3LS2A

Crystal structure of an s-formylglutathione hydrolase from pseudoalteromonas haloplanktis tac125
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
278
structure length
278
Chain Sequence
LENISSVKVSGGWHKQYTHSAVSTHCTMRFAVFLPPGASESNKVPVLYWLSGLTCTDENFMQKAGAFKKAAELGIAIVAPDTSPRGDNVPNEDSYDFAQGAGFYVNATQAPYNTHFNMYDYVVNELPALIEQHFPVTSTKAISGHSMGGHGALMIALKNPQDYVSASAFSPIVNPINCPWGVKAFTGYLGADKTTWAQYDSCKLMAKAEQSNYLPMLVSQGDADNFLDEQLKPQNLVAVAKQKDYPLTLEMQTGYDHSYFFISSFIDQHLVFHHQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an S-formylglutathione hydrolase from Pseudoalteromonas haloplanktis TAC125.
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
molecule keywords S-formylglutathione Hydrolase
total genus 93
structure length 278
sequence length 278
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ls2A00
1TIBA 2CB9A 4AO6A 3W05A 2GBFA 4H7EA 4AMZA 3ESBA 5EHZA 3WK8A 1XZDA 2XLBA 5AKLA 5I9IA 5FPQA 3ZV7A 4DSAA 4K6GA 1KU6A 1BS9A 4BZZA 1VA5A 2CJPA 1SCKA 5ALGA 3KD2A 1ZJ4A 1LPAB 2VQ6A 5EIAA 2AJ8A 5IVHA 1NX9A 5HFAA 5D7BA 3I6YA 2DQYA 4YPVA 3I1YA 4TPKA 4PNZA 3BWXA 2QXTA 3O4HA 5IKXA 3C5VA 4AO8A 5E2IA 5LP1A 3IUNA 3DOIA 2IITA 3PICA 4J0JA 5ALKA 1CFJA 3STVA 4JYMA 3STYA 1VA4A 4X00A 2AJBA 3GELA 3WKBA 4ARBA 2WFMA 3QH4A 1XFDA 3WKDA 3RLIA 4N8SA 4XIIA 3ESAA 3DKRA 5JYCA 4X93A 3WK6A 4BC0A 3AIOA 2K2QB 1XRPA 3QMVA 2PUJA 3C70A 1AKNA 1Q0RA 1ETHA 5E4TA 4W9RA 4QNNA 4QA9A 4ZRDA 5CRIA 3FLAA 4Z49A 3IA2A 1CR6A 1UOPA 1CUHA 1VE7A 4KAAA 3MUOA 3ICVA 1XZKA 1ODCA 3WMRA 4X95A 1ACLA 3AUKA 2XUPA 1W76A 5ALRA 3WKEA 2B20A 3FYTA 2QJRA 4WY8A 3VKFA 4BP8A 5JZ9A 1X2BA 4DTCA 5C8VA 2O7VA 4LKOA 4C88A 2XUFA 3WL8A 5FV4A 2HU5A 1F0NA 2O2GA 5ALJA 4B81A 5AM2A 3HACA 2I78A 3HABA 2PU7A 4ZI5A 1EINA 2HL6A 5JASA 5A6VA 2WJ3A 1VXOA 4N8EA 2GZSA 4JH0A 5FP0A 1CUCA 1N5MA 4Q3LA 3A70A 4B9EA 4XX1A 4EY5A 5AO9A 4QDTA 4H35A 5HKBA 4J03A 3QZUA 1C4XA 2HIHA 2XMSA 2ZYSA 2WU3A 4YX9A 1GPLA 3L1HA 1Y37A 2EDAA 4OU5A 5A2GA 1AX9A 2FX5A 2AJCA 1LNSA 2QUAA 3I2IA 4HVTA 5CXXA 3G7NA 3PUIA 1DT5A 3I28A 1SC9A 4FKBA 1EH5A 4BVLA 1VKHA 5HKAA 4UFNA 1DT3A 3WLAA 1EHYA 4P92A 1M33A 5A7GA 3ANSA 1FFEA 4BRSA 3C45A 5HK8A 4FLEA 1THGA 1XQWA 2J3QA 1YB6A 5JANA 3ZLTA 5ALHA 4KR0A 4DNFA 5AKEA 1AQLA 4FMPA 1W1IA 2Z5GA 1QO9A 2H7XA 2VA9A 4BDSA 3OTQA 1K63A 4ZV9A 4QZVA 1WM1A 4UHBA 5FPPA 4FNGA 4JEIA 2EEPA 2ZJ7A 2OAGA 5A71A 3CN7A 4FTWA 5ALWA 1BEZA 1LZLA 2G5PA 2V98A 1J1IA 3HI4A 1JT2A 5HQ3A 1WPRA 2WG1A 5A7FA 4GBGA 2FJ0A 4UBNA 4IQ4A 1QIFA 2XMZA 2WG0A 3IB3A 4EB0A 3R41A 2H9YA 2VSQA 2G4LA 1EB9A 4S0XA 3HZOA 5DTJA 3D5EA 2C5GA 2QUBA 1SCQA 5BV7A 5K3CA 3D3NA 1UFOA 1XQVA 2IIVA 3R3WA 3RM3A 1JU3A 2VT6A 3W2TA 1ZGCA 4UFOA 1N8SA 2HA4A 4GW3A 3OC0A 5ALTA 4I3FA 4LXHA 3S8YA 5AOAA 3WWOA 2XE4A 5K3FB 1UK9A 1QLWA 2YXPX 1BN7A 1TQHA 4LXIA 3JWEA 1LLFA 2JBWA 3WKAA 4NVRA 5IVDA 2ACKA 2HRRA 5EFZA 1AUOA 2RIPA 4DIUA 5BWCA 1P0QA 5CT6A 1DWPA 2G5TA 4G9EA 1G66A 3WIOA 4ARAA 2XQIA 4KAJA 2ONCA 5HQ3B 4GECA 4HS9A 3FLBA 3IBTA 4Q1VA 3QVMA 2GYUA 4QLOA 1QJ4A 5LKAA 1CUVA 1Q84A 4C87A 5LIPA 1WB6A 3CXUA 1E89A 1KEZA 1U65A 2B9VA 2QM0A 4KEAA 3FOBA 3F97A 3I6MA 5CH8A 4BTVA 3C6BA 3WA6A 4X85A 3D59A 5LZ9A 3OG9A 5FXMA 5CT9A 4CCWA 1CUXA 2PKYX 4JYPA 4FFVA 4AQDA 2WG2A 3WWCA 3H19A 4JUIA 4RPCA 5CTAA 1GQSA 1YAJA 4AN0A 1J06A 4O08A 5AK4A 2BFNA 5HF9A 3DS8A 1ZD2P 2CKMA 3FYUC 3FWHA 4DNQA 3BL8A 5ALQA 2W6CX 3H0CA 1H2YA 3HXKA 3WK9A 4BYMA 5LZ4A 3D2AA 4QWMA 4WFIA 4DMKA 1N5RA 1AC5A 5CH5A 1Q0ZA 2JF0A 5DLPA 3BDVA 1UKAA 3WIBA 4UPDA 1LGYA 2IX9A 3M83A 1MAAA 4G9GA 2WIDA 5K3AA 5AI9A 3O4JA 5AOCA 1U2EA 3EBLA 5JD4A 2WQZA 4UBLA 1QE3A 3VVLA 5DYTA 2HA6A 5C7YA 2XUQA 5ALZA 3ZLUA 2AJLI 4X6YA 2X8BA 4KRXA 1ZICA 3UUFA 2JEZA 5SYMA 4WFKA 3C6XA 5AK3A 3N0TA 4KACA 5LZ2A 3F67A 5D3KA 5ALIA 4RGYA 1ZGBA 5AM4A 5AOBA 3KSRA 4MYSA 5T4FA 1XLWA 2I3DA 4UBKA 2XMDA 4B0PA 1XLUA 5HK9A 3SWWA 3ANTA 1MTZA 5JZSA 3EIOA 1BEEA 2VTVA 4UBIA 4WFJA 1DWOA 1P0PA 2JGMA 2RHTA 3WJ1A 2OGSA 3B3QA 1FFCA 2Q0XA 2Z3WA 4MQMA 1T2NA 3O95A 1W4LA 1E3QA 3VDXA 4OYYA 2GYVA 1RP1A 4BRZA 3SK0A 1IMJA 3ESCA 2XQGA 3STWA 2ZYRA 1MAHA 2JGLA 1WB5A 3FVTA 5AK5A 1CUAA 3T4UA 1OILA 5F4ZA 2PSFA 2WHQA 3BE8A 4HTAA 4CIAA 4AMYA 1CUZA 5AK6A 4BTLA 3F8SA 2UZ0A 2XUOA 4CCYB 4QE3A 4N5HX 3GZJA 3I6ZA 4L3WA 4EBBA 3V1KA 4B85A 4B84A 1CUJA 1LBTA 4BE4A 4J3JA 3WL7A 3DDUA 4F21A 1YA4A 1EI9A 4Y2PA 1VJ5A 4FBLA 1XRRA 1CVLA 2HU8A 3AFIA 3DCNA 5FLKA 2ZVDA 1EA5A 1GGVA 3DL4A 4X71A 3BF7A 2YYSA 3L1JA 5ALYA 5J3JA 4OCZA 4QDUA 1XZEA 1J07A 5AP9A 4IHAA 4E15A 4Y2YA 3UMJA 2CZQA 3FVRA 1QFMA 1VLQA 3ED1A 5ESRA 4ZV7A 4Y2VA 2OQIA 2WSLA 1CUIA 4OB7A 5LZ5A 1H23A 2VF2A 3LS2A 5HF6A 1CUYA 1UKCA 3JYHA 4BCCA 1BU8A 1USWA 3IIIA 4KE8A 5AH0A 5CW2A 4UHCA 1MNQA 4W1PA 1XZLA 4X3CA 2BUBA 4XJVA 2CEKA 5T4EA 1QIDA 3H2IA 1FSSA 4W1QA 4U2EA 2C5FA 3DNMA 3FAKA 2JGFA 1XZJA 4IH1A 2RGUA 4F5ZA 5AI4A 1BROA 1TCAA 1TCCA 3FYUB 4ZREA 5DNVA 2ZJ6A 2Z8XA 2C58A 3H2JA 4BP9A 1R88A 1P0MA 1SFRA 1A8UA 4CG2A 3BF8A 2RI6A 3G0DA 3KWJA 2PUHA 3O9VA 2HA7A 3K2IA 3OURA 4H18A 2J3DA 1FFBA 5JADA 4TGLA 1UWCA 4BAZA 1E8DA 1QIMA 2P8SA 2HA5A 3STTA 1R4ZA 4MXDA 1W52X 3AIKA 3PFBA 1KU0A 1U8EA 1GQRA 1JJBA 2XI4A 4J0DA 2V96A 4AO7A 5ALNA 4Q3OA 1DINA 