3LRYA

Crystal structure of synthetic hiv-1 capsid c-terminal domain (cca)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
71
structure length
71
Chain Sequence
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 capsid protein
publication title Limitations of peptide retro-inverso isomerization in molecular mimicry.
pubmed doi rcsb
molecule tags Viral protein
total genus 29
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3lryA00
4U0AA 1QRJA 3DS5A 1EIAA 3DS0A 5HGOA 3H47A 4XFZA 4U0BA 3DS1A 3G1IA 5DCKA 1E6JP 2BUOA 3VRLC 4PH1A 4XRQA 2L6EA 2XV6A 5JPAA 1A43A 2M8NA 2KODA 2M8PA 4QNBA 5I4TG 2JYGA 4PH0A 2ONTA 4U0FA 3G21A 3MGEA 2JO0A 4U0EA 2JYLA 1EOQA 4XROA 3G0VA 2EIAA 1BAJA 3LRYA 2M8LA 1D1DA 4U0CA 3H4EA 4M0IA 3G28A 5HGLA 4COCA 2LF4A 2XT1A 3DS3A 3P05A 4XFYA 3DPHA 4IPYA 2XXMA 5HGNA 3DTJA 3G26A 1AUMA 4U0DA 3DS2A 4XFXA 3NTEA 4WYMA 5HGMA 3DS4A 4COPA 3G1GA 3G29A 1A8OA
chains in the Genus database with same CATH superfamily
4XFZA 4U0BA 1E0HA 2XV6A 2LOLA 1YITP 2JBGA 4M0IA 2PNGA 2OARA 2L4BA 1GPJA 2L9FA 5HGNA 2VSQA 1AUMA 1YJWP 1N8RQ 3HZQA 2LKIA 4BPHA 2KORA 2JYGA 1Z6MA 1M1KQ 1IUQA 1F80D 2VLQA 2FAEA 3CCLP 2OTLP 2LF4A 3EJBA 1FR2A 5F2KA 3HYBA 1ACPA 1E6JP 2DNWA 2L6EA 2PEIA 2KODA 2M8PA 3CCSP 1K30A 2LMLA 2WPTA 3CCVP 3GJNA 1M74A 1K73Q 2XT1A 2MR8A 4H2YC 5HVCA 4F37A 2PEKA 1VQ8P 1KLPA 2QEXP 2GZEA 3CCJP 2FQ0A 1DNYA 1OR5A 2EHSA 3B5IA 1D1DA 2Z45A 2K0XA 3CC4P 3EJEA 1YHQP 3P05A 2KOQA 2N5HA 2CG5B 4COPA 2GZIA 2KGAA 1EIAA 2VLOA 1IMPA 3H47A 2KOOA 5DCKA 2N50A 2K93A 4GR2A 4H2XC 2GYKA 1VQ4P 1VQKP 4NEOA 1Q81Q 5BS1A 3Q20A 2N6YA 3GZLA 1YJ9P 7CEIA 5F2NA 2AFEA 3DS5A 3CXCO 2BUOA 1Q82Q 4XRQA 3G6EP 4CA3A 4BPFA 1MZ8A 2MD9A 2JYLA 3I56P 4HKGA 2EIAA 2QA4P 1DV5A 1VQLP 4XFYA 3DPHA 2M5RA 2N5IA 2GDWA 1A8OA 1KD1Q 3CCUP 2KOSA 1M90Q 3E2DA 2KR5A 2KOPA 4PXHB 1EMVA 2EG5A 2KGEA 1YJNP 2Z46A 3RG6C 1VQPP 2MF4A 2JQ4A 1GXHA 1NJIQ 5KP8B 3DS3A 1S72P 2X2BA 4XFXA 4U0DA 1RNIA 2KG8A 1VHNA 1K8AQ 2GZJA 1RO0A 2Z44A 4MRTC 3CPWO 2LPKA 2PEJA 2EFJA 2LIWA 2ONTA 4U0FA 2FADA 1BAJA 2GZGA 1KC8Q 3G28A 4H2WC 2JU1A 