3LRHA

Structure of anti-huntingtin vl domain in complex with huntingtin peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
PVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords anti-huntingtin VL domain
total genus 27
structure length 109
sequence length 109
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrhA00
1B2WH 3BOVA 1FYTB 4OBRA 1T83A 3T04D 3VDBA 3BPOC 3TNNB 4WEBL 2QBWA 2H45A 4OKVB 4OUUA 5DRZA 2ZOLB 3FQUB 4C57C 2Z4QB 2DQCH 3IF1A 1GH7A 3PDOA 3HC3H 4LVOB 2HWZL 2AQ3A 4AG4H 3IDYC 5J11C 5CD5C 1N6QL 3U9PH 1FV1A 2BVTA 2ZSVB 2XN9D 3P0VH 3QQNA 1RUAL 4OF8A 1KEML 1IL1A 1JHTB 2UUDK 4JY4A 3KYNB 5FGBA 2BNQE 1JFQH 3P9LA 2LE9A 4W6YB 2PW1A 2V9RA 3B9KC 5DK0A 5BVPH 4YDIH 3PGDA 1KIRB 1DLHA 3B5TA 3GRWL 3KLHD 2CJUH 3O2DL 1QQDA 4WU5A 4XBEL 3GI9H 5C0NC 1MPAH 5D93C 4DFHA 3MA9L 1WQVT 2GSGA 4NQDA 7CGTA 4WUUE 1AXSB 1I1RA 3AM8C 4H0HB 4ZUUB 2F19H 4MA1C 5I1EL 5HHXL 3GMRA 1G1CA 4P46A 2ZJSL 2XTJC 1N0XH 3DX7B 3ZKXB 2FNBA 1MQKL 4JQIH 4YAQB 5HPMA 2Y5TB 4X4XA 5GS0D 3T3MF 3EOBB 1KCSH 3GSVB 4K8RC 4PUBH 5J9PB 1JWMB 3JV5A 3X11B 2ICWI 4OTXL 4XVTL 1JF1B 5F7FA 4NOBA 3HCVA 1FE8L 3FQXA 3LSOA 1YN7B 3T1WA 3UTSA 2E7MA 5EWIH 1KPUB 3QUYA 4S1DD 1TLKA 4PJDA 3EYQD 4UTBH 5LCVH 3IDMB 2BY0A 2E9JA 1R5VA 2XN9E 2GW5A 1NUNB 5D2NE 3CFCL 5A2FA 4JHBA 4KZDL 1E28B 3ZZ1A 1BVKA 3AREB 1KXTB 1QKZH 2RCSH 4ZUWB 3EHBC 4G43A 3K2UH 5FGSA 3OKDA 2BDNH 1MVUB 5I1HH 4PGCB 1AO7B 1BQSA 2AKRA 2EEDA 3FONB 4PJ9B 3JBG7 1S7SB 1JK8B 3SY0B 1I3VA 4NJ9H 2F53B 1ZWIB 3QRFM 1N2RA 4EQ3A 3WS6A 1YMME 4OB5L 4HH9A 1OWWA 3BPNC 4EN3A 2QEJA 1NSNH 2VR5A 1CXLA 1U92B 4NZRH 1KN4H 5CZVL 4L3CA 4U3HA 5D7SH 3HRZA 4TSAL 5FHAL 2HTLD 4NZDA 4ODXB 4PJAB 5HGHA 2XWBA 5INDB 4ZTOL 3BGMB 25C8H 1CF8H 4K94L 5BCAA 4M5ZH 1RFDH 4NO2A 5DVOA 4M6OH 3TEUA 5DFVC 1KFAH 3KPNB 4Q7DA 5GGTH 2EC9T 5EO1B 1FDLH 3SE4A 3S96B 2PN5A 2VUYA 1NCCL 4AEIL 5DEZA 4TPRL 1ES0B 3NH7L 2DD8L 2DWEA 2B39A 4P5KA 4L9LA 1TNMA 3U6RA 1S5HB 2DIJA 1S3KH 4HWNA 4HW6A 4Z7NF 5C0BB 1XCQB 2NY4D 3VG0L 1SYVA 4E42B 2OR7A 4P23C 2JELL 4MJ4A 5KSAD 3EOYG 5GRUL 3RUGA 1BOGB 4GAJL 1TXKA 3QUYC 4KZDH 3O2VH 5FOJA 1C5BL 4GAGL 2AEQH 3GBNH 3WKMH 4N8VG 3T77B 2A9MH 4RIRA 3U4EA 4MAYD 3SO3C 4J12A 4JFHE 1IGIH 2RR3A 4EOWL 2BY1A 5IFHH 4JDTL 2LAAA 4KMQA 1HH9B 2YA1A 4JKPH 3VXMD 5JHDB 2C3WA 3BEVA 1TQBB 1K4CA 3EUUA 5E8DL 4OLUL 2YZ8A 4QXGH 5A2JH 5E4IA 5D5MB 1ZANH 4Y5YB 4YK4B 4AZ8A 4JVUA 3PQYB 1Q0YH 5IB2B 2OXGA 5I18L 4XVUD 1KBGL 2VWEE 4MSWB 1A6PA 4JDVA 2J8HA 2O5ZL 5GJSH 1JHLH 4ZOAA 5IFHL 2FGWL 5JA9A 5DDHB 1UB6B 4JO1H 3FMGL 3DXAB 3JWDL 4ZG1A 2OJZH 3QIUC 2X4UB 4JO2H 4APQC 3GUTB 1Y6MR 4F7MA 5L9DL 1WC7A 3I6LE 3DETC 1F2QA 4WUKH 3VFUB 1BVKB 4POUB 4JZOA 1TVBA 1DEEB 3I84A 4ZPVA 4CADA 3RY5A 2QLVB 2FX9L 4PREA 3K46A 3MBED 1WK0A 4BFEA 5HHMD 1N4XH 5M95B 1UENA 3MLUL 1CYGA 4MXQD 4EJ1C 3JTSB 2X9WA 1AP2A 3S35X 3O4LB 3LHPH 5AYQA 5HPOA 4P2QB 4N0FA 4U6TA 3QDGD 1HNGA 1N8ZB 4WTZG 1LDPL 4QHUB 1H3VA 4KVCL 1WTGT 2Q7NA 3FO1B 4HPOH 2Y7QB 1M4KA 2HT4C 5E2UL 2IWGA 1P6FA 4NFDA 4I0PA 5HGDB 1U8MB 2NXYC 1RZIB 5INDA 4EDWL 4ZTPH 4R4NC 4ELMF 2WBJC 1V7NL 1MIMH 4YJZL 4Z7WB 1CD1B 1CD0A 3UP1A 4CVUA 4Z78B 3ZDYF 5I1IL 3GIZL 1A22B 4NQEE 3S37L 3ARBA 4HIXH 1JF6A 5JPMA 2Z93A 1MCHA 4YHYB 5CIPH 4XH2B 3ARPA 1QRNE 3SDDB 3UPCA 2R1YA 4JCMA 3NIDE 5CJQH 2VQTA 4XMPH 1NGQL 4J4PA 3V5DB 5DURB 4JO1L 2HLFD 5GRYA 3WD5L 1VACA 4JRWA 5CEYA 4PP1D 1CGSL 1VKXB 4OM1H 3MX0A 5C92A 5DO2D 1P4LB 3TV3H 3SBWC 1IBGH 1ZGLB 4GBXC 1CDYA 3T0XA 1ZEAH 2CDEB 2VC2H 4UI2A 1OAUH 4JZNA 2AK4B 3M17B 3PGCA 1WFNA 5EB9A 4GOSA 4PJEE 3L3JB 4DGIL 3GHBL 2BC4B 2HT2D 2EO9A 4HWBH 5KVDL 4L4TA 4N8VB 4YHZH 2V2XB 3T0VA 4U49A 3SDCA 4RISL 4DZ8A 5ESAB 3EYSL 4KMLB 1CT8B 4JKPL 4XVJL 3G5YB 3B6SB 5DXWA 1S9WB 5CEZE 4LCCA 1XGPB 1N4XL 4MCZA 3MA7B 1BLNA 1RK1B 2AXGB 1UACL 2ITCA 2MHAA 2YD7A 2Y9RT 4NWTL 4P2QE 5D5MF 1QLFB 2IAMA 3BT2H 1IZJA 3LOWA 3MV8B 3WXVL 3Q6FB 4LKXA 4TTDD 1XZ0A 2OS7A 4WUUD 3RI5K 3ZTNH 3V6ZA 4HV8A 1EGJA 3LKOA 3WIHL 3DX9A 5GJTH 1P5VA 5ADPH 3QNYB 3ZYIA 3T0BA 1X4ZA 3TIEA 1JHKH 3BRGC 4FXGB 3F5WA 4PJXF 3SGEH 2WQRA 1PKQB 2GFBA 3DMMC 4OJFH 1IJ9A 1VGEL 2CDFA 1A4JB 1KPRB 4JRYA 1BBDH 4QT5B 4LRNL 4Y4KB 1OM3L 5CP3H 3RUGF 1XF2B 1UXWB 3GK8H 4OZHE 3JWDH 2XICA 3MC0A 2PYEE 3DUSB 1CI5A 3T4AA 2W9DL 5ERWA 1M05B 4K9EH 1VFBA 4MA3B 4A6YB 3HRZB 4JFFE 3HHRB 1EAPA 2J6EH 5EDXA 5I74B 3KPQB 4UILH 1HIML 4X6EA 1NCWH 4BFGA 3KWWA 2HFTA 3O6FA 1B0RB 5DJXA 4ZTOH 3QDAA 4LOUD 5EOQH 4PJCE 1ADQA 1KF9B 3GSNB 4XB8A 4DW2H 1A4KA 3SBWA 3S97C 1OW0C 3I75B 4NQUA 2YUWA 1RHFA 3BQUB 4XVJH 1E4KC 3TIDA 3QIUD 5KZCB 1S78C 1CFQA 1K5NA 2DQFB 4HMCA 5C0GA 3LN4A 3QNXA 2Q76A 2JELH 4Z76A 4B41A 5DZOA 3GIZH 3L5JA 2V7HA 4I3SH 1CU4H 1DDHB 5DR5L 4PJIB 2J88L 2R1WA 3UC0L 3X13A 4PYGA 2Z93B 5JIHA 4QRRD 2HKFL 4N0YL 4KPHH 4KU1A 4LNRB 3QAZC 3P73B 5ESQA 1A7NL 3HZMA 3MRIB 4ZFZB 2WP3T 4B7IA 5I15L 1BZ9A 4X9GA 3QH3A 4H1LB 1A9EB 3PXHA 4G8GD 4AH2A 1N5YL 1R0AH 1IC7H 3R0MA 4GRMA 4IMKC 4N8CL 1U8JA 4P2RD 3QWOA 3FT4B 4ODVL 5CD3B 5A16B 1PQZB 4IMLB 3V95A 1T21B 4APQB 3OB8A 4PRHE 2XACC 1U3ZA 2DWDA 4WFFE 1AO7D 3G5XA 3RBSA 1RURL 2W0FA 5DD3L 1VDGA 4B50A 1LK2A 