2QXUA 4OUKX 1QIEA 2JGIA 5AKJA 4CG3A 5JD6A 2HHAA 3L1IA 1ORWA 4CI9A 4BVJA 5CMLA 1IUPA 1A7UA 1EK2A 4L9AA 2RAUA 3KDAA 3FSGA 1YS1X 4DYHA 1BCRA 1FFDA 3M82A 3H04A 2BUCA 5AICA 2GZRA 1ZI9A 3DD5A 2WHPA 4PO3X 4WDRA 2O2IA 4Y2QA 4BBZA 1HKHA 1UK8A 1XRNA 2OQVA 2FUKA 4I19A 3YASA 4PW0A 1UXOA 2XLCA 4LYEA 4X92A 3WJ2A 4U2DA 4E11A 3G0GA 5ALMA 1XKTA 3SC2A 1R3DA 5DYWA 1XQYA 2OLEA 4ZXFA 4B7ZA 4B80A 3WWEA 5CURA 3AIMA 1IVYA 1LPNA 3VJLA 5ALXA 4J0CA 4QDZA 5ALFA 3QPCA 1MPXA 4G4IA 2W22A 4BB0A 3R3UA 3EQ9A 4G8BA 4Y9SA 4ETWA 2I03A 5I8PA 1TAHA 1EXWA 4GLBA 1JKMA 1DQYA 1S8OA 4EHBA 2PSDA 1YA8A 5BWBA 1JJIA 3FYUA 4Y2SA 3D7RA 4P08A 3IUQA 5IVIA 3G9ZA 4K2AA 2DHCA 5ALDA 1GPKA 2ACEA 1YS2X 4AB1A 3PF8A 3QMWA 4Q05A 1DX4A 1EVEA 2XMGA 4BDTA 4MYDA 2QMQA 4DMFA 3G9UA 4H7HA 4BE9A 1XZHA 1ISPA 2Y1KA 1ORVA 1MX5A 1O6FA 4PQEA 2WFLA 4EY7A 4EA6A 4HXGA 3G8YA 2C0PA 2ORYA 2ROQA 1YB7A 1H22A 3LCRA 5ALOA 3ZPXA 1EK1A 1G42A 3O4IA 4KE6A 1WHSA 2WJ6A 2WTMA 4J7AA 4C89A 4U2CA 1CLEA 1JMKC 2XUKA 4FWBA 3KXPA 4QLAA 3V1NA 2Z3ZA 1T4MA 2FJPA 1CUGA 3W9BA 4LIPD 5CBKA 2BAGA 1DTEA 4DNOA 3DLTA 5ALSA 2ZJFA 4A5SA 2OPHA 4Q34A 2OGZA 2WUGA 4HAIA 3TEJA 1N1MA 2GYWA 2QR5A 1P0IA 4LXGA 4C4XA 1C7JA 3BIWA 1VE6A 4FOLA 4RE6A 4Y2JA 4UBJA 2QKYA 3WWDA 4HZGA 1CUBA 2O2HA 5ISMA 2RHWA 4K6HA 3CCCA 5EIEA 1UKBA 4UHEA 2WIKA 4DGQA 3QPDA 3C87A 4GXNA 5DNWA 1E66A 4FBMA 4EY4A 2QT9A 4KE7A 5C8XA 3BXPA 3WQHA 2WJ4A 4GEGA 2V9ZA 4J0IA 4IH4A 1EB8A 1IUOA 2PX6A 3ZLVA 1ZIYA 1CUWA 5ALPA 4PSCA 4G8DA 4ITVA 1XRLA 3ICWA 5K3BA 1QTRA 4A16A 2H1IA 5YASA 3I2JA 1C7IA 1CEXA 3RARA 5AIBA 4PSDA 2HU7A 3HEAA 4FNMA 5AI8A 2G63A 1IZ8A 4HXEB 2PPLA 2XQKA 5JAPA 4X6XA 2HA0A 3TRDA 1ZD4A 3P2MA 3EQ7A 1MT3A 1NU8A 4G4JA 3C43A 3DEAA 5JAHA 4H7IA 3HYSA 2PSEA 3C6YA 1QGED 1D07A 3W06A 4TVKA 3D4LA 3WZLA 2HRQA 1K4YA 3I2GA 4OPMA 2ZSHA 3QITA 3E1GA 1YR2A 5AKKA 1LPPA 3U1TA 4AZ0A 5A62A 3HJUA 5BOVA 2XQJA 3OM8A 4P9NA 3RK4A 1XRMA 3T52A 4C4YA 2D5LA 2D0DA 1Z68A 2AJDA 2C0QA 4BATA 4HXFB 1TRHA 3FLEA 3AINA 2VATA 2OAEA 3WK4A 2WILA 2XT0A 4MWTA 3MUNA 4L0CA 3NWOA 2XQFA 1LZKA 1AGYA 1JJFA 1CIJA 3N2ZB 3O9MA 2PU5A 1R50A 1ZI6A 5KBYA 5AKHA 2C7BA 5K3EA 2WFLB 2J4FA 1WOMA 5K3DA 2ZYIA 3FCXA 4U2GA 4UBMA 4WY5A 3GFFA 3K9BA 2XUIA 5CH3A 5EHNA 3H1AA 2VT7A 2WLSA 1BCSA 3R3VA 3WYNA 3BJMA 2XDWA 4L72A 2ZYHA 5JATA 1TK3A 1PFQA 1L7AA 1WHTA 1FJ2A 3DYIA 5DTIA 2BJHA 5AIAA 4MQLA 3A6ZA 5KWIA 5DJ5A 2JGEA 4CG1A 4MEBA 4KJXA 3PDCA 1YAHA 6YASA 1X70A 1QOZA 7YASA 3DKKA 3PF9A 5FRDA 5AKYA 1ZD5A 2XUDA 1ZJ5A 4DLNA 2VJBA 5JIBA 2JIDA 2HDWA 1ODSA 2VJCA 4UUQA 5ALLA 2DHEA 3IVMA 1AZWA 5FOQA 1DWQA 5HCUA 1TKRA 4Q82A 2OCIA 3U0VA 3OOSA 5IVKA 5HF5A 3FNBA 4EZIA 5JARA 3M81A 4QDOA 5D3ZA 4C6HA 3AILA 1QZ3A 2Z8ZA 2DQZA 4EY6A 2H7YA 5H3HA 1QIHA 3WA7A 1UT6A 5AKGA 1CPYA 1ZIXA 4H7FA 1LPSA 1DU4A 4CFSA 2WHPB 5LZ8A 2VAVA 2XB6A 4X91A 3IUJA 3I2HA 1BN6A 5K5EA 2NW6A 4NMWA 4BC1A 4Y2TA 3WL6A 2XMRA 1E8NA 1K6EA 4KYVA 1A8SA 5CT4A 3GBSA 1LBSA 4OB6A 1UOQA 3JW8A 2CUTA 1GPNA 5AHXA 4HRXA 2LIPA 1HQDA 3BIXA 2OGTA 3FCYA 4BZWA 1XZAA 5C81A 1FFAA 5LKRA 1PV1A 4DM7A 1K8QA 3QPAA 1XZBA 2HFKA 4MEAA 3V1LA 4CIBA 1BRTA 1XQXA 3G0CA 4K5QA 3LIIA 4FFWA 2ZSIA 1ZOIA 4QWWA 3H17A 3AJAA 2R11A 1UOOA 3H18A 3MGAA 2WTNA 5FDFA 2GBGA 4F0JA 2ES4A 1GZ7A 4H7DA 1MU0A 2Y2UA 1MX1A 4J0HA 1DQZA 4QEKA 3R3YA 2GBIA 3HSSA 2QZPA 1B6GA 4B82A 5AM0A 2QS9A 5HZGA 4UHHA 2XMBA 4I4CA 4WDQA 1LPOA 3FSGD 3HLKA 3ZWQA 4K6KA 2DCMA 3G0IA 3CN9A 3W9UA 3UUEA 2Y6VA 4PF1A 1MN6A 4MWSA 1H2XA 4W1SA 4B0OA 2XUAA 1YCDA 2EDCA 3ESDA 3AZOA 2OCLA 1ACJA 3WK5A 4WJLA 3PE6A 2DFPA 4AN1A 2JGJA 1MO2A 4YK7A 3E4DA 3GROA 3IDAA 4B83A 1CQZA 2DHDA 5JD5A 4QDXA 1CUEA 2HA2A 4Q3KA 1CRLA 2JEYA 4BVKA 3E3AA 3HRHA 1JMYA 4G1FA 1EDBA 2OG1A 2WHRA 3TJMA 1VOTA 4GDMA 1HBJA 1DX6A 3V1MA 4C4ZA 2OCGA 3IURA 2BCEA 2BKLA 1RWQA 3WK7A 1W6RA 1MX9A 1YASA 4XWGA 4FHZA 1G5FA 5AM1A 1XRQA 5AI5A 5E4JA 2VAXA 1VZ3A 4J0KA 3BDIA 4IO0A 1F0PA 1RYYA 1THTA 5LZ7A 1QO7A 1QTIA 2O7RA 5I7UA 2YASA 1CUFA 1ZI8A 5EIHA 3Q8WA 3AZPA 3NOXA 3RKSA 4BCBA 1GT6A 4X94A 1SCIA 4G5XA 4BCDA 5DWDA 3SX4A 1BE0A 5DNUA 3H2HA 4UFPA 4CCYA 4RNCA 4GI1A 1XLVA 1QFSA 1UZAA 3AZQA 2J4CA 5T4HA 4B9AA 2WU4A 1VXRA 4YASA 3C8DA 3STUA 2QTBA 3GUUA 2XMCA 4NS4A 3PFCA 3QMMA 4DMHA 2WIJA 5DYYA 2BGNA 5FKJA 2GBCA 1EVQA 5IH7A 1QIIA 1JFRA 4M0MA 3FBWA 2AXEA 2BUAA 1EDEA 1L7QA 1W75A 4H77A 2BGRA 3VJMA 1HPLA 5KREA 3WZMA 3W04A 1H2WA 4X90A 4X97A 2VEOA 3CCBA 2PM8A 3WKCA 4DNPA 5CT8A 2OXEA 3QYJA 1F8UA 5AKXA 3DYVA 1XROA 4HRYA 5AKIA 1TCBA 3M3DA 3A2LA 4FDMA 5AKZA 2C4HA 1R9NA 3PUHA 4V2IA 5EHQA 3NUZA 1ODTC 1F6WA 1XZCA 1QIGA 4DMCA 4EUSA 1I6WA 4PSUA 4GHWA 2PVSA 2WUEA 4G8CA 1NU6A 2WM2A 2VJAA 1JI3A 3G0BA 3MVEA 2I3ZA 1CV2A 2R8BA 4J0GA 5D6OA 3F96A 3WI7A 1L7RA 1AURA 4GWLA 3QM1A 3ILSA 1CUDA 4RE5A 1WPXA 5AM3A 2PSJA 3DQZA 1SOMA 3IUMA 2HM7A 3C8HA 3ZI7A 2HA3A 4F60A 3V48A 1XZGA 1UK6A 2QOEA 5LYYA 4ROTA 1OXMA 3H2GA 1EDDA 3I2KA 5EI5A 4H7KA 2B4KA 1QIJA 1E8MA 4KAFA 2VJDA 2X76A 3WWPA 5ALUA 3A2NA 3C6ZA 4X6UA 4C01A 4BAGA 2YH2A 2CMFA 5C8ZA 1ZD3A 5E4YA 4DSZA 3EF3A 3D0KA 1XZMA 5EGNA 3OPMA 1MNAA 4P93A 5HFNA 5LLSA 1A88A 5A7HA 3BJRA 4BAUA 4D9JA 3HC7A 4G4GA 3NGMA 4M0EA 1J2EA 2PL5A 3KOOA 3Q0TA 4NZZA 4WCVA 1AMNA 4Y2RA 2HADA 1HDEA 