3LRYA

Crystal structure of synthetic hiv-1 capsid c-terminal domain (cca)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
71
structure length
71
Chain Sequence
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Limitations of peptide retro-inverso isomerization in molecular mimicry.
pubmed doi rcsb
molecule keywords HIV-1 capsid protein
molecule tags Viral protein
total genus 29
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3lryA00
3DTJA 4QNBA 1EIAA 3G1GA 2KODA 5HGOA 3DS0A 4COCA 5HGLA 4IPYA 3G1IA 4U0EA 4XFXA 2JO0A 2M8PA 1D1DA 2ONTA 3G29A 5JPAA 1QRJA 3DS1A 2L6EA 4XFYA 2M8NA 3DS3A 3G26A 4PH1A 3DS4A 3DPHA 3H4EA 4U0CA 4XROA 2JYGA 3G21A 4U0FA 4XRQA 2EIAA 1E6JP 4M0IA 3MGEA 2JYLA 3DS2A 2LF4A 3VRLC 1A43A 4WYMA 1A8OA 1BAJA 2XV6A 4COPA 5I4TG 4U0BA 4XFZA 2XXMA 4U0AA 3DS5A 3LRYA 4U0DA 3H47A 3NTEA 5HGMA 5DCKA 3G0VA 2M8LA 2BUOA 2XT1A 3P05A 1EOQA 3G28A 1AUMA 5HGNA 4PH0A
chains in the Genus database with same CATH superfamily
2FVFA 3CCRP 2PENA 1OR5A 5EJDA 3G26A 2KG9A 1VQMP 1S72P 4U0FA 2JQ4A 3E2DA 2NO8A 1X3OA 2OTJP 1HQBA 3G6EP 1RO2A 2LL8A 2LMLA 5BS2A 4PXHB 4GR6A 2BHVA 5HGNA 1DNYA 1VQ7P 1VHNA 2FACA 3B4QA 2JAZA 3GZLA 2M8NA 4F37A 4MRTC 2KW2A 5F2KA 2JYLA 3CCJP 4COPA 2K5XA 2XV6A 3RG6C 3CCLP 5CZDB 1YI2P 4DG9A 2LTEA 2PEKA 2N50A 3U43A 2PEOA 2CNRA 3DS3A 1KQSO 2CQ8A 3NTEA 2KWLA 2BUOA 3EJBA 1E0HA 5F2NA 3CXCO 4IZ6A 1YJWP 2GZJA 2LKIA 1MZ8A 3LMOA 1A43A 2LPKA 3CC2P 3LRYA 4UHPB 1GPJA 3G0VA 1EIAA 1IMQA 2MVUA 3G1IA 4XFXA 1K8AQ 3EJDA 2JU1A 2KOQA 2KORA 3CCSP 4H2XC 2EHSA 3CPWO 1ZMBA 2E1MA 1YJNP 5EW5E 3CC7P 3GJNA 5BS1A 2FQ1A 2M8LA 2CG5B 2XT1A 2EHTA 2DGYA 2M5RA 3HYBA 2GDYA 1KC8Q 2AFDA 4XRQA 2EIAA 3CCUP 1Q7YQ 4XFZA 2KOOA 1VQOP 1KD1Q 1M74A 5HGOA 1YITP 2LIWA 1QVGO 3GZMA 3HZQA 2AFEA 1Q82Q 2OARA 1M1KQ 2K2QA 2PEJA 2K0YA 4H2YC 2Z45A 2GZIA 2AVAA 2GDXA 2PNGA 4U0DA 2L4BA 2GDWA 3G28A 3CMEP 1VQLP 2FAEA 1VQ6P 2JO0A 1HY8A 1VQ4P 2LOLA 3WBHA 3DPHA 2K93A 1EMVA 2FADA 2FVEA 1A8OA 2JGPA 3I56P 2Z44A 5HVCA 3M1MA 1YIJP 2DNWA 1K73Q 5F2OA 2KGDA 2PY8A 2KGCA 4XFYA 1Q81Q 1F80D 2JBGA 3OW2O 