3LRYA

Crystal structure of synthetic hiv-1 capsid c-terminal domain (cca)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
71
structure length
71
Chain Sequence
b'SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 capsid protein
publication title Limitations of peptide retro-inverso isomerization in molecular mimicry.
pubmed doi rcsb
molecule tags Viral protein
total genus 29
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3lryA00
4XFXA 3DS3A 2M8NA 1QRJA 5DCKA 3NTEA 4PH1A 2XT1A 4U0DA 2M8LA 5HGOA 3DS2A 4XRQA 4U0CA 4COPA 4COCA 1D1DA 3G21A 1A43A 3G28A 3DTJA 4U0AA 3H47A 4U0FA 4XROA 4PH0A 3DS1A 3DS0A 3G0VA 3G1IA 2EIAA 3MGEA 3G1GA 2XV6A 3VRLC 3DPHA 4XFZA 4U0EA 2ONTA 1A8OA 2BUOA 2LF4A 3G26A 4M0IA 2JO0A 2L6EA 4QNBA 1BAJA 1EIAA 1EOQA 3DS5A 1AUMA 3G29A 3LRYA 5HGLA 5HGNA 4WYMA 4U0BA 2JYLA 5I4TG 5JPAA 3H4EA 2KODA 2JYGA 3P05A 4XFYA 3DS4A 2M8PA 5HGMA 1E6JP 4IPYA 2XXMA
chains in the Genus database with same CATH superfamily
3CCSP 2GDXA 1QRJA 4BPFA 2L4BA 2M8LA 1M6EX 2FQ0A 3G0VA 3G1IA 2XV6A 2LIWA 1VQ4P 1T8KA 3G26A 2DNWA 4H2YC 5CZDB 1VQ5P 5HVCA 2M8NA 3CCRP 4U0DA 2GDWA 2CNRA 4U0CA 1M6NA 2KW2A 3HZQA 2LMLA 3DS1A 3E2DA 1ACPA 3H0DA 2KOOA 7CEIA 2AVAA 1Q81Q 1OR5A 3CCMP 1NJIQ 2NO8A 3Q20A 2M8PA 2VLQA 4GR6A 4XRQA 2LOLA 3H47A 3B4QA 2GZIA 2N50A 1YITP 2GZGA 4HKGA 1L0IA 2KR5A 2L6EA 1VKUA 2VLNA 1EIAA 2BHVA 2VLPA 1VHNA 4XFYA 3CCLP 2M5RA 2FAEA 2XZ1C 4NEOA 1K9MQ 3B5IA 4F37A 1A8OA 2FVFA 1KD1Q 2AF8A 2AFEA 2KG9A 3RG6C 2KODA 1RO2A 1NQ4A 2MD9A 4XFXA 1MZ8A 4PH1A 1HY8A 1L0HA 2JGPA 5KP8B 1N8RQ 2Z46A 2FHSC 3OW2O 4U0EA 2PEMA 2GYKA 2JAZA 3CCVP 1AUMA 4U0BA 1FR2A 1KQSO 2GDYA 1VQKP 2PY8A 1ZMBA 1Z6MA 2FQ1A 2N6ZA 1YI2P 2N6YA 1HQBA 2ONTA 1M1KQ 5HGLA 2VSQA 1BXIA 1M74A 2L9FA 2JYGA 5HGMA 1YJ9P 4IPYA 4DG9A 4BPGA 2K0XA 5BS1A 3DS2A 1IMPA 3CC7P 5KP6B 2AFDA 1VQPP 4UHPB 5KP7B 1IMQA 2LPKA 4H2XC 2JU1A 2CG5B 2MR8A 4CA3A 3CCEP 2VLOA 3CD6P 2L22A 3G71P 2P9XA 3G6EP 1RNIA 2K2QA 3EJEA 3G21A 2WPTA 4MRTC 4U0AA 3CCJP 2KWLA 5EJDA 2EIAA 3VRLC 5BS2A 1UNKA 1ZNVA 2JO0A 2KG8A 2KGAA 4QNBA 1VQ8P 2MVVA 5I4TG 