1WCYA 3I1IA 1GXSA 2WKWA 1LPBB 3TGLA 3O4GA 1WB4A 1JU4A 4AX4A 1Y7IA 3LLCA 4H7JA 1LPMA 4FLFA 3VISA 4OU4A 1G4HA 1EX9A 2DSNA 4B6GA 3X3HA 1CUUA 5CXUA 3B5EA 1B41A 1XZIA 2JGKA 1CQWA 5AI6A 5T4BA 3D2BA 1XZFA 4KRYA 2X5XA 4E14A 3R0VA 4EY8A 4H0CA 3I2FA 4UHDA 3STXA 3V9AA 1HL7A 4KE9A 2V97A 4XVCA 1PJAA 3A2MA 5SYNA 5ALVA 4Y2XA 2H7CA 5EHXA 1GKLA 2QVBA 4U2BA 2Y6UA 1U4NA 3K6KA 3G02A 2XUHA 3WL5A 2OCKA 4UHFA 2PSHA 2QJWA 1CUSA 2E3JA 1R9MA 5JALA 3LIPA 3VXKA 1QIKA 4ZGBA 3VJKA 3H1BA 5JAUA 1QONA 4LHEA 3C5WP 3GA7A 4FLMA 1Q83A 4JNCA 1XKLA 3R40A 5HF8A 4U2FA 3D2CA 3IULA 3DJYA 3F9CA 4UBOA 3VVMA 5JZBA 3O0DA 1A8QA 4X7BA 3E0XA 4W63A 3DOHA 3S2ZA 2HFJA 2WUFA 4A23A 2WIGA 3PI6A 2ECFA 5AM5A 5CT5A 4LYDA 5JAOA 3KWFA 1H2ZA 1X2EA 3G9XA 4IH9A 4ZWNA 4OSEA 2XMQA 3B12A 1HLGA 3R3XA 1VZ2A 4Y2UA 1R1DA 4Y7DA 2B61A 1IZ7A 4AXBA 4INZA 3LP5A 1O6GA 2PBLA 4OB8A 2CBGA 4MJ3A 2QRUA 1GKKA 3R3ZA 5K3FA 4OYLA 2RONA 4AZ3A 3H2KA 4W1RA 2WIFA 1Y7HA 3QBJA 3G9TA 2WUDA 2DR0A 5AJHA 4M0FA 4N8DA 5AI0A 3EQ8A 5ALEA 5FUMA 2WFZA 4E46A 4PV7A 2XUJA 1OCEA 1K5PA 4OD0A 3DL7A 1MJ5A 2Y2VA 3WYDA 3F98A 2XUGA 4N5IX 1E5TA 1IUNA 5KWJA 1UK7A 1YSCA
chains in the Genus database with same CATH superfamily
1TIBA 5HM8A 2CB9A 4O4JA 2NU7A 1FFXB 4G1BA 5CDGA 4P36A 1M1XB 3ZE9A 1O9GA 4OFZA 1E62A 3QKUA 1MB4A 1WF6A 1SQGA 4B31A 1JHMA 3L7AA 3FE2A 2FN9A 1OX6A 2PYDA 1KXZA 1Z8DA 2AKYA 3NHZA 4KQ1A 1SVWA 2CVFA 3N8HA 4QOGA 1EWRA 4DL9A 2ZB3A 4HB4A 2YZMA 2WRZA 1KVQA 1TFUA 3BWBA 3NORA 3QFHA 2R3SA 3BH7A 3NW9A 4Q93A 4QUEA 4IGKA 4UMVA 5CB4A 2SNIE 2POCA 2IZ0A 4FFLA 3ER9A 4PX2A 4U9UA 3TBKA 1GAWA 4Y3UA 3ZV7A 4MKHA 1OPXA 3CO5A 3R7SA 4CI9A 2HHCA 5K0BA 4IYRA 3BCUA 5CA1F 3WLEA 2CVPA 1UJBA 4K40A 3V4RA 4BKRA 4RD2A 4B6JA 1E9EA 2D5IA 2CJPA 4FOOA 4POAA 4DWOA 1IBRA 4ENTA 1SCKA 5ALGA 3LXUX 1S8NA 2J31A 3GPIA 3FDIA 3WB2A 4EHLA 4QJ3A 3CRZA 3RIXA 3PSAA 1YBMA 4UTRA 1QNFA 2YHSA 3SYMA 1ULSA 1ZJ4A 4C20A 4KV9A 4L95C 4FFNA 4TYYA 5HFJA 3R7BA 3RASA 2C29D 3EPJA 3ZD7A 2VQ6A 5EIAA 1E5LA 3W5IA 2JIZA 5HTKA 2PX4A 4R9UC 1JSCA 2AVDA 2VDNB 4TS3A 5IVHA 3BT7A 4FT4A 3EVBA 3Q9SA 2CYCA 1FYWA 3EXIB 4WN9A 3D81A 3S5JA 2DECA 1KC1A 3AI7A 2FPIA 3DGEC 1HQKA 1C8VB 3AP3A 5LJLA 5B1DA 4B3HA 3LV8A 4BWVA 2QM7A 4ZOLA 3BWMA 3ED5A 2HB6A 2GDZA 3CLTC 4LCBA 2A78A 1F2TB 1GTVA 3HCPA 4TROA 4DA0A 3VI3B 3O4HA 4EAAA 3ZE6A 1R10A 2I8CA 4LHVA 4Y6LA 4Z2AA 4AO8A 3EOAI 5E2IA 3FTCA 1CQIB 1XNQB 4HVLA 1EQ2A 3W90A 3KFLA 4NCJA 4IMJB 2Q4RA 1Z56C 3PRYA 1V96A 1UBUS 1PR3A 4AWXA 3LHIA 4FVTA 2TYSB 1ZK4A 4I2NA 4MULA 1XMSA 3AEKB 7MDHA 5DO9A 5KWEA 1Y4AE 1K66A 3GRPA 3NJRA 3DOIA 4X41A 3ZE2B 1PCXA 3UJPA 3NXKA 4RHCA 1WSWA 2O0JA 3T7KA 1JPJA 4ENPA 5FNVB 4KQ2A 1G55A 3HZRA 5IK2A 1CFJA 3JRWA 1Q74A 3V4PB 1Z37A 2DMRA 3T5GA 5IFKA 2H4JA 4BOYA 3DAHA 4PLZA 1EQUA 3KJXA 3JQ7B 1V1RB 5A3SA 4ZMBA 5L40A 1Z29A 1U7OA 3OCXA 1KQPA 3GELA 3WKBA 2HIGA 2CYAA 5T7BA 4QT4A 2NYRA 4OTZA 2Q6IA 5EINA 5CB4F 4JJGA 1I7PA 4N8SA 1RLUA 2BTQA 4XIIA 1TEZA 5B6JA 2I22A 2NV6A 4DARA 4LF5B 4OF4A 1JKJB 4X1IA 2J3JA 2ZBGA 1A5TA 5DMXA 5DSXA 4C3OB 3AIOA 4GOXA 2K2QB 3IMFA 2VP4A 3QMVA 4Y9RA 5JRDS 1V5EA 2IZOA 4I5IA 3QX3A 3IFSA 1XCMA 2AGVA 5J58A 4CLOA 1DV1A 4RTJA 3A4NA 3GMDA 2UU9B 3PJFA 3P9PA 3HR8A 4GM4A 5AW5A 1CSEE 1IBLB 3MM4A 1RD4A 3DL0A 4P53A 4C6RA 3D4NA 4DV3B 5JH7A 4YJGA 1B76A 2GF9A 4I8DA 2P8JA 4JCOA 1BCSB 3C85A 5EUMA 3HY3A 1JEYA 4IH4A 5H70A 4Z49A 1SU7A 2WKRA 621PA 4WINA 4CR7A 2QRVA 4L4SA 5E0KB 5GADl 3GFSA 1C9EA 4JHLA 1R5BA 2I7XA 1FP6A 3DAPA 4KAAA 5FOWA 1NAIA 2Q8QA 4F92B 2O1WA 2Z4RA 3CH5A 1Z5PA 3BYZA 3K0AB 5J59A 3U44B 1ODCA 2A0WA 2XGMA 1GFSA 3UV7A 1R0SA 2QNBA 3H4TA 1T1IA 4HYYA 4BEJA 5IS2A 3WMRA 4Q7JB 2Q50A 3QXHA 2UYGA 2PMKA 4Q19A 5TNXA 3K05A 1S6YA 4LCEA 4O33A 1J8DA 2IY8A 2XUPA 2ENWA 5JUWA 2G70A 4UUBA 3E6AA 1U0TA 1R5OA 4D4IA 5TQJA 4EELA 2D59A 1R3UA 1T2VA 4MIKA 1V43A 3V4ZA 1KTVA 1WZNA 3TOVA 3ZX4A 3K0AA 2ZS7A 3NBZC 1I6KA 1BDJA 5BWOA 1GL6A 4CMBA 3P20A 4DS3A 2Z0MA 5HS6A 2H5JA 1ADYA 5BQFA 4D9MA 3VKGA 1X2BA 1IOLA 4TRJA 4BO9A 4GR9A 5KNBH 4YP1A 2QRPA 4GRDA 1IOZA 3SYKA 4ZKDA 2Y3IA 5B7NA 1GZ5A 4KGVA 3DBRA 1HUQA 2EFGA 2E5FA 2VUTA 1ZONA 2XUFA 1XL1A 4QASA 3WL8A 2DBVO 3WLPA 4D02A 4Z1MA 4F3NA 5FV4A 1QFXA 2RH8A 3ILVA 4S12A 3N6RA 1F0NA 3N6XA 1AO0A 1JIKA 4OHWA 1XCOA 3GXBA 4N0EA 1DARA 1R6DA 3CTMA 4EDHA 2O2GA 5DWVA 2GLXA 4JBIA 3NV7A 4PLWA 1T5LA 3FMIA 1FSFA 2OV1A 3ER8A 2J3HA 3ZZ0A 3HACA 3AVYA 1L5OA 2H4FA 3HABA 1YBVA 5KU1A 1RSZA 2DCUA 1EGQA 2E4YA 3CLUC 4GOLD 2AUTA 2X42A 4LZPA 2WMNB 1PD1A 3W5UA 1IK6A 3C8UA 3WICA 2F67A 2HL6A 3SS9X 3HDQA 4G2NA 3I9MA 1JG4A 3DOOA 3MOSA 3R7LA 1TZBA 1M7HA 4IG4A 1PQPA 4XX1A 1LV7A 2OBMA 1TECE 2GCIA 3HA3A 2P9JA 2WOOA 2VDUE 3F5MA 3GNQA 3MSCA 3EF0A 3PZRA 5AMXA 3QZUA 1M10A 4G5OA 2EKDA 2PGLA 4LJLA 4YRJA 5BMOA 1C4XA 1JDPA 1JXMA 2DULA 2GEBA 1PQ4A 2V7UA 1TE2A 3ND8A 2B99A 2XMSA 4UU1A 1W581 1JE0A 2J9FA 5SICE 3AVQA 5CDFE 2IUEA 3FVQA 3M6MD 2PO5A 3NBUA 1PIWA 4JLBA 4A7PA 4ZTUB 3K7EA 5IKMA 4OUDB 4AWAA 2ZR7A 3IL2A 1GPLA 3L1HA 1Y37A 2LP4Y 2REOA 3KS9A 4FKZA 4WACA 5FTKA 5A2GA 3FWKA 3SICE 4D8TA 2QNRA 1ORTA 3K0CC 1LNSA 1JG6A 3HCFA 2WT8A 2BCGY 4I4LA 4Q3CA 2QTLA 2I4MA 2QU7A 3G7NA 1V1MB 1UBHS 4X7MA 4XM2A 4JJAA 5AVUA 3ROPA 3PC3A 4ZAGA 