2FVEA 2MVVA 4DG9A 3CC2P 2VLPA 2FVFA 2AVAA 5KP7B 3VRLC 4PH1A 2PY8A 1ZNVA 5CZDB 2KG9A 4U0EA 2KGCA 3M1MA 2M8LA 5HGLA 4IZ6A 2LL8A 1K9MQ 3CCMP 2PEOA 3CC7P 4WYMA 3G29A 3RG2A 1QRJA 3CCQP 3DS1A 1HY8A 1UJZA 2N6ZA 2JU2A 4QNBA 2JB0A 1JJ2O 1Q86Q 3MGEA 2LIUA 3G71P 1RO2A 4IPYA 2QNWA 2FQ2A 5EJDA 1AF8A 3B4QA 1QVGO 4PWVB 2FACA 1VKUA 2MR7A 2XZ0D 2JGPA 1M6EX 2M8NA 5F2OA 2AF8A 2CNRA 1EOQA 2BHVA 3LRYA 1VQOP 2N98A 5KP6B 3LMOA 1VQMP 3G26A 1ZMBA 2AFDA 4R0MA 5HGMA 2P9XA 2DGYA 2PENA 4UHPB 2K2QA 3CD6P 1A43A 1W2BO 4PH0A 3G21A 2CWOA 3EJDA 1KQSO 3G0VA 1VQNP 2K94A 3WBHA 2NO8A 2K5XA 2ERHA 2XXMA 2FQ1A 3CMEP 1YI2P 2EHTA 5HGOA 2KWLA 3U43A 2GDYA 2OTJP 1BXIA 2GDXA 2XZ1C 2GZFA 4XROA 2JAZA 4U0CA 3CCRP 2KGDA 4COCA 2FVAA 1GXGA 3I55P 2L22A 3G1GA 1VQ5P 3CMAP 5JPAA 1Q7YQ 3CE7A 1VQ7P 2K92A 4BPGA 3H4EA 2L0QA 1VQ6P 5EW5E 3DTJA 2VLNA 3GZMA 3DS4A 3H0DA 2PEMA 5BS2A 2LTEA 3NY7B 3G4SP 1AYIA 1VQ9P 5I4TG 4QKOA 1YIJP 2JO0A 2CQ8A 1NQ4A 1UNKA 2K0YA 1IMQA 2MY5A 3NTEA 3CCEP 2K0DX 2E1MA 2ROQA 4U0AA 2KG6A 5HV8A 3DS0A 1QVFO 3GKLC 3G1IA 1T8KA 1L0IA 1CEIA 2CGQA 1L0HA 2FHSC 4GR6A 3OW2O 2KW2A 2PEQA 1X3OA 3DS2A 2MVUA 1M6NA 1HQBA
chains in the Genus database with same CATH topology
1EIAA 3H47A 4XFZA 4U0BA 5DCKA 2OTJP 3VRLC 4PH1A 2PY8A 2XV6A 1YITP 4GR2A 4U0EA 4XROA 1VQ4P 3M1MA 2M8LA 4U0CA 3CCRP 4M0IA 1VQKP 5HGLA 1Q81Q 5BS1A 3Q20A 4COCA 2OARA 1K9MQ 5HGNA 3I55P 2PEOA 3CCMP 1AUMA 3CC7P 1YJWP 4WYMA 1YJ9P 3G1GA 3G29A 5F2NA 1N8RQ 1VQ5P 3HZQA 1QRJA 3DS5A 3CXCO 3CMAP 3CCQP 3DS1A 2BUOA 1Q82Q 4XRQA 3G6EP 5JPAA 4QNBA 1Q7YQ 1JJ2O 1Q86Q 2JYGA 1VQ7P 3MGEA 2JYLA 3I56P 2EIAA 1M1KQ 1IUQA 3H4EA 2QA4P 1VQ6P 3CCLP 2OTLP 2LF4A 3G71P 1VQLP 1RO2A 3DPHA 4IPYA 4XFYA 3DTJA 1QVGO 3DS4A 3H0DA 2PEMA 5F2KA 5BS2A 3HYBA 1A8OA 1KD1Q 3CCUP 1M90Q 1E6JP 3E2DA 2L6EA 1M6EX 2M8NA 2PEIA 2KODA 2M8PA 3G4SP 1VQ9P 5F2OA 5I4TG 3CCSP 2EG5A 1K30A 1YJNP 2Z46A 3RG6C 1YIJP 1VQPP 2JO0A 1EOQA 2BHVA 3LRYA 1VQOP 3CCVP 1NJIQ 1M74A 1K73Q 2XT1A 3DS3A 1S72P 1VQMP 3G26A 1ZMBA 4U0DA 4XFXA 2PEKA 3NTEA 5HGMA 1VQ8P 3CCEP 2P9XA 2DGYA 2PENA 2E1MA 2QEXP 4U0AA 3DS0A 