3LS2A

Crystal structure of an s-formylglutathione hydrolase from pseudoalteromonas haloplanktis tac125
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
278
structure length
278
Chain Sequence
b'LENISSVKVSGGWHKQYTHSAVSTHCTMRFAVFLPPGASESNKVPVLYWLSGLTCTDENFMQKAGAFKKAAELGIAIVAPDTSPRGDNVPNEDSYDFAQGAGFYVNATQAPYNTHFNMYDYVVNELPALIEQHFPVTSTKAISGHSMGGHGALMIALKNPQDYVSASAFSPIVNPINCPWGVKAFTGYLGADKTTWAQYDSCKLMAKAEQSNYLPMLVSQGDADNFLDEQLKPQNLVAVAKQKDYPLTLEMQTGYDHSYFFISSFIDQHLVFHHQYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-formylglutathione Hydrolase
molecule tags Hydrolase
source organism Pseudoalteromonas haloplanktis
publication title Crystal structure of an S-formylglutathione hydrolase from Pseudoalteromonas haloplanktis TAC125.
pubmed doi rcsb
total genus 93
structure length 278
sequence length 278
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ls2A00
2WG1A 5AKLA 5JIBA 1ZJ4A 5AI8A 1XZBA 2Q0XA 2AJBA 4MJ3A 3LIPA 5T4BA 1UWCA 5ALMA 2Y1KA 3OURA 1SCKA 2WHPA 4B6GA 1QIHA 2WJ4A 1TCBA 4X7BA 3IUNA 2XUKA 4X6YA 4CCYA 3DYVA 4QDUA 1J07A 1MX9A 1A8UA 1CUFA 4B7ZA 1UOPA 3HACA 5DYWA 1W1IA 4HRXA 3GUUA 1CUSA 1JFRA 1Q0RA 3O4IA 5SYNA 4X71A 2VATA 4H0CA 5LZ8A 1JKMA 3AZPA 5CRIA 3LLCA 3NGMA 1IZ8A 4MWSA 2D0DA 4EUSA 2WTMA 1LBSA 1ETHA 1YAHA 3AFIA 4U2FA 3EF3A 1LGYA 2OCKA 1EXWA 2Y2VA 3QMMA 1F8UA 4BVKA 4W9RA 4P9NA 3GELA 3IA2A 3PUHA 1CUBA 1YCDA 4QLOA 1EDEA 4IQ4A 3G9ZA 4DTCA 3G0CA 3F8SA 1X70A 1QIEA 1L7AA 3K6KA 3C5VA 5A62A 4UUQA 2BCEA 3HSSA 4UHBA 5H3HA 3E4DA 1XZMA 1W76A 1ZD3A 5AKYA 3AUKA 1MPXA 3G02A 5CXXA 2Y6UA 4YK7A 1ZICA 3VXKA 1UK7A 3HRHA 1CUJA 5AM0A 3H0CA 3G8YA 4LYEA 1QE3A 1MAHA 1K5PA 1GZ7A 4C4XA 3AIOA 3FCYA 4TPKA 1AC5A 1MT3A 3GROA 5CH8A 2R8BA 5F4ZA 4ZV9A 4Y2UA 1XROA 5ALTA 1XZGA 5T4FA 2R11A 3R3ZA 1ZJ5A 3D0KA 4FNMA 1N1MA 3HI4A 5E4TA 2QR5A 4AZ0A 4DNOA 4KE6A 3FNBA 1H2WA 4N5HX 1XQVA 4E46A 4Y2XA 1K6EA 3U0VA 2VF2A 2X76A 3C70A 2V96A 4BTLA 4Q05A 5AK6A 1HDEA 5JD6A 3PICA 3BWXA 4MEAA 5JASA 4OUKX 4LIPD 1WOMA 4XWGA 4YX9A 5CBKA 4KACA 3AJAA 3DNMA 1W6RA 2XUAA 5FPQA 3V9AA 5AKZA 2PUJA 1XLVA 2Z8ZA 2OAGA 1C7IA 3D7RA 4OB7A 1R1DA 5EHQA 4RE6A 1CRLA 5JAHA 2X5XA 1NU6A 2GYWA 3UUFA 4E11A 3WKBA 4GEGA 3FVRA 2JBWA 1VXOA 2PBLA 3B12A 2HU5A 3WWDA 1BEEA 1WB5A 5BOVA 3ESCA 2HHAA 2ES4A 4QDXA 1AKNA 3QPAA 1DWQA 1UXOA 1XZKA 5HCUA 5AOAA 5AHXA 1VE7A 4K6GA 1H22A 3G0GA 3D2CA 3S8YA 1TIBA 1RWQA 5HKBA 4FOLA 3B3QA 2GZSA 3ZLTA 4C88A 3VJLA 4UHFA 1J1IA 4WFIA 2WJ6A 4HRYA 3N2ZB 4K6KA 5AKIA 1Q83A 4ZWNA 4K6HA 1QIGA 3D3NA 2PU7A 3C87A 1DQYA 3L1JA 4BCBA 3P2MA 3DKKA 5LZ9A 5D3KA 1CQWA 1QIFA 1IZ7A 4BC1A 5BWBA 7YASA 3ILSA 1ZIYA 5IKXA 1GXSA 3STVA 3BF7A 5CTAA 2OAEA 1R88A 4IH4A 5ALDA 4G9EA 1F0NA 5JD5A 1QTRA 2VSQA 4RGYA 4EHBA 3E3AA 3ZLVA 2WHQA 4H7KA 2RHTA 5IVIA 3DS8A 2QJRA 1MJ5A 5AI4A 1XZEA 3CCCA 4B0PA 5HZGA 4BP9A 1QO9A 2IIVA 4DSZA 1WB6A 1G66A 4N5IX 4KRYA 4AB1A 4MWTA 2XUJA 3A70A 5HF9A 5ALNA 3W04A 3H2JA 4X93A 4C4YA 5AKGA 5K3AA 2B9VA 3C6BA 3QYJA 4BATA 1I6WA 3MUNA 3CCBA 2ACKA 1BEZA 5BV7A 2C4HA 1GKKA 1PV1A 2PSHA 1LPBB 4OYYA 4UHHA 3IUQA 4CIAA 2ZJFA 1WHSA 2JEYA 2JF0A 2ZSIA 5DLPA 4W63A 1JJBA 1F0PA 2WFLA 1X2EA 5AM2A 1QIDA 2HIHA 2W6CX 2C5GA 4EY8A 5LIPA 1UKBA 1H2XA 1EB8A 3C6YA 4FKBA 5HQ3B 4DMFA 3F98A 4WY8A 3STTA 4NMWA 3H04A 5DNWA 1VXRA 1CV2A 3T52A 3OG9A 5FP0A 2QS9A 5DNUA 5E2IA 4ITVA 4IHAA 1XRNA 2H7CA 5DYTA 4M0MA 2JGJA 1EHYA 1E5TA 4Q1VA 4TVKA 1XLWA 2WFZA 1TCAA 2Z5GA 2Y6VA 3ESDA 4Y7DA 4HS9A 2QUBA 2DFPA 3WZLA 2XMZA 1O6FA 3WKCA 1E66A 4JNCA 3DDUA 2GZRA 2BJHA 2BKLA 1ZD4A 2OGSA 1YAJA 5AP9A 5ALUA 3W2TA 4P08A 4QWMA 5D7BA 4B83A 3AZQA 1GT6A 3WK8A 4Q34A 1LNSA 4FLMA 2HA2A 3WWOA 3SX4A 3H2IA 4BZWA 1MNQA 4S0XA 5LKRA 