1LK7A 4ZQEA 2C83A 3AEYA 4NS1A 4LDAA 1CR4A 1PZGA 1SC9A 3PKZA 4FKBA 1D3AA 3DDOA 1JILA 3WE7A 1YDHA 1QE5A 1VKHA 3PE3A 2OEPA 1KSJA 1OB5A 3PXAA 1M33A 2WWIA 3W2EA 2GCGA 1S4QA 3MAGA 4P7FA 4D7AA 1BMFD 1TUBA 2G06A 2CV0A 3QE2A 3FSEA 4KNVA 5A03A 5DBEX 2YQ5A 2UZ4A 2RI1A 3NDBB 2Q2QA 4EWLA 1QB7A 1L5QA 2VWGA 4TLAA 3S8EA 4TV9A 2ZRLA 2X58A 1EFPA 2OHOA 4MWBA 2G80A 4BE7B 2J3QA 4YV7A 5JANA 3X0DA 1OV4A 4MINA 2EYUA 4NARA 4RTQA 2BCJQ 4KR0A 5EZQA 4WWHA 1THZA 4Q7QA 1PJZA 1ZVJA 2VWPA 3GO4A 2BFFA 1RPZA 4HN4B 3T9DA 4B74A 4DLYA 1WY5A 3GPLA 3JTMA 2QN3A 1ZGZA 4DTIA 4PBSA 1FLNA 4MR8B 2L0XA 5T6MA 4GF5A 2H3HA 1D0IA 1OQAA 1L4GA 4L15A 2P4SA 3SJUA 5AVWA 5KSOA 5JCOC 4J4TA 5BRAA 2RH4A 4PHFA 4OVKA 3E35A 3JQFC 2NXWA 3NV9A 4WZAE 5FPPA 1EBBA 1JW9B 1DE0A 4M6WA 5BT8A 3IAUA 4J7UA 5HW0A 3RVBA 1U6JA 2A9KA 3HXPA 5EQFA 4EKNB 1A9XA 4B5LA 2XVXA 4LA4A 1ZD1A 2OAGA 2YV4A 4WBNA 4B2IA 4R2WA 2AZTA 3ADKA 1OVMA 4KQHA 2CVQA 2WB4A 1J1IA 1I2BA 5CB4B 1T34A 2JJ1A 1UAYA 1XCGB 2Z9CA 4OOEA 4YR7A 5A7FA 5C80A 1SMKA 3ROQA 4UBNA 5KVCA 4WKGA 3VR2A 4B44A 4FW9A 5IJ9B 2OVFA 1QIFA 3THXB 1AA9A 2CWWA 2VDWB 4OQMA 2V4ZA 3PT5A 4TT3D 1KP3A 3SKVA 1WXEA 2WBLC 5B4VA 2NSDA 2G4LA 1PV2A 1VI2A 2JCGA 10MHA 3V8PA 1RXEA 2PZ8A 2BMDA 5F7XA 1K2WA 1MJNA 1R0RE 1YS7A 2IGTA 2PUTA 1FJHA 1SCJA 2J3MA 4YN3A 3WOHA 3D5EA 4RENA 1XLTC 3FDZB 2QUBA 4XCQA 1SBTA 5K3CA 3ZVRA 2PBZA 4LZLA 3OICA 2R8OA 5JBIA 1RBMA 3Q0IA 4ATNA 1YR7A 5CGQB 3Q3CA 2IW1A 1DUVG 3CT4A 3SVTA 3AM1A 5IJAA 2VXOA 3AY3A 3NKFA 2AF4C 4LWOA 5CUQA 4D9BA 1IXRC 1ECFA 1YVEI 1RQRA 2A57A 4UFOA 2J9GA 2WNIA 4MVJP 3SZGA 4QG3A 2HA4A 2VH5R 3WHIA 2EL7A 3OIGA 4Z86A 1F9EA 2NO6A 3H2ZA 1DBRA 2QX8A 4IIJB 2B94A 2QL7A 3S8YA 2BMEA 2Q7OE 5M29A 1E1CB 3I5UA 3CR8A 1OKKD 4LV6A 2QTTA 3PC8C 3KKNA 3LQ2A 4O4LA 2XE4A 3WWOA 5K6TA 2MSKA 1A96A 1OFHA 1QLWA 2YXPX 3CSSA 4W7IA 5FYQA 1SD1A 3ASYA 2BW0A 1QQTA 4TYNA 5FAKA 2V7QD 3K0EA 1SZCA 4JBYA 3ZS9A 5HKKD 1TQHA 4Q48A 1V95A 4Z0HO 3JWEA 2XY4A 3FPHA 1QYCA 2BE9A 3BIFA 3ENWA 1N0HA 4ZCSA 1NNI1 5LMCA 2ACKA 1W29A 1ZCZA 1P19A 2HRRA 2QTCA 3FGZA 3QYPA 2RIPA 3U17A 4KQXA 4WTOA 4DIUA 1JAHA 2CLOB 3U3ZA 3GRYA 4PLVA 2VP5A 3E3LA 3FTDA 1ST3A 3KQYA 1ZHFA 2YIDA 1SXPA 4NBRA 3UC5A 3QNUA 5B7GA 2I7VA 1DWPA 1KBQA 5FBVB 1Z0KA 4HDKA 2RGAA 4HLDA 1M2KA 1T9AA 1OHHA 3HLYA 1KJZA 1RXWA 4R1NA 5E1BA 1H2RS 3P0EA 2O4UX 1WXDA 3OA0A 4TQAA 2W2LA 2PT5A 3L6RA 3LKVA 2ZRMA 4GECA 3QOFA 5E7IA 1NYQA 2X9NA 5HE8A 4YREA 4CQMA 4UM5A 4C05A 3EARA 5FUVA 1KO7A 3UWOA 3C3XA 5DX0A 2NXNA 4TKZA 5D5HA 2QD5A 2QUHA 4BFVA 4MKFA 4ALKA 3SBOA 4MQFA 2ZIAA 1I1HA 4KU4A 4US2R 5LKAA 4PTZA 2LKDA 3USZA 2CFCA 3IE2A 1VC2A 3H1EA 1WB6A 2Q8PA 3RJZA 1KWGA 3H1TA 4X1YB 2WUWE 3EQ6A 2BMWA 1VYTA 4YCSA 1E89A 4B3TB 4DXHA 1KEPA 1SG0A 1U65A 2AFIB 2B9VA 4C06A 4H4EA 2AYYA 5CNIA 5ERXA 3RWBA 3KUXA 2UZ1A 4WOBA 4MCIA 5TT1A 1OWMA 3PDIB 4KIWA 3T3NA 2JFHA 2UZ3A 2CBZA 4KO2S 3RSOA 1IMOA 3SDZA 3JD2A 4FB5A 4GVLA 4V0RA 2M1ZA 1J1UA 1LJ8A 2EIHA 1Q7GA 2CJWB 5GV8A 2ZIXA 3VGJA 2VIIA 4ZAVA 4YJ2F 4GH5A 3W5HA 3UF0A 1N7JA 2HWKA 5CT9A 4CCWA 4OBXA 1L3BA 4WOJA 3IERA 1CUXA 1UH5A 2ZWMA 4KXVA 5FTJA 4J6EA 4LECA 4LWQA 2WG2A 1CZRA 4GGPA 4NBTA 1K8XB 3H19A 4B76A 4LRWA 4JUIA 4RPCA 1YK1A 1P2FA 4CT5A 1PE0A 2VDKB 3A4LA 3EFEA 1M6NA 3RFVA 1DHTA 3QVUA 1LTQA 2XBLA 1SA0B 4BLTA 2YJNA 1XTVA 1GQSA 3L8YA 3WGNA 4MHTA 4P34A 5G4KA 3C3JA 4HF7A 4BB9A 3G2IA 4LWZA 4OY3A 4QGGA 4CYMA 1SZPA 3NI2A 1TQ8A 3RWMB 5AK4A 1P1BA 2FVYA 3FKSA 4L4UA 2QLTA 4RORA 4MS3A 4LJ7A 4ZXPA 1NW7A 2B8TA 5FUQA 3ZEIA 3FWHA 5BO5A 4YUXA 3TECE 4HDKB 4XAQA 3KUKA 5FBRB 3LCVB 2Q27A 2HO5A 4PX3A 2WK1A 3BL8A 1DKQA 2ORIA 2AMFA 3N07A 4ZRNA 4LBVA 8ABPA 1JYSA 2H8GA 2DB3A 3H0CA 2ZAIA 2W37A 3NHLA 3ISJA 5KYXB 4DE5A 1C3OA 2HC9A 2QTZA 4I4NA 1OVGA 4YAGA 3A1WA 4FDTA 3AETB 4NEHB 4NYMQ 4BYMA 5AW3A 3VYTB 5CXSA 2G6BA 3GIWA 1M1ZA 3ZV4A 3TLMA 3AL0C 2HCJB 1QK3A 4QWMA 4YBZA 3DW3X 3MAAC 1K1EA 4YIHA 1N9GA 2PZEA 4HN9A 1XNHA 3ODGA 4L0DA 4UKDA 1X7WA 1F60A 3PPWA 4ECAA 4C0XA 2A7QA 1AC5A 2ZAGA 4C1BA 1YJQA 5LC1A 1U0FA 2ETXA 3ZY4A 1SXJE 3ZWWA 4AY2A 1GG2A 1BHJA 1HT0A 1KF0A 1LGYA 2IX9A 3IR7A 1C4WA 4OXNA 3M83A 1PT5A 2HSGA 4IXNA 4G9GA 3TQFA 4Z5XA 3R7FA 2OWEA 5CX1B 3SFVA 3OX2A 4Z8YA 3IJRA 3DWEX 3EGCA 2QL5A 4Y6OA 5HGJA 3X1JA 3IESA 4PGGA 3X1DA 4CFZA 1PF7E 5DN6D 1L4YA 4BO5A 3E9DA 2QDKA 5DGDA 3P9NA 1MO5A 1PFGA 2CNBA 1MG5A 3HYNA 5KYWA 4UTNA 1TU0A 1N3YA 3IE0A 3QVLA 4PG7A 1MP0A 2ZIFA 4RJLA 1OY1A 4X20A 1QTNA 3LOUA 5ALZA 3V8NA 2FPUA 3VVBA 3KO8A 2ZG6A 4ZOCA 2AJLI 2JLRA 4X6YA 3HCCA 4K2HA 4H7PA 2QAGB 2VZ0A 2X8BA 3S2GA 1ZICA 3L7NA 2Z5VA 1C9MA 3Q7QA 5KCMA 2JL1A 2BDUA 1XNJA 1ZXLA 3N7UA 5E6UB 5HS4A 1F06A 1F4LA 2VNSA 3H2SA 3ZNPA 3HBFA 2Y1GA 1FBTA 4DSOA 1KMHB 3EZ7A 4W5WA 4XCXA 3R9IA 4BFTA 4MPJA 1KFEB 3LUAA 1Y3IA 1N36B 4AY5A 3EVZA 1SVUA 3FETA 3GAZA 4M8SA 1ZRSA 1PR1A 1KI3A 2OB1A 1W0KA 1VSQA 2P4UA 2YIMA 4GBMA 4RGYA 2NXJA 1AIPA 5AOBA 2YRFA 4JQCA 4MYSA 1CS0B 1Z4KA 1PP4A 1KSGA 3WSWA 4WBNB 5BN3B 5LOVF 4U9IS 2ZCJA 2I3DA 4UBKA 1KK0A 3JQ9C 3DZHA 4E07A 1HDXA 1UANA 3GAAA 3GJ4A 1EDOA 221PA 3OZXA 1SELA 4Y2GA 3IPYA 4B0PA 3LT5A 4JR2A 3ZJTA 2GERA 2Y1CA 2FQXA 1AKYA 1AE1A 1CD5A 5JDCA 2WJVA 3SWWA 5KYKA 4DR4B 2ZWAA 3LZDA 2IE8A 2I6UA 2JKVA 3K72B 3M1YA 