3VI4F 1U91A 1RHHB 3LV3A 3T4YA 5FGBC 2J12B 5EG6C 1M1SA 4QOKE 4K3EL 4NQED 4OLYH 1KYOK 1TQBC 2ZOKB 4OCWL 4K7PL 5BRZB 5FGCE 3FCTB 3HC4L 4HZLA 3D25A 3MV11 2X7LA 4CVZB 2EYRA 1P84K 1ES0A 3BE1H 4WI3A 4XNXH 2BVOB 3GMQA 1RUAH 4QHLA 5H35B 3UJJL 1QEWB 2F53E 1ZA3B 2XWJA 4LAQL 2PKDA 1DJSA 5JR1H 4HGWA 5D4QA 5HYJB 3P4OB 3EOBA 3OTTA 1QLEH 3OAUL 4X5XB 5DI8B 1MFNA 5HY9B 5C0FB 1S7VA 3BJ91 4XPFH 4XI5C 3IFLL 3O0RL 4UOW0 3LQZB 4L5FL 3B9VA 1NUFA 4ONHB 1UWGH 3VI3F 4N5UA 3STZB 3CFEA 2HFFA 3RX5A 4HS8H 5IM7A 5FO8B 2OZ4H 2ZCHH 4F33A 1KPVA 1OSZB 3H9SE 4YWGH 3VWKB 3QRGL 2DM2A 3E3QE 4KJPD 1QLRA 2FATL 2GJZB 4YE4H 4M3JA 2F15A 3JTSA 1EEQA 5KJRH 2P24B 2P5EB 3TT3L 4PRPB 3IU3A 1HSAA 3MNVA 3NIFE 4FXKA 5JW4M 1CGUA 1QSFA 1S7WA 3HC3L 5JXEC 1OB1A 3SDAD 3V6OA 1XR9B 3G6AA 1RJYB 1QRKA 4GMTH 4Y8AA 4KROB 2MCG1 1N2RB 2VDKL 2JLLA 4HH8A 4NQSA 3FB7A 2AI0L 1UH3A 2CO6B 4P9HL 4W4OC 3IDXH 2BSRB 1KENL 3PWLA 1Q0XL 1S7RB 3KNBB 3MUZ1 4M8QA 4F7PB 2DB8A 1AKJB 1X5YA 3WBDA 4KK5C 2HG5A 2F74A 1MI5B 4TUKH 4LEXL 2DI8A 4PYHA 1VPOL 1G7QA 5IB4A 4KV5E 4L8SA 1UQSA 4UQ2B 4UV4L 1D5ZB 4WW1B 3ULUL 5HHOE 3QUKA 4OFKA 3P4MA 1D6EA 1MCKA 3RZCD 4XBGA 2MKLC 4HBCL 5T1KD 4Z0BL 1DN2A 3NA9H 2D9QB 3UTZB 4BKLA 4JRYD 5F9WC 3ZE1E 4DZ8B 1RULH 5DHYB 4FQXC 1RK0A 2OR9H 4UQ3A 4WEMB 4YR6A 1OWRM 4Z7NE 3GDBA 3O4OB 4NQDD 1ZSDA 1CDUA 4GG6F 3LEVL 1CCZA 3AU1B 4R96A 3GBMH 2VZUA 4WHTA 1J8HE 3PJSB 4ODWA 1IGFH 3QI9A 5JUEL 1MJJB 2J2ZA 2XNAA 5KTEH 2NPLX 4U6XB 3DVNA 5F89B 3KJ6H 3LN5B 4JG1H 1MLBB 1T5WA 3T77A 3U4EB 4DK6A 4XPBH 4NBXB 5EIIA 4TYUA 5CUSL 1G9ML 1LK2B 4R4BA 4MA1B 3WFDL 3WO4C 2L4OA 3MROB 1NC4D 5ICXA 1NGYA 5E03A 1FCGA 4MX7A 3FMGH 1PLGL 3RU8H 1A7OH 2WZPD 5FYJE 1JV5A 2R56H 1DBBH 4HQQL 5DC9B 4HGKC 3D2UB 4NUGH 1UXWA 5KAQG 4KKAD 1PY9A 4D3CH 4KGLA 4MSWA 1JYWA 4JFPA 3IFOB 2XRAL 1JYVA 2XZCH 1U8OB 1RU9L 2CRYA 1OAYH 2EDTA 2QADB 2ZWLT 4Y5YA 4A6YA 1Z9MA 4XXDB 3TN0C 5JPNA 3VJ6A 3IXTA 2IQ9H 1EHLL 4Z7WF 5B39B 1GGBL 2QQKH 3TJHC 3VU2A 1C16A 2YD1A 3D0VA 1QQDB 3VH8A 2B2XH 1JGVL 4RGMB 2BNRA 1FNAA 1ACZA 4LLUA 5MEPB 2YD3A 3GHBH 1PVHA 1EBAA 1ZHKB 4Y2OA 2AJUH 3V6BR 1ZT4B 3EHBD 4D8PA 1CICB 5HHPB 1U42A 4P2RA 4QWWC 4S0TD 1XH3A 5HHMB 1J0HA 2ATKB 5CP3A 1P1ZB 4APQD 1HE7A 1DQLH 3LKOB 3O2WL 3U7AA 2DKMA 2H2SC 3KLSA 1BQHA 1HKLH 4IRSB 5EBLB 5FO9B 1AHWB 4S1DC 5F3HB 4U6VL 5D7JA 4YNYB 1YN7A 5B4MC 4P59H 1V3KA 4U7SA 1J0IA 2BOBB 4FFVD 5B4MD 4HKXB 4KJWD 5E8NB 4C56A 1MI5A 5GSVB 1T20A 2XY2A 3KYAA 1VCAA 1FZOA 3QHFL 2VABA 4P2OB 4HCRA 3NN8B 3U0TB 4N5EC 2K1MA 1WF5A 4OGAD 1H3PL 1AFVH 2PR4L 1VEOA 1BOGA 5F9OH 4PGCA 1FSKC 2YKLH 4FFWC 1NKOA 5IW3A 2X4OB 4H5SB 2EIDA 4M5YL 1C5CH 3DGGB 4PGDA 4UIMA 4X6EB 3SGDH 2P4AB 3CU7A 4HIIA 1IAKB 2P8MB 1NBZB 5IMOB 4JO3H 2G75B 3VXRE 3WDHA 3GHEH 5DYOA 2CXGA 5JW3L 3EYUH 5IT2L 3BSZH 2VDMH 2ZOKA 4K3HA 3D3VE 3RGVD 4LU5L 1A7RH 1LNUB 3I50L 2X7LB 3KJ6L 4JG1L 4GKZA 2R2HB 3J8F7 4GRLA 1KOAA 4HK3N 1EBPA 4DKFH 2ADFL 2D7MA 4JREC 3OKMB 3KS0J 1IFHH 4O2CB 3RWGA 5C0AE 1S7XA 2EE3A 3SCMD 4X7TA 2QQLL 5CWSB 4GG8B 4PJFE 1N6UA 3KPTA 3CMOH 4XHQA 1MAKA 1YY9C 3LQZA 4JKMA 4YWGL 1CG9B 1G7HA 2J6EL 3QCVH 1A6ZA 1I3RB 1NCBH 5J6GA 1SYSB 1HINL 1J7VR 2NY5C 3D39A 4MNQD 1XEDA 2X4PA 1F3DH 5E9DA 5AAMA 3K1KC 4ACPA 3JWOC 3QRGH 5TE6L 1FGVH 4QHKI 5FUOH 1RU9H 4JREB 4ZSOE 2MHAB 1KLGA 2A6DA 1I7TB 5B38G 4AMKH 5T1MA 1P7QA 5IHBA 1JZ6A 1B3JA 3KYKL 2ZPKH 5FYJU 1TETL 1X6LA 4OCLC 1FNFA 1BVLB 3O2DH 2HFEB 4MGXA 3U48A 3D3VD 5HI4D 4X0KB 4X98A 5I8OH 2Y36L 3F58H 4RSVA 5ADOL 3VI3E 3Q3GB 3MLTB 1WIOA 3FRUB 2ZNWA 3U7WL 5CJBA 5D7IE 5HXMA 2EO1A 3VDCA 4PIRF 5DMGD 1JI1A 3G9AB 3SQOL 2YR3A 1UYWL 3TZVC 4O9HL 1NPUA 2AEWA 2EDJA 2VSCA 4U0RB 2HAZA 2X4SB 3C5ZD 3RPIA 2FSEB 4X83A 1S8DA 2CD0A 4WW1A 3AAZA 2Z8WC 4D0DB 3GGWA 4K94C 1MJ7H 3GKWL 4DZBB 1PYWB 4Q74A 5GZOD 2NTSP 3DYPA 1LDPH 1B4JL 4OZGA 2H1PH 3THMH 2DS4A 2R8SH 2GTZB 4MNQE 4XCYB 1RURH 2DJSA 3QG7H 1NAMB 1XGUA 4MD4B 3RFZC 5BW7C 5F93C 1G7LB 3BP7A 1YYMH 4Q6IC 5I16A 2C3VB 4ZXBC 3IFLH 1HHJA 3SKMB 4I77H 4ZMAT 2IALA 8FABB 2LU4A 2OTPA 35C8L 4XVSL 2HFGH 3VMNA 3ZO0A 4GMSL 4Y2DA 2IPUK 5ICYB 5IG7A 3C87A 3OG6B 4D9LH 3ZE2F 1MHPH 3DO7A 4AQOA 3WFDH 2E6PA 2IFFL 1MWAA 4FQJH 4OB5H 2WWMC 2BK8A 4Q6YA 4R2GC 5K9QI 1R6VA 2NY1C 2FO1A 2QJDA 2VDML 1BM3L 3I6GB 3LKRB 1YYLH 1XGPA 1H5BA 5DSCB 4Q9QL 4UV7L 1QD0A 3ROOB 1INEH 2R4RH 5IHLB 4JFXB 3UYOD 4P46D 2DWDB 5I2IA 3PWJB 3MRGB 1M7DA 3U0WH 2FJHA 2VQ1B 5DD0H 3PGFL 4M1GH 1F6LL 5FFLA 3P11L 3U36B 3H8NA 1RJZA 4G8GA 5I15H 4EI5B 4IDJH 1IEHA 2GFBB 2EIEA 2CDFB 4IEFB 2FEDC 4CVZA 3DV4B 1T2QL 4EOWH 5EUKA 3WFCL 2VR9A 3TJHD 4UINH 1I9IL 2Q1EA 3TBYB 1MWAL 4RX4D 4J3WA 4XNQA 3RVTD 2W9EL 1I7TA 1D5IL 3FO9A 5HD8D 1F00I 5FECB 3VXNA 5T1DH 4X8XA 4QRQA 3MA9H 3S98A 1GGCH 2WINA 4RWYH 2RJMA 2CUHA 2VXQL 2CKBA 3I3BA 5ADOH 1CT8A 4LPUA 5H37H 5BJTA 3G5YA 2Y06H 2FCBA 5C3LD 5GJSL 5TH2A 2OTWB 4QGYA 3ILQC 2LTQB 3CX5J 4KWUA 4N90D 4LLDA 4KC3B 4X80H 4LK4A 2XPGB 5L2KD 1KXVC 3ARQA 3ZKNC 1TITA 5IHZB 3ZDXE 4HFWA 4JR9H 3QFDB 1PKOA 1OTSC 4JZJB 4NKIH 1A6VH 5ALBH 5FCUH 3EYSH 5I6XB 3RPIB 2ZCHL 2P24A 2ZKHH 1H0DB 4RMQA 2WIIB 1A3RH 4MQXC 1D7FA 2DQIH 3VG9C 3C9NA 1T1XB 2UWEB 4LHQB 