3OPMA 4OPMA 4H7DA 3UMJA 1DWPA 3HYSA 3QVMA 2J4FA 1E8NA 3M81A 1P0PA 1AQLA 2HU7A 3BL8A 4M0EA 3R41A 1TCCA 1QOZA 2XMGA 2VT7A 4A16A 5ALOA 1B41A 5A7GA 5HQ3A 4AO7A 2XUIA 2PUHA 1CLEA 5AKJA 1ZI8A 5DWDA 2OCLA 1R9NA 5EHZA 4L72A 2ONCA 4ROTA 1XZDA 4O08A 2XMRA 1C7JA 3ANTA 1OCEA 2DSNA 1R9MA 3D4LA 3I2KA 3BXPA 4B82A 4GWLA 5AKXA 2QXTA 1A8SA 2ZYSA 4PSDA 4W1PA 4CI9A 3F96A 5K3FA 3K9BA 3I6YA 2QT9A 5AM5A 3V48A 4IH1A 5E4JA 2VQ6A 2XB6A 1LPPA 2BUAA 1G5FA 2WG2A 5FUMA 5FRDA 5AICA 3FYTA 3G0DA 5EGNA 1OXMA 5HFNA 4J7AA 5D6OA 2ZYIA 2DHCA 2LIPA 1BU8A 1TK3A 3BDIA 2QOEA 4Y2YA 1DTEA 1CUIA 4FLEA 3WL7A 4Y2QA 4P92A 2ROQA 3FAKA 5FLKA 1CR6A 1QLWA 2IX9A 5EIEA 1EVEA 1GKLA 2I3DA 1YA8A 1LPAB 1MU0A 3N0TA 4KE9A 5HK9A 2CUTA 3FLBA 1UK9A 1N5MA 1K4YA 2CBGA 2J3QA 2G63A 2XDWA 4Y2TA 5LZ5A 4N8EA 3H19A 3BF8A 3IUJA 2XLCA 4DNFA 5ISMA 4OU5A 3VJMA 1BRTA 3S2ZA 1A88A 3QM1A 1P0IA 5SYMA 4AZ3A 4ZGBA 3H18A 4ZXFA 1IUNA 2WJ3A 3DJYA 4XX1A 1R3DA 3WZMA 1MNAA 2B61A 1CQZA 2J3DA 1ODTC 4HTAA 1ZI9A 3TGLA 1UOQA 1EX9A 4WFJA 3U1TA 3L1HA 3I2JA 5ALHA 5AIAA 2GBFA 2PSJA 1FSSA 4X94A 2VTVA 2HA5A 1EK1A 5KBYA 1JMYA 4GDMA 2DQZA 4YPVA 1SFRA 4AXBA 5KWJA 1QIIA 5FOQA 5HK8A 4QDZA 3RK4A 1BCSA 3HXKA 4BRSA 3OM8A 1E8DA 4UFOA 5C8VA 3RARA 3WK5A 1AZWA 5A7FA 3O9VA 3C5WP 3IUMA 2RI6A 2PL5A 2RHWA 2WUEA 2JGMA 2FUKA 3WJ1A 4E15A 3VISA 1ZGBA 1YS2X 3H2KA 4WCVA 3ICVA 1X2BA 4K2AA 4BAGA 4GHWA 2EEPA 3F67A 4Q3LA 2XI4A 2QM0A 5A2GA 3C8HA 2C0PA 3R3YA 1QONA 1SCQA 2WHRA 1GQRA 1BN6A 4FBMA 3WK9A 3DOHA 4L0CA 2HDWA 4G5XA 1VLQA 4UFNA 1BE0A 5IVDA 2WSLA 1AGYA 1WB4A 5FDFA 3O95A 2H7XA 4K5QA 4WJLA 1QTIA 3G9XA 1YSCA 5ALWA 5C81A 4MYDA 3CXUA 3WIOA 2CEKA 4AMZA 1HPLA 1CVLA 1YR2A 3PDCA 4Y2JA 5FV4A 3AIKA 2O7VA 2WQZA 3ZV7A 4QLAA 3G0IA 4ZI5A 3MGAA 3BE8A 1CUDA 3M83A 4U2DA 2ORYA 4F5ZA 1WPRA 4ZREA 1N5RA 1ACLA 2GBIA 4KR0A 1H23A 3ED1A 3QMWA 2Y2UA 3IIIA 4BYMA 4H77A 2XMDA 2XUPA 5K3CA 4H7JA 2WU3A 3STWA 3G9UA 1ZI6A 4NZZA 4G8BA 3KOOA 4BCCA 3WA7A 4RPCA 2WHPB 4OYLA 1RP1A 1CUXA 2PM8A 4X92A 3F97A 3KDAA 2HA4A 4QNNA 3PI6A 2I78A 4BRZA 4MXDA 5EIAA 1MAAA 4CG2A 2IITA 2G5TA 2XQIA 3AINA 3WWPA 5AM4A 1T2NA 5JZSA 4GBGA 4X6XA 3AIMA 4M0FA 4TGLA 5CH3A 1CUVA 3FBWA 3DQZA 2I3ZA 2HADA 4JEIA 3WKDA 2EDAA 3HZOA 3HC7A 1LLFA 2PKYX 4J3JA 3FOBA 4HXFB 4RE5A 3LP5A 1TRHA 1VE6A 2H7YA 2XMSA 4F60A 4J03A 1MO2A 4GI1A 3W05A 5JALA 1XKTA 1U4NA 5K3EA 3I28A 1LPMA 1C4XA 4B84A 5EIHA 4OD0A 3A6ZA 2V98A 1FFEA 2QUAA 4PW0A 4QE3A 3RLIA 2WM2A 3IBTA 4OB6A 2OGZA 1USWA 3D2AA 4IO0A 4Y2PA 2BGNA 2QTBA 2VAXA 4LKOA 1EI9A 1YS1X 3DD5A 5CMLA 4DYHA 1GPLA 1WM1A 3EQ8A 3R40A 2V9ZA 4DMKA 3HJUA 1OILA 4X00A 5KWIA 3NOXA 5FPPA 4QA9A 2WUFA 2I03A 5AM3A 2JIDA 1G42A 4LXIA 2NW6A 4QDOA 4A5SA 2BUBA 2OCIA 1YB6A 1CUZA 3RKSA 1RYYA 2WLSA 4OB8A 1H2YA 1UZAA 4BAUA 4AO8A 4X91A 1AX9A 5ALFA 5JZBA 4PSUA 4KJXA 2K2QB 5AIBA 5CT6A 2WIDA 4Y2VA 5BWCA 5YASA 1XQYA 3QH4A 1P0QA 4UHEA 3K2IA 2BUCA 5ALEA 1SOMA 2BAGA 2ACEA 2H1IA 4HVTA 1CUGA 4ETWA 1BROA 4N8SA 2DR0A 4UBLA 1ORWA 2UZ0A 3C8DA 4H7HA 1JMKC 1G4HA 1CUEA 3D59A 1XKLA 4BB0A 3NUZA 5AH0A 4UBKA 3H2HA 4UBOA 3Q0TA 2O7RA 1JI3A 3H17A 4FLFA 2VEOA 1PFQA 3VDXA 1JU4A 3I2GA 1QGED 3Q8WA 4GW3A 2HRQA 3I2HA 2WTNA 5AKKA 4PNZA 3R3VA 2WUDA 3G7NA 4ZV7A 2GYUA 1EDDA 1EA5A 2WG0A 5HF5A 2ZSHA 4LXGA 1YA4A 4ARBA 4MYSA 3WYDA 4PV7A 2O2GA 4B80A 4B85A 4FDMA 1N8SA 4KAFA 5ALRA 3V1NA 2HL6A 3DL4A 3L1IA 1KEZA 3I6ZA 5JADA 3AZOA 4EBBA 1FFDA 1U8EA 2DHEA 2WUGA 4W1RA 3BDVA 5AOCA 2ZJ6A 3IURA 4FFWA 2VAVA 1XQXA 2PSDA 5I9IA 1CUHA 3STXA 3DCNA 3C45A 2CKMA 2XMCA 1AUOA 3E0XA 3WK4A 3W9UA 1Y7IA 1CUUA 4DM7A 3QMVA 4MQMA 4AN0A 2FX5A 5AJHA 4FTWA 3SK0A 4PO3X 2XQJA 4U2CA 4C4ZA 5JAUA 3W06A 1FFBA 2VJCA 2AJ8A 2G4LA 1Q84A 1W52X 1DQZA 1XQWA 4U2BA 1CUCA 5A6VA 