5ELLA 3VR6A 4PC7A 1TYCA 1VJDA 1ZOOA 1Y89A 1BEEA 1UJNA 1M6WA 2FPWA 3X1WA 3NTUA 2DTDA 2IYUA 1CQJB 2CNKA 4WFJA 5JNLA 2GYYA 1P0PA 1VL6A 2C78A 4UZSA 5EIOA 2YS7A 4O1MA 1RMTA 3KKOA 3WJ1A 4FYIA 4J16A 4Y6PA 2AI3A 1VMDA 4OFXA 2INGX 3NO4A 2VHTA 1GV0A 1EVIA 1FFCA 3IQIX 4NBWA 5DI9A 3RTEA 3C3MA 5CFQA 1WIWA 3SNHA 3OTOB 3EIHA 3D8HA 2Q0XA 4D3DA 1QH8A 2GPBA 2JFQA 4F6RA 5IF3A 3WDKA 4LZAA 2VNHA 5IX8A 4OK5A 3Q3EA 1E79A 1EUZA 1B1CA 1H0SA 3ETLA 7REQB 5TPZA 1IM2A 1M9NA 5DH9A 1XU7A 3VDXA 4CMJA 1O8CA 1IJFA 2VKTA 4M1OA 1KVUA 4EW1A 4BRZA 2HLDA 1X80B 5JEDA 4TXLA 1N6KA 1Z5WA 2F3QA 1YRLA 1ZIDA 5ED4A 2IPMA 2WINI 3WLSA 4NFSA 4MV7A 2AW3A 2PSSA 3OD1A 5DW0A 5IHPA 4HAOA 1T2CA 3BMOA 3OZCA 1GDTA 4JU8A 1V7ZA 2VDPB 2D7DA 1OILA 1WJGA 2GBLC 3MZ0A 3DDZX 4PICA 1PJTA 1V35A 3EGVA 4E2FA 4EW6A 3T5CA 5BPHA 5BUQA 2P4EA 1JNXX 1VCMA 3GJ8A 2CW5A 2G36A 1JS1X 1THMA 1TYDE 1WDKA 3MJSA 2BEKA 5KJEA 4EW2A 1DFIA 2GKOA 4XR9A 2WICA 4M36A 1U3FA 1C1XA 2ZROA 1HFJA 2F1HA 3R75A 1A1VA 2JFOA 2NUAB 2ZBRA 4L4XA 2Q0SA 2QX7A 4N54A 3SHOA 2QWXA 1YQQA 1AKWA 3C3PA 3DUFA 3QLVA 3RBZA 4L02A 13PKA 3KOXA 4P7BA 1O6CA 3V4FA 4N5HX 4E21A 3GZJA 2C2MA 3I6ZA 5D3MA 3IP5A 4L3WA 2G6TA 3UJNA 4HQFA 4H15A 1QM5A 1EYZA 3EBPA 3FBTA 4FGUA 1MXHA 3PFIA 4C7BA 3CRMA 3SX0A 4E5UA 1OC2A 4RVHA 2OA0A 2WC1A 3CLKA 3B70A 4I81A 2OZLB 2P27A 4KXQA 1SXGA 2D7CA 3D6NB 4NBNA 4F21A 2DT8A 2I6GA 3PGJA 2II6A 3VR5H 5BR1A 4BVHA 1Z0ZA 3AL2A 1PV4A 5F3WB 1LKZA 4CI0B 1EI9A 2VDLB 2IF0A 1USKA 2X5KO 1N4AA 1O6BA 4JB8A 4GKAA 1ZMBA 1RTKA 4D8UA 2OV2A 2Z6UA 3DE7X 1WABA 1CVLA 1GAJA 1OFVA 1J0BA 1EMDA 1ZCFA 2Y1DA 4Q18A 1FXWF 2HU8A 3ZY6A 3IR6A 4G56A 1B2RA 3TBHA 4CV3A 4YAKA 3QVJA 2ZVDA 1AKEA 5GZ3A 5IH3A 5FPTA 5KZMB 4MRNA 4UOQA 1UBGA 1FJXA 3LCUA 4W5OA 3GHYA 3M6AA 2EAUA 4DABA 2ZANA 1CE8B 3DFUA 4HX9A 4QYSA 2PD3A 3BMXA 4ZVUA 3OT4A 4JYCA 4RPLA 3ZHOA 1PGPA 1UBLS 4Y2YA 3UICA 3ND6A 3N75A 3C5HA 1MZVA 3BILA 3EXEB 3WVNA 1OH8A 2E48A 4MV1A 2B1QA 2GTIA 4WOPA 1BFKA 5CJJA 3R5KA 3ORYA 4S35A 4P58A 1MPTA 2EV9A 5FA5A 4NYJR 3A27A 3GA0A 2HPAA 3A6EA 1VBFA 4Y2VA 2OQIA 2WSLA 1AA6A 1SKYE 2A0FA 3P9IA 5DHFA 4BGIA 1YMUA 1FTQA 1UOEA 1GSOA 2LCIA 2ZOSA 3OFSA 5CG2A 4BNZA 1GUAA 2W98A 3C3WA 1UKCA 4FYHA 2B8NA 1K5HA 2PNJA 2PFKA 1OIVA 3H8SA 1F1BA 1KVSA 1LLDA 4G6ZA 4I9HA 3K53A 1IM8A 1V8BA 3VTZA 4URYR 4KBGA 3IPLA 5AH0A 3R7NA 3VH1A 3LP8A 4HEHA 2YX1A 4YDRA 3WISA 5KB3A 3IEVA 2PMCA 2FRVA 1MNQA 2X5NA 3QW2A 5TC4A 1KY2A 4W1PA 1RAFA 4R2LA 4DAEA 5DBOA 3U39A 1MABA 5FO0A 3TIGA 4EUHA 2ZZNA 2DY1A 4MJXA 3ZWMA 2PRSA 3KOYA 1EX6A 3ANLA 5AD1A 1SXHA 5T4EA 5IN4A 4KPEC 3P2YA 3BD9A 3LCCA 4KLAA 2GETA 2H0QA 4CETA 3IQEA 3N3AC 1N6RA 2BSAA 5ELXA 3DNMA 4JD5A 1BWRA 4DZRA 4H08A 1NOJA 1XZJA 1VG8A 2OG2A 1SM4A 3WYBA 1V3UA 2B4YA 2NT4A 1T3HA 2X7HA 4KTTE 4RLQA 2RGUA 2I2DA 4PQFA 2HDOA 3KX2A 2P0EA 4K81B 4KXUA 4DLTA 3LDUA 1WULS 4HQKA 4QFMA 1K4MA 2IOQA 2JASA 5A6SB 2C58A 4BP9A 2LIVA 4FZVA 1KOLA 1PJQA 4F2HA 1QYVA 4YONB 1K97A 1O57A 3UKDA 2AOWA 1XF1A 1PSDA 3LUJA 2N9UA 3HKBB 5H81A 5TIIA 4D0SA 3G0DA 3D6AA 3WYFA 1TD1A 3QQ5A 1BYIA 4PX9A 4MJLA 2R7KA 2CHGA 1QDLB 4CBVA 1Z6ZA 4CU5A 1EFUA 4XI9A 5BSEA 1IPFA 1FSZA 3TMAA 3DLBA 1O1YA 2E1RA 3CUVA 4Y7CA 5FT9A 3OURA 1R74A 4LXQA 4H18A 1DAGA 4PTYA 5J40A 5K4AA 1JU9A 4UCWA 3MJHA 3W5CA 2GUGA 4HFNA 4U6QA 1SCUA 4V2UA 2VJKA 2KYRA 4BNWA 4BO4A 3H97A 1CW2B 1FFBA 2Y1XA 5G0TA 1F0YA 2N75A 2GEJA 4FFMA 1E8DA 2ZM6B 2V7QA 1AT1A 3J81k 4YECA 3OCWA 2M6KA 1KAEA 1U5AA 1P60A 1Y9EA 4IKPA 4UPVA 3UFBA 4P32A 1GG9A 2NIPA 4DCTA 4URXR 3PFBA 1ZJ6A 1L4LA 2Q7XA 2EYQA 4HBGA 1PJRA 1GZ6A 2CWDA 3AESB 4JQSA 2LNDA 3QX8A 4MVYA 1O7JA 4WJZA 3X1XA 4BVBA 3OLWA 1SJ9A 2PDAA 4XWYA 3NAGA 2GAIA 5G02A 4J0DA 2V96A 4F97A 3IKJA 5IG2A 4WFQA 2J07A 2J3KA 1E64A 3S3TA 4JKIA 2B7BA 2MINA 1KETA 5IAKA 1U1EA 4MPTA 3OZSA 1GILA 1G5QA 1RKXA 5JJLA 2ECKA 4UVHA 1QG6A 4FM9A 5B1YA 1AK1A 4KOAA 3QWBA 2DFVA 1R4MB 2WEKA 3VKWA 4F9EA 5JNRA 1K98A 5L4LA 1KPIA 3UPTA 5F33A 4HMOA 3J7TA 2NTVA 2GO7A 4Y9TA 1NTRA 1ORWA 4RANA 5FPSA 4BO8A 5CMLA 5JZOA 2GDJA 2H11A 1EK2A 3H9CA 4L9AA 2A14A 1JZQA 3D5TA 3ANNA 4RF3A 1L5WA 3KDAA 1KP2A 3T99A 4JT4A 4JMPA 5IMBA 1BGVA 3CB4A 3UJ8A 5ERGB 2GAAA 2QZ9A 1DEXA 2G7ZA 3ECCA 2WF8A 3I1JA 3L2OB 4JB3A 1SHTX 1FFDA 2C3MA 3BEDA 3LKBA 1NI3A 3HDYA 3H04A 3AVPA 1HDGO 2YL2A 3HJRA 1GQ2A 3I34X 4V24A 3NYRA 4MI9A 1JQEA 1R5JA 2QTHA 2HLPA 4C7KA 3CLSD 3B7WA 4I1RA 1MO3A 2Q5IA 1TD9A 4D4KA 4HWTA 1RRVA 1XJWA 4EHHA 5AOCA 2GZRA 2GASA 3GNLA 1QVZA 3DD5A 4XR4A 2WHPA 4DCPA 3IIKA 1QRRA 3ELWA 1BWPA 1NJFA 3EEIA 4PO3X 5THXA 4DVGA 5FPYA 3VR2D 4WDRA 4AJEA 3FCAA 3L82B 1HKHA 1UK8A 1XRNA 3QQPA 3ZIDA 1QWSA 4J76A 1E92A 4H17A 1S2MA 4X92A 4Q9NA 1WXIA 1TC2A 4LE0A 3ZIAA 1IVSA 5JJ5A 1G20A 3UK6A 4EQ6B 4EA7A 4E11A 1ZN7A 1R5NA 4HS4A 4ZCQA 3FPJA 1JSZA 1JQAA 3JD4A 3SC2A 1ORDA 3ZBPA 1DJNA 1R3DA 4N9QA 5CXQA 3D5QA 4HVCA 3CIOA 3HRKA 4M49A 5C7OO 4ZXFA 2F1IA 3AHEA 1YZFA 4B80A 5LYJF 1ODIA 4K3UA 4RS4A 1UMBB 3GQBA 1VL1A 5EIBD 3LX6A 1M8FA 3DZJA 4QU9A 2VL7A 4C6TB 5KQMA 1YXMA 3D1VA 4WL0A 3EMDA 5ALFA 3KOMA 5T8KA 3DM9B 4JP1A 4D9NA 1J8FA 1JDBC 1ZWLA 5JYEA 3PKIA 1ZMXA 5F51A 2ADOA 4G4IA 4TZ0A 3FDXA 1P81A 1SVKA 2VNKA 2W22A 2FK8A 2K6GA 2HHJA 3VOTA 4BB0A 4C14A 4ETWA 2LVBA 2QRQA 1D6SA 1JXOA 2I03A 4KI0A 4OHZA 1XCJA 4HGOA 1C9KA 3OY2A 3RSSA 2P6OA 2QW0X 4ANFA 4TMWA 1EXWA 5EQJB 3OO0A 5JCJA 4D43A 5JAMA 2SKEA 5DT9A 1RYHA 4CMKA 1KORA 1S8OA 3RUPA 5MGNA 1OKKA 2YWCA 3Q3JB 2PSDA 1HMPA 1YA8A 4M9SA 2VP0A 4YJ3A 3CPHA 1NONA 1JSXA 1M34E 2YOGA 2QK4A 4DCCA 1JJIA 3FYUA 4MUIA 4UE3S 2W83A 4RFVA 4TKVA 3KYDB 1PQYA 4ZK2A 3FMGA 4N5MA 4E30A 3HWX1 3MBIA 3OP1A 4O4HB 3T9AA 6AT1A 5T57A 1B14A 4WEOA 4XSVA 5COBA 1GPKA 2ACEA 1YS2X 4AB1A 2NNWB 3N8IA 4HFJA 1QDUA 1W8IA 5LYJB 4EGQA 1DX4A 2OWDA 4JGGA 3BMQA 4REQA 4X54A 3PYXA 3T6KA 9MHTA 3D3QA 3KEOA 2DKFA 3RVKA 1I01A 3I5MA 2GM4A 1XUOA 3ASUA 2HBQA 4IF6A 2IYQA 4RTKA 3N0WA 1A50B 3K9QO 4FWIB 4KXWA 1L4UA 2YQZA 2QZSA 3BTVA 3OA2A 2VQ3A 4H7HA 5FJIA 1ISPA 2GRAA 2EJWA 2Y1KA 1RWVA 3AQ4A 2NVWA 2FLVA 1MX5A 4G0MA 1ZOPA 2FR8A 1DPFA 2EOAA 2LR0A 4DIEA 3U4QA 3CUEF 2CL0X 3ORFA 3ETDA 4EA6A 4HNUA 4JB0A 2HSDA 2CLIB 2H1CA 4JX9A 4QT0A 4AJ4A 2Z5LA 4ALLA 5BSVA 2HU2A 6LDHA 5AVRA 2QF7A 3N8KA 4AS3A 4JJ8A 3LWDA 4Z3OA 3ZPXA 1H22A 1EK1A 1IJKA 1N6HA 3SP1A 1UMDB 3O4IA 4JLNA 1C0LA 5BSGA 3EAGA 2YXDA 2ZTUA 3FYHA 4P6VF 5C4IA 3JQFA 1CLEA 3B3GA 3ETGA 3K35A 5LA6A 3IUYA 4WRRA 1IQ0A 2YBDA 3A9RA 1YDWA 4FJ2A 1M8PA 1KIAA 1GQQA 1A98A 1ZH8A 2V7TA 3KLPX 5F7OA 1T4MA 4TUYA 3LUKA 1TB4A 3H5NA 3G2HA 3OOYA 4MB0A 1H3FA 1OR8A 2ZYDA 3MB8A 4FCCA 1KARA 3L0DA 4H3SA 4TXNA 3UB2A 5CBKA 3LFHA 5LPNA 1Y7PA 2JIQA 2BAGA 1W85B 1RHKA 3FNEA 2RB4A 1QRDA 4ETMA 3RNOA 5FWXA 3DLTA 1EP2B 4YXWA 2BFAA 2ZJFA 5FL7D 4A5SA 3HKEA 1FYEA 1XA3A 2P2SA 5DLDA 1P6UA 1VHLA 3CTPA 2FDXA 1RLMA 4F1JA 2JFUA 2FG7C 4HAIA 3TEJA 4ZD6A 5LIRA 1ML3A 4WXEA 4H9GA 3EZGA 4HN2A 3VMFA 2QRMA 1AB6A 2J0EA 1SIWA 2G7MC 3WOVA 1JBEA 2XXAB 1IWPB 4LOIA 1DCTA 4LXGA 4JOSA 5GJBA 4Y1RA 3WAJA 4URUR 1Y6QA 3RC8A 5H8WA 4K7JA 4B79A 3GDHA 1P9LA 1WSBA 3BAFA 5EMNA 3UWPA 1UC9A 1M34A 4DJDC 4ARUA 1VE6A 3DMFA 5A4JA 2ZRIA 3FWPA 4ENVA 4FDLA 3HEBA 2RHDA 4WGGA 4EJSB 2MSNA 2B69A 5LLDA 1YJ5A 1NA5A 4ZU1X 5HXAA 3E58A 2RBKA 5AVTA 5EWJB 3HGTA 2WTUA 1F8FA 1ZVKA 5TPZD 5EIEA 1BZYA 3MCUA 3GR6A 1Z5VA 2TECE 1C50A 4LYGA 5HZHA 5DI3B 1VPWA 1MJGM 3QPDA 3C87A 1IZZA 5DNWA 3KTDA 3UMFA 3L84A 4II7A 4D6YA 2Z2JA 2B1RA 1GJRA 1VB5A 2O23A 3GH1A 1LTHR 1Z5GA 2Q5EA 3I09A 3W8EA 1G8GA 1P9OA 2IYOA 4E5PA 1Z6TA 3K4QA 3L79A 1W49A 1P17A 3NTVA 4TWAA 3WQHA 3AFGA 4GEGA 5BVHB 1FXSA 2Q2WA 4G41A 1RRKA 2O8FA 3ETHA 5KINB 4G8DA 4I1UA 4ITVA 4RPHA 3WLIA 3VU9B 2Z6AA 3A4YA 1A9YA 1J8MF 5EJ7A 5E3IA 4M1SA 3A9CA 2WT9A 2QB5A 3FF4A 1DLJA 3GVXA 1QLHA 3OQHA 4P4TA 5EP2A 2OYRA 4A16A 2PY6A 2WB2A 1CE8A 1X6VA 1TJ3A 1ZXXA 2RC5A 4MB2A 3W2HA 1ESEA 2H07A 4BFLA 2R7MA 4KK3A 3JYNA 3JX9A 4CNBA 3OZWA 1MA3A 4ZC8A 2FK7A 4RU1A 4HVAA 4IQFA 4XKJA 1VIMA 2AV6A 1O5IA 3E7WA 1FTYA 3RC2A 3OLYA 4FNMA 1NXQA 1PR0A 5DEOA 2R8YA 2Y71A 3U5TA 5KTSA 16PKA 1G8AA 2ZW9A 3PQDA 2BV3A 5EHIA 4CTNA 4GOMD 1MOQA 3TQCA 3FCSB 2XQKA 3DSRA 4HQLA 5CK5A 4G89A 1UJMA 4QRIA 3E2IA 2RKBA 4BP1A 3WLTA 4CDGA 1KS2A 5JAPA 3OECA 2Q6LA 2Z08A 3K1ZA 4UEQA 1E2LA 2L18A 3GG2A 1DOAA 3A8TA 1PNQA 4PZUA 3RRBA 2P6PA 2IIQA 2IY7A 4L3VA 4MKIA 3AKDA 3KPYA 1KE1A 2P30A 2OO3A 3EDOA 1DO0A 2IYWA 2NXCA 3T3DA 3NBQA 6PFKA 1XCBA 4G4JA 1GIAA 3A1TA 4L75A 4O4LF 4XQGA 1MAUA 2DBZA 2OM2A 3HYSA 3ILXA 1F2UA 2CNDA 2QVYX 1WXGA 2NPIA 1AGNA 2VS1A 4TVSA 1OV6A 3C6YA 2BKXA 5BURA 1D07A 1DBVO 1TA0A 1KH2A 2CHFA 3GT4A 4ND6A 1JR4A 3R77A 4ZU6X 3N0XA 1EG2A 2W6IA 3FYCA 1V47A 1K4YA 4KBYA 1Y4SA 1EX7A 4DDTA 2JJ8A 3CY6A 4OPMA 5EMKA 2I87A 5HIIA 1BJKA 4HY3A 1LU9A 1J25A 2J7KA 4BMSA 2A1UA 1RU3A 3RVMA 2R8EA 2VDOB 2RIRA 3I6IA 4FFSA 2EJCA 1MOPA 2V55B 1ULZA 3UH1A 4EL5A 4HNAB 5G40A 2IU0A 1WVGA 1HQYE 3G59A 4Y2HA 4ZO8A 4RSRA 1KC3A 4KVGA 4U7HA 4NZMA 3C6MA 3HR4A 3LXMA 3QLUA 4EBFA 1PWYE 2FZWA 5TXGA 2DU8A 1JKJA 4X1IB 3RIGA 1NMXA 1NUPA 3ZK7A 4AI6A 2GJ8A 5HBGA 1TVEA 1UPTA 2XNDA 3A1VA 4PZAA 3C14C 3OM8A 1TUIA 3V7WA 1ENPA 3GNTA 4GP7A 5EJ4A 4BNDB 2BTQB 1ONBA 3LO8A 3O9ZA 2BLNA 3K5PA 4LYHA 4W6ZA 1PGNA 2COKA 3I42A 4TTJA 3U7JA 1IB6A 3C7TA 3PIIA 5IEBA 2P9EA 4N7MA 1S3SA 1B2LA 5KAPA 2AJDA 2OXRA 4RLSA 4MA4A 3AEQB 2QE7A 4C7JA 4RK1A 3JS5A 3INRA 1XXHA 2IYRA 5EUCA 3FLEA 3AINA 3DB2A 2ZKIA 4OA8A 4YMVA 4RM2A 4CM4A 2OAEA 3KLOA 2OTCA 4UXJA 1H6CA 3KAPA 1P1JA 2CN1A 1DCKA 2P1ZA 1ANKA 1AGRA 3NWOA 4N12A 2YKGA 3H8JA 2ISCA 4CKEA 4C0QC 4JOBA 1D1QA 1JJFA 2YWBA 1XAIA 2QVCA 3INGA 3NC4A 4O25A 4EY3A 1CIJA 1Q7BA 3N2ZB 4U7FA 2Q4BA 2X6RA 1TEHA 3QFRA 1DKOA 1NNUA 3OUUA 3R2JA 1ZI6A 4JSYA 4WXYB 3V6MA 1JR6A 1SB9A 3F78A 4MO9A 2C7BA 2P78A 5E8JA 3QKRA 4Q00A 3BJZA 1QPGA 1V11B 4WASA 4BKPA 1RXVA 4NULA 4ENRA 3WMGA 2V9CA 2ZYIA 4U2GA 5MGBA 1NXPA 4N0DA 1KY5A 3U62A 2VSXA 3ME5A 3DL2A 3K9BA 4DZZA 3IAXA 3G2JA 4BBJA 1KP9A 1XWIA 2B25A 3U26A 1RXSA 1N9KA 5CH3A 1INLA 3K5IA 3TTXA 4WK6A 3PD1A 2WF7A 1COZA 1O4WA 2O3TA 1BSVA 2IOYA 3R3VA 3TOXA 1HYQA 421PA 3K9LA 3RW9A 4D80A 3BJMA 2XDWA 4Z7NB 1TYZA 5GINE 2R2AA 4L72A 3V7FA 4EITA 3FOEC 4QGSA 2PCJA 2ZYHA 4J8PA 1W4RA 3ICCA 4L4YA 4P4NA 1N2CB 2CXXA 5B1SA 1TK3A 4E4TA 1FJGB 3R20A 1AUVA 1M72A 1WHTA 1FJ2A 2JBAB 3A2KA 4YH1A 1GUDA 1NE2A 5C8YF 4IIXA 5AIAA 3GIDA 3GVHA 4FHFA 1LDNA 4GR5A 4LQ4A 4U8HA 4XSGA 2DPLA 1N2EA 2VKQA 5D86A 1QC5A 2Q9UA 2GGSA 3BE6A 1QGZA 3IMKA 4PFQA 3OUZA 