2XXMA 1W2BO 2FADA 2FQ2A 1YIJP 3CCUP 2GZJA 2QNWA 1Q82Q 2N98A 2GZEA 3DS0A 3GZMA 2PEQA 4XFZA 2CGQA 2FACA 2MY5A 1EOQA 1VQNP 2DGYA 3H4EA 2EHSA 1QVFO 1UJZA 1RO0A 5HV8A 2KGDA 2E1MA 1VQ9P 2N5HA 2EHTA 1K73Q 1DV5A 2XZ0D 1K8AQ 2FVAA 3DPHA 2QA4P 4M0IA 2K0DX 3CC2P 1X3OA 1Q86Q 2MR7A 3I55P 2LKIA 3DS4A 1F80D 4GR2A 1AYIA 2PEOA 3G4SP 5HGOA 4COPA 2ROQA 4H2WC 4U0FA 4PH0A 2GZFA 3CMAP 3I56P 2L0QA 2LF4A 3M1MA 4PWVB 2JB0A 4BPHA 3EJBA 5EW5E 3CMEP 1KLPA 2K0YA 3CCQP 2PNGA 3LMOA 1YJWP 5DCKA 1EMVA 1D1DA 4COCA 5F2NA 1A43A 3G28A 5F2OA 1GXHA 2K92A 2KGCA 2KG6A 1K30A 1JJ2O 1DNYA 1BAJA 3LRYA 3CC4P 5HGNA 2OTJP 2JU2A 1E6JP 1GPJA 3GZLA 2LL8A 3U43A 1S72P 3NY7B 4IZ6A 2PEJA 2X2BA 1GXGA 3DTJA 2JBGA 2LTEA 1VQOP 1Q7YQ 4R0MA 1E0HA 2EG5A 3RG2A 4WYMA 3P05A 2OARA 2FVEA 2PEIA 2CWOA 3NTEA 2KOPA 3WBHA 2KGEA 2LIUA 2BUOA 1QVGO 1AF8A 3CE7A 2QEXP 1YHQP 2KORA 2OTLP 5F2KA 2KOSA 2XT1A 2CQ8A 2K94A 2KOQA 3MGEA 3G1GA 2Z44A 2MF4A 3EJDA 2JYLA 5JPAA 2JQ4A 1M90Q 2ERHA 3CPWO 1IUQA 2K5XA 3DS3A 1CEIA 1VQLP 2N5IA 1VQMP 1VQ6P 1KC8Q 2Z45A 2PENA 3CXCO 4XROA 4PXHB 4QKOA 1YJNP 3DS5A 3G29A 2K93A 3HYBA 2EFJA 2MVUA 2PEKA 1VQ7P 3GJNA 3GKLC
chains in the Genus database with same CATH topology
3CCSP 4XFXA 1QRJA 1S72P 4PH1A 1YIJP 2M8LA 3CCUP 2PEJA 1Q82Q 3DTJA 1N8RQ 1M6EX 3DS0A 3G0VA 3G1IA 2Z46A 2XV6A 3OW2O 2PEQA 4XFZA 4U0EA 2PEMA 1VQ4P 1VQOP 3G26A 1Q7YQ 3CCVP 1EOQA 2EG5A 1VQNP 1AUMA 4WYMA 4U0BA 2DGYA 3P05A 3H4EA 1VQ5P 1QVFO 1RO0A 2OARA 2E1MA 2PEIA 2CWOA 1VQ9P 2M8NA 1KQSO 3NTEA 3CCRP 4U0DA 3WBHA 4U0CA 1VQKP 1M6NA 1ZMBA 2PY8A 1K73Q 3HZQA 1YI2P 3DS1A 1K8AQ 3E2DA 3DPHA 2ONTA 2BUOA 2QA4P 4M0IA 1QVGO 1M1KQ 3H0DA 3CC2P 1Q81Q 5HGLA 2QEXP 1YHQP 1Q86Q 1M74A 3CCMP 3I55P 1NJIQ 2JYGA 5HGMA 1YJ9P 3DS4A 2M8PA 3Q20A 4IPYA 4GR2A 2OTLP 2PEOA 5F2KA 4GR6A 2XT1A 3G4SP 5BS1A 3DS2A 4XRQA 4COPA 5HGOA 3CC7P 3H47A 4U0FA 4PH0A 1VQPP 3MGEA 3CMAP 3G1GA 3I56P 2LF4A 1YITP 2Z44A 3M1MA 2L6EA 1EIAA 2BHVA 2JYLA 5JPAA 3CMEP 4XFYA 3CCQP 3CCEP 1M90Q 3CCLP 3CD6P 3CPWO 1IUQA 1YJWP 3G71P 2P9XA 3DS3A 1VQLP 5DCKA 1VQMP 3G6EP 1RNIA 1VQ6P 1D1DA 4COCA 2Z45A 