5CT5A 3I2FA 3LS2A 2WFMA 2XUHA 4BC0A 4BCDA 4CCWA 4XVCA 1XZHA 4C6HA 3D2BA 3KSRA 3HLKA 5EHXA 5K3FB 2QMQA 3C6XA 1B6GA 3LCRA 1GPNA 4J0HA 1QFMA 2JGLA 2HA7A 2RGUA 4B81A 3I1IA 1JU3A 4KAJA 4RNCA 2WU4A 2HU8A 2QVBA 3BIWA 4AX4A 4KYVA 4DLNA 3HABA 1EK2A 1DX4A 3HEAA 3WWEA 3JWEA 2EDCA 5IVKA 4UFPA 3M82A 5ALPA 4DMHA 4FBLA 2D5LA 4ARAA 3IULA 2XQKA 2YASA 5ALGA 3BJRA 1FJ2A 3LIIA 5FXMA 3I1YA 3VKFA 1ORVA 4G4IA 1W4LA 1U2EA 1NX9A 4D9JA 5FKJA 1THGA 3WK7A 1T4MA 4CG1A 5DYYA 4QEKA 2WIJA 3WL5A 5T4HA 2WIKA 3R3UA 3OOSA 2OQIA 3KXPA 2PX6A 2GYVA 5AKHA 4UBNA 4YASA 1D07A 2WILA 2HA6A 3WKAA 2OPHA 3T4UA 2PVSA 1YASA 3QITA 4H18A 1GQSA 3TEJA 3WIBA 5ALSA 3DEAA 1XRRA 4EB0A 5C7YA 3H1AA 4JYPA 5CH5A 4QZVA 3FSGA 2VT6A 2QKYA 4Q82A 1THTA 4Z49A 4GECA 2AJDA 4C01A 1CUWA 4UBMA 4J0CA 4BE4A 3F9CA 3QPCA 4L9AA 4X6UA 2PPLA 3C43A 4PQEA 2VJDA 1XRLA 4I19A 5CT8A 5EFZA 2OCGA 5DTIA 1Y7HA 4AN1A 2VA9A 1BS9A 2HFKA 3JYHA 3QPDA 1HLGA 2OLEA 3OTQA 3UUEA 2E3JA 2C0QA 5LZ2A 2DQYA 2GBGA 1F6WA 3C6ZA 3VJKA 3YASA 3FLEA 3WL6A 1DU4A 4N8DA 2VJBA 1TAHA 1UT6A 1K8QA 1Q0ZA 1CIJA 4BP8A 1IUOA 3FYUC 2PU5A 3JW8A 5CT9A 2YH2A 4ZRDA 3X3HA 1HQDA 1K63A 2WIFA 3ZWQA 5J3JA 3I6MA 4KE8A 3WMRA 3A2NA 2O2IA 5CT4A 1HL7A 1EDBA 4BZZA 3V1KA 4UHCA 2O2HA 3D5EA 5DNVA 4A23A 1IVYA 3DLTA 5CXUA 4PSCA 3VVMA 1CUYA 4GXNA 3O4JA 4G8CA 2W22A 4KAAA 2BFNA 3MUOA 1XZJA 4X3CA 2ZYHA 4BAZA 4EY4A 2Z8XA 3GZJA 3A2MA 1VZ2A 1FFAA 4X97A 1Z68A 3ZLUA 2FJPA 1HKHA 2CJPA 1TKRA 4WDQA 3CN9A 3IVMA 4I3FA 3WA6A 1QIMA 3RM3A 1BN7A 2RAUA 2X8BA 1O6GA 2FJ0A 4V2IA 2DCMA 4CIBA 1YB7A 4WFKA 4Y9SA 4EY6A 4JYMA 2WIGA 5ALLA 1LPSA 5AI9A 1QZ3A 3O9MA 1L7QA 2B20A 1XFDA 3O0DA 5AM1A 2HRRA 3FYUA 2HA3A 4H35A 1DWOA 1EVQA 2XUFA 1XRPA 2XQFA 5DTJA 1ZGCA 5ALVA 2ZVDA 4BTVA 4UHDA 4MEBA 4BBZA 2QRUA 5IH7A 3WYNA 4L3WA 3V1MA 3V1LA 5AKEA 3O4HA 5LZ7A 1UK8A 2XMBA 3CN7A 2AJCA 4LXHA 1MX5A 5JARA 5AK5A 4U2EA 1QO7A 1Y37A 4BDSA 5CW2A 2OXEA 5JZ9A 1CEXA 4I4CA 2QJWA 1JT2A 4G9GA 1U65A 4FFVA 5AI0A 4KEAA 4Y2SA 3EQ9A 4EY5A 5AI6A 5IVHA 4J0KA 1XZCA 4C89A 1DT5A 4G4JA 2XUDA 2JGEA 2XE4A 1VZ3A 1CUAA 2HA0A 2YYSA 5D3ZA 3KWFA 5HF8A 2G5PA 4BVJA 1IUPA 4INZA 1LBTA 2OG1A 1A8QA 1WPXA 3IB3A 4IH9A 2QXUA 5ALKA 2AXEA 1AMNA 4G1FA 1QFSA 1XZAA 3QBJA 4KE7A 2AJLI 3WI7A 5T4EA 1ODCA 4NVRA 1EB9A 3GFFA 1WCYA 3WQHA 4CG3A 5HF6A 4AQDA 4FNGA 3ESBA 4G8DA 3BIXA 4UPDA 1HBJA 1VKHA 2OQVA 5JD4A 2XUGA 2PSEA 3E1GA 4GLBA 1SC9A 3R3WA 3WK6A 3ESAA 4EA6A 1XZIA 4XJVA 4MQLA 4F21A 3EIOA 5AOBA 4E14A 1QIKA 2C5FA 2XMQA 1J06A 2C58A 5ALXA 4DIUA 4U2GA 3GBSA 3R0VA 3WJ2A 4CCYB 5K3DA 5I8PA 1EH5A 4EY7A 2VJAA 5C8XA 5LKAA 2XUOA 3H1BA 1KU0A 3FYUB 1GGVA 1PJAA 1XRQA 4BVLA 2XLBA 4J0GA 1WHTA 4H7EA 2RONA 5LYYA 2JGKA 2PSFA 4BDTA 3B5EA 2CZQA 5K5EA 3GA7A 2DHDA 1BCRA 4W1QA 4FMPA 4X90A 2BGRA 3DOIA 4QWWA 1LPNA 2ECFA 3I2IA 3IDAA 4HAIA 4OCZA 2HM7A 5ESRA 3EQ7A 4XIIA 5LP1A 5AI5A 4DNPA 5KREA 5I7UA 1GPKA 3G9TA 4FWBA 4AO6A 1MTZA 4G4GA 4BE9A 4DNQA 6YASA 3NWOA 3G0BA 1UKCA 2Z3WA 1UKAA 4UBIA 3TRDA 4HZGA 1XLUA 1QIJA 3PE6A 1DT3A 1ZD5A 1J2EA 4UBJA 3ZPXA 3DYIA 3PF8A 1E3QA 3VVLA 1P0MA 5EI5A 4W1SA 2Z3ZA 4J0DA 1R50A 4FHZA 3DL7A 4EZIA 4HXGA 2P8SA 1UK6A 2GBCA 3AILA 4JH0A 3QZUA 5E4YA 3SC2A 5JAPA 1NU8A 2V97A 4PF1A 3WLAA 3EBLA 1VJ5A 4HXEB 3PUIA 4H7FA 4LHEA 1M33A 5LLSA 3FVTA 5LZ4A 2ZJ7A 4X85A 1L7RA 2OGTA 1LZKA 3BJMA 4P93A 4DSAA 1AURA 3M3DA 3WL8A 3PFCA 4CFSA 1UOOA 1W75A 2YXPX 1ZOIA 1MX1A 5JAOA 1FFCA 2C7BA 3O4GA 1XZFA 2CB9A 4J0IA 4C87A 2H9YA 2B4KA 1ISPA 2J4CA 1KU6A 4OSEA 1JJIA 1VA4A 2WKWA 3PFBA 5JYCA 2CMFA 3A2LA 1A7UA 4DMCA 2JGFA 1ZD2P 5EHNA 3FLAA 3FSGD 5K3BA 2XUQA 5C8ZA 3R3XA 1VA5A 1JJFA 4H7IA 5JATA 1ZIXA 3OC0A 4J0JA 1LPOA 2RIPA 4AMYA 1S8OA 1QJ4A 4KRXA 4QDTA 1SCIA 4Q3KA 5CURA 3WWCA 4X95A 1TQHA 5HKAA 3KWJA 5ALJA 1DINA 1E8MA 3H2GA 3PF9A 1MN6A 2JGIA 2QZPA 3ICWA 1XZLA 1UFOA 3SWWA 4WY5A 4WDRA 4OU4A 3MVEA 5AK4A 5A71A 1H2ZA 4Q3OA 3ANSA 3FWHA 1R4ZA 4F0JA 5ALYA 1LZLA 4LYDA 3STYA 3FCXA 3STUA 5ALIA 5ALQA 1VOTA 4Y2RA 5DJ5A 3ZI7A 5A7HA 4B9AA 1XRMA 1IMJA 1DX6A 4B9EA 2ZYRA 5JANA 2XQGA 1EINA 3DKRA 4DGQA 2XT0A 5ALZA 1CFJA 1ACJA 4NS4A 4B0OA 3TJMA 2WFLB 2JEZA 5AK3A 3W9BA 5AO9A 2HFJA 1ODSA 3KD2A 1CPYA 3WKEA 4JUIA 1E89A 5HFAA