3GMSA 4JYZA 5B36A 3W6OA 3QW4B 3TPFA 3Q3IA 5DJ5A 4F71A 4M1ZA 1JLSA 4MGHA 4CG1A 3OHMA 3RS2A 3K71B 3PC2A 1R4NA 3F49S 1OGIA 3IBSA 1K6JA 2VQSA 3PDCA 2I29A 3QF7A 4FCWA 4QHTA 3A6JA 3GARA 4HGPA 4QQFA 4R40A 6YASA 1X70A 3AF4A 2GK7A 4F11A 3ZNOA 3BHJA 5FRDA 2WZBA 2BEUA 4EGSA 4LVOA 3L8ZA 4UUMA 4JSRA 1ZJ5A 2ZSEA 2JHFA 2WKPA 2VJBA 5JIBA 1FMFA 4UHJA 4FXOA 2HDWA 1JR3E 1ODSA 1M73E 4L57A 1Y80A 2VJCA 2C77A 1V0JA 4UUQA 3UOAB 4LHYA 8ADHA 4YLYA 4O4JB 4NBUA 4LDZA 2BIFA 1AZWA 2FWAA 5D01A 3MPOA 5K20A 3ZU4A 2NZXA 3AF1A 1U7DA 5LQJA 4M21A 4D8WA 4JB2A 3P97A 1TKRA 1IRXA 3AUFA 1I3CA 3OOSA 5HF5A 4LNUA 4HSEA 1XKQA 4PFJA 3U7QA 3AILA 5ER6A 2WWWA 4X6LA 1D7AA 3I76A 1S2GA 1MFPA 2X19A 1M7BA 3SBEA 3ZUPA 4DXDA 3EYWA 1T9GR 1U8UA 1F8YA 3AUJB 1Q16A 2GAFA 1FVOA 1XTQA 4JDUA 1TMYA 3TLAA 5AKGA 5CVTA 4RXMA 2VZEA 1CPYA 3OQIA 1NRWA 1IK4A 2XF2A 2ZWVA 4XUEA 3ESQA 4ARZB 2JZCA 1NYTA 3VAYA 4EVIA 4EUEA 4H7FA 1A95A 2VF7A 3TIVA 2FSVA 3FWYA 1DU4A 1ZP6A 2AG6A 4PO9A 4UEOA 4CFSA 1JWLA 1KH3A 3V8RA 2J6HA 3A06A 1Y3BE 4X91A 1YA6A 1LF5A 3I2HA 1NZJA 2OZKA 1TA4A 4KZKA 1P3JA 1WBJB 3HRIA 5IAJA 3ZOZA 1P2SA 5K5EA 2J48A 3GGSA 1BOFA 3P0HA 3G8BA 1Y1QA 4BCCA 2XMRA 1CHDA 1K6EA 2W4QA 4OK3A 5AHWA 3I04A 5AJXA 3SJAA 4DUGA 3B1XA 1BS1A 4FOPA 4HNTA 3UB3A 1U8FO 4OB6A 5ADWA 5F1YA 1F0KA 1MW9X 1XK7A 2Z6VA 3JW8A 3L02A 1II0A 4M83A 2CUTA 1IB0A 3UW1A 3VX3A 2HJRA 4RTPA 1MZPA 3F6PA 1V6CA 2XJ9A 1XDGA 1MJFA 1M1YA 4HRXA 4PTLA 4QUIA 4AZSA 4PZ0A 1VJRA 1OGJA 3WP0A 4RA9A 1OMOA 3L6DA 4P2BA 5ICMA 4BZWA 3ZK8A 1I7NA 1I51A 5A9RA 2GPSA 5LKRA 1PV1A 3QPUA 2ZRBA 4BFUA 3KETA 1RPNA 4JGIA 3VO8A 4LXXA 3JU3A 4CQNA 2DR3A 1Q3HA 1NVEA 1I1NA 2GFIA 4Y9DA 3L1VA 4RABA 5K2MA 5CM9C 3UGTA 3BX1A 3JSAA 3MGGA 4YMTA 1M2HA 4ALMA 3AHJA 1U63A 3P52A 4P31A 2FWPA 4BVGA 2J45A 2GAJA 3MUEA 5THQA 1ZOIA 1EFRD 1NM5A 1MB0A 3AJAA 2F8MA 3Q87B 1JDBB 2O57A 4QWWA 4EGAA 2PXXA 3I62A 3KDPA 2ONZA 4O2AF 1QHXA 5D2CA 4DNXA 4D45A 2EVWX 1I1QB 2WTNA 3G17A 5JSZB 4RTSA 3NM6B 4KQMA 2D1TA 5SZKB 1Q20A 2B37A 5HZMA 5HNKA 2PWZA 1ZOLA 1BO6A 2GAOA 1KYWA 2QZPA 3EN0A 3PK0A 3BK1A 2ZIZA 3KVVA 1SUDA 1M75A 1XEWY 2ZE6A 3E7FA 4OGKA 3WB9A 4EYEA 5JZMA 3MINB 4Z7QB 3MTAA 3TDNA 4G0QA 4DFDA 4IG9A 5EPOA 4ED9A 2AG1A 1LPOA 2HJHA 4NJOA 1WMSA 1BXKA 3G0IA 2FCAA 3CN9A 4OXKA 4JR0A 3WRXA 4QTXA 1NN5A 3L93A 4JLMA 1B42A 2I4RA 2B5OA 2VTEA 4D74A 4I9FA 3I8XA 4LJ5A 2GILA 2E6UX 1T2EA 1MN6A 3CX4A 2QMUA 2Z2KA 4BIIA 3DM5A 1KA9H 3R9KA 3ZJUA 2R6R1 4NQZA 4WAUA 1FRFS 1P1CA 1YQGA 1EUCA 3H8WA 3ZNQA 2C2GA 3FOWA 3VQTA 3AZOA 3TR6A 2D62A 4A1OA 2DERA 2XNCA 2XGGA 1RI5A 5G3ZA 1WSAA 2OCLA 4YMWA 5FUBA 5HX7A 4Z0TA 3U1VA 4WJLA 2DLCX 1E3WA 3TQTA 1E1CA 2PMFA 4AULA 3KRTA 3GLFE 1JG3A 3IIMA 3OEYA 4YK7A 4YRCA 1PJ3A 3ZIAD 4B83A 3U4IA 4TM7A 1FLAA 5JCZA 3LFUA 1RE0A 3D3KA 1C1DA 2ZRKA 1RAEA 3AXTA 3C3AA 4M8NE 2CMKA 1NBHA 2DQSA 4Q4AB 4FS8A 5AXAA 4BNUA 1X94A 3AFOA 5MN4A 4W5NA 2G1PA 1A3CA 3KZVA 1CRLA 5J63A 1LBHA 2AOVA 3BXXA 3RO7A 5LBTA 4MW2A 3AIIA 1LRKA 2ACWA 3GJ5A 4PG6A 1GAXA 3QRWA 1V7QA 4GOJA 5E9QA 2GQ0A 1JDVA 1EDBA 3ZU6A 4AP5A 3LPAA 2W8BA 3L6CA 4QYWA 1GRQA 3PQ6A 4TTAA 5HIAA 1KSHA 4LAFA 4E5VA 1Q11A 3A26A 3CNNA 4JUBA 3RR2A 4O2RA 4QVKA 3EZ9A 2CLDX 2HRZA 1P2BA 4R83A 3FZQA 4X5OA 4NE7A 1GU0A 2FXVA 2CSXA 2IELA 1DX6A 5T6BA 3V1MA 2I8AA 2XXJA 2RHGB 4M0UA 4MUMA 1D8TA 1EBFA 3IHTA 5JRJA 2BCEA 2ZRQA 3WC4A 3WK7A 3DFFA 5JYDA 2BZGA 2PLNA 4MTCA 1YASA 2O0LA 2GT1A 4FHZA 4XWGA 3WNDA 4CL3A 2QLBA 2HX1A 3PNLA 3DDCA 3ONVA 3QFFA 1WZEA 3SQDA 3EZXA 5E8RA 2C7RA 1NFRA 2ASEA 4QPCA 2HJSA 4ARVA 4YCCA 2HYIC 2F1RA 1DXHA 3RS9A 2J87A 1EAYA 1ABFA 2JA2A 2C61A 3CWQA 2W48A 4PNPA 4K6MA 1DKLA 3EW9A 3HUDA 1Y4UA 4M76B 3U3RA 2P3QA 3PG5A 3K70D 1M8JA 1QO7A 3B1YA 1M54A 1N8NA 5I7UA 1RAGA 4W9NA 2B8EA 1EVZA 4J7CA 4D99A 2BMFA 3DTVB 1D03A 1L8LA 4RDCA 4IZHA 2I6TA 5K0SA 2AG8A 4X94A 1G9TA 4YCDA 1C3JA 1SR8A 1SWWA 4G1EB 1Z15A 4FQ7A 2O3SA 3REQB 1NHGA 4RK7A 4GPAA 4KL8S 2OV8A 1Q1BA 4MWCA 3WGZA 2V0GA 2JVIA 4UTXA 3W4JA 3CWCA 1NX6A 3BCSA 3EZFA 4PN3A 3NBFA 5KNBD 1ECJA 3U3XA 5G2OA 1LFDB 5BNZA 3Q3GE 2GN0A 3OKPA 4UNSA 3EPRA 3LCMA 1MGOA 1BD3A 2D5CA 2C59A 4KQGA 4MGKR 4FCVA 1NJGA 1IXYA 3CUUA 5JE8A 2DETA 2J4CA 5A3RA 5T4HA 4B9AA 2QRJA 4YASA 1EXMA 2YY6A 1V8ZA 3WFJA 1JQDA 4CDRA 4FU0A 1SVSA 3N6VA 4KMRA 3NCTA 1EGHA 5B55A 5F64A 2FPPB 2I4TA 3OAAD 2PKRA 1T29A 5JJIA 1I4TD 4DMHA 1IIBA 1EE2A 2NZ2A 3GRKA 4INJA 4L0MA 2RI0A 1OYOA 4R4JA 4V3BA 3QEAZ 1TX4B 1XGKA 2ATCA 2GHRA 5DIZA 3RUCA 4E2YA 1UBRS 1KYTA 3Q5DA 4LHSA 1PEYA 1V8PA 4QQ8A 4ZMSA 3D8UA 5FWNA 3QBTA 1OXUA 2OCYC 4UVIA 5FKJA 1L5YA 3G2QA 2PGJA 4Q7LA 4HQNA 4MMXB 5COAA 2ZFUA 1E1QA 3AR9A 1RQNA 1QIIA 4RFSB 3QF4A 3AEUA 4XGQA 3BC1A 5JQGF 3T1HB 1KR5A 2ZJ2A 4M0MA 3AEQA 2IPNA 3EXEA 1RP7A 4L5YA 4F1WA 3ICQB 1L7QA 2FEKA 2VJLA 4TQ9A 4JI1B 1P29A 4H77A 3KZXA 1SCNE 4JLAA 2Q1YA 4JMLA 3TSAA 3ADDA 4ZYLA 4BQSA 2O07A 3QV1A 4BNDA 2H0AA 4MW4A 5CFRA 2N46A 1PS8A 2A5FA 1RHJA 4Q66C 4QL3A 1YULA 2DJIA 3BCRA 3NP7A 5EEHA 5CVCA 4JV5B 2WMDA 1OASA 3UJBA 1E32A 4BMCA 1EG7A 1H2WA 1ZUIA 3MWYW 4X90A 4F6LA 4LY9A 3RYCB 4EPVA 4EUNA 1L6IA 1W48A 3CT6A 2V65A 3CCBA 1EA7A 4AX8A 1C7ZA 2XVAA 3ZW8A 1KFKB 1P39A 3H84A 1J7KA 2VI5A 1DAPA 4F3CA 1DBSA 1FYVA 3R8CA 2WNHA 2FSGA 