1KC8Q 2PENA 3G21A 1A43A 3G28A 5F2OA 4U0AA 5F2NA 3CXCO 4XROA 3CCJP 2EIAA 1YJNP 1K9MQ 3B5IA 3VRLC 5BS2A 1A8OA 2JO0A 1K30A 1JJ2O 1KD1Q 4QNBA 1VQ8P 1BAJA 3DS5A 3G29A 3LRYA 3CC4P 3RG6C 3HYBA 5HGNA 2EFJA 5I4TG 2OTJP 2KODA 2PEKA 1VQ7P 1RO2A 1E6JP 2XXMA 1W2BO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFX A;  3DS3 A;  2M8N A;  1QRJ A;  5DCK A;  3NTE A;  4PH1 A;  2XT1 A;  4U0D A;  2M8L A;  5HGO A;  3DS2 A;  4XRQ A;  4U0C A;  4COP A;  4COC A;  1D1D A;  3G21 A;  1A43 A;  3G28 A;  3DTJ A;  4U0A A;  3H47 A;  4U0F A;  4XRO A;  4PH0 A;  3DS1 A;  3DS0 A;  3G0V A;  3G1I A;  2EIA A;  3MGE A;  3G1G A;  2XV6 A;  3VRL C;  3DPH A;  4XFZ A;  4U0E A;  2ONT A;  1A8O A;  2BUO A;  2LF4 A;  3G26 A;  4M0I A;  2JO0 A;  2L6E A;  4QNB A;  1BAJ A;  1EIA A;  1EOQ A;  3DS5 A;  1AUM A;  3G29 A;  3LRY A;  5HGL A;  5HGN A;  4WYM A;  4U0B A;  2JYL A;  5I4T G;  5JPA A;  3H4E A;  2KOD A;  2JYG A;  3P05 A;  4XFY A;  3DS4 A;  2M8P A;  5HGM A;  1E6J P;  4IPY A;  2XXM A; 
#chains in the Genus database with same CATH topology
 3CCS P;  2GDX A;  1QRJ A;  4BPF A;  2L4B A;  2M8L A;  1M6E X;  2FQ0 A;  3G0V A;  3G1I A;  2XV6 A;  2LIW A;  1VQ4 P;  1T8K A;  3G26 A;  2DNW A;  4H2Y C;  5CZD B;  1VQ5 P;  5HVC A;  2M8N A;  3CCR P;  4U0D A;  2GDW A;  2CNR A;  4U0C A;  1M6N A;  2KW2 A;  3HZQ A;  2LML A;  3DS1 A;  3E2D A;  1ACP A;  3H0D A;  2KOO A;  7CEI A;  2AVA A;  1Q81 Q;  1OR5 A;  3CCM P;  1NJI Q;  2NO8 A;  3Q20 A;  2M8P A;  2VLQ A;  4GR6 A;  4XRQ A;  2LOL A;  3H47 A;  3B4Q A;  2GZI A;  2N50 A;  1YIT P;  2GZG A;  4HKG A;  1L0I A;  2KR5 A;  2L6E A;  1VKU A;  2VLN A;  1EIA A;  2BHV A;  2VLP A;  1VHN A;  4XFY A;  3CCL P;  2M5R A;  2FAE A;  2XZ1 C;  4NEO A;  1K9M Q;  3B5I A;  4F37 A;  1A8O A;  2FVF A;  1KD1 Q;  2AF8 A;  2AFE A;  2KG9 A;  3RG6 C;  2KOD A;  1RO2 A;  1NQ4 A;  2MD9 A;  4XFX A;  1MZ8 A;  4PH1 A;  1HY8 A;  1L0H A;  2JGP A;  5KP8 B;  1N8R Q;  2Z46 A;  2FHS C;  3OW2 O;  4U0E A;  2PEM A;  2GYK A;  2JAZ A;  3CCV P;  1AUM A;  4U0B A;  1FR2 A;  1KQS O;  2GDY A;  1VQK P;  2PY8 A;  1ZMB