3TESA 1U8NA 3MGTA 1NLBH 4Y0GA 4JG0H 4X6CA 3E3QC 3RUGE 3UTQB 1X5HA 1UJ3B 3ARSA 2BVYA 4HUNB 1KSRA 3S37X 4Q97A 2NY2D 4Z77B 4FFWD 5FO7B 5CCKL 3L7FA 4Y5VB 1NFIB 1Q1JL 5KW9H 5MHSD 2BZDA 3SE3A 4EN3C 4JN1H 2NY3C 5K9KB 5KOMC 1JCKA 4NQTA 5H8DA 4EKXA 3IDJA 3KPSD 4PB9L 1YPZB 1J10A 5JR1L 4QRPA 3RWHA 4OZFB 1K8DA 4K7FB 4ETQA 1MCCA 5C9KA 5I1CL 3TBWA 2PTTA 3ESVF 3FQRA 1B0RA 5DJXB 5FYKE 3WUWA 4PJ5D 1OARL 4NJAH 5TJWK 5CGMA 1A1OA 2E9WA 3QBTB 4KVNH 1G7PA 4NRZA 3CUPA 3V7AG 4HCRH 3VXUE 3HG1A 4B0MM 2P5WB 1ZHLA 25C8L 2VYRE 5IESH 1QFWI 2UUDH 3ULVE 4FFZH 1AD0A 1DUYB 2DBJA 4DEPC 1RZJH 3BQUD 5EZIL 2V2TA 3M8OH 3T2QA 2N7AA 5ENWA 3OAYK 3W9DA 2H6PA 1A14H 2D7PA 3TN0A 4AM0A 3IJYA 3UJIL 2MJWA 4X9HA 4UDTB 5IBTL 4CUCA 1KXQE 3MRMB 1ZLVK 1KLGB 2Z91B 4WI9A 1IAIL 1I1AD 4L29A 4U6XA 1X5LA 3ARGC 3KYNA 5FDWB 2F5BL 5ESQB 1QTYT 3AC0A 4X6CF 5T1KB 3ZE0F 3S5LG 4G6ML 4N0RA 1A9BA 1PY4A 3PQYA 1PZUB 1EZVY 1IAKA 2P8MA 3OPZL 4NO5B 4I13B 5E6IB 1LO2L 1HQRB 1VA9A 3SGKA 5GGQL 1A6TB 3NFPA 4J3VA 4JHZA 3RAJH 2FL5B 5FA4A 4M7JL 2VWEC 2A9NH 4OLVL 1MCIA 3B9KA 2NXZB 3MV9D 3WFBL 2A73A 2AEPH 2ENSA 4Y2DD 3H7BB 2X1OA 1EJOH 1OGTB 1JYNA 5EO9A 3MFFA 2XQYG 2VSDA 5C0DA 3KPOB 1OPGH 1IKNA 1MCLA 4X6FB 4F9LA 4GRLC 5CGYD 1BAFL 3V4PL 3QHZL 4RGMC 2A77L 5KJRL 2VXQH 2ZCKH 3FO0L 4PTUB 5F6HI 3RDTD 3N9GL 1AIFB 1EEYB 1TPXB 3MR9B 3V5HB 4E41B 1LE5B 4S1SH 1XF3B 1I9JH 3OR6B 3WS6C 3MUHL 3V2AR 4H8WC 1FSKB 1MFCH 1EJOL 2HRPL 1A5FH 3WXWH 5CZXD 3T3PF 3U30B 3P4OA 2R0WH 2DYPA 3UX9B 2BNRB 2IALB 8FABA 3K7UA 1P4IH 4NUJB 2RHEA 3QJFA 3KG5A 4R0LA 1YMHA 2ESVA 4G43B 2VDPL 2E3VA 1P7KB 1RZ8A 2GYSA 1ZVSB 3O4LD 4X7EC 3LKPA 4IDLA 1KN2H 3ABZA 3WE6B 1X6NA 2ZG2A 4WWKB 3ARYA 1IKNC 3WIIH 4C55A 2NMSA 1A8JH 1IAIH 5JOFA 1FZMB 1U3HC 4X4YB 3NN8A 3U0TA 4TSBL 1M71B 1UC6A 3IFPA 3MBEB 3TH2T 4JHWL 3NABL 1J9CT 1JPGB 1YPZF 1R5WA 3STLB 4CN1A 1FL3A 5GXBB 3MLWL 3QI9C 1S7UA 4JPVH 1IGCL 4OCXL 4QRPB 1EA9C 2YK1H 2ORBL 1NAKH 4XPHH 3EZJB 3SDDC 3WNNA 4EI6B 4RZCB 5FYLH 2DD8H 4U1HA 2CRZA 3IGAB 4DGVL 5E1AA 1TVDA 1MJ8H 3AB0C 1FNSH 5JW5B 1INDL 1QHPA 1NGWB 5ID1B 4ZUTB 1E6OH 4TRPL 4IRZH 1LEGB 4PJHF 3T0EE 4NZTH 4J3UA 1D9KA 2IAMC 3QPQD 5DJDA 5ITBH 1RZFL 2CIIB 3HS0A 1HYRC 1U8KB 5I8EB 4LBEB 3WNMA 3VGEA 4UMGA 3QCTL 1KYOJ 1CFNB 2VAAB 3MTRA 4O2CA 4V2CB 1C08B 1ZLUK 2DKUA 1GGIL 5I73B 3VA6A 3V6FB 3V79C 1MH5A 4WI5A 4ZNEA 1KB5H 1C7SA 1E4JA 1RUQL 1IQDA 1YMMA 1LNUA 3M8OL 3G08A 2M2DA 3BMWA 3O9WB 3JUZA 3OGCB 2IH3B 3PV6A 4UTBL 4HDIA 4BQBA 5DURD 3QIBA 4K23L 2DIAA 5JHDE 1R3HB 4Y1AD 2WINB 3HC0B 3Q6GH 3LS5H 4LPTA 1S5IH 3CSBA 2VXSL 3IJSB 3SN6N 3TO2B 2GT9A 4QXWA 1F90H 5IOPB 5K9QG 3GM8A 4AJ0A 2X44D 2E8YA 3FCTA 4HZLB 3RL2B 4XNUL 4WEUD 1K6QL 1WCBA 3B9KB 1GOHA 4ZUSA 2P46B 3AY4A 5H35A 4Z7OE 1A4JA 5MERB 3BI9X 2IANE 2VLRD 3EFFB 4DTGL 4WV1C 3RZCB 1KJ2H 1J18A 4ZUWA 2ZUWA 3DXAD 4NKMB 1HXYB 4WO4D 2ADIA 2C7UB 1I4FB 1T0NA 4PRBB 1I1CA 3DV4A 3MODH 4FQIL 3SY0A 3QUXB 4UTAH 4PY8I 4GW5A 4EBQL 1WC7B 2DI7A 5E6ID 2DN7A 5INCA 5LJYH 1YY9D 5H37G 4WWKD 1F58L 5L0QC 2FSEA 4P2OA 4JHAL 3CC5B 3KDMB 1BF2A 5LAXA 3OR7A 4HJGA 3S8WA 1U8IB 3VXME 5GIRB 3H9HB 3IKCA 5ACMA 2R0WL 4F7TB 4FFVC 5A2IH 4DW2L 1CXKA 5B39A 1MFDH 4YBQD 3ZL4L 3WSQH 4K7FA 3SO3B 4H0IA 1C16B 4QRTA 2GITA 2XXMB 4OIAA 4EUPH 1G0DA 5HYFA 4NO2B 5CBEA 1QACA 3ULVD 3HZKA 4RWHA 4HSQA 2UYLB 1AXTH 1T4KA 4ZUVB 3UTTA 5JOPE 2IFGA 1UKTA 2F54E 4GAGH 3RWJA 1Z9SA 3DO7B 5I1EH 5D2NC 3MV9A 5EC2A 5FDYA 4K2UH 3V4VH 4CU6A 3C2AH 3C6LA 1S78D 3OKEB 1LO3H 4M7LH 3P77A 4RMVA 1HWHB 3VFNA 4ODBD 4TNWF 4J3XA 4X7FC 2AEQL 3MSPA 1O0VA 4KAQH 3RAJL 2NXZC 3RUGB 5D2LA 5KSVA 1VENA 1HHGB 1PD6A 3BP6A 4PRIE 3V0WL 4FQHB 1VFMA 4IMLA 4IRJC 2M8XA 1SBBA 1YEGL 4KJYB 4C58B 5IMLB 5DT1L 4MJIB 3ZSSA 1OAXL 4B53A 5FYLE 5DUBA 2FHBA 5TE7H 1PEZA 1U3HD 4DQOH 3QIWA 43C9B 2F5AL 3QEGL 1YEEL 3H7BA 1H3XA 2IQAA 3RWHB 2JB5L 5JOEA 3QUZB 1JNLL 4UV7H 4M7KH 2VXSH 1V3LA 4PG9B 5KOVC 4K3GA 3MOBH 1CICC 4OZFG 2YKLL 3ARED 2E6JA 2RB8A 1MSPA 5EU7C 5IVXA 3N1QC 4JFHD 3O8XA 1KC5H 3MA7A 4NFCA 4UT7H 4XC3L 5FKPB 5FOBB 5B8CB 3MMEA 1WZLA 5FKAA 4BSVA 1QFUH 5GGRB 4WI7A 4PJFF 2H6PB 4AM0B 3TT1L 1KTLA 1HWGB 1YZZA 3PABB 4JN1L 4AIOA 4OZIB 3CZJA 2OTWA 1A6AA 4RNRA 3SDXA 3VXOB 3S4SA 4M7LL 1JGEB 3HLAB 5HHQB 1KIQA 3VWJA 3U4AA 3MRFB 2Y5EA 1QRNA 2P5ED 5J6GB 2VLJE 5DGQA 3UJIH 4KKCC 1FPTL 4MAYA 3CFKB 5LVEA 2GUOB 5CJXA 2G60L 2VKWA 5A2LH 5KVFH 3W11C 1MCSA 1CL7I 2BXZA 3E2HB 3BXNB 2BX5A 4FQPA 2VL5A 4K55A 1EHLH 2QR0A 4NKOA 3GB7A 2DICA 3UZQA 3UBXI 3VG9B 4Z0XA 1JPGA 1R5IA 2XZQL 4OZ4A 1GPOL 2DMCA 1BVLA 1YA5A 2FYYB 5E5RB 1MWAB 5KBNC 3DYMA 4ODHH 1GAFL 5HI3D 1CDHA 4OV5A 5FO7A 1G7IB 1LO5B 3RTQD 4PPTA 3L7FB 3SJVB 5IB3A 4MJ2A 1INQA 4X6CB 1RIVH 4M48L 3BQUA 3GSQA 3OF6D 1JTPA 4JN2A 2HP4A 3WN5A 4Y89A 3A67L 1IBGL 4EZMA 2VLMD 1BX2B 1LO2H 2YZ1A 5HTSA 3WLWC 4R7NA 4Y16B 4R97B 3R8QA 5F1SA 3OHXA 3HMXH 1SY6A 2V17H 4N9OB 3UAJC 2Y6SD 1P4LA 3S35H 2BVUA 3TO4B 3O3DB 1IGJA 3NCCB 3MNZB 2JE8A 2BC4A 4OT1H 1CBVL 1GIGL 4U1IA 5IB1B 4R7DB 3HZYB 4LHUA 5DD5H 2JIXD 3BGFC 3V7AE 4XTRD 1DVFB 4AH2B 2G2RA 3RWFA 1KN4L 1CFBA 1H8OA 1DP0A 3L5IA 3QDJA 4MJ6A 3H6JA 5F1OB 3VRIB 4JFEE 1ND0B 2NY2C 4PJ9C 