4IHJF 3E9MA 4JASB 4Q1CA 4Y6QA 1BXZA 1F8UA 3DYVA 1GYQA 1XROA 2XE7A 3KJHA 4EG7A 2O52A 2PXAA 1OLSB 3JAKB 2HDHA 4I46A 5DN9A 4BU0A 4DYDA 3LUFA 4Q37A 5F35A 1RABA 3Q88A 3AOGA 4FNOA 2CVOA 1DKRA 5EKSA 4B4OA 5A5EA 4QM7A 3GLRA 3REOA 3PJGA 5BR4A 3DVAA 3F7MA 1T8UA 3PJDA 3MWEB 4ZQIA 4HUTA 3DDSA 4ZEMA 5KNDD 1DAHA 1T0UA 3EZ6A 4GLJA 2JH8A 2ZYVX 1WCIA 4KQKA 2PYZA 4GUAA 3OJLA 3EGEA 3NUZA 2X9GA 3ACCA 2NAFA 2EEZA 4LGCA 2XD9A 2C88A 4NESA 4YRGA 4BFYA 3V4VB 4MYCA 5KCZA 1SXJA 2GN6A 2ZSKA 4DA6A 4LTMA 1VKNA 1QSGA 3L6UA 1PBNA 1Z8NA 4JELA 1FDTA 5ITZB 2GD0A 1R18A 2WD7B 1V5IA 5E2BA 3T1OA 3V8BA 4Z4EA 1I6WA 1WPGA 1JXAA 3MQ2A 2QRGA 1I0LA 4G0ZA 1O3YA 3NLLA 1EWTA 1FYFA 4KG7A 4QYXA 3P71T 1G16A 3QY9A 1GNLA 4QECA 4CTJA 1TUEA 1RR6A 3AFMA 2Q6TA 4FFBB 2Q3LA 3PFNA 2WM2A 3TTTA 1GPYA 5I7EA 3ELUA 1Q57A 2VJAA 3RK0A 1VE9A 3G0BA 3VO9A 3QVXA 3I0ZA 1Y4ZA 4L5BA 5D6OA 5KJ6A 1Y98A 4J49A 1H6BA 4IIHA 2Q5OA 1G7SA 1YIOA 2YZGA 1UODA 3EVNA 3NKVA 3WI7A 3DLCA 4RJTA 2RAVA 1Z4MA 3EA0A 1AURA 4GICA 1W35A 5JS2A 1JPNA 2XAAA 3BL5A 1KFBB 1NQVA 4BMYA 2B5VA 1URPA 3G8CA 4DKJA 1Z6GA 1GRNA 3E9EA 4H6PA 3LRPA 4YRIA 4KTVE 4MPPA 2RAFA 4N03A 4IDEA 1U8YA 1F17A 1VYHA 4Q9LA 1CUDA 2X0KA 2YMLA 1DKMA 1WPXA 4N9WA 3NYQA 2PSJA 4MV5A 3DQZA 1Z3IX 3OZAA 4NOLA 3U13A 1FU7A 4YP9A 1IYZA 4UUOA 3ZI7A 4C0SA 4R71A 4CEHB 1A97A 2B30A 2VP2A 4UPDA 2HNKA 3ZV6A 3OFVA 1QP8A 1UK6A 3I53A 1N0VC 3HCEA 3RRNA 4B4DA 4QU0A 3VO1A 1SVOA 4DLBA 3W1VA 3ISTA 5C9ZA 1ZUHA 1T1GA 4MQEB 3RRYA 2FQWA 1Q22A 3FZEA 4CIVA 3QPWA 4H7KA 2B4KA 4EHNA 3LDHA 5BWLA 5K8UA 4OI2A 4C4RA 1T3SA 4CXMA 4MW7A 2UYYA 2EX4A 3CW8X 5KYXA 5DNEA 4Q1FA 3GFTA 1R6XA 2A9JA 1KI6B 3C6ZA 3ZDBA 1G2OA 2JLVA 3GEHA 3RCBA 3C3BA 1T3ZA 3FCEA 4OIFA 4C01A 2C42A 1Q1EA 2BMVA 5CNJA 2WF9A 4M0PA 3JQ7A 5KI6A 2YH2A 3DE6X 1JEOA 1L6RA 2NNLD 5KU7A 3CVYA 3AY6A 4GVXA 4NSNA 1PDOA 5KX5F 2PZGA 2AZDA 1QGOA 1V6SA 3U7FB 3ZVNA 4QUHA 5LQDA 3D0KA 5CA1B 4MVJM 2PS0A 1ADFA 1NFQA 1F2UB 3GEEA 3IYLW 2CUKA 4OXYA 5I48A 4UAVA 1UINA 4UZEA 2WM3A 4OJYA 4LDNA 4CM5A 1D6NA 1RFLA 2H4ZA 1V26A 4HLUC 4RZXA 4YY3B 1BXGB 3L05A 1YZLA 1NXWA 1OYWA 4PXAA 2D4AA 3ONWA 5DP2A 4BAUA 1T9ZA 2R60A 4BEBA 3CS3A 3VJRA 1R0LA 2W6OA 1WSDA 2PL5A 3BE5A 5SY4A 4C4SA 3K94A 3U7GA 2W8ZA 3OEEA 4R9RA 3DZIA 4AJLA 2HR1A 3Q2OA 1WNTA 5E9WA 1TI7A 5BMVA 4NK5A 3QVSA 1TT5A 1XEAA 5BW8A 4JL6A 4HH3C 3ZDDA 4PC3A 3JWPA 1XMPA 3BD8A 3TGLA 4IJ6A 1OW3B 1C0KA 1LSJA 1SU6A 3QKSB 1WB4A 1WKBA 1A5ZA 4TVBA 5EJAA 3RT7A 1TM3E 4X7RA 4AX4A 5FB3A 3LLCA 3WO1A 5A5DA 4CEJA 2VP9A 3SQNA 1PFYA 3VISA 3AM5A 1G4HA 3PHLA 3D6FA 4H3VA 3DCYA 3OJXA 3B36A 1J2UA 3T3MB 2PGIA 3EPLA 1W93A 1D04A 1RIFA 3WLNA 4B6GA 4OX9Y 1TTTA 4F9FA 2ZM5A 1CUUA 3HUFA 1C41A 2Q99A 3B5EA 5KHLB 3FKQA 1NQWA 2JJMA 2RD2A 3LLMA 4I14A 3HFRA 3KQHA 3P0FA 5SZIA 3MERA 1YR8A 4NV3A 1IHUA 5CLGA 1SBQA 3E4CA 2Z2ZA 4C7MA 1AGPA 4N40A 3H1FA 3D2BA 4FHGA 5T4BA 2R84A 5JXIA 5J2UA 3CB2A 1E4YA 3FPKA 2X5XA 4NG4A 5DMHA 2PUBA 4PPGA 1BVHA 1CS0A 1SHLA 4XLZA 1UAGA 3ZZ1A 3R0JA 3OIUA 5CLHA 4C78A 4KVFA 3LH5A 1I32A 3KVNA 1UJCA 1GNQA 5LWHA 4FYMA 1GADO 4MS1B 1KOJA 2VSFA 4ZVQA 1PJAA 3W6NA 5JNVA 1AQYA 1OC4A 4JXXA 4LYJA 1H6AA 4HDQB 5EHXA 2ORWA 1P72A 1QF7A 3M1LA 1YFLA 2QTRA 2IYNA 1KMIY 3U1BA 4FMCB 3FOAA 1YHYA 4NAUA 5IC5A 1FOEB 4HB2A 2Y4OA 1T5IA 5C8DA 3DHEA 3U4CA 3SZOA 5JDCC 5CFZA 1N32B 2C2XA 2G72A 4RM3A 2YN4A 5KTPA 4EJSA 1UP6A 3WL5A 4BMXA 3C5EA 3UEOA 5MN5A 1HETA 1U9CA 2PLWA 4XTCS 2OCKA 2PA3A 1M6VA 1V5GA 2ZQ5A 3OFJA 4UHFA 4BO6A 2VN8A 4D4MA 1UM9B 2ZK7A 2QJWA 3QXJA 2ZYAA 4F12A 1CUSA 3P5SA 4PR0A 2E3JA 1SD2A 2P9YA 1R9MA 5JVDB 1Y6ZA 2VYND 1N7IA 1NQTA 2PWYA 1S3IA 1XTUA 1PK9A 4ZT5A 3BCHA 3VJKA 1KEVA 5JMTA 3QLVC 1QCZA 5JAUA 1HK7A 3MRSA 3C5WP 3LA8A 2VYFA 3RANA 4R1QA 3U40A 5BSKA 3GRZA 4ID3A 1JIJA 1SVIA 4I5DA 1AOXA 4CHTA 3D8RA 2GLTA 1JJAA 2D1FA 2HEIA 4JT9A 3DEHA 1J2TA 1I7QB 3L7DA 4IEEA 5HF8A 4IDCA 2C7OA 2X41A 1PAUA 5EGSA 2AK2A 3ZDCA 3IULA 4O4HF 1HO3A 2WJGA 4AK9A 3PQ4A 4UBOA 3VVMA 2GZ2A 5JZBA 1A8QA 1N9GB 4IWXA 4EG6A 2IYVA 1IY1A 3K09C 5EWMA 4X7BA 4QICA 5FBQB 3KDSE 5ER9A 1XF9A 1YRAA 2HFJA 2WIGA 2MYNA 3AETA 3PI6A 4WA8A 1MD9A 1WUIS 1ZN9A 2ZDHA 2FG6C 1ZGGA 2CBXA 4URFA 1BHQ1 1C30A 5CU7A 2FETA 4RPGA 1ZUNB 3A31A 3GPBA 3L9XA 2VDWA 4N3NA 1QU2A 2Z9DA 2XGJA 1Z0JA 1H66A 5D3QA 4YNBA 2Q2NA 4PHGA 3FUUA 2AOTB 3QLJA 1X2EA 1Y5RA 3EMBA 1M2GA 3GMTA 3PFFA 1KNQA 1T4CA 1KBOA 1Z5UA 4J2TA 4TYQA 3RPEA 3H87A 4ZWNA 3T9FA 1W36C 3QTTA 3L1KA 1P3DA 3E3MA 3UXHA 4FYVA 1XPRA 4UUPA 4QBIA 1Z2DA 3SDBA 5J2TB 1P9NA 2HAEA 2C03A 4FI3C 4PLHA 5JFTA 4R1TA 3SXUB 5EY5B 3CGGA 3EGXA 3H4MA 3N8NA 3TAXA 3ZE8A 2ZUFA 3AVXA 2YZNA 2VR1A 1NQUA 3WRVA 4P4UA 2W6MA 2Q1XA 4I1SA 3UHOA 4AU1A 3T8YA 1O6GA 4BN0A 4BV2A 5FV7A 3N1UA 4OB8A 1PSWA 3NBAA 5KTTA 5DNCA 1TO1E 5EWMB 2J6BA 3M9LA 5B30A 3DBVO 5GAJA 4NWIA 4DLLA 4RUKA 1JPUA 1JHPA 1BMTA 1GQFA 1U9IC 3IKLA 3KFVA 4QQRA 1JHZA 4IX1A 2NN3C 2ZIXB 4OKNA 3VC7A 3DV0B 2O8VA 5LP6C 4DV5B 1XRJA 4K0KB 1QFYA 3NAMA 3LYLA 4JHXA 1QUFA 3R3ZA 2FFRA 2NG1A 2RONA 3F6YA 4OYLA 4D4GA 1YL5A 4AZ3A 1ACMA 1GL3A 3FPGA 2KBEA 2QLLA 4W1RA 2WIFA 1OIWA 1ZFNA 3I45A 3T1YB 3IUBA 1SKBA 2DR0A 4M9RA 1VL2A 3F3YA 2FWJA 3FKSD 1G21B 4MQUA 1I2AA 1KI7A 1DDIA 5FBHA 5ES4B 2ZIVB 3GZNA 4ASUD