chains in the Genus database with same CATH superfamily
1P31A 2GPWA 1OXXK 2P78A 3ANLA 5K0TA 1FQWA 1JFVA 1JA9A 4YA6A 2YJGA 4MQEA 1PT9A 1OXUA 4K6MA 2PK3A 4YCBA 1YB5A 3IQEA 4M1YA 2AJBA 4MJ3A 4NLLA 4OKNA 4URVR 1FW6A 1FNBA 4R1PA 1YMVA 1DFIA 5T4BA 1UWCA 1H6CA 1DJLA 2HJGA 1KMIY 2X3UA 3W5HA 1ZSYA 1IATA 5FHQA 2AE2A 1FXWA 2Q5LA 2Y1KA 4GZMA 5DX0A 5HE9A 3NGXA 4Q1CA 3S2EA 2I6QA 1FZQA 3W7VA 1XYYA 2XD9A 4H9GA 4MVJI 2A84A 4YP0A 4FW9A 3IUNA 3G2NA 2G83A 2BGMA 2DETA 1N25A 1T2DA 3GPBA 4QOJA 4EUKA 4URFA 1CKEA 4DKXA 1SBZA 3W6ZA 1JKJB 3GLVA 4NCNA 3B20A 1D0IA 1NP7A 3MHPA 3IP9A 2O8FB 5DT2A 1NXXA 1W35A 2WWRA 3DYVA 4GL4A 4QDUA 4QUJA 3E3NA 1QTQA 1DJPA 3ZE1B 2IYPA 1KA9H 2ZATA 5K01A 1IU9A 4EDHA 1P2UA 2QV7A 2O0HA 4JUBA 1ID8A 1Z7BA 1A3CA 4MS4A 2IBTA 1R74A 4B7ZA 1M9NA 3CRZA 2FGJA 1EZZA 2EG9A 1QG6A 3B70A 2BMEA 4CKEB 3DZIA 4JJAA 5DYWA 4ZCTA 1W1IA 4Y9RA 4LFAB 2F8SA 4MKIA 2FMHA 2AZXA 2IU6A 1S2NA 1QDUA 2QZ4A 3AFNA 1QWSA 3AI1A 4DLZA 3PPVA 3PQ3A 1T9AA 2DX7A 5EKDA 4L73A 2V58A 4YYZA 1H1TA 3NTOA 5SYNA 1BCRB 1IEWA 2BFMA 2VATA 2XRFA 4DLXA 3TMYA 2W4MA 1CG6A 4CM9A 3ZV6A 1EQ2A 3MUEA 3Q5DA 4NSNA 1P1RA 2GUGA 4LCEA 5BVHA 2F8TA 4RYDA 1J8VA 1A4IA 1JHMA 4PLCA 2RI0A 4MWSA 4KI7A 4PYQA 1F17A 1NVKA 1NE2A 2XNSA 2EKLA 3P1JA 4FC7A 4X3PA 2QL9A 4ZOEA 4EUSA 2GRAA 2C5SA 5I45A 3TFQA 1A9RA 4FMDF 1LBSA 4BO6A 1HFKA 4NXNB 3IHKA 5JD3A 1OASA 3V9PA 1NQTA 3QX8A 4M60A 3ZWBA 2X3YA 3IAM1 4FEEA 4EGCB 3BH0A 4PHHA 4AROA 5EKXA 2AV6A 1W4CA 2ZTMA 4U2FA 5TT1A 4YT4A 5IKPA 5AXAA 3EVTA 3MWFA 3EF3A 4W6ZA 5A4MS 1IB0A 2DECA 1EXWA 3S7ZA 4UUNA 3SF0A 3IUBA 3GAFA 1ZGAA 4BY9E 2YIMA 1A4XA 1W8IA 3WTBA 1IOVA 3TX2A 2ZXFA 5FNVF 2BL4A 3NXSA 4OXNA 2Y1EA 2H92A 3RKRA 1KOJA 3U7FB 3RVQA 1I7NA 5C18A 2QAGB 3H1FA 5AVKA 4AJIA 4TKVB 4PRLA 2WR8A 3T9EA 3T1NA 4Q7QA 4O29A 1RXSA 2N1BA 3VOBA 9LDBA 1EDEA 2IPXA 2F17A 2G1KA 4RY2A 4C05A 3CUYA 2OBMA 4Z9AA 3PDUA 1QCCA 3G13A 3UCEA 4DTCA 4AKHA 5T6MA 2O2DA 4YQZA 1RRPA 3ZWMA 2C4VA 1KBOA 2ZRBA 4FDUA 1OB5A 3F8SA 4YJ2F 1FUUA 3NHSA 4ZVVA 5BY2A 3K5HA 3MGBA 3LKDA 4RKQA 4OXXA 4AUMA 3JQFA 2C3UA 2QSUA 1FSPA 3P7MA 3HSSA 2E6KA 5BOSB 4UHBA 1U3CA 3IDSA 4JVNA 5H3HA 3E4DA 4WINA 2Y1LA 2G80A 4IHJA 2QVCA 2Q6OA 4GFDA 3FFXA 3ZW9A 5JAZA 3AUKA 2QN8A 2Y99A 4Q19A 3AHFA 4Q47A 1J5EB 3ZD7A 1FLNA 1KYIA 2QE7D 2ZB3A 3BIOA 3G02A 4BFUA 1G7RA 4EJ0A 1P9OA 2A67A 2SCUA 5CXXA 1IN8A 2K6GA 4D0LB 3PX2A 1ONNA 4ZHSA 1M0WA 4HWOA 5TT0A 1FTQA 2P4SA 1U3TA 1UK7A 2GR9A 3HRHA 3KHKA 4HWSA 1FYFA 1GP2A 3VGPA 2DULA 5HMLA 1QUFA 1RKUA 3RYHA 3I5YA 1YDMA 3L5OA 4FX5A 4O2LA 4MX8A 4A4DA 2GM4A 3HCEA 3RV3A 1XD8A 1NULA 5AM0A 1NVXQ 4XQEA 4JT9A 1NNUA 3INRA 4Z53A 3X43A 4K9SA 3TBHA 1UAAA 3RASA 4P54A 4NCKA 1VFPA 2ZBUA 5KHAA 1NHGA 3FGZA 3TPFA 5AJUA 4DBLC 5L6MB 1QAQA 4LECA 5A5DA 4WCFA 1EBUA 1GZ7A 4C4XA 4GC9A 1QPZA 1TEHA 3WB1A 1PG0A 4FWIB 3LPCA 4PO1A 3BXGA 2IHZA 2XY4A 3Q1KA 4FFDA 4FUTA 5A3VA 3IOBA 1B73A 1IC6A 1YB4A 2FE1A 2Q4EA 1Q50A 1H2RS 2QSJA 3LQ1A 3PX3A 2FPGB 1C81A 3RAGA 3EFHA 4IDCA 4EF6A 3VR3A 1NQXA 2MHCA 4EK9A 2ZCJA 2YN2A 4A6XA 2VJNA 5FTNA 3WFJA 5JAMA 3VC7A 1Z7GA 4RLQA 2J3EA 3F3YA 1W46A 5HPYB 1W0JA 5D2CA 4B3TB 1V6SA 4RX1A 4HNRA 4O2BB 2RBGA 3QUQA 2DTEA 2JCYA 5HR5A 4OFZA 4FNMA 2P6NA 2AKEA 4N7JA 3IBCA 4IL5A 5FEUA 1SU7A 4CEJB 3A4LA 