2R39A 2YHGA 3E1F1 3F8UB 4LSVH 2BNQA 5EZJA 4ENEC 4LKXB 5IT2H 1PZ5B 2NY1B 1ZLSH 2IFFH 3ARGA 3LEXA 1Z9LA 3LV3B 1TFHA 2DDQH 5L2KA 4G42A 1KT2B 5KSUB 2VLKE 1YQVH 4GMSH 3TC9A 4JPIB 2A38A 1CDCA 1LK3H 2R15A 1IKFH 4POZC 1W2KT 4XP6H 5CHNB 4QRSB 1QFPA 1UH4A 4P2CG 5BOPA 3VJ6B 3LKSB 1E4XI 4K8RD 2ID5A 4LSVL 3OG4B 3RA7L 5HYEA 3CC5A 4JGUA 4GH7B 1F4XL 1WUNT 3BIKB 2WMPA 3QG6A 4CJ0A 3S3SA 1EAPB 2YPKA 4PJ9A 4BZYA 1QRNB 2X9XA 4MQSB 3C08L 2AK1H 3U2SB 1ORQA 4NDMB 4L9LC 3ET9F 3IETA 2WP3O 5C0AB 3ULUC 3QNZA 3NTCL 2AVGA 1I8LA 4UDUA 4DN3L 5IQ7L 1R24A 1JPFB 4U1JA 4XC1L 3MR9A 3SE3C 1LE5A 5GSRB 5ICZA 5JIPA 1ZANL 2WW8A 4Z7OF 4YDLC 4JB9L 1YJDL 3MV9B 4J8RB 1UKQA 2IBZY 5EC2B 2OP4L 3O6LL 3GRWH 2A83A 3PHOB 3ECBB 3O3BA 3MRLB 4WWKA 5B21A 3SKNB 5KG9B 1F3RB 5B3JE 2YUVA 4L8BA 5TE4L 1RZKL 2DBLH 3Q5YA 1O7VA 1ROWA 4I1NB 2EDRA 4LVOC 4QHNA 2NZ9D 1LILA 3E6FA 1HKLL 1OGAD 4PJ5E 5IHZA 4GRWB 1XGUB 5J0BA 1J0YA 1S7UB 1U8MA 3T09A 5EN2B 1VEMA 5ADPL 1Q9OB 3PHSA 2EDXA 4KJWC 4AY0A 4BK4A 1EO8H 1BBJA 1FFRA 1L4IA 1LE9A 4XP4L 3ZKQD 3T0DA 4U1GC 5TF0A 1FVCA 4R97C 3L3OB 4A2MA 5DYOB 2E6QA 1FNGB 1U41A 4FA8A 3IKCB 4LLAA 1RIUL 1TZGL 3MRDA 5FDWA 4RQQA 1GGTA 3RA7H 4ELKB 1T21A 4APQA 1HOCB 1RZGA 1QFWH 4LBEA 5KZCD 1QRND 3V0VA 1SY6L 3G5XB 1U91B 3AY4C 4XNYH 4PJGA 2JJVA 3OBAA 3SGKC 1MCOL 2B1AL 3AROA 2PXYD 3KPPA 3HCVB 4YPGA 1ZA6A 5T5FH 3G5ZB 4M62L 5F88A 4JM2B 3BDYL 1BM3H 3IDMA 3SDXF 4TOYH 5BO1H 1PZ5A 5L2KE 4MNHA 1DDHA 3ARGB 3FAXA 1KJ2L 5E9DB 2LVCA 3RGVB 4C83B 4HLZH 4AEIH 4Z8FH 2VITA 4N90E 4HEME 2VLKD 3GSUB 5I75B 4MHHI 2VDOH 3QPXL 3A6CL 1BD2A 4HG4J 5HDBE 3JTTB 4R90L 4ZS6D 4Y4FD 4LNRA 1CE1H 1S9YB 3L3GB 5CBAB 1AY1L 5E2UH 1NMBH 5JW4Q 4NQVA 4HT1L 3FO2B 5HD8C 2EECA 1NKRA 1T0PB 2GT9B 4GRWE 4O2EB 1RUPH 4P23B 3RJDA 3WJLA 5DK0B 4L4VD 4LFHG 3MLRH 3V52L 1BD2D 4PB0L 2HVKA 4BSWB 1FVDA 4EI5D 4QXUL 1A6UL 3IYLW 1JBJA 1IGCH 1MEXH 2X42A 4LMQI 1DL7L 3RDTC 3IU3B 1H8SA 3S36X 3RWCA 3GSXA 1T0NB 4RIRB 2IANA 1FE8H 4N0YH 3CK0H 3UMTA 5FYKH 1WEJH 2FIKA 4NDMA 1ZHBB 3R06B 4WNQB 5J7CC 3IETB 4QRUA 4TNWK 4WHYH 1KCSL 1CE6A 5HI3C 3PP4H 3SE8L 2MQ0A 5EZLB 5CEXB 3SKOB 2X4RA 1JF1A 3FTGB 2XPGA 4KDWA 5EO1A 2Z31A 2AABH 4WENB 3GSQB 5E2WL 1XGRB 1NEUA 5EU6B 5T1LD 3WXVH 5HGDA 2QKIB 3HUJA 4OZGB 5DT1H 3LQAH 2JJSC 3BESR 3VGFA 5IB4B 4U3CA 2IEPA 4Z78A 1D5BA 1RZKH 1D5ZA 1IM9D 3HC4H 5DHVB 1XIWA 2O5XL 5C3TA 1KUMA 4CKVX 3QUKB 2ZKHL 3D0LA 1CD8A 1JHKL 3TP4A 1FFNA 3RVVC 2C4XA 3TH4T 3ULUE 3EYFA 1WV7T 1ACYH 2MOVA 4PLJC 4GT7A 1X7QA 2P43B 4ELME 4CMMA 4S2SB 1CVSC 5AZ2L 1BFSA 2AXHA 1KJ3H 1QO3A 1YPZE 3U1SL 3O0RH 1YEFH 1JZ7A 3MRQB 1FO0H 1KIPA 2H8PB 1NBQA 3P2TA 3U4BH 1I1YA 2V5MA 3VRJB 4WFGE 5C70A 1ZGLA 4CN4A 3VXUA 2XA8L 1TQCC 3LMJL 2O5XH 3RWEA 4PY8J 1A3LL 3QDHA 4M03A 1Y6KR 3TFKD 5DRNB 3UTSE 5CZVH 1AXTL 1QSFB 5C08B 3DVNB 3TFKC 5DHXB 2HJLB 1RJYA 2YN3A 2FBJL 4OUUB 2HJFB 2Q6WB 5ESAA 4XNZC 4HIEA 4MJIA 1I3GL 5I2IB 5DQJA 5L2JA 5CKAA 3QDMB 3VD3A 3CUPB 5FM8A 5D70H 1KELH 5FYKD 4WTZA 5C0BD 1KB5L 4JPIA 2J5LC 5ISZA 3EOAB 2BSED 3L9RA 2JK5A 3DUHA 3NCBB 5LBSL 1CFSB 3HN3A 1AGBB 4FNLH 3CJJA 4PTTB 3H3KA 1RZIA 3MRBA 5BV7H 2F74B 2D0GA 5IVOA 2GY7B 4LSRH 5E94B 3EDJA 2HLAB 3BEWA 4X6CE 5EUOF 4HCRL 5ISZD 2DQJL 5E6ZA 1LHZA 3H9YA 1CDBA 1X5KA 4NQDB 2L7UA 5BRZA 4CNIA 4YHZL 1MJ8L 3QIWD 5DLML 5C0ND 3T3ME 2VRAA 2W38A 1GC1L 5T1KA 3VXNB 3H9ZA 4OTXH 3MRRB 4Y1AA 4LHUB 2ED8A 1J1PL 2QL1A 4P4KA 4O2EA 2DL2A 2EXYD 5I1AB 2YWZA 2GJ6E 1DZBA 1UVQB 5K9OA 2O5YL 3QCTH 4WHTB 1ZTXL 2PO6A 3CNKA 1KB5A 5GIRA 3EDKA 1NC4B 3VFTA 1MLCA 1NDMA 4DN4L 3BZ4B 4ZO7A 5D2LE 4KJPC 1U3HB 1RUQH 1H3TA 1MLBA 1R3HA 5C0DB 4NNPL 3SGEI 5FAAA 3T3PE 1GXEA 2P7TA 3FB5A 3QDGE 1DCLA 3BKCL 5L8LB 5ALCH 4PRHD 3O11A 1HHIA 2I07A 2O5ZH 1OD9A 4IOIB 4BFIA 4NN7C 3LZFL 4PGZA 4PJ8D 5FO9A 4Y2DC 1MF2H 3VFMA 1QSEB 4XCNB 3HE6C 2HTLC 3HUJE 3CDGA 1PG7L 2DQIL 3QCUH 5EN2A 3THML 1F13A 4L4VB 5KSAC 3CVHB 1TVHA 4P57B 4HF5H 2FR4B 4H8WL 5JMOC 3I9GH 3QZWB 5D1ZB 2F54D 4DUWA 4MWFB 4XVTH 4PJIA 3BH9A 1CGVA 1Z9OA 4NKMA 2PO6C 3N1MC 4I48A 5DGRA 3GFUA 3FL7A 5FIEA 1I7UA 5DJZB 4F7PA 1X7QB 5EWIL 5BOZG 4XPAL 3ARDB 1HOCA 4LGPB 4PLKC 3ZE2E 4PJXE 4YHMH 2QHRL 4M1DL 4Y4HD 5GJTL 3VWKD 1JNNL 4FQIH 2D4FA 4K9EL 5E0QA 4P46C 4K3DL 4DKFL 4XPFL 3C8HA 2LU3A 1VFBB 1GL4B 2W0LA 3H3PH 1CICA 4LOUC 5HHPA 1F11B 5J1AA 1VGKA 3SJVD 1YEIL 2X4QA 2X70A 3TPKA 1FG9C 4UOW1 4XC1H 1I8KA 1CQKA 4PD4J 4F58L 5EU4B 3I6GA 3P40A 4B5EA 2ZUXA 1PKQE 2DOCA 2UV3A 1I9IH 3FHQA 5DJDB 5DJ8A 2NNAB 5FUCC 1KULA 1ZGLP 5BQ7A 1KEGH 4Z7UE 4AEHH 4NO0B 5DJ0A 4W6WB 4GXUN 4TSAH 5DMJB 5DRZB 2QSTA 5EU6D 4XRCA 5KVFL 4PJ7F 4JAMA 4XH2A 4XAKE 1WEJL 1Z0MA 1GOFA 2PNDA 2FLRT 3KR3L 4Y4KA 3TJEH 1J8KA 3W9EB 4ODVH 4LHUD 5FB8B 1DQDL 5FV1L 5H2BA 1G9EA 4HWBL 2YRLA 4K71C 3DSFH 3OJ2C 1KT2A 3L1OH 1HQRA 5J4MA 4HDIB 4MAYC 5DJAA 1QSFE 3WYRA 1GOGA 5BS0E 3LB6D 3I9GL 1DBMH 2HFEA 4P4RB 4U1NB 3G6JF 1GGIH 1FZKB 1DBJH 3ULSB 4ONGL 4HD9A 5MENE 2A2QT 2O5YH 1CR9L 3MLXL 2YEZA 1F3DJ 3REVA 2EDKA 5EOCL 4DN4H 4URTB 43CAA 2R69H 1IGYB 1P84J 1URLA 2PYEB 4YPGB 1R5IB 4Y1AE 2R2BB 4I0PD 1FIGL 2D2OA 4IIQC 1MRFH 4OCNC 5DMGC 4CVXA 2YPKB 3FFCA 4YK4C 3UO1H 1WAAA 3EO9H 