2JU2A 3G21A 2K94A 1M6EX 2P9XA 3EJEA 1BAJA 2VLPA 2MVVA 1VQ5P 1VQKP 1L0HA 2N5IA 3P05A 1GXHA 2KODA 2GZGA 4COCA 4U0EA 2OTLP 2GZFA 1VKUA 4NEOA 1YHQP 1Q86Q 5JPAA 3G29A 2VSQA 2Z46A 4PWVB 1BXIA 3MGEA 3VRLC 1VQNP 4CA3A 2PEQA 1JJ2O 1GXGA 5DCKA 2MD9A 1NJIQ 1M90Q 1K30A 4PH0A 2GZEA 2PEMA 1IUQA 2QA4P 1FR2A 1QRJA 2CGQA 2K92A 2FQ2A 4PH1A 3CMAP 3DS4A 1AYIA 1K9MQ 1ACPA 1KLPA 4H2WC 2QEXP 2KR5A 2EFJA 3DS5A 3H47A 1QVFO 2LIUA 2CWOA 3I55P 2L0QA 3G1GA 3DS0A 3CCQP 5KP7B 2AF8A 5HV8A 3H4EA 2XZ1C 2VLQA 4WYMA 2KG6A 1W2BO 4BPFA 2N5HA 1ZNVA 2PEIA 3DTJA 3GKLC 2QNWA 2MY5A 3G71P 1T8KA 1VQ8P 1UJZA 2L6EA 4QKOA 1Z6MA 4XROA 2LF4A 2EG5A 4U0AA 2FQ0A 5HGMA 1N8RQ 2WPTA 1UNKA 3H0DA 4QNBA 1RO0A 2M8PA 1D1DA 2KGAA 2KGEA 3CCEP 2VLNA 2L22A 4BPHA 4GR2A 4M0IA 7CEIA 2K0DX 2FHSC 5I4TG 3CC4P 2XXMA 2X2BA 5KP6B 3CE7A 3CCMP 1CEIA 2MR8A 2ROQA 3Q20A 2ERHA 1VQ9P 3NY7B 2MF4A 2N98A 1YJ9P 1VQPP 2JYGA 1IMPA 2MR7A 2GYKA 1M6NA 1RNIA 3CCVP 2K0XA 2N6YA 1AF8A 4HKGA 1EOQA 5KP8B 1DV5A 2JB0A 3RG2A 4R0MA 5HGLA 4IPYA 1L0IA 2KOSA 2ONTA 3DS1A 2N6ZA 4U0CA 1NQ4A 1E6JP 2FVAA 2VLOA 2KG8A 3DS2A 4BPGA 4U0BA 3B5IA 3G4SP 3CD6P 2KOPA 2XZ0D 1AUMA 2L9FA
chains in the Genus database with same CATH topology
3DTJA 1EIAA 3G1IA 4XFXA 1K8AQ 3CCRP 3G71P 2PENA 2PY8A 1VQ8P 3CCSP 2L6EA 4XFYA 3G26A 3CPWO 1ZMBA 2E1MA 1VQMP 4XROA 1S72P 1YJNP 1Q81Q 3OW2O 3G21A 1M6EX 4U0FA 3E2DA 3CC7P 2P9XA 2OTJP 2LF4A 2EG5A 1BAJA 3G6EP 5BS1A 1RO2A 4U0AA 5BS2A 1VQ5P 1VQKP 5HGMA 1N8RQ 2M8LA 4GR6A 2XT1A 2BHVA 3P05A 2DGYA 5HGNA 1VQ7P 3H0DA 4QNBA 2KODA 4COCA 4U0EA 2OTLP 3HYBA 1YHQP 1Q86Q 1RO0A 2M8PA 1D1DA 5JPAA 3G29A 3CCEP 2M8NA 1KC8Q 2Z46A 4GR2A 4XRQA 2EIAA 4M0IA 5F2KA 3CCUP 3MGEA 1Q7YQ 2JYLA 3VRLC 3CCJP 1VQNP 4COPA 2XV6A 5I4TG 2PEQA 4XFZA 3RG6C 2XXMA 1JJ2O 3CC4P 3CCLP 5DCKA 1VQOP 1NJIQ 3CCMP 1M90Q 1KD1Q 1K30A 4PH0A 1M74A 1YI2P 5HGOA 1YITP 1QVGO 3Q20A 3HZQA 2PEMA 1IUQA 2PEKA 1VQ9P 2QA4P 1Q82Q 1QRJA 2PEOA 2OARA 1YJ9P 1VQPP 3DS3A 4PH1A 3CMAP 1M1KQ 3DS4A 2JYGA 1K9MQ 2PEJA 1KQSO 2QEXP 1M6NA 2Z45A 1RNIA 2EFJA 3DS5A 3CCVP 4U0DA 3H47A 3NTEA 1QVFO 2BUOA 2CWOA 1EOQA 