1RHRA 3F74A 1H42A 4C7MA 4NH0A 2G8NA 2TRSB 2ZWOA 4GNRA 4M0KA 1NY6A 4XPZA 3IPCA 2JFWA 2VJKA 3QFHA 1D4ZA 3FR8A 5IKMA 2UUBB 5JDIC 2X4GA 2JFUA 4HK4A 1DQSA 1MBZA 3PWSA 1O58A 3IP5A 4M89A 2C8LA 3LUCA 3AH8A 2PH3A 1K6EA 4DIBA 2AQ8A 5K6AA 3ORHA 1DADA 1KFEB 1W96A 3FOAA 5DO9A 3VV2A 4F9GA 3A28A 1E7YA 1T8RA 2GJ9A 4M0DA 4MYRA 1QHFA 1ZQ9A 2V54A 2X76A 3OZCA 3UANA 2I76A 3SVZA 4A82A 2ZAMA 1ZCBA 4RSGA 3CVJA 2QI9C 4P4LA 4Q05A 3RB8A 3RHSA 5AK6A 1O6BA 3FGPA 1HDEA 1JN0A 2BFWA 5B6JA 5JD6A 1YCFA 3H1EA 1T5DX 3LDGA 5JASA 3Q11A 1VHQA 3A4VA 1SOVA 4FR0A 2Q5CA 3SAJA 5GP1A 4XWGA 5ILGA 2JIRA 4H1WA 3RS5A 2AHOA 4YX9A 3A1NA 2V7TA 3KQMA 3PQCA 4YUZA 1KMQA 5CBKA 2P7HA 3TLXA 4L27A 1OMOA 4JVSB 3E5NA 4MQFA 5DSTA 3DBOB 3V9AA 3HB0A 5BN1A 4X7MA 1K7YA 3KCQA 2PH7A 5AKZA 2A0KA 2IOHA 3ZDQA 1KI6A 3LDHA 3MLAA 4WK2B 2B4RO 1XLVA 3MTAA 4O4HA 2QZZA 3NH6A 5EMMA 5ED0A 4AKIA 4WERA 1V48A 4EATA 1FYDA 2WPDD 1Z7WA 4PC1A 1C7IA 3D7RA 3R9IA 3LAWA 2J9FA 1OI2A 3TSWA 1R1DA 2NTVA 2RH8A 3HWWA 4DW8A 4RE6A 1CRLA 1Z5GA 4ZDWA 1CQPA 2IKQA 3JQEA 1C2YA 4R9UC 3ZHVA 2XXBA 3L0YA 8ABPA 3NUGA 2A9JA 3U1VA 4YP6A 4F4JA 4YRZA 3MS4A 6ADHA 3DWGA 3EC1A 2FF5A 3FVRA 4OM8A 5LB4A 8GPBA 4YDQA 3EVBA 3F6SA 1H4SA 5JBIA 2P0EA 1OBVA 2FF7A 3B12A 3UB2A 1NLFA 3RJ5A 4B4DA 4RULA 3CVVA 4LJ9A 4M38A 3MBOA 2HRBA 4ZI2A 7ABPA 1BEEA 4CIXA 2QX7A 2FI1A 3NBYC 3WADA 1CDZA 4FSDA 4HJXA 4N03A 2DVMA 4GYYA 4HFNA 4DB2A 1VIAA 1C1DB 2OHHA 3ES9A 3K70B 1WBDA 3RSCA 2X7JA 4W8HA 4QDXA 1K68A 5BQPA 1AKNA 2GRJA 1SIUA 3LF2A 4OL0A 2G1JA 3DTVD 2BR3A 1DWQA 4HQ0A 1EXVA 1UXOA 3LXUX 3FR7A 5HCUA 1VBKA 4JKOA 5I7EA 3FFTA 1THMA 4IXWA 4LMAA 1VE7A 3B6JA 1ESNA 1LNQA 5JY6A 5J2UA 1FL9A 3CJTA 3MTBA 3PYLA 4URYR 3GBPA 1Z45A 3CR3C 3HI6A 2V8OA 3VHRA 3CVXA 1KK0A 5HKBA 1AD2A 4OMFG 2BFCB 4RY0A 4IY1A 5K6AC 5DYNA 2QA5A 3B3QA 3BAFA 1UJ5A 4D8YA 3VJLA 1ODLA 5ESWA 5H59A 1J1IA 3KJZA 4M6WB 1Q2XA 1OPRA 1EAYA 1S6YA 3AHDA 3QKSB 1W2GA 2CB0A 1HY3A 5COQA 5L3QB 3IV9A 1LC3A 5AJTA 1U81A 1XAJA 3JWHA 4E08A 1GPUA 1V3QE 1YR1A 2JRLA 4YLYA 2IIPA 2VUUA 2ZUTA 4ZOCA 3L1JA 3L84A 4FSHA 1N32B 5LZ9A 3SJUA 2NVOA 1TTPB 2ZSBA 3VNQA 5BNZA 3PPXA 5EJ4A 3LT4A 1OI4A 1GPDG 3OQIB 4DAOA 3M33A 5IKXA 3OO1A 2GJ4A 2REQA 1WDTA 4MVXA 5CLQA 5FL7A 2FR8C 3CVOA 5IANA 3TAUA 1SVUA 1NE7A 3QVGB 4IIBA 1GXSA 4LC0A 1T5IA 4LZOA 2ZIGA 4Q9DA 5FOXA 1WB9A 1KRWA 2NO7A 5KOJB 4HAWA 4Y9TA 3IQFA 5ES3A 3Q2KA 2PT9A 1R88A 2G5GX 3TVDA 1V1MA 3C98A 4TV9F 4IH4A 5CFZA 1ARZA 3TCKA 2BM1A 4G9EA 5DNDA 1F0NA 4YDRA 4HB4A 4QYIA 4EW6A 3HZRA 4ZRNA 2VS1A 1HR0B 3ZDYB 4EUFA 3D02A 1LY1A 1XQ6A 4KO2S 3CO5A 5EKUA 2HDOA 3D6MA 2WHQA 3A9RA 4Q3CA 3UFXB 1T5BA 4H7KA 1MRZA 1M0TA 2J9GA 5AJVB 2OCDA 1TM3E 1E2DA 3VO9A 1XTJA 3I8OA 1K7XB 3AVVA 3W78A 1MJ5A 3UW3A 1PNOA 3CCCA 4F6CA 4N54A 5HZGA 4RIFA 4MAAA 4BP9A 2QTNA 4JVMA 3M4NA 2B69A 4M1MA 5HZMA 3IJEB 4LWZA 1MTOA 2W37A 1WD5A 3L43A 2XYQA 4KRYA 4KDRA 4EW3A 4ENRA 4UCXA 2XUJA 3L05A 3NNNA 5HF9A 1E94E 4DF3A 2FRDA 3PITA 1U0HC 4IG9A 4BMOB 3U4QB 5K3AA 1M1ZA 2B9VA 3IKLA 3P9KA 2K7FA 1DCTA 4OX9B 1EP9A 3OP1A 4LY6A 1ONSA 4C2AA 3DBLA 3PDJA 3PI7A 1O9BA 3QYJA 1GQOA 4PR0A 1DRVA 3CCBA 3WV5A 3T3DA 4UREA 1GGMA 1M1NA 5BPHA 2HLHA 4HX2A 3UC5A 4V0QA 4AUEA 4RH3A 1O5TA 3SS8A 3GU3A 2QK4A 5I5EA 3D3JA 4J1SA 2ZS7A 1GG5A 3VPFA 2Q3BA 2OLJA 4UHHA 4ZOAA 4CIAA 3GGSA 2IP2A 3C7CB 2EJVA 2WQ7A 1J0EA 4RD2A 4F97A 3BGOS 4LGYA 2Y92A 1OLSB 1BSVA 5KYYA 2HJRA 5TPWA 1X0VA 4F9FA 1EEXB 1OUMA 5DEIA 1AIPA 3WQQA 1TYBE 1F0PA 2FVYA 4US0R 1KP3A 2GKOA 2OC9A 4PRYA 2VDKB 1XT6A 3VR6A 1J2TA 4G5HA 2H16A 2QF7A 3OIUA 2CGEA 3E2PA 1GUAA 1EB8A 1I0ZA 4WJKB 1NFRA 2CYCA 4KH0A 4GP6A 4N6GA 2G9NA 3A0UA 1RWOA 1ZL2A 1EGAA 1FPQA 1TU0A 4PFKA 1PTKA 1QRDA 1E3LA 3DCIA 3VR3D 2Z2IA 2C7GA 1EFVB 