4OD3H 5DS8B 3L3HB 5JORB 4WFEE 1WJ3A 1NGXB 3X12A 3IU4L 2YPLD 1HHIB 3VW3L 1OLZA 5C0RH 5E6IC 3UROR 2KPNA 2N1KA 4NUJA 4NRXB 4CAGA 3HR6A 2Z0BA 3B5HA 4ZSOB 2VLRB 3HKFA 2JJTC 3G6DH 4UT9L 4F58H 4YHKL 3QUMA 3QUYB 4P23A 4M8VA 5D9SB 2RFXA 1EO8L 1QZ1A 2VDOL 4UU9B 1BGXH 4OCYL 2W65A 4RGNC 5IK3A 5CCKH 1Q9WB 2PYFB 5HYQB 3H9HA 1T1XA 2UWEA 3BD4A 3ORJA 2A6KB 2ERJC 2R56L 3HI6L 4RA0C 4GO6B 4EXKA 1F6FB 2ZNXA 3UTQA 5F9WB 4ETYA 5EBMA 5EFIA 4F9PA 5J56B 3OAUH 5JXED 2ZG1A 4XPBL 4FNLL 1I9EA 4XMLL 4N68A 5FHBH 2A1WL 2JCCA 3ZHDA 4GKNB 1QSED 3EOAA 3DVGB 4LLQB 3D85B 3I6KA 4PTTA 5BZWB 3LN9A 4G9FD 3T08A 1INDH 3B4NA 3ZKMD 3PV7A 1LP9F 1DSFH 3SDDA 1CLCA 4I2XB 2FATH 4KDTA 4HXBH 1J0ZA 3O45B 4O51A 2ZCLH 12E8L 4G7VL 2FECL 1A1NB 4PJHE 1NLBL 3F7RA 4NKQB 4QY8A 4OF3A 4YFLF 1XCTA 4ZFOB 4KHXH 2ESVD 3SJVA 2VUOA 1I7ZA 1IGTA 1MH5B 3ZDYE 4CNIB 4EI5C 2IC2A 1KEGL 4FZEH 4CDGC 4DGYL 5CZKA 4R6UA 4Q6IB 3S96A 4RISH 2DWEB 1JZ3A 3D3VB 1LDSA 4DOHE 3CMOL 3FB8A 3I2CL 2V5YA 4LGSB 2DQDH 2UY6A 4ZFZA 3PQYE 3RKDC 1KJ2A 4J3TA 4NO3B 1IZKA 3HR5A 1S5IL 1P9MA 5ESVA 5AWNL 1J11A 1XF5B 1JZ4A 3V0WH 1OTTC 1S9WA 1YEHL 1G9NH 4ERSL 3ARFD 4P5MB 2Y06L 4Y88A 4CRPA 2IAMB 4AEEA 4QRQB 2BMKB 4OCYH 4JM2A 1PQZA 3WIHH 1BIIB 4Z7VA 4MDJB 5E8OB 5GS2D 4HIEB 3W11D 5IVXE 3GMOA 5SV3A 4MQ7A 3MLXH 4DVBA 1T7YA 3WFZA 3IJHA 3MCG1 3PJSA 1H3UA 2KKQA 5DD1L 4DAGL 4D8PB 5IKCB 1QVOB 4EDXB 3KPLB 4KDVA 3OKLA 3SPVB 4HGMA 1GIGH 1S7RA 2EDQA 2C7UA 2F53D 2XTJB 1ZHNB 4UB0H 1X3DA 4PRBA 4QHKJ 1TCRA 4EUPB 5E2VL 1BQHB 1ZHBA 1FC1A 3CXHK 1A7BA 1T0MA 2EDYA 2EIZB 1CE6B 3MROA 3GMNA 5FUZL 1MFEL 1E6JL 2X1QA 5C1MB 5CEXA 3BYTA 3CD4A 5EA0H 3U46B 2DQHL 5TDNA 5KN5B 2DLFH 3GSXB 3GUTA 3VGDA 2RBLA 5DJCB 4TTDC 3GKZA 5FYJH 2YPLA 5E00B 4KRPB 1FL5A 3UTZA 1E4XL 1KPVB 5C0BE 1W8OA 3VFUA 1FG2B 1WFTA 5EZOH 4PLJD 2DDQL 5IHUH 3TZVB 3BGFB 3FO9B 3MLYH 2E7HA 2B4CH 3ZDXF 1ZK9A 4XT1C 2A6KA 1HYSD 4OJFL 5F9DC 1TPXC 4J1UB 5EU3B 3WLBB 4KROC 3PL6C 5F7DB 1DTUA 3OXSB 4ODXA 4PJAA 1P4BL 1JGVH 5HGHB 4N0CC 3QWQB 3BGMA 1XF4A 4XP4H 1GYAA 3P30H 4ZNCD 5I8CA 1R24B 5I75C 4JJHA 4CJ1A 3MRNA 5MEOB 2VJXA 4KV5F 5DJ8B 1T1ZB 3ALWA 3DV6B 1YMMD 5BV7B 2X5PA 4GRLB 3QB7C 1U93A 1QFWL 3R4DA 4P5TB 5HGBB 3Q6FA 2BJML 4P57A 1SMAA 3FOLA 3IGAA 5I17A 3PWUA 2Y1VA 3WDJA 5HHOD 3K2MC 2V9TA 3VXUB 3KAAA 3FHAA 1QBAA 3CFJA 1U6AH 2N4IA 3NACL 1KN2L 2DM3A 3AMLA 5JW5A 5SX5K 4LEOA 4ZNEE 2ITDA 4BQCA 4GRMB 3TNNA 3DI3B 5IVNA 5CBAA 1D6EB 4OKVA 1YJDH 5DJ2B 1TENA 2CLZA 15C8H 2C3HA 4RMSA 4Y7MA 4YC2C 5JW4R 4OF0A 1VKXA 3UTTD 5IF0A 4FMFA 5HI5C 4X5LA 1N26A 2OR9L 4KK8D 2UZIL 4G6JL 1W0VB 4IS6B 4P49A 5DF0A 3SE9H 1AGEA 4LMQE 1SEQH 5FYKU 5EO9B 2V2WB 3MJ7A 3M17A 4MDIA 1TJHL 4HF5L 5JHLL 2F5AH 4RBPK 4WU5B 2ESVE 5ITFB 2EZ0C 5FHAH 4P3DA 5JDSB 5J3HC 4RX4A 4FP8L 3QDME 4NRXA 1MF2L 1NSNL 5BQ7B 4JY5L 3K74B 4K71B 2ZZUT 4HJ0D 3JV4A 5HI4C 4XRCB 3OR6A 5DMKB 4BZ1L 1SJHA 2X4SA 3RJQB 4OAWA 4WI6A 2E27H 4ZAKB 5D7LA 3RZCA 1FN4B 2B8OT 5DEFB 5BVJA 3FT3A 3BVNA 4LLVA 5EU7E 3TVMA 4HUVA 3BXNA 3X14A 2HMID 1KENH 1UGNA 4NGHH 1YQ2A 2QQQA 5H94A 4JM4H 1XF2A 3U2SA 4JY5H 4XXDA 4OUOA 4A2LA 1IFHL 4M62H 3KPMA 3HZVA 3DUSA 1UJ3C 2DQHH 3HI5L 1QSEE 2R29L 4G8IA 2DLTA 2X6MA 5LGKA 4HJJH 2MWCA 4IDJL 5ANMB 1KTKE 1UACH 4KHTH 4QHUA 3CLFH 3ROLA 1A6UH 5I1DB 2A83B 3PHOA 4OZGE 2D03L 4LNVA 4UIKL 4BZ2L 2F8VA 2XZQH 4RZCA 2W0FB 1KGCE 1FJ1B 5F7LB 1OAXH 2DLGA 1QOKA 4JFQB 3IDYB 5EORH 4L3AA 4LSQL 4Y4KC 4K3JL 3GSNA 2MMXA 4BH8A 2ICES 4MHHG 4FABL 1NH6A 4PV9A 5C2UB 5GS2H 3GI9L 3ZTJG 1IEAB 4K7PH 4HS6A 3QIWC 1D5BB 4JM2F 1YEHH 4CGTA 1OY3B 4LARL 2F19L 1JMZA 3TM6A 4M6NH 4JFED 4QXTB 5DUPH 7FABH 4NRZB 4KK8C 4OLZH 5IEHA 3DROB 1NCDH 5F9AC 4LIQL 3SKJL 4R8WH 3P73A 2W9EH 2GIYA 3IDGB 3AUVA 1A6VL 4DTGH 2EXWD 3HZMB 3ARBD 5C0IB 1JPST 5LCVL 3TBYA 1WBYB 3ZTNL 3ZMRA 5EA0L 4BK5A 1M7IB 3OZ9H 5L2KB 4YE4L 5IG7B 5ICYA 4HIJB 1OT1A 5DJAB 3BT2L 1JWSB 1FAIL 4ENED 2J6EA 5MERA 3BKJH 1K8IB 5I76A 3KLHC 5C2BL 3LHPL 5IGXH 4NJAL 1CLOL 3QCVL 4PJ7B 1FNEA 2HT3D 4ZXBA 1BFVL 2EDNA 1FZJB 2QSCL 4G3YH 3UTSD 1I7ZB 3RZWA 5D6CA 1FH5H 1B2WL 5IP4A 5KSAA 4DZBA 3GSOA 5HDQH 3QG6B 1CIDA 1WBZA 4N5ED 4LGRB 1OSPH 4JRYE 3SDYL 5INCB 3WCYA 4TRPH 3NVQA 4OD1H 3QT2A 5MI0C 3U36A 1KTDA 3T4AB 1DBJL 1SJEB 3MACH 5F96H 3OR7B 4HJGB 2X1PA 3RVWD 1IGYA 3CXDL 2KL6A 5HY9A 5C0EB 4JEGB 4U1KA 1JGEA 1MEXL 2NCMA 4BQ8A 2F5BH 3U9PL 4ZYKB 1L6XA 2P1YA 4H25B 1JNHB 4XBGB 3ARDA 3KPRD 4QF1A 1T6WA 1UXSA 5F1NA 5DS8A 3CFEB 3NA4A 3W0WE 3KXFD 2ATKA 1C1EH 5JW4N 3WDIA 5CP7B 4HWZB 3CFCH 3L3DA 1T4KB 3X3GH 4TUJB 1BIHA 2FB4H 3P0YH 1VEPA 3HZKB 2PYFA 2APWA 4ZUVA 3UPAA 4KHTL 3FQTB 3RWJB 1CFVL 4KQ3L 4KRLB 1LO4H 4PLNC 4XBPB 5ETUB 3WE6A 2XIDA 1TCRB 3WUWB 5DHVA 2MCPH 3IDXL 1A6WH 5C7XL 1FFNB 2OMBA 4P2YA 3HG1B 3GBNL 4FOMA 3K4AA 4NQSB 3GGWB 2AK4E 3MV8E 3HI1A 3AM8A 4FQXA 5CAYB 2WSKA 2D7QA 1NCUA 5D1XD 1T5XB 1U8LB 3W5MA 1F4WL 3MO1B 2HG5B 4M43L 5IIEA 2WANA 4JAMB 4F7EB 1ZS8B 4UBDC 3VGHA 2V5SA 2WQ8A 4NZUH 1FL6B 3BHBB 1A1NA 4ZPTA 4H1LA 2VDPH 4R2GD 2FO4A 1T2XA 1U8NB 2AGJH 3OKYA 3QFJE 3MNZA 4E42A 5GHWL 4NQEB 1PG7H 2FH6A 3NCEB 4EVNA 2HH0H 5EUOB 2FGWH 5I8EA 1VACB 5CEYB 2XA8H 4TVSa 1EXUB 4XHJD 