1RNIA 5HGOA 1QVFO 3CCJP 3G1IA 1K8AQ 3CD6P 1RO0A 2Z44A 3B5IA 1A43A 1W2BO 3CPWO 2PEJA 2EFJA 4PH0A 2ONTA 4U0FA 3G21A 2CWOA 1KQSO 3G0VA 1D1DA 1BAJA 1VQNP 3WBHA 1KC8Q 2Z45A 3G28A 3CC4P 1YHQP 2PEQA 3P05A 4GR6A 3OW2O 2XXMA 3CMEP 3DS2A 4COPA 1YI2P 1M6NA 3CC2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0A A;  1QRJ A;  3DS5 A;  1EIA A;  3DS0 A;  5HGO A;  3H47 A;  4XFZ A;  4U0B A;  3DS1 A;  3G1I A;  5DCK A;  1E6J P;  2BUO A;  3VRL C;  4PH1 A;  4XRQ A;  2L6E A;  2XV6 A;  5JPA A;  1A43 A;  2M8N A;  2KOD A;  2M8P A;  4QNB A;  5I4T G;  2JYG A;  4PH0 A;  2ONT A;  4U0F A;  3G21 A;  3MGE A;  2JO0 A;  4U0E A;  2JYL A;  1EOQ A;  4XRO A;  3G0V A;  2EIA A;  1BAJ A;  3LRY A;  2M8L A;  1D1D A;  4U0C A;  3H4E A;  4M0I A;  3G28 A;  5HGL A;  4COC A;  2LF4 A;  2XT1 A;  3DS3 A;  3P05 A;  4XFY A;  3DPH A;  4IPY A;  2XXM A;  5HGN A;  3DTJ A;  3G26 A;  1AUM A;  4U0D A;  3DS2 A;  4XFX A;  3NTE A;  4WYM A;  5HGM A;  3DS4 A;  4COP A;  3G1G A;  3G29 A;  1A8O A; 
#chains in the Genus database with same CATH topology
 4XFZ A;  4U0B A;  1E0H A;  2XV6 A;  2LOL A;  1YIT P;  2JBG A;  4M0I A;  2PNG A;  2OAR A;  2L4B A;  1GPJ A;  2L9F A;  5HGN A;  2VSQ A;  1AUM A;  1YJW P;  1N8R Q;  3HZQ A;  2LKI A;  4BPH A;  2KOR A;  2JYG A;  1Z6M A;  1M1K Q;  1IUQ A;  1F80 D;  2VLQ A;  2FAE A;  3CCL P;  2OTL P;  2LF4 A;  3EJB A;  1FR2 A;  5F2K A;  3HYB A;  1ACP A;  1E6J P;  2DNW A;  2L6E A;  2PEI A;  2KOD A;  2M8P A;  3CCS P;  1K30 A;  2LML A;  2WPT A;  3CCV P;  3GJN A;  1M74 A;  1K73 Q;  2XT1 A;  2MR8 A;  4H2Y C;  5HVC A;  4F37 A;  2PEK A;  1VQ8 P;  1KLP A;  2QEX P;  2GZE A;  3CCJ P;  2FQ0 A;  1DNY A;  1OR5 A;  2EHS A;  3B5I A;  1D1D A;  2Z45 A;  2K0X A;  3CC4 P;  3EJE A;  1YHQ P;  3P05 A;  2KOQ A;  2N5H A;  2CG5 B;  4COP A;  2GZI A;  2KGA A;  1EIA A;  2VLO A;  1IMP A;  3H47 A;  2KOO A;  5DCK A;  2N50 A;  2K93 A;  4GR2 A;  4H2X C;  2GYK A;  1VQ4 P;  1VQK P;  4NEO A;  1Q81 Q;  5BS1 A;  3Q20 A;  2N6Y A;  3GZL A;  1YJ9 P;  7CEI A;  5F2N A;  2AFE A;  3DS5 A;  3CXC O;  2BUO A;  1Q82 Q;  4XRQ A;  3G6E P;  4CA3 A;  4BPF A;  1MZ8 A;  2MD9 A;  2JYL A;  3I56 P;  4HKG A;  2EIA A;  2QA4 P;  1DV5 A;  1VQL P;  4XFY A;  3DPH A;  2M5R A;  2N5I A;  2GDW A;  1A8O A;  1KD1 Q;  3CCU P;  2KOS A;  1M90 Q;  3E2D A;  2KR5 A;  2KOP A;  4PXH B;  1EMV A;  2EG5 A;  2KGE A;  1YJN P;  2Z46 A;  3RG6 C;  1VQP P;  2MF4 A;  2JQ4 A;  1GXH A;  1NJI Q;  5KP8 B;  3DS3 A;  1S72 P;  2X2B A;  4XFX A;  4U0D A;  1RNI A;  2KG8 A;  1VHN A;  1K8A Q;  2GZJ A;  1RO0 A;  2Z44 A;  4MRT C;  3CPW O;  2LPK A;  2PEJ A;  2EFJ A;  2LIW A;  2ONT A;  4U0F A;  2FAD A;  1BAJ A;  2GZG A;  1KC8 Q;  3G28 A;  4H2W C;  2JU1 A;  2FVE A;  2MVV A;  4DG9 A;  3CC2 P;  2VLP A;  2FVF A;  2AVA A;  5KP7 B;  3VRL C;  4PH1 A;  2PY8 A;  1ZNV A;  5CZD B;  2KG9 A;  4U0E A;  2KGC A;  3M1M A;  2M8L A;  5HGL A;  4IZ6 A;  2LL8 A;  1K9M Q;  3CCM P;  2PEO A;  3CC7 P;  4WYM A;  3G29 A;  3RG2 A;  1QRJ A;  3CCQ P;  3DS1 A;  1HY8 A;  1UJZ A;  2N6Z A;  2JU2 A;  4QNB A;  2JB0 A;  1JJ2 O;  1Q86 Q;  3MGE A;  2LIU A;  3G71 P;  1RO2 A;  4IPY A;  2QNW A;  2FQ2 A;  5EJD A;  1AF8 A;  3B4Q A;  1QVG O;  4PWV B;  2FAC A;  1VKU A;  2MR7 A;  2XZ0 D;  2JGP A;  1M6E X;  2M8N A;  5F2O A;  2AF8 A;  2CNR A;  1EOQ A;  2BHV A;  3LRY A;  1VQO P;  2N98 A;  5KP6 B;  3LMO A;  1VQM P;  3G26 A;  1ZMB A;  2AFD A;  4R0M A;  5HGM A;  2P9X A;  2DGY A;  2PEN A;  4UHP B;  2K2Q A;  3CD6 P;  1A43 A;  1W2B O;  4PH0 A;  3G21 A;  2CWO A;  3EJD A;  1KQS O;  3G0V A;  1VQN P;  2K94 A;  3WBH A;  2NO8 A;  2K5X A;  2ERH A;  2XXM A;  2FQ1 A;  3CME P;  1YI2 P;  2EHT A;  5HGO A;  2KWL A;  3U43 A;  2GDY A;  2OTJ P;  1BXI A;  2GDX A;  2XZ1 C;  2GZF A;  4XRO A;  2JAZ A;  4U0C A;  3CCR P;  2KGD A;  4COC A;  2FVA A;  1GXG A;  3I55 P;  2L22 A;  3G1G A;  1VQ5 P;  3CMA P;  5JPA A;  1Q7Y Q;  3CE7 A;  1VQ7 P;  2K92 A;  4BPG A;  3H4E A;  2L0Q A;  1VQ6 P;  5EW5 E;  3DTJ A;  2VLN A;  3GZM A;  3DS4 A;  3H0D A;  2PEM A;  5BS2 A;  2LTE A;  3NY7 B;  3G4S P;  1AYI A;  1VQ9 P;  5I4T G;  4QKO A;  1YIJ P;  2JO0 A;  2CQ8 A;  1NQ4 A;  1UNK A;  2K0Y A;  1IMQ A;  2MY5 A;  3NTE A;  3CCE P;  2K0D X;  2E1M A;  2ROQ A;  4U0A A;  2KG6 A;  5HV8 A;  3DS0 A;  1QVF O;  3GKL C;  3G1I A;  1T8K A;  1L0I A;  1CEI A;  2CGQ A;  1L0H A;  2FHS C;  4GR6 A;  3OW2 O;  2KW2 A;  2PEQ A;  1X3O A;  3DS2 A;  2MVU A;  1M6N A;  1HQB A; 