A;  1Z6M A;  2FQ1 A;  2N6Z A;  1YI2 P;  2N6Y A;  1HQB A;  2ONT A;  1M1K Q;  5HGL A;  2VSQ A;  1BXI A;  1M74 A;  2L9F A;  2JYG A;  5HGM A;  1YJ9 P;  4IPY A;  4DG9 A;  4BPG A;  2K0X A;  5BS1 A;  3DS2 A;  1IMP A;  3CC7 P;  5KP6 B;  2AFD A;  1VQP P;  4UHP B;  5KP7 B;  1IMQ A;  2LPK A;  4H2X C;  2JU1 A;  2CG5 B;  2MR8 A;  4CA3 A;  3CCE P;  2VLO A;  3CD6 P;  2L22 A;  3G71 P;  2P9X A;  3G6E P;  1RNI A;  2K2Q A;  3EJE A;  3G21 A;  2WPT A;  4MRT C;  4U0A A;  3CCJ P;  2KWL A;  5EJD A;  2EIA A;  3VRL C;  5BS2 A;  1UNK A;  1ZNV A;  2JO0 A;  2KG8 A;  2KGA A;  4QNB A;  1VQ8 P;  2MVV A;  5I4T G;  2XXM A;  1W2B O;  2FAD A;  2FQ2 A;  1YIJ P;  3CCU P;  2GZJ A;  2QNW A;  1Q82 Q;  2N98 A;  2GZE A;  3DS0 A;  3GZM A;  2PEQ A;  4XFZ A;  2CGQ A;  2FAC A;  2MY5 A;  1EOQ A;  1VQN P;  2DGY A;  3H4E A;  2EHS A;  1QVF O;  1UJZ A;  1RO0 A;  5HV8 A;  2KGD A;  2E1M A;  1VQ9 P;  2N5H A;  2EHT A;  1K73 Q;  1DV5 A;  2XZ0 D;  1K8A Q;  2FVA A;  3DPH A;  2QA4 P;  4M0I A;  2K0D X;  3CC2 P;  1X3O A;  1Q86 Q;  2MR7 A;  3I55 P;  2LKI A;  3DS4 A;  1F80 D;  4GR2 A;  1AYI A;  2PEO A;  3G4S P;  5HGO A;  4COP A;  2ROQ A;  4H2W C;  4U0F A;  4PH0 A;  2GZF A;  3CMA P;  3I56 P;  2L0Q A;  2LF4 A;  3M1M A;  4PWV B;  2JB0 A;  4BPH A;  3EJB A;  5EW5 E;  3CME P;  1KLP A;  2K0Y A;  3CCQ P;  2PNG A;  3LMO A;  1YJW P;  5DCK A;  1EMV A;  1D1D A;  4COC A;  5F2N A;  1A43 A;  3G28 A;  5F2O A;  1GXH A;  2K92 A;  2KGC A;  2KG6 A;  1K30 A;  1JJ2 O;  1DNY A;  1BAJ A;  3LRY A;  3CC4 P;  5HGN A;  2OTJ P;  2JU2 A;  1E6J P;  1GPJ A;  3GZL A;  2LL8 A;  3U43 A;  1S72 P;  3NY7 B;  4IZ6 A;  2PEJ A;  2X2B A;  1GXG A;  3DTJ A;  2JBG A;  2LTE A;  1VQO P;  1Q7Y Q;  4R0M A;  1E0H A;  2EG5 A;  3RG2 A;  4WYM A;  3P05 A;  2OAR A;  2FVE A;  2PEI A;  2CWO A;  3NTE A;  2KOP A;  3WBH A;  2KGE A;  2LIU A;  2BUO A;  1QVG O;  1AF8 A;  3CE7 A;  2QEX P;  1YHQ P;  2KOR A;  2OTL P;  5F2K A;  2KOS A;  2XT1 A;  2CQ8 A;  2K94 A;  2KOQ A;  3MGE A;  3G1G A;  2Z44 A;  2MF4 A;  3EJD A;  2JYL A;  5JPA A;  2JQ4 A;  1M90 Q;  2ERH A;  3CPW O;  1IUQ A;  2K5X A;  3DS3 A;  1CEI A;  1VQL P;  2N5I A;  1VQM P;  1VQ6 P;  1KC8 Q;  2Z45 A;  2PEN A;  3CXC O;  4XRO A;  4PXH B;  4QKO A;  1YJN P;  3DS5 A;  3G29 A;  2K93 A;  3HYB A;  2EFJ A;  2MVU A;  2PEK A;  1VQ7 P;  3GJN A;  3GKL C; 