2ARJB 3BO8A 1DSFL 2VLKB 3NAAH 2GJJA 2IF7A 1RVFH 3JWDC 4RGNE 5LG1A 3OJVC 2J4WL 4BELD 2WUCL 5JDJA 3V4PH 5SWSD 4NNXA 5JZ7C 1K4CB 1INEL 4ZFFA 5E2JA 5J3HD 5BXFB 3BE1L 3QA3B 5GGSA 3HC0A 1OAKH 2DM4A 3B2VH 2ZOLA 4GSDL 2YPVL 1ODAA 3MV8D 3PHQA 2F8OA 1HN1A 5E2TH 3GMOB 1VFAB 2BOCA 4I3RH 4JDTH 1AD9A 4HS3A 1TZIA 3QQ9C 1L0YA 1I8LC 3QR2A 1NMAH 2ZPKL 4LCCB 3QI9D 5EBLA 3EJYC 4HUVB 1Q72L 1RZJL 4YNYA 1GZQA 3L7EB 4TUOA 4FQ2L 4U1MB 1W0WA 3F7VA 3MRFA 1AO7A 2X4NB 3PL6B 4XXCC 5FUCE 2XI9A 5D5ME 3BN9C 2AJXH 5MEQA 2BHYA 3CCHB 3B2UD 2R23A 1UA6H 2Z92A 2EIZA 2YSSA 3VW3H 3RX8A 2WLYA 3TIEB 3MLTA 3RX7A 4R0LC 4LASH 5IKCA 1OPGL 1UWXH 3G6JE 2CLRB 4OFYD 2OZ4A 4ZPVB 4GJTB 3MJ7B 2P7TB 3FB5B 1SHMA 1I1AB 5FECA 3QUXA 4XCCL 1MY5A 1D6VL 3L3KB 3DSNA 3ULUD 4YFLI 3BX7C 3RGHA 4OM0L 3D69A 1F4AA 3QFJA 3TBWB 1UJTA 3L3DB 3IDNA 1IE5A 4LLUB 1BOYA 5D72L 2OXHA 2VE6A 5IW6A 4XNUH 4KUCF 3UTPD 1IC7L 3QISA 4KTYA 3DVIA 3TLRA 5CGYC 1A7OL 5C6TH 3SKJH 4FG6D 4YFEA 5JW3H 3VH8G 1VB9A 5D1XC 1AKJA 3QIBC 5CFHA 4L4VA 2IPUG 4OLZL 2M26A 1JI2A 4MXWL 4HK0A 1BBDL 4R7NB 4I0PB 5SWZE 5JQ6L 1K9TA 5HHNA 4XVSH 1UZ8B 5DEFA 5BVJB 3OKKB 5D7JB 3KHQA 1CK0L 5M94B 4OGZA 4GG8A 4X7SH 3LRSA 1H0DA 1AKJD 1OAZH 5K59E 1T80A 2YD8A 4R2GB 4ZDHB 4HKXA 5C0CD 3H42H 2DQFA 4J3SA 5EOQL 3FB8B 4K7PY 3D18B 3K8KA 4L1DA 2DYPB 2HJFA 3N1GC 2HA1A 4HIHA 3ZKSD 4LFHD 4HXAL 4ONFH 1A2YB 1IQDB 4F37K 1U0QA 4NRYB 2I27N 5D2LB 1A64A 1KJVA 3B43A 4XAWL 4R96B 1IAII 3BUTA 5I73C 1B4JH 1JWSA 5T5NG 1N0LA 2W1NA 3CH1A 3PIQA 4WTXA 4S10A 2BNUB 5F89A 3H9SD 4PBWD 1QNZH 3PDOB 4H26B 3NIDF 5IMOA 2HLAA 2VXTH 4ETQB 4M1CC 1J5OH 3LQMA 1ORSA 4R4ND 4PJBE 4IJ3B 2DLEA 4RGOH 1YEIH 3QIWB 1G7PB 4WW2B 4YDIL 1FFQA 1N64H 1D5IH 2BCKA 2DTMH 3IRZA 4MCZB 3LKSA 3TBSB 4RFNB 2DYPD 3RIAK 1DQJB 2R2EB 4Z5RA 2Z9TA 3VG0H 5AYUL 4LSQH 3IAQA 5IVZA 1W0VA 3RGVA 3HE7C 4LKCB 3MLRL 4JFPB 2R0LH 5DUML 1RI8A 3V52H 1SEBB 4O2FB 3QQ4A 2QSQA 4QOKD 1W72H 5KSBA 2I60H 4Q6IA 5D7JD 2ESVB 2PR4H 1AGFB 1UXSB 1F42A 3ZKXC 4PREB 3A6BH 3TWCL 5CMAB 5HHVL 5DC0A 4G6AD 1AR1C 12E8H 4G7VH 5KS9F 1ORQB 2Z31C 3U0WL 3ALXA 5DLMH 3ZYJA 3RWFB 3O6KL 2NY2B 1RZ7H 2QTEA 3QDJB 3QJHB 1X5XA 2PYEA 2KZ1B 2MTPA 3V5KA 1ZT7A 5SX5H 1AO7E 4NP4H 2JB5H 3UTSB 5C9JB 3CLFL 1ZT4A 1QHOA 5BMFH 1FRGL 4F33B 3DUUB 1IILE 1CR9H 4M7LT 4MB4A 3UO1L 3QFDA 3ALPA 1QKZL 2RCSL 1H5BC 3HUJF 1UWEL 4P9ML 3VXRA 5I9QC 1CD1A 3FZUD 4WV1A 1CZ8H 4EN3D 1A6WL 3T0WA 4YX2H 2VOTA 5F3HA 3RTQB 4ELMB 4EDWH 3GBML 5FEBA 3GSOB 4FN0A 3HE6A 3FQWA 3RIFK 3K2UL 3PL6D 2EE6A 3T65B 3HZVB 2HN7B 4PP2A 1JGUH 3TIDB 4JKKA 3M45A 5CLWA 5I17B 4Y5XA 3GKWH 2JB6A 3SOBH 3GI8L 3GMNB 4F2MB 1IT9H 2ADGB 5F9JA 1PYWA 4NNYB 4HH9B 2VN7A 1GHFL 5C07D 3VGAC 4JFZL 5EOCJ 4DAGH 4AIZB 2VL4A 4DQOL 5JHLH 4R3SA 5HYJE 4XNYL 4PP1C 1G0YR 4X9IA 2QQNH 3NCYS 3ZYOA 5BS0D 1NJ9B 2X4OA 3V0VB 3D18A 4HWZA 1RZGB 1VERA 5A40E 3R1GH 4OSUH 1JRHH 2P5WD 3MLSH 1Q38A 1JNJA 3UJTL 4TULL 1UZ6E 4LHJB 1A9EA 4FQXD 1FNLA 1HHKB 3GMMA 2HKHH 3D85A 2W9DH 3MXVL 3O3DA 1QBBA 2A74A 2X1WL 2XKSA 4FQJL 1IEAA 2HJKB 2HJLA 3N85H 1R5WB 3STLA 3W2DH 4YPJA 3HZYA 4YBLC 4HPYL 5EBGA 2A1WH 4LSRL 1PAMA 5F88B 4HS3B 4MNHB 1QFUL 2DMBA 4G3YL 4Q2ZB 4PJBF 3MBXH 4C83A 3BYYA 4HKJA 2Z91A 1B88A 3B5GA 1QUNA 3OJDB 1NMCB 2I25N 3L1OL 2MCPL 3TGXA 3QWRD 5JXEA 4XCEB 1EGJL 1FYTE 2XTJE 4P4RA 4YXKL 4FS0A 1T1YA 5E4EB 1KJ2B 4HWUA 1KCRL 3ARGD 2EC9U 1AR1D 2X4PB 2XG5A 1T89A 4K8RH 5HYIA 2F8XC 4X5XA 1DANT 1JNLH 3W5NA 3QHZH 3GSRB 4FQ1H 1ZEAL 4WRLA 5BW7A 1MHCB 1JUFB 3C5SA 3L5XH 1X5ZA 3CX5K 2JJTA 5D71L 2DLIA 3Q5TA 3CVHL 4CVXB 5IV2B 3P9LB 3DHMA 5JNYA 1GHFH 4I3GA 3SQOH 5I30L 4OQTL 1PLGH 3RU8L 3KPQA 1KIRA 2JIXA 1JTOA 3FFDA 4ZS6C 4WWID 1N59A 2GCYA 3RVXC 2D9CA 4KRNA 4M5YH 2Q8BL 4KRPC 1OOAA 1KCLA 3BPNB 1NDGA 2BRQA 1LEIA 3MLSL 1WICA 1AGDA 4OQTA 5AAWA 1BHGA 1MJUL 3L5WA 4C4KT 3V7MA 4YUEH 5F6HJ 4D9RD 3HRPA 1JZ5A 3GSWB 2JTDA 4WFGD 2B7DT 5K9JH 5J12C 5L7XL 1V05A 4IMKA 4HKZA 5IK3B 1CL7H 3BWAB 4MVBC 1L6ZA 2EC8A 4R26L 3PWVB 5F1NB 1T6VN 2JCCF 4KVNL 1KJMB 4FP8H 3LEVH 3SOBL 4WW2F 1KIPB 1E6JH 1T04B 4NIKB 1JWUA 4FFZL 2ARJQ 3BDBA 5CJXC 3OAZK 4MZ2A 1JIBA 3EYOA 1HHJB 3TN0B 4NWUL 3ULVC 4NOFA 4QRRB 3X3FH 1KJVB 5KANI 4ALAL 4NZRL 5DRWB 3CZFA 4N0UE 5D8JH 1T2JA 1MHPL 1I85C 1RQ5A 1YY8A 3U7YH 4NHCH 2ZUVA 4GXUM 4I3RL 1IGMH 4EEEA 1NQBA 4Z7QE 6CGTA 4CU7A 4U6YB 2EEBA 4PFEA 4P59L 1K85A 4NN5B 2NY7L 4W4OA 2ED7A 4HUUA 2H26B 4LVNB 3L3IB 1DVFC 3MO1A 2A74B 1NBVL 4ZOCA 4NN7B 3WIHA 3WN5C 3QEQA 1BJ8A 2FHCA 3C6SA 2CKBH 2PTTB 5B8CA 2X89D 4FTVD 2BVPB 5HGAB 1FNEB 5C0JA 1TJGL 1Q9KA 1GVIA 5LGJA 5GGRA 3IRPX 4AMKL 4Y19B 3RY4A 2ZG3A 1INQB 3UTOA 1L7TH 3DURB 2ZCLL 5TFSH 3VFPB 3ZTJH 3P4NA 3JV0A 2MNUA 4O9HH 1X5GA 4GBXB 4PS4L 2XV6B 3GMLA 1NEZA 2W9LA 5AD0A 4P5KB 5J1SC 2V2XA 1OGAA 4WU7A 4F3FB 3W9EA 3UTPE 1TJIH 4NC2B 2H1PL 2DBLL 4JLRA 3FOMA 3B6SA 3M1BB 5C0EA 3REWB 3QWRA 4HC1L 3SQBA 2ICWA 3JTTA 1MCJA 5T3XD 1JNHA 3ARFC 4MAUL 1OP9A 3QYCA 4C59B 5EC1B 2EE9A 1TZIB 2QADC 4MCYA 5GGQH 1NGPH 3L6FA 4V1DB 4MNGA 4UDUB 3SEPA 1G6VK 2JIXB 3N0PB 2IADA 1ZVYA 5HBBA 4LVEA 2GCYB 1HSBB 4LPVA 4NKDB 3MODL 1LP9B 5GRVL 1PKQA 5DK2B 4BM7A 4JDZA 5MEPA 3O8XB 3RWCB 