3I8SA 1JZTA 4LFCB 2H65A 2FCRA 3AFOA 4R9SA 3TJZA 2AG5A 2BEJA 1WDLA 3JASB 3W6NA 5JQWA 1NVAA 3FGOA 5A04A 4I9NA 1VSUA 3GEHA 3ROXA 3FJ1A 5KKCA 3B89A 3W8EA 1F0YA 1PS9A 5EE5B 1UC8A 5GJWC 1DMRA 1U5AA 4ZO6A 4B7CA 3FFWA 5JXJA 4DEXA 1U3WA 4IFTA 1Q1BA 2X7HA 1ZJ6A 3K0AB 1NF2A 4DMLA 4JA0A 1YKFA 4OXYA 2C78A 4M0MA 3HDTA 3W4IA 2ZIXB 3AFGA 4Z4HA 2E49A 2JFVA 3W4JA 5CB8A 4CM5A 3FOWA 2IY9A 1C7ZA 1EHYA 1RKBA 2ZWIA 3A37A 1E5TA 2ORWA 4Q1VA 1SVWA 1XLWA 2AKAB 2WFZA 3GG9A 4KLAA 4MNTA 2Y6VA 3PRKE 3LGSA 4K9KA 4MAMA 4EI2A 1YBFA 3UJPA 2QUBA 3N7TA 2QUIA 1JDZA 3WKCA 5FBVB 4CM8A 2IKSA 3DDUA 2BJHA 4LBZA 4WLNA 3U80A 1H6AA 1U8TA 1T29A 2B8WA 1SN7A 4XYLA 2JJ2A 1PL0A 4P08A 5T57A 1B76A 3TLGA 3AZQA 3DP7A 3DAFA 2UYCA 3DMDA 4R9NA 3KOUA 3ND7A 2W9XA 4Q34A 5JH7B 2IBSA 1JDVA 2HA2A 3B6EA 4OP1A 3OQOA 1QCDA 3I6QA 3DEHA 2XRMA 3A14A 4G24A 4J94A 4L5BA 1LC0A 4A8HA 2HC9A 3HJTA 4X7RA 2X6QA 4S0XA 5LKRA 3RTGA 1J2UA 3U3OA 1V7PC 4KWIA 1O5IA 3ND9A 3WWYA 3A6KA 4TMFA 1L4NA 4KXXA 1CF4A 2HMVA 2EKQA 4EG0A 1E8NA 1WUJS 4D92A 3M81A 2D3TA 3I4CA 4KZKA 4YB8A 2HU7A 5HJ7A 1NRXA 5HVNA 2DU8A 3A9WA 1GNTA 4B31A 2BKAA 2WTXA 3A06A 3E82A 4QOEA 3TE6A 2J9ZB 3M6FA 1QG0A 2ENWA 3KDPA 4MHTA 4DG9A 4LVUA 4LOJA 4EKYA 5IBCA 3RYCB 5IJ0A 2V5VA 2VDUE 5G0WA 5EMJA 2ONYA 2ZJAA 4KQ6A 1XVLA 4B6FA 5B55A 1RYEA 5IUJC 2NPIA 4M4SA 4A6PA 3MT9A 4BKRA 3Q87B 3U1BA 3GLIA 3S2FA 4E4YA 1RKXA 1CJTC 5F98A 2XUIA 3P97A 4DQKA 5KNBD 1TMYA 1XDUA 2PQMA 2PMCA 3DMRA 2PUHA 2LGJA 3DEKA 3IC5A 3SPXA 3T3IA 1RJ9A 5AKJA 1ZI8A 3EAFA 5DWDA 3B8EA 3G68A 5BWLA 4TL8A 4R0MA 5JS8A 3S1LA 1ODFA 2VJMA 5EHZA 2XBMA 3BXXA 1E3IA 1N9GA 2OKGA 2I7DA 3M1AA 1XZQA 4CLRB 3D81A 4DR3B 3QG1A 5LQCA 2BISA 2WWXA 4YALA 3U7QA 3BYZA 1YZNA 4EKGA 3ANTA 2Z3VA 2HNAA 3IUEA 5LMUB 4U8GA 3B53X 5ESDA 3ZQ4A 2MYPA 2HGSA 3EN0A 5JECA 2B78A 4WN9B 1E92A 1OR8A 4YRMA 1R9MA 1UDCA 2XWQA 1YXMA 1TJNA 1PGOA 2UDPA 4J07A 4RDXA 1YOBA 5AKXA 3V7NA 2Z4SA 4F21A 4FYMA 4A1FA 2ZI7A 4JBXA 2OG2A 2XV1A 3I72A 1SBCA 3EWAA 3A1FA 3SC4A 5FQOA 5KWSA 5F7ZA 4DLUA 2OWEA 5B7PA 2ZWAA 3EVNA 3ORRA 3TECE 3LSTA 2JBAA 2Q3EA 4FU0A 1FTSA 1G8YA 1L8OA 2IUSA 4N65A 3K0EA 3JV7A 1WLSA 2OXTA 3WGMA 2DLCX 1DSSG 2JHPA 1G5FA 3ZHYA 3WYGA 1QHXA 3FOEC 1IBKB 3DP9A 4QO7A 4MV4A 3GLRA 4CMIA 2C5EA 3O4FA 1C14A 4FHDA 2CCGA 1JFTA 4QAJA 3ZNQA 4XCXA 4A92A 5J2TB 4ENQA 1NBMA 2OP0A 2Z98A 5IAOA 5E4FA 3BDIA 2WPNA 5GQSA 2WYWA 4Y2YA 5C8DA 4I3HA 1DTEA 1CUIA 1ECCA 3D8UA 1CQJA 3KJFA 4JFAA 5B7QA 4ZVUA 3H5AA 4F6LA 1YK0A 2YVQA 2O20A 2ROQA 1SZPA 4NFLA 4YP9A 4EGFA 4NARA 5K0ZA 3IIKA 2J0SA 2IX9A 5EIEA 1CB7A 1EVEA 2CXUA 4UU0A 2YV2A 3PHJA 1DKQA 3KKMA 2I3DA 4ZV4A 1TJ4A 1J0XO 3HCDA 3BBPA 2G0NA 2CE7A 2ISSD 1QB7A 2RGCA 2GCIA 3NRBA 1LPAB 5AW2A 1N36B 3K8YA 5KX5A 2IYAA 3N0TA 3DL0A 4BTEA 4HLUC 4KE9A 3VU1A 1SUAA 4B46A 3RBVA 5IWCA 4WI1A 2PN1A 3M1LA 3V3KA 4CLXA 3VKGA 1NN1A 4TL9A 4L9SA 1T25A 3WGOA 4DIDA 2WP8J 3N53A 3I45A 1UC5B 5D87A 3TTXA 1G8HA 2J3QA 2VNKA 1OBCA 2I54A 4A03A 1D2GA 2PCLA 4X1IB 4D25A 2GZ3A 2EGHA 3PUZA 4GLFA 4J1TA 5EL0A 4HOYA 5IAKA 2EW8A 1BOOA 2X9GA 1KO5A 1ST3A 1N4AA 3RG2A 4WN9A 1K8RA 3QW4B 4IQGA 4B09A 1I7DA 5B7GA 2Y0BA 2YUIA 2PMEA 2UXCB 3QQPA 4ZTZB 3RSHA 2VXYA 5LN1A 1KAGA 1KI2A 3JD0A 5FJIA 5JTUA 3I61A 3R7FA 1M2OA 1EP2B 5DRYA 2ZLBA 5I9MA 3IVGA 3ZWNA 4IIJA 4UNQA 4ND5A 3H8SA 1N2XA 3D8RA 4OU5A 2QTLA 2O7NA 4Y6PA 3S2ZA 3VC3A 3RC9A 4EHLA 1A88A 1RHQA 2KW5A 2ODEA 1P0IA 2IOYA 5SYMA 1XA3A 4BUCA 2J0EA 2HF9A 4ZXFA 1HM5A 5KQLA 3A2KA 4TL7A 4U63A 4UC0A 3DJYA 1R3DA 5HKLA 1UOEA 2VQ3A 2BOVA 2NUAA 1PZXA 1TF5A 2J3DA 3G59A 4LHWA 2WI8A 1JQJC 1ISMA 1KO4A 1OXKB 5EP1A 1RRCA 2Y27A 4FK8A 1UOQA 3VR6D 3VPCA 1ZM2A 4WLUA 3L1HA 2XGOA 3I2JA 3TZHA 3MUFA 3HVRA 3GQVA 2HQBA 4B3RB 5LQMA 1G6HA 