#chains in the Genus database with same CATH homology
 3CCS P;  4XFX A;  1QRJ A;  1S72 P;  4PH1 A;  1YIJ P;  2M8L A;  3CCU P;  2PEJ A;  1Q82 Q;  3DTJ A;  1N8R Q;  1M6E X;  3DS0 A;  3G0V A;  3G1I A;  2Z46 A;  2XV6 A;  3OW2 O;  2PEQ A;  4XFZ A;  4U0E A;  2PEM A;  1VQ4 P;  1VQO P;  3G26 A;  1Q7Y Q;  3CCV P;  1EOQ A;  2EG5 A;  1VQN P;  1AUM A;  4WYM A;  4U0B A;  2DGY A;  3P05 A;  3H4E A;  1VQ5 P;  1QVF O;  1RO0 A;  2OAR A;  2E1M A;  2PEI A;  2CWO A;  1VQ9 P;  2M8N A;  1KQS O;  3NTE A;  3CCR P;  4U0D A;  3WBH A;  4U0C A;  1VQK P;  1M6N A;  1ZMB A;  2PY8 A;  1K73 Q;  3HZQ A;  1YI2 P;  3DS1 A;  1K8A Q;  3E2D A;  3DPH A;  2ONT A;  2BUO A;  2QA4 P;  4M0I A;  1QVG O;  1M1K Q;  3H0D A;  3CC2 P;  1Q81 Q;  5HGL A;  2QEX P;  1YHQ P;  1Q86 Q;  1M74 A;  3CCM P;  3I55 P;  1NJI Q;  2JYG A;  5HGM A;  1YJ9 P;  3DS4 A;  2M8P A;  3Q20 A;  4IPY A;  4GR2 A;  2OTL P;  2PEO A;  5F2K A;  4GR6 A;  2XT1 A;  3G4S P;  5BS1 A;  3DS2 A;  4XRQ A;  4COP A;  5HGO A;  3CC7 P;  3H47 A;  4U0F A;  4PH0 A;  1VQP P;  3MGE A;  3CMA P;  3G1G A;  3I56 P;  2LF4 A;  1YIT P;  2Z44 A;  3M1M A;  2L6E A;  1EIA A;  2BHV A;  2JYL A;  5JPA A;  3CME P;  4XFY A;  3CCQ P;  3CCE P;  1M90 Q;  3CCL P;  3CD6 P;  3CPW O;  1IUQ A;  1YJW P;  3G71 P;  2P9X A;  3DS3 A;  1VQL P;  5DCK A;  1VQM P;  3G6E P;  1RNI A;  1VQ6 P;  1D1D A;  4COC A;  2Z45 A;  1KC8 Q;  2PEN A;  3G21 A;  1A43 A;  3G28 A;  5F2O A;  4U0A A;  5F2N A;  3CXC O;  4XRO A;  3CCJ P;  2EIA A;  1YJN P;  1K9M Q;  3B5I A;  3VRL C;  5BS2 A;  1A8O A;  2JO0 A;  1K30 A;  1JJ2 O;  1KD1 Q;  4QNB A;  1VQ8 P;  1BAJ A;  3DS5 A;  3G29 A;  3LRY A;  3CC4 P;  3RG6 C;  3HYB A;  5HGN A;  2EFJ A;  5I4T G;  2OTJ P;  2KOD A;  2PEK A;  1VQ7 P;  1RO2 A;  1E6J P;  2XXM A;  1W2B O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...