4JRYB 1X4YA 3D85D 5I76B 5FUOL 1WITA 1RSFA 3DSFL 1XGYH 4K3EH 4WGWB 5T1LB 1MREH 2P8PB 2X4TA 2YPLB 3U9UA 2JB6B 1FCCA 3MMEB 4I9WE 4Z7UB 3Q3GA 4RRPA 3D69B 3KYKH 2ZUQC 3FN0H 2G5BA 3EW3B 3PABA 3NCFB 2AEIT 5F7KC 3QO0B 4LEXH 5DDHA 1H15A 1UG9A 4HPOL 4AG4L 3K3QA 1I7UB 1MI5D 1CF8L 1S7QA 4PD4K 5E6YA 4M4PA 5F7EH 2ATPB 1A7PL 2DMKA 4G6MH 3BHBA 2R69L 3RVVD 3UAJD 3HI5H 4GKSB 4ZAKC 1ZV5A 2A6JB 4ZFGL 5EH1A 5HSFA 3O2VL 1HYSC 3BIKA 3HTLX 3EO9L 4HJJL 1MRCL 4F15C 3RWIB 5TPWH 4K2UL 1MCOH 2DI9A 2HJKA 2BNQD 1P7KA 2QQLH 1NANH 3C60C 3C60A 1OSPL 5DR5H 2PTVA 3K1DA 3SDAA 3HMWL 4WWKC 2OX5A 4XPGL 1BEYH 4PRHA 1WTLA 5E95B 4C54A 4M4RA 1ZOXA 2VLJB 5IESL 1MVFA 1ZXQA 2WIMA 3RQ3A 1T03L 2VDKH 2PYED 5DQDL 2OJEA 5KS9B 3WHXA 3EGSB 4UUJB 4FQHA 4P23D 5KVMC 2R2HA 1Q9KB 1TZGH 1U58B 2ADGA 1LEKB 5BV7L 1CVRA 2GK0B 1VPOH 2H9GB 3CFDA 4E0RA 1DUZA 4NQVB 1RJLA 2P49B 3EDEA 5F3BA 1FLRL 4X4MA 4R7DA 1E27A 1FGNL 1WCQA 3S36L 1WBYA 3RVWC 5TF1H 1YMMB 2KQNA 4NZUL 4BH7B 1DLFL 3MZGB 4XNXL 5DI8A 2DAVA 1Q8MA 1G7JB 3KYOA 1BREA 5EO0A 4RFEB 5I1KH 5DRXB 4G8FA 4XX1G 3O8XD 2LFGA 1BZQK 2HVJA 5T3ZE 3IKKA 1EXUA 5D1ZD 2DQCL 1BGXL 1OW0A 4FZEL 1SJHB 2FEEL 2XWTA 3SGJA 3R0NA 1UB5A 2IGFH 4ZAKA 1XMWA 2HRPH 2EZ0D 3X3FL 2JF1A 1MFEH 3C6LC 4ZUSB 4ZSOA 3RL2A 1I9JL 5HHQA 2ZSWB 1UM5L 5JXAH 1LWRA 4HK0B 3EFFA 4ODHL 2HTKC 4C56B 3UBXB 5HHNB 2OCFD 5DVNA 4GW4B 1D9KC 4X8JB 3PDDA 3QO1A 2APFA 3C5JB 1RMFL 5DMIH 1IRAY 3BW9B 4NT6A 2G9HA 1GZQB 2HRLA 3DUUA 2EKSA 3CGTA 1XF1A 3LKQB 3WS3A 4I0KA 3VXTA 2ZP0T 4NP4L 1S9XA 2K9UA 5F96L 2ATPA 2P44B 1XIWD 1FG2A 3UYRL 4NGHL 1Q0XH 5T3ZH 3VFSB 2WWMD 1UQSB 1MUJA 5AZEH 3SDCC 3QP3A 1AI1H 4PY7A 1F4YL 4FMKA 1CZ8L 2MSPA 2EH7L 3MLWH 4JVPA 4HAFA 3C60B 1LO0L 1I7RA 3OKMA 4Z7WA 1IQWH 4U1HB 3ETBF 1S7XB 1XCTB 4XP5L 1A1MB 4PRHB 5GRWA 1O5DT 1Q0YL 1QA9A 2AK4D 3WO4B 4FTVE 4RBPH 4QXGL 3MLVL 4BSJA 5IIEB 2LQRA 4JJ5A 5DD5L 3I6LD 4KXZH 3I02B 5IB1A 4E9LA 4L4TD 4ODSL 3DPBA 4YZFE 1RK0B 3VFVA 4M1CD 2HT2C 2P5WA 2R9HD 3LRSB 1OP3H 1DVFD 4F80A 4M43H 4G6JH 5DZNA 3A0OA 5SWZD 3NZ8B 5T5NF 2NLJB 3EKCA 3K8MA 1PX3A 2GQHA 2Z35B 2HFFB 1QO3B 2WNGA 3HB3D 3W0WD 1L7IH 2PETA 2A77H 4X0KA 4EXPX 4LLWB 3AMKA 5D96C 1J88A 5C2BH 3ILPB 4YDKH 5EBWB 4N9GA 4LQ1A 3LB6C 2JJWA 1NGYB 3H3PL 2BY2A 4MZ3A 5FCUL 4YQXL 3OXRB 1NCCH 2OZ4L 2FLBT 3FJTA 4NBZB 3QUXD 5DEGA 2Q6WA 4NM4L 4EUPA 1CICD 4YHML 4M6OL 2FYYA 3RL1A 3INUL 4LL9A 5HGAA 3V4VL 5JNYB 1ZHNA 3ES6A 1MREL 1EGJH 4YXKH 3WL9B 1UB5B 3TCXA 5SWZB 5IMMB 1JUFA 3C5SB 5D2NA 4NBYB 3RP1A 4R9HA 2XRAH 3C08H 3IVKA 2NTFA 3F7PC 3OF6A 3GJFH 1CE1L 3FQWB 3QIBD 2VISB 2ADIB 3FFCD 2Z8VC 3BKYL 3TBSA 1HI6A 4HULB 4PJHB 2R2EA 2VDQH 1JPTL 4PJGE 1BEYL 5GISH 3A67H 1QR1A 4NPYA 5CINH 4XMPL 1A21A 1ULVA 2GI7A 4JB9H 2OSLB 1J12A 1M05A 5A3ID 2XQBL 4RMRA 3RVXD 2G9HB 2VLRA 4WHYG 2NY3D 1D9KD 1GJIA 3BUYA 1KJMA 5I19H 4KKAC 4XGZB 4JGJA 4LASL 4X9FA 4H1LH 4RAUA 1TNNA 2B4CC 2NW2B 3IFNL 3CSYA 4KUCD 3VXSE 4Y5VA 2IH1A 1A4KB 1GPOH 1HNFA 1HSBA 3O3UN 2VH5H 1KLUB 4KI5C 4QCIB 4CU8A 1T1ZA 3KHOA 5AG9A 3HAEH 3P9MB 4NKOB 2B0SH 3MNVB 3T0AA 4YDVB 1YY8B 1J1PH 4DOHB 5SWSE 5SWQB 4AK1A 1F4YH 3PWJA 1Q1JH 5KW9L 5GZNC 1EDQA 1GZPB 3UCRA 4B7LA 3AS0A 4Q9BA 4K23H 3ARVA 4KTEL 1RJZB 2ZJSH 4G8GB 4LLQA 1NFDF 2GAZB 2VZSA 4U6HA 1FLTX 2X10A 1IL1B 1JHTA 4E0RB 1Z3GL 4L8DB 1A47A 1N5AB 3L95B 3TYGH 3EDFA 5F3BB 5I1CH 5DFVD 1DUYA 4UIMB 2V17L 5DD6A 2B1AH 1G7QB 4ONGH 1DQTA 5BO1L 2J8OA 5IR1A 4NHCL 4W68A 4XI5D 5C09D 3HNSH 2IAND 2VLRE 3BPLB 1X5FA 1NLDH 4DCQA 4GBXD 5DRNA 5HDQL 1ZA6B 5ID0A 2XXCB 3B83A 1PEWA 1FNSL 4KUZH 1YNTB 4W6XB 35C8H 3KGRA 1N6VA 5E1HB 2AJZA 1NEZB 3DRTB 3JV6B 2X89A 1S9KC 1SBSH 1YNKL 2G2RB 4QRRE 3HR5B 1MFDL 3ZL4H 3AREC 3EIFA 1FQ9C 3DURA 3VFPA 5JHDA 4U1SB 1QSZA 4QYOB 1G7HB 5KANG 1WWCA 2X4QB 2I9LB 1QSEA 4XCNA 4DKEL 1I3UA 4PJGF 2OTUA 1ND0A 5JORA 2IPKA 4IM8A 3RBGA 1NL0L 3TO2A 4LSUL 2DM7A 2R29H 5IBUB 4DVBB 2WBWB 1J8HB 1T1WA 3IS1X 4CBPA 3BVNB 5TDOA 1E28A 5SWSB 3PP4L 4YHIA 1D5XA 1YECH 4LCWE 4AIXA 1ZE3C 1I8MB 5MP6H 3E6FB 5AYUH 3UDWA 1U6AL 4PRAA 1XF3A 1IAOB 4UNTA 3FQNB 3SE8H 1AC0A 2AQ1A 1DLHB 3DTXA 1MCBA 3BH8A 3MYJA 1BAFH 4OF5A 1J05B 3EO1B 4KMTL 3DX6B 3OGOE 4JZJC 2F58H 1BFTA 5K9OB 3QXWA 2X4RB 4HJ0C 1LO0H 1YECL 3DXAE 3WFCH 4P46B 4HWBA 4KJQC 5T1LA 3QUXC 2EH7H 3BUYB 1WFOA 2Z31D 4G80B 4O5LH 5EORL 2Y07L 4XWOD 2NZIA 3HNSL 5I74C 1HEZB 1S7TA 3SJVE 3AAZB 3DECA 4NCC1 1JPFA 3OPZH 4U1JB 1R0AL 1AP2B 3CFIC 1REIA 3NZHL 5C07E 4KY1H 3FQTA 2VLLA 5L8JB 4X7SL 1CGXA 5I1JL 3FO1A 4XZUA 4YDVA 1F4WH 4O51B 4WW2C 3QHTC 3L5WB 1RV6X 4LCYA 1RD6A 4TQEL 2FX9H 3RY6A 1H3GA 4KK6C 3C5JA 3E8UH 3AREA 3RWIA 3BP4B 4RAVA 3WIFB 5CSZA 2DLFL 3TZVD 2VITB 3UZVB 4ZUTA 3KXFB 2DLHA 1C12A 4XNMA 5CSGA 5C08A 1CXFA 2AV1A 1RAMA 5LKNA 1CGWA 1EJ6A 2C1PB 5L0QB 1MRCH 1OAKL 4NC0B 3P77B 1UEYA 1HKFA 2BNRD 3QUYD 1RPQA 3PWUB 3EYOB 2E27L 1I75A 4YDLB 1E6OL 2ENYA 4QRRA 1EO7A 1GGBH 2QQNL 3QDMD 2NW3A 1I8IB 4Y8DC 1UM5H 4DCQB 1K4DA 4HIJA 1BFVH 1HZHL 1AGBA 1HIMH 3V8OA 1MY7A 1WBXA 1MCEA 1WSST 3TT3H 1KJ3L 5I66B 1AJ7H 4MQ7B 5DVLA 4RA3A 3KPSA 3QUZD 4K7PX 4N8VA 4LPWA 1DQJA 2AJXL 4LDEB 4NN5C 4YHNB 4ZODA 2LV4A 3QDGB 5D96B 5C09A 3LCYA 4QOKB 