTTC 4DAGH 3P0GB 3PL6B 4F7EB 5FHBH 2DM7A 5BMFL 2J12B 3ULUL 3I9GL 2PR4H 2NY1C 4NZUH 3NA9H 1IC4L 4KH2A 3TO4B 1A7NH 3FQUB 4JRXB 3VWJC 4PP1C 3X11A 1UWGH 5HYIA 4Z7UB 4PFEA 1MNUL 5T5FL 5SWQA 2VN7A 3U7WH 2BNRE 5HD8C 1OP3H 1M7IA 2C4FT 3KJ4B 2K7QA 4U6VH 4HJGB 1AIFA 4MA3A 3ZDYF 4JG0L 4PLKC 1AO7A 2X4TA 3SE4A 4PJFB 5BJTA 1QEWA 1WUNT 2F74A 3RKDD 1UM6H 5IOPB 2VZOA 2ZSWB 4PBVC 1UH2A 1WAAF 5DMKA 1KFAL 1W2KT 4AEHL 3ARFB 3UEZA 2D7MA 5ECJE 5E8DH 1DVFC 5IEHA 4G7YH 3V6OC 3TGXA 3WFCH 4P3DB 3DHJA 3GMLB 4JCLA 2XN9A 4BYHA 4L4TD 1JI2A 4PJ5D 3MRGB 5LQBL 3C09C 3FTGB 3UTTA 3O2DA 4PJCB 2X09A 2XFXA 4KKBD 4JM2F 1TQCB 3JZ7A 4S2SB 3UYRH 3N85L 1CFNB 2ZCLL 4QRRB 4GKZA 4RWYH 4YXLH 4NZRL 3U2SB 1KCUH 3KLAA 3TV3H 5DDHB 2Y5TB 3O3EA 5MEQA 1AI1L 1BIIA 4ELKB 5ADPL 4WHTA 4WV1A 3MOAL 3M17B 4O9HH 3DV4A 3TZVD 4AEFA 3VXUB 3RIFF 5FYLE 1A7QH 4JFFB 3WNMA 4F3FA 4C4KT 1LEKB 2V9RA 1A3LL 5J13B 4PJDE 3B9KA 2VDLH 5L2KA 4I77H 1BQHB 3CC5A 4RRPG 5DYOB 1CYGA 3GK8H 5CZVH 1EIBA 2EXWC 1EO5A 2NMSA 2FLBT 3WKNA 3MLYL 4FMFA 43CAB 3FJTA 3FFDA 1T0MA 2HKHH 2WQRA 4XVUD 5DRNB 3VDAA 3MA7B 4RGOH 4M1GH 2V7NA 4RQQB 4ZAKD 2QKIB 4LDLB 1P7QA 5JPMB 25C8L 1C8PA 2CJUH 2IQ9L 4DZBA 1QFWM 1EO7A 4AL8H 4G5ZL 1KTRL 1PEZA 1DQLH 2SEBB 3H0TB 1T0NA 2X44D 4GSDH 4Z0BL 5AUMB 3CSYB 3KPSA 3ARGD 2ITCA 3AMLA 3BP5B 4OF0A 3N1GC 4XNMB 4J4PA 1EFQA 2EH7H 3U9PH 4EKXA 3H6JA 5C0AB 4B41A 5EO1A 1G7JA 5F9OL 3DXAB 6FABH 4NWUH 2NTFB 4AEIL 4KKCD 3P4MB 2JIXB 1MCNA 5KSBE 4HIIA 4Z7VF 5EOCJ 3BDXA 3JWDC 2C1OA 4MJID 4GW5B 2BRRH 4HFUL 3OJMB 15C8L 4Z7QE 5HGBA 4LNRA 2NNAB 5J56B 1XGTB 4N0FB 4Y5YC 2NLJA 3NBNA 5A2IH 3QUXA 4WY7L 4JFDB 4OZGF 1OB1A 5IG7A 1SY6A 5C0CA 3QNZB 2YD2A 3TESA 3QCTH 4JFQA 4GLRH 3D2UA 1FCCA 4PJ8A 2FO4A 2WBJD 4BFIB 4PJHF 2A6JA 4UNUA 2NCMA 4G8GB 1I4FB 1AGCB 2MMXA 5GIRA 3MBEA 5FAAA 3BPNB 3B5HA 2P8PA 1R3IH 5AYUL 4X6EB 1ZV5A 3O4OB 5D70L 5GISH 5AZ2L 2P8LB 1TCRA 1YN6B 4PGEB 4GG8A 5FA4B 3ARBB 5HVHB 3KPRA 5CCKL 4FG6D 2OTPA 1U3JA 4CDGC 1SEQL 4S1QL 2Y23A 5ACMA 4UTAL 2DD8L 1B0WA 1UYWH 3BJLA 1XIWA 4D3CL 1VPOL 4GQ9H 2PKDA 4WO4C 3MV8A 1I9IL 1TJGH 3GIZL 1CDIA 5FCUL 2KBGA 3QPXH 1U6AH 3H9HB 1QBLL 3T4YB 3MJ7B 3FO2A 1K3ZA 3ARPA 1R0AH 3VE0A 4L5FL 3HCVB 1MVFA 4QTHA 3VXOA 1MFBH 4AQOA 5B39G 1MY5A 2HG5B 2FX8H 1U3ZA 1BF8A 2EKJA 3L1OH 3D85A 2PO6B 3NGBC 3ARFD 1D6VL 5DJAB 1J0ZA 3MLSL 1AHWB 2VOTA 3SDAC 2CIIB 2CKNA 1XF5A 3RKPA 4X5XA 4L3EE 1LO4L 1J9CT 1N2RB 3CD4A 3IU4L 2EKSA 4IOSD 5ELIA 2VR5A 5AZEL 1Z6JT 4HKJB 4D9LL 4QRSA 5HDOA 3TBVA 1T7ZA 4OLVH 3DX9B 1V7NH 4RMSA 1YPZE 2Y36L 2UY6A 4JHBA 1XCTB 1Y18B 2J1KA 5DRWA 2L0DA 3RNKB 1LEIA 5F88B 4QRRD 4J3UA 5EORL 2DWEB 3EYVA 1QR1A 2HFGH 1T83C 5EOTB 4NO0B 5BS0D 3H3BC 1DN2A 1YMHB 4WWID 1LQSR 2H8PA 1LEGB 4OLZH 2X4NA 3DMMA 5HHPA 4IRZL 5KW9L 4LLMA 1IGIH 5H2BA 4Y4FA 2OJEB 5C0BA 4M6OL 3WKMH 2CKBL 2NX5E 3T0EA 1ADQL 3FRUB 1P4BH 2ZP0T 1D9KD 1HHKA 4JO2H 1JGUH 4JEGB 3ULVE</