#chains in the Genus database with same CATH homology
 1EIA A;  3H47 A;  4XFZ A;  4U0B A;  5DCK A;  2OTJ P;  3VRL C;  4PH1 A;  2PY8 A;  2XV6 A;  1YIT P;  4GR2 A;  4U0E A;  4XRO A;  1VQ4 P;  3M1M A;  2M8L A;  4U0C A;  3CCR P;  4M0I A;  1VQK P;  5HGL A;  1Q81 Q;  5BS1 A;  3Q20 A;  4COC A;  2OAR A;  1K9M Q;  5HGN A;  3I55 P;  2PEO A;  3CCM P;  1AUM A;  3CC7 P;  1YJW P;  4WYM A;  1YJ9 P;  3G1G A;  3G29 A;  5F2N A;  1N8R Q;  1VQ5 P;  3HZQ A;  1QRJ A;  3DS5 A;  3CXC O;  3CMA P;  3CCQ P;  3DS1 A;  2BUO A;  1Q82 Q;  4XRQ A;  3G6E P;  5JPA A;  4QNB A;  1Q7Y Q;  1JJ2 O;  1Q86 Q;  2JYG A;  1VQ7 P;  3MGE A;  2JYL A;  3I56 P;  2EIA A;  1M1K Q;  1IUQ A;  3H4E A;  2QA4 P;  1VQ6 P;  3CCL P;  2OTL P;  2LF4 A;  3G71 P;  1VQL P;  1RO2 A;  3DPH A;  4IPY A;  4XFY A;  3DTJ A;  1QVG O;  3DS4 A;  3H0D A;  2PEM A;  5F2K A;  5BS2 A;  3HYB A;  1A8O A;  1KD1 Q;  3CCU P;  1M90 Q;  1E6J P;  3E2D A;  2L6E A;  1M6E X;  2M8N A;  2PEI A;  2KOD A;  2M8P A;  3G4S P;  1VQ9 P;  5F2O A;  5I4T G;  3CCS P;  2EG5 A;  1K30 A;  1YJN P;  2Z46 A;  3RG6 C;  1YIJ P;  1VQP P;  2JO0 A;  1EOQ A;  2BHV A;  3LRY A;  1VQO P;  3CCV P;  1NJI Q;  1M74 A;  1K73 Q;  2XT1 A;  3DS3 A;  1S72 P;  1VQM P;  3G26 A;  1ZMB A;  4U0D A;  4XFX A;  2PEK A;  3NTE A;  5HGM A;  1VQ8 P;  3CCE P;  2P9X A;  2DGY A;  2PEN A;  2E1M A;  2QEX P;  4U0A A;  3DS0 A;  1RNI A;  5HGO A;  1QVF O;  3CCJ P;  3G1I A;  1K8A Q;  3CD6 P;  1RO0 A;  2Z44 A;  3B5I A;  1A43 A;  1W2B O;  3CPW O;  2PEJ A;  2EFJ A;  4PH0 A;  2ONT A;  4U0F A;  3G21 A;  2CWO A;  1KQS O;  3G0V A;  1D1D A;  1BAJ A;  1VQN P;  3WBH A;  1KC8 Q;  2Z45 A;  3G28 A;  3CC4 P;  1YHQ P;  2PEQ A;  3P05 A;  4GR6 A;  3OW2 O;  2XXM A;  3CME P;  3DS2 A;  4COP A;  1YI2 P;  1M6N A;  3CC2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...