3G28A 3I55P 3CMEP 3G1GA 3DS0A 5HGLA 4IPYA 1VQLP 3CCQP 1VQ6P 5F2NA 2JO0A 2ONTA 3DS1A 3CXCO 1VQ4P 3WBHA 3DPHA 3H4EA 4U0CA 1YJWP 1E6JP 3DS2A 1A43A 4WYMA 1A8OA 1W2BO 4U0BA 3B5IA 3CC2P 3I56P 3G4SP 3CD6P 2Z44A 3LRYA 3G0VA 3M1MA 1YIJP 1K73Q 1AUMA 5F2OA 2PEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTJ A;  4QNB A;  1EIA A;  3G1G A;  2KOD A;  5HGO A;  3DS0 A;  4COC A;  5HGL A;  4IPY A;  3G1I A;  4U0E A;  4XFX A;  2JO0 A;  2M8P A;  1D1D A;  2ONT A;  3G29 A;  5JPA A;  1QRJ A;  3DS1 A;  2L6E A;  4XFY A;  2M8N A;  3DS3 A;  3G26 A;  4PH1 A;  3DS4 A;  3DPH A;  3H4E A;  4U0C A;  4XRO A;  2JYG A;  3G21 A;  4U0F A;  4XRQ A;  2EIA A;  1E6J P;  4M0I A;  3MGE A;  2JYL A;  3DS2 A;  2LF4 A;  3VRL C;  1A43 A;  4WYM A;  1A8O A;  1BAJ A;  2XV6 A;  4COP A;  5I4T G;  4U0B A;  4XFZ A;  2XXM A;  4U0A A;  3DS5 A;  3LRY A;  4U0D A;  3H47 A;  3NTE A;  5HGM A;  5DCK A;  3G0V A;  2M8L A;  2BUO A;  2XT1 A;  3P05 A;  1EOQ A;  3G28 A;  1AUM A;  5HGN A;  4PH0 A; 
#chains in the Genus database with same CATH topology
 2FVF A;  3CCR P;  2PEN A;  1OR5 A;  5EJD A;  3G26 A;  2KG9 A;  1VQM P;  1S72 P;  4U0F A;  2JQ4 A;  3E2D A;  2NO8 A;  1X3O A;  2OTJ P;  1HQB A;  3G6E P;  1RO2 A;  2LL8 A;  2LML A;  5BS2 A;  4PXH B;  4GR6 A;  2BHV A;  5HGN A;  1DNY A;  1VQ7 P;  1VHN A;  2FAC A;  3B4Q A;  2JAZ A;  3GZL A;  2M8N A;  4F37 A;  4MRT C;  2KW2 A;  5F2K A;  2JYL A;  3CCJ P;  4COP A;  2K5X A;  2XV6 A;  3RG6 C;  3CCL P;  5CZD B;  1YI2 P;  4DG9 A;  2LTE A;  2PEK A;  2N50 A;  3U43 A;  2PEO A;  2CNR A;  3DS3 A;  1KQS O;  2CQ8 A;  3NTE A;  2KWL A;  2BUO A;  3EJB A;  1E0H A;  5F2N A;  3CXC O;  4IZ6 A;  1YJW P;  2GZJ A;  2LKI A;  1MZ8 A;  3LMO A;  1A43 A;  2LPK A;  3CC2 P;  3LRY A;  4UHP B;  1GPJ A;  3G0V A;  1EIA A;  1IMQ A;  2MVU A;  3G1I A;  4XFX A;  1K8A Q;  3EJD A;  2JU1 A;  2KOQ A;  2KOR A;  3CCS P;  4H2X C;  2EHS A;  3CPW O;  1ZMB A;  2E1M A;  1YJN P;  5EW5 E;  3CC7 P;  3GJN A;  5BS1 A;  2FQ1 A;  2M8L A;  2CG5 B;  2XT1 A;  2EHT A;  2DGY A;  2M5R A;  3HYB A;  2GDY A;  1KC8 Q;  2AFD