4HUUB 4I0PC 4NKDA 1LD9B 4WDIB 4I18B 5BVPL 4NQDE 2UZXB 4RMUA 1ETZB 4RMWA 1JV5B 2C3XA 2WBJA 3BDYH 2YRPA 2NNAA 3QUZA 4J6RL 3DIFB 3I02A 4PLOB 2ICWJ 3D2UA 1I1FB 4I3SL 4G5ZL 2XKNB 3HUJB 1C5BH 3WNOA 4K3JH 4RDQG 1MCFA 1G6RA 2CRIA 1KTDB 1E4XH 3BAEH 3S34L 4DKEH 4Z6AT 3QFJD 4OF7A 4I8DA 5FF6B 4YXHL 3KYOB 5HHOB 4OCRH 4JY6B 4JZOB 3HNVL 4Y19D 2JKXA 5CEZH 1NDMB 4LLDB 1ZLUH 1KPRA 4TSCH 1C5DB 1DBAH 1L9MA 1G7LA 3BP7B 1NCWL 3B2UC 3EOTL 4TUJA 3FO2A 1OQXA 1UM6L 5GRJL 1WIPA 1BZ7A 1A6AB 2XT1B 1D5MB 1DQQB 5DQDH 3SCMB 1MCDA 1G1YA 2WIIA 1OAZL 5IWLA 3WJLC 5SX4H 1XAUA 4KMTH 1UT9A 2N56A 2QV2A 1LGVA 2F54B 3FZUC 4PRIB 4EI6A 3EYQC 4FQLH 3D6GA 3MV01 4MXWH 5MHSE 2X40A 3PXJA 5E7FA 1X5JA 1NGXA 5J11B 4QRUB 2VE6B 4HMEA 5IW6B 4C56D 1ITBB 1N3NA 4ODUA 3WUZA 1EFXB 1T22A 2XYCA 3H2WA 3Q0HA 3W39A 1WWBX 3FRPA 1WBZB 1FLRH 1N5AA 4FQQA 4OLXH 1MCWM 4LSTL 1HI6B 1FBIH 3FB6A 1L7IL 1QPPA 3FOLB 1U8KA 3TYGL 4ZTPL 2VTFA 4S0SD 1S9VB 3PNWA 4Z9KB 2YS4A 4H1LG 1MUJB 3CX2A 1A7RL 2GJ6D 3I50H 1J8HD 3LD8B 2CK2A 2CRMA 2AW2A 3MJ8B 3ZHLA 5JO5A 4NQCB 4ODTL 3OAYH 1YMHB 2GTWA 5HVHC 3DRQB 4OM0H 3MRDB 4OZHB 3ZE1F 4WUUB 4A6YH 4RQQB 1X5IA 1JN6A 1YNTA 5B38A 3MRQA 3RHWK 5FYKL 4H5SA 1S5HA 4HG4K 1A1MA 4LSSL 5D7IA 3FT2B 3OQ3B 4PBVC 2NW2A 5HVWA 1CTOA 4P4KB 3CIQA 2BERA 3MOQA 3DNKA 3EYVB 4WFHD 4YZFF 5F8RC 1FZMA 2E9BA 2DF3A 4LSPL 4J4PC 1KCUH 2LU7A 1WCBB 2ZUUA 5J6HA 3O6FC 2Y7QA 3MBXL 4GKOA 1MAMH 3QA3A 1OHQA 5GGSB 5I1GH 1VFAA 2BOCB 3VWKC 2CKBB 3MV7E 1NCAH 2R2CA 4X7TB 5DJ6A 3S9DB 2XQBH 3BEVB 3F5WB 5HVFB 4FQLL 3PWPB 3L9RB 4KKLD 4F8TA 1JTTA 3BP5A 3NIGE 4NSKA 2GHWB 5GGSY 2ZUYA 4YXLH 3VE0B 4BJLA 2OP4H 1BJ1J 3V5DA 1KBGH 4GW5B 5GS1A 5IV2A 3U1SH 4MNGE 3QUML 5HHVH 1FN4A 2W60A 1CFNA 1TJIL 1SM3H 5I1HL 2YD2A 2IGFL 2OQJA 2ICWB 1IC5H 3TVMC 5KSAB 1K3IA 1KCRH 4FZ8L 1F45A 2F58L 1MQ8A 2R2BA 1OGTA 3FONA 1N5YH 2BJMH 4FQ1L 1S9XB 3KPOA 1WAAF 4HHAB 2C4FT 1FO0A 3VWKA 4W81A 4F37F 4Z7VB 1UADC 5GHWH 3ULUF 4JPKH 1UH2A 2VKXA 2ZUSA 3QEUA 1C8PA 3H42L 4RFEA 1KNOB 1TMCB 1K2DB 1EHXA 4UT6L 5ACZB 3LKPB 4U4BA 4OZFA 2XWBB 1J86A 2XFXA 4HC1A 4XAKD 3V6ZB 1QBLL 4OCWH 3VXRB 4LVHC 3MJGX 4S1RH 1PJ9A 5J9PA 1F6AB 1BQHG 1EK3A 2G5BB 3O11B 1LMKA 5JOFB 1BJMA 4FFYL 4HUMB 1TVBB 3EYUL 3UJJH 5A2KH 2R1WB 1S7QB 5HYSB 1Z3GH 2C1OA 3LPFA 2AV1B 3MV7A 2OMNA 4JJ5B 4GW1B 1AD0B 4DN3H 1RZ7L 3C8KA 3SKNA 5KG9A 1MCPH 4L4JA 2V2TB 3DMMB 5E8PB 4F15B 4LPYA 4V1DE 1S9VA 5C71A 1HINH 1NMBL 4NNYA 5C0RL 2OI9C 2YK1L 5IQ9B 3RNKB 4IBLT 4QNPF 3NGBC 1NLDL 1YEGH 3A6CH 3DVGA 1UZ6F 4MA3A 4GQPH 4AENA 4M00A 3WS3B 5E5MA 3DBXB 3IT8D 4FRWA 4G8EA 4KFZC 2EYTA 1FZKA 3OXSA 1X5AA 3HMWH 4YHPB 3OKOA 5DD6B 4HWEH 5GS0H 2YD4A 4X6DB 1WISA 4RRPG 1YC8A 4P99A 3O4OC 4GMTL 4NQXA 2HFGL 5M7QA 1KV3A 3I2CH 1FH5L 4Z95H 1CFSA 1MAML 2EYRB 1EZVX 3DMMD 3GMQB 4QHLB 1XGQA 1OD7A 4GXVL 4Y19E 3CFBB 1KC5L 4PG2C 4QTHB 5AD0B 4J4PD 4C4KO 4DKDC 4X99B 1Y6NR 1KG0A 3CU1A 3EAKA 4PJXA 4ERSH 4TVPE 4JFOA 2EDLA 3DWTA 3HE7B 2Q20A 3MRJB 1FRGH 5C6PB 1RK1A 2W59A 4LVHB 1U8QB 2OJZL 2EH8L 3BIAX 2C1PA 3BP5B 5KVGL 3ARFB 5CEZL 3MV8A 2QQKL 1F5WA 2CLVB 5KVEL 1XZ0B 3CVHH 1QLRB 2GJZA 4JFFD 4JQIL 3GBLA 1V5JA 1EMTH 2W60B 1B0WA 5IJKA 4BH7A 5TDOB 4G8GE 1TJHH 4MNGB 3IJYB 2CR6A 3VWJD 3CDYA 2EEAA 2PXYA 2GJ6A 1RUKH 5ACLA 1DEEA 4F9PC 3PDGA 2FZ3B 3MFGB 5CD3A 4Z7WE 1HXMA 4TUKL 3L7EA 3KPLA 1OM3H 3JWOL 1U3HA 4QHMB 3OMZA 3O6FD 1F3JA 5LGHL 2BRRL 4AL8L 4LVNC 4KI1A 1XGTA 4PG2A 3GSVA 1DBBL 4MLSA 3ILPA 3D0VB 3QDGA 3DARA 4LAQH 4ZS7H 1QP1A 3HPJA 3VH8B 3HNTH 2J8UF 3TNMA 4JKLA 3WNLA 4WW2A 4X4YA 4U6VH 4PV8A 2YEZB 4J7RA 1KPUA 3MZTA 1FYTD 4XMLH 5CUSH 2D0HA 3AXLB 2B1HH 1QBLH 1NGZB 1BX2A 1RJCA 4LCWA 1MI5E 4NM4H 4P2QD 3ME0A 1EHNA 4JO4H 4LSPH 4QXTA 2LABA 2E9IA 3CK0L 4CMHB 5JPMB 3GMPB 4G6FB 2V5RA 1P4BH 2R1XA 3MRPB 3R1GL 4JRXA 4OSUL 1V7MH 4W70A 2NX5E 4U1IB 3ZT6A 5H94B 4NM8H 5FM4A 5B8CC 4H20H 1MHHB 5J1TC 5GSVA 4MAYB 5DD0L 3FFCE 4K94H 3EO0A 2DQTL 4HQQH 3MBEC 2D0FA 5KVDH 3KLAB 2YA0A 3RNKA 5F1KC 2E7CA 5GGVL 2HKFH 4N0CD 4PJCF 5BS0B 4L3ED 3RY6C 1VGKB 1IARB 1P7QD 3WMSA 5JZ7D 2ADFH 2X70B 3KS0H 4OD3L 5JMRA 1EVUA 2CJUL 2AQ2A 3FQUA 4ZOEA 3VFNB 3H9SB 3KPNA 5CJOH 2H2SD 1NBZA 3WHE0 1JFQL 1LO4L 3TJEL 3X13B 1DFBL 5I8KL 3H0TA 5IB3B 1U8HA 5BXFA 4QCIA 3MREB 2GSIB 3E8UL 4HWEL 3T65A 3CVIH 3DO3A 2YOCA 1F97A 4PRPE 3G6DL 4UT9H 4Z0BH 3SPVA 5I30H 4HLJA 5F72S 3S37H 4PJBA 1J0KA 5C0JB 4QY8B 3WNPA 1PG7W 1I9RL 4DGYH 3DX9B 1KG0B 3MXWL 1NC2B 5ISZB 3RI5F 4OIIL 3ARBB 3VGBA 3TA3D 1NGWA 2RGSA 4KKBC 5IEHB 5ID1A 2FEDD 4JRXE 3BRDA 5EPMB 1DFBH 3VXQA 1CG9A 5F7NC 4OLUH 3B9EA 3GIVB 4G6FD 3DIFA 4H25A 1A6ZB 2O61A 2Q8BH 4D0CA 3ZHKA 2VLJD 2Z92B 4JPVL 4D0BA 1CGYA 3OX8B 4QOKA 3QUZC 4S11A 2XWTB 5KSBE 3TPUA 3N50A 1E4WL 9CGTA 4D9LL 1LVEA 1SEBA 4O2FA 5DVKA 2GJ6B 2QHRH 1ZHKA 4YBLB 4P5MA 3CAFA 5KSBB 4N0UA 4RNRB 3RGVC 1XH3B 3O2DA 3ELAT 3MYZA 4FTVA 3CXHJ 4ISVB 3DRTA 1OSZA 5EIIB 1GCFA 4J6RH 2WUCH 1KTLB 1UVQA 4WNQA 4ONFL 4F9LC 2NYYC 1OTUC 1TDQA 4M6ML 3PWVA 1YEFL 1ZT1B 4E41A 3QDJE 3BWAA 1B90A 5IM7B 3WSQL 3QIUA 3EBAA 1EEUA 1JF5A 1EIBA 1WIUA 4G7YH 4KQ4H 5C0GB 4HUWB 2YWYA 3OKEA 5J8OA 3C8DA 1RFDL 1SBSL 1YNKH 1ZKAA 1FFPA 5DQ9A