3JQRA 4Y30A 3KLMX 4R1UA 4KFSA 2HSDA 3KL2A 3UENA 3DVLA 2G1PA 1GFZA 2TMKA 1DAOA 4HQLA 2AD1A 4YH1A 1RPAA 1LF5A 3PUWA 5KBYA 1JMYA 1TA4A 4JLOA 4PX3A 1FMTA 4OHBA 3O8NA 3PQEA 4LTMA 1VCHA 2JCGA 4TQGA 4B6RA 4JS0A 2RKWA 2X2EA 5ECGC 3SHFA 1NHWA 4A0SA 1U8UA 4C20A 4AXBA 4KXLA 4P3OA 4BO1A 2FZEA 1Z5VA 5AXBA 2Y1XA 1DTWA 4N3BA 1PZMA 2R7NA 3RK4A 4D7AA 1F0KA 3BERA 4N9QA 4Z8YA 1Y3IA 4HLUA 3T7AA 1XD9A 5DIZA 3TPZA 2GFHA 1XAIA 3DZJA 1TMOA 3AR5A 4IMIB 5BP7A 3P9NA 1JI0A 4XB2A 5C8VA 3RARA 4ML3A 3H5OA 4GC5A 3OZFA 3TN7A 2XJ9A 4ZIRA 2YZNA 1AKWA 4HAOA 2ZIXA 3KJHA 1JF8A 1SULA 4ZT5A 5HWSA 1DDOA 3FWKA 4MLDA 2CC2A 3C5WP 1OFUX 4GVXA 3EK2A 2VUHB 4Z4CA 3NHYA 3BCRA 2RHWA 4TTTS 1E6UA 2JGMA 1QH8A 1L7BA 1R4MA 3U3RA 4U7JA 4RTQA 1Z2EA 3P9RA 1OX5A 2WD8A 1P2DA 2ZI5A 4N1AA 4OX9Y 1RWNA 3DW3X 2MINB 3CEMA 1ZGBA 3DMNA 2X4DA 3OZRA 4P7FA 2CLFB 3A6FA 1A9XA 3ZCPA 3N2LA 2ZIUB 4WCVA 3TZ6A 4D45A 3ICVA 4W9NC 2RAVA 2W2MA 4KQGA 5FNVA 3QXJA 1M5UA 4CF4A 2BJWA 1QCZA 1EU1A 2AYZA 1I3NA 1EJ0A 1RZRA 4AZ0B 3A6JA 3OQMA 4HFMA 4U7HA 5AM3A 3F67A 4Q3LA 3ITEA 3AEKB 2N1MA 3FMGA 5JDCA 4YRLA 4Y1RA 3LQRA 3PWZA 5GONB 2JVIA 4PE5B 3IRUA 3A9UA 4CF3A 4EX6A 5FA5A 2EJWA 1ADCA 1GKUB 5IVPA 1UPFA 3HBLA 2MYNA 2QPLA 4W5NA 5EFZA 2WHRA 1HDOA 4IOLA 1JAZA 2O8DA 1GQRA 3IKMB 4AD8A 3MINB 1FP2A 3DOUA 1YR8A 4RVUA 5BN4B 2VLIA 3SR3A 1BN6A 2RAPA 5F33A 4C5CA 2QHXA 3FX2A 2Y9MB 3QTLA 4RPGA 4URUR 4NDZA 3W6PA 3DOHA 5L4SA 3RREA 3G82C 3VU9A 2BMDA 4U7FA 5EIFA 4HL6A 3GRKA 1PJLA 3AJEA 3MOGA 1I1HA 3SJ7A 2BVNA 4TSFD 5AOVA 1DC7A 1L7EA 3A0RB 3DXZA 3GMIA 1E9BA 2AQKA 3ONWA 4KLNA 3RYFA 4WJLA 2WM3A 3W3AD 1IVNA 3L0SA 5GJVC 2R44A 3HKEA 1LW7A 4WK4B 1LV7A 3QVUA 4D2IA 2C2MA 1R0SA 1XE3A 1J8MF 4Z0HO 3T5PA 2W2KB 5C3MA 5ALWA 3C1AA 1YQWA 4D3YA 3QUBA 3CXUA 3EXEB 2FN9A 2FLVA 3WIOA 3OU6A 2CEKA 4G1UC 1S4QA 2HF2A 4BMZA 5H1YA 4ZI7F 1NWHA 4FYPA 3NHKA 2PX2A 1HPLA 3VR2D 3MCTA 4B3XA 1G8GA 5DLEA 4CMJA 1N6KA 1OHHA 2QN6A 3VKWA 1Z2AA 3WNDA 5FV4A 1JBKA 3BH6A 1B0PA 4TMKA 2VJPA 3CNOA 4NK4A 3NEYA 1ORHA 3KPJA 3HCBA 1AN0A 2FQWA 1QHHB 2WQZA 2ZI6A 2ZS9A 3GPCA 4UU8A 3Q7EA 1Z4OA 3R5SA 3U4MA 1N5KA 1RBZA 5C31A 1I8TA 3CEPB 3I39X 3N0WA 2IWRA 5AUPB 2X0FA 2WWGA 3LL7A 2IXFA 2B25A 1R8QA 1UQTA 3BWMA 3GLSA 3H2BA 3M83A 4P86A 2XCLA 2PUVA 2XA9A 4WXEA 3SYKA 3TSAA 2ORYA 1QPBA 2Q50A 2W2KA 2XA2A 4MKXA 1KARA 4MRMB 4F5ZA 2PUCA 1BVHA 1XP8A 4UM7A 3MCVA 1P4GA 4BZQA 1NW3A 3PD1A 5GM2A 4A27A 3LX4A 1T5HX 2RBEA 1SCNE 1ZC4A 1GZUA 2VJOA 4KR0A 4KOEC 4DRYA 2FPIB 2I67A 1NZJA 4Q4CA 4RJLA 2B3TA 3ED1A 2Q4TA 2J3MA 4H77A 2WB2A 1L5VA 2WSMA 3KPYA 1FQOA 4B73A 4Y67A 1JJVA 5JCOA 2VCYA 2WC1A 3ZNNA 1BJTA 3G9UA 1OZGA 1RWWA 4KGVA 3RAPR 3TI7A 4NZZA 4NBLA 1R0YA 1G5QA 1L8AA 2NVWA 2YRFA 3I9V6 3KOOA 5D84A 3LUKA 5K7SA 2HGZA 1RCTE 2NYRA 3OLZA 4BCCA 4BMCA 3BREA 3OEED 4WY2A 4GZ3A 3ZDZB 4MRMA 4UW9A 1E18A 1MC4A 2PZGA 4RPJA 5KSZA 1E2BA 3A4MA 1I51A 3PUJA 2WHPB 4OYLA 2PS0A 3I83A 3N6XA 1SXJD 1F5NA 1VCNA 3DTVB 3OJOA 3H3FA 3F97A 2W6JA 4D4IA 1JLHA 4JODA 1MENA 4EAAA 4NWIA 5L3QA 3H5NA 2V7QA 1YVPA 3R0QA 3WGZA 5A0TA 4FNAA 4Z54A 2MU1A 1FUYB 2ZJOA 3LW7A 5CB0A 4DGSA 2BI7A 1VKJA 1WE2A 3GLHE 2OWDA 3NHWA 3Q10A 1O8BA 2ZUFA 2CHGA 3G5AA 3PI6A 4C14A 4RQBA 1VG1A 2D1FA 2EWWA 2D13A 4XM1A 4WOBA 1OTYA 4MXDA 1CY2A 3QFTA 4WRRA 3WY9A 1JR3D 3I5UA 1RTKA 1MAAA 2O1EA 5BSWA 4MVJH 1X1DA 2HNKA 1AKTA 1WXGA 3F90A 5DASA 2R6HA 1TYAE 2JJYA 3PCRB 1NDHA 4IXNA 4HVAA 2QI9F 4BS9A 5D5HA 4V1CI 5K05A 1XU7A 5LOVF 1WZEA 4UU7A 3ISVA 5CJJA 4LDQA 3KVRA 2QGZA 3PG5A 1T2NA 2SBTA 2DHQA 2P2ZA 1YU6A 5FTJA 4CL0A 4Z3KA 4OHOA 4M0FA 1ZOSA 3QY9A 4CL2A 3HGTA 3ML1A 5CH3A 3WLJA 4KMSA 2OBXA 3B60A 5IF3A 1I94B 1JFLA 3LYHA 1DC5A 1Z33A 3OLVA 3RABA 1PZNA 2GGSA 1MB0A 2QLMA 3L46A 1KDZA 