A;  4XRQ A;  2EIA A;  3CCU P;  1Q7Y Q;  4XFZ A;  2KOO A;  1VQO P;  1KD1 Q;  1M74 A;  5HGO A;  1YIT P;  2LIW A;  1QVG O;  3GZM A;  3HZQ A;  2AFE A;  1Q82 Q;  2OAR A;  1M1K Q;  2K2Q A;  2PEJ A;  2K0Y A;  4H2Y C;  2Z45 A;  2GZI A;  2AVA A;  2GDX A;  2PNG A;  4U0D A;  2L4B A;  2GDW A;  3G28 A;  3CME P;  1VQL P;  2FAE A;  1VQ6 P;  2JO0 A;  1HY8 A;  1VQ4 P;  2LOL A;  3WBH A;  3DPH A;  2K93 A;  1EMV A;  2FAD A;  2FVE A;  1A8O A;  2JGP A;  3I56 P;  2Z44 A;  5HVC A;  3M1M A;  1YIJ P;  2DNW A;  1K73 Q;  5F2O A;  2KGD A;  2PY8 A;  2KGC A;  4XFY A;  1Q81 Q;  1F80 D;  2JBG A;  3OW2 O;  2JU2 A;  3G21 A;  2K94 A;  1M6E X;  2P9X A;  3EJE A;  1BAJ A;  2VLP A;  2MVV A;  1VQ5 P;  1VQK P;  1L0H A;  2N5I A;  3P05 A;  1GXH A;  2KOD A;  2GZG A;  4COC A;  4U0E A;  2OTL P;  2GZF A;  1VKU A;  4NEO A;  1YHQ P;  1Q86 Q;  5JPA A;  3G29 A;  2VSQ A;  2Z46 A;  4PWV B;  1BXI A;  3MGE A;  3VRL C;  1VQN P;  4CA3 A;  2PEQ A;  1JJ2 O;  1GXG A;  5DCK A;  2MD9 A;  1NJI Q;  1M90 Q;  1K30 A;  4PH0 A;  2GZE A;  2PEM A;  1IUQ A;  2QA4 P;  1FR2 A;  1QRJ A;  2CGQ A;  2K92 A;  2FQ2 A;  4PH1 A;  3CMA P;  3DS4 A;  1AYI A;  1K9M Q;  1ACP A;  1KLP A;  4H2W C;  2QEX P;  2KR5 A;  2EFJ A;  3DS5 A;  3H47 A;  1QVF O;  2LIU A;  2CWO A;  3I55 P;  2L0Q A;  3G1G A;  3DS0 A;  3CCQ P;  5KP7 B;  2AF8 A;  5HV8 A;  3H4E A;  2XZ1 C;  2VLQ A;  4WYM A;  2KG6 A;  1W2B O;  4BPF A;  2N5H A;  1ZNV A;  2PEI A;  3DTJ A;  3GKL C;  2QNW A;  2MY5 A;  3G71 P;  1T8K A;  1VQ8 P;  1UJZ A;  2L6E A;  4QKO A;  1Z6M A;  4XRO A;  2LF4 A;  2EG5 A;  4U0A A;  2FQ0 A;  5HGM A;  1N8R Q;  2WPT A;  1UNK A;  3H0D A;  4QNB A;  1RO0 A;  2M8P A;  1D1D A;  2KGA A;  2KGE A;  3CCE P;  2VLN A;  2L22 A;  4BPH A;  4GR2 A;  4M0I A;  7CEI A;  2K0D X;  2FHS C;  5I4T G;  3CC4 P;  2XXM A;  2X2B A;  5KP6 B;  3CE7 A;  3CCM P;  1CEI A;  2MR8 A;  2ROQ A;  3Q20 A;  2ERH A;  1VQ9 P;  3NY7 B;  2MF4 A;  2N98 A;  1YJ9 P;  1VQP P;  2JYG A;  1IMP A;  2MR7 A;  2GYK A;  1M6N A;  1RNI A;  3CCV P;  2K0X A;  2N6Y A;  1AF8 A;  4HKG A;  1EOQ A;  5KP8 B;  1DV5 A;  2JB0 A;  3RG2 A;  4R0M A;  5HGL A;  4IPY A;  1L0I A;  2KOS A;  2ONT A;  3DS1 A;  2N6Z A;  4U0C A;  1NQ4 A;  1E6J P;  2FVA A;  2VLO A;  2KG8 A;  3DS2 A;  4BPG A;  4U0B A;  3B5I A;  3G4S P;  3CD6 P;  2KOP A;  2XZ0 D;  1AUM A;  2L9F A; 
#chains in the Genus database with same CATH homology
 3DTJ A;  1EIA A;  3G1I A;  4XFX A;  1K8A Q;  3CCR P;  3G71 P;  2PEN A;  2PY8 A;  1VQ8 P;  3CCS P;  2L6E A;  4XFY A;  3G26 A;  3CPW O;  1ZMB A;  2E1M A;  1VQM P;  4XRO A;  1S72 P;  1YJN P;  1Q81 Q;  3OW2 O;  3G21 A;  1M6E X;  4U0F A;  3E2D A;  3CC7 P;  2P9X A;  2OTJ P;  2LF4 A;  2EG5 A;  1BAJ A;  3G6E P;  5BS1 A;  1RO2 A;  4U0A A;  5BS2 A;  1VQ5 P;  1VQK P;  5HGM A;  1N8R Q;  2M8L A;  4GR6 A;  2XT1 A;  2BHV A;  3P05 A;  2DGY A;  5HGN A;  1VQ7 P;  3H0D A;  4QNB A;  2KOD A;  4COC A;  4U0E A;  2OTL P;  3HYB A;  1YHQ P;  1Q86 Q;  1RO0 A;  2M8P A;  1D1D A;  5JPA A;  3G29 A;  3CCE P;  2M8N A;  1KC8 Q;  2Z46 A;  4GR2 A;  4XRQ A;  2EIA A;  4M0I A;  5F2K A;  3CCU P;  3MGE A;  1Q7Y Q;  2JYL A;  3VRL C;  3CCJ P;  1VQN P;  4COP A;  2XV6 A;  5I4T G;  2PEQ A;  4XFZ A;  3RG6 C;  2XXM A;  1JJ2 O;  3CC4 P;  3CCL P;  5DCK A;  1VQO P;  1NJI Q;  3CCM P;  1M90 Q;  1KD1 Q;  1K30 A;  4PH0 A;  1M74 A;  1YI2 P;  5HGO A;  1YIT P;  1QVG O;  3Q20 A;  3HZQ A;  2PEM A;  1IUQ A;  2PEK A;  1VQ9 P;  2QA4 P;  1Q82 Q;  1QRJ A;  2PEO A;  2OAR A;  1YJ9 P;  1VQP P;  3DS3 A;  4PH1 A;  3CMA P;  1M1K Q;  3DS4 A;  2JYG A;  1K9M Q;  2PEJ A;  1KQS O;  2QEX P;  1M6N A;  2Z45 A;  1RNI A;  2EFJ A;  3DS5 A;  3CCV P;  4U0D A;  3H47 A;  3NTE A;  1QVF O;  2BUO A;  2CWO A;  1EOQ A;  3G28 A;  3I55 P;  3CME P;  3G1G A;  3DS0 A;  5HGL A;  4IPY A;  1VQL P;  3CCQ P;  1VQ6 P;  5F2N A;  2JO0 A;  2ONT A;  3DS1 A;  3CXC O;  1VQ4 P;  3WBH A;  3DPH A;  3H4E A;  4U0C A;  1YJW P;  1E6J P;  3DS2 A;  1A43 A;  4WYM A;  1A8O A;  1W2B O;  4U0B A;  3B5I A;  3CC2 P;  3I56 P;  3G4S P;  3CD6 P;  2Z44 A;  3LRY A;  3G0V A;  3M1M A;  1YIJ P;  1K73 Q;  1AUM A;  5F2O A;  2PEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...