3ZDEA 4B44A 5KVAA 1YTUA 1KAEA 3NM5A 5DHRA 2DY1A 4JEIA 5KQRA 1JHZA 1PWZA 2ZYAA 2AUTA 1QOPB 4I1IA 3HZOA 4EGSA 1O4WA 3E27A 3HC7A 4YFVA 2D7JA 1RC8A 2JG3A 1ZW6A 2X1LA 3FOBA 4ZTUB 2IYLD 2D1YA 2PZBA 4Y6QA 3SNHA 1NMZA 4BNJA 1GGKA 2H7YA 1MAUA 2OHVA 3V34A 1Z63A 3HA3A 4Z4GA 1P6XA 2I1VB 4PLWA 1Z6ZA 2QRHA 4ZAWA 1MO2A 1VYHA 1C1XA 1VHJA 1MJGM 4IIFA 4Z0NA 5BQ5A 2ONJA 3WLPA 5LMCA 2PGNA 1XKTA 2X9LA 1UUFA 1U4NA 3HVIA 1X6VA 1Z17A 2LIVA 4II2A 4EEZA 4DADA 5IT5A 1D3AA 1VDMA 2BHSA 1U7OA 1Y8QB 2IYUA 5EIHA 3ASUA 3CZAA 3TDNA 3QFCA 3R74A 3T12A 2FJUA 4MW2A 5E2AA 3I9MA 3BRQA 3RLIA 2EKPA 3ZQJA 2ZK7A 121PA 3AI2A 4PZDA 4BUJA 2NV2B 5EC8A 4K28A 1U3VA 4UUMA 1A82A 3BIFA 3D2AA 4RZUA 3MWEA 3RHZA 3C3BA 3BE5A 1RXIA 1EK6A 1FNNA 3KT0A 4IO0A 2BGNA 3QEJA 4Y2PA 2QTBA 5DBFA 1A9TA 2X4LA 1NBIA 1PP4A 1RQ2A 2WAOA 4B48A 3HNRA 2DPHA 2Q7DA 1F06A 4ZQHA 1QP7A 3WRWA 1F7UA 3ZY4A 2IHVA 3IJPA 2NQ2C 1PL6A 2NX2A 2ZRPA 2ZU6A 2IE8A 2Z4TA 2RARA 5BQXA 4L5CA 2BM0A 2H59A 4EUHA 1GWNA 1B93A 4EQ6B 4BLUA 1UPAA 2QE7A 4DMKA 3EVFA 1Y1QA 1OILA 1Z8FA 2WYVA 3Q3EA 4FGUA 4X00A 3WOHA 1GAWA 2XSZD 4F2PA 3AONB 3L0PA 4WZAE 5FUVA 3OT1B 3EIUA 4D80A 1UWVA 3OZIA 4XI9A 2ZZMA 2WUFA 4R2JA 1KORA 3IVCA 2H00A 2R7AA 1G42A 2QTTA 3PUYA 2WNHA 3FDJA 4I5DA 4F9TA 3IL2A 2BUBA 4RJIA 1YL7A 4HDOB 4X9XA 1A2BA 4V0SA 1YB6A 3NO4A 1II9A 2JFFA 3LFTA 3DF9A 3TFWA 3E7FA 2RB4A 5D5QA 1HDZA 4OB8A 2F7SA 1W4BA 3AUAA 3U39A 3T1HB 2QD5A 2HBZA 4HPXB 5GWXA 4BFTA 5ADUS 1BE6A 4MWEA 2EGUA 4HGRA 4X91A 5CAEB 2H7VA 3BMQB 3QX9A 4PVDA 2JHGA 1RXEA 5K8IA 3UYKA 2GZHA 4KJXA 2H06A 5JRDS 4PTZA 5AIBA 4CV1A 2WNSA 1GL7A 1G8AA 1TB4A 2D1RA 1BRMA 2WIDA 3B1VA 4NNJA 1P4JA 1QP8A 4M83A 3ZQ6A 4WHMA 2YBEA 3T9AA 3FA2A 1CP2A 3QYAA 4MB6A 3DHEA 3ZD9A 2JLXA 4WCFB 3ULKA 3CXRA 5CR9A 5DHFA 3TLCA 2RHJA 4L5IA 2P6RA 3OPVA 2HREA 5KTNA 3A1WA 3DT9A 4AU1A 3M1YA 4O4JA 4Z1MD 2GAJA 1W0JD 2BUCA 1JSXA 4FYYA 2P5SA 5DCYA 3Q2OA 5ALEA 4YMIA 2RIRA 3OEHA 1HXHA 3AM4A 2C61A 3EC2A 4RIHA 1PFVA 5IC4A 1SOMA 5LU9A 2A0FA 2BAGA 3PHIA 1NVFA 2GTHA 4HMPA 4HVTA 2B1GA 9ATCA 1JAXA 2PJRA 1K3FA 4DA6A 2ENUA 1CUGA 3WIUA 1S2GA 2C1ZA 4MV1A 3IHWA 3A9VA 2DR0A 3AF4A 1NASA 4LC9A 3WYBA 5AVTA 4TSFA 4WV3A 3KEQA 4PZYA 3J7AC 2UZAA 5JE8A 4WFQA 5FLYA 2UZ0A 1UFVA 2B34A 2PJDA 1IQ0A 1IG3A 3T7SA 5LD2C 4KVFA 3OESA 1CUEA 4JN6B 3D59A 1C3JA 1PR5A 1XKLA 2CLKB 1MKYA 3TAXA 4BB0A 4QJ3A 2IHTA 8ATCA 4DQLA 4D8UA 5KYXA 2QUKA 3COJA 1IK4A 4HDKB 3F4KA 1U90A 1NW7A 1HK7A 2DOKA 1Y7LA 3RD5A 2WUWE 1DWUA 4HWPA 1BKDR 4QECA 4CTOA 5BYAA 1AS0A 2X2PA 1M7BA 1AUVA 3A6HA 4OH7A 3B6IA 1BYIA 1CY1A 4NG4A 1LRLA 3LUDA 4ESOA 1MO6A 1PFQA 3O0TA 3AX6A 3GD7A 3VDXA 4LGMA 4CKZA 2I91A 2PZMA 2JHFA 3KOYA 4UTOA 1AGPA 1GAQA 1Q0LA 2WA2A 1QGED 1HFEL 2YIJA 4FZJA 1GRQA 4DNXA 2RHMA 1A7KA 1XOIA 1RJGA 2O5RA 1IWPB 4GW3A 5FL3A 3CWZA 4Y8VA 1BXKA 1TC2A 5DF1A 2PO7A 5FI3A 5IC6A 4YPFA 3EW9A 4PHGA 3V1YA 2CYBA 3GMSA 4JBNA 2Y67A 1N1EA 5EPEA 3G7NA 4YAKA 4ZV7A 1W29A 2HYIC 4JMPA 4UXIA 4YI3A 4G89A 4O02B 2QL7A 5ITZA 5JVDA 1EA5A 3PCTA 1CY4A 3LLUA 5HF5A 4F5EA 1QF6A 4GYWA 2CVHA 4JYZA 4TYNA 4W7IA 2A30A 1E6EA 3OM9A 4ARBA 4D3DA 5KTOA 4TZKA 1Q1GA 3PNMA 1ZISA 4R1SA 3WLEA 4DKJA 4JB0A 1FRNA 5FR2A 1OREA 4J49A 4R1LA 3I2YX 3DLPX 2FPPA 3LVBA 4RV5A 4K9OA 4X8OA 3HDQA 4FI3C 5CK4A 3ER6A 5FUXA 5TPZD 3K73O 1P1BA 3T54A 3V1NA 2C7PA 3EWIA 3QBEA 2P2CA 1V25A 4Z9YA 3KZCA 2FR0A 3L1IA 3LT2A 5TEWA 3SU8A 2D06A 3AYZB 3MXTA 3N3AC 5IYZF 1FVXA 3UMSA 3X2SA 3UKDA 2QYSA 4P7KA 4KSBA 4WX2B 3ZUPA 4Q03A 1JDBC 1F1JA 1N1GA 1EFVA 1UBKS 2DHEA 3L49A 4PFJA 4RK4A 2PRZA 4GQBA 3TTSA 4L1KA 4RK1A 5CVVA 5AOCA 1D4OA 2V7QD 2CDRA 2Q0HA 1FDSA 1LS1A 3EJ6A 4D6PA 4YC7A 1SU6A 5TMPA 1NKTA 5HXAA 2XRZA 2XA1A 3N0VA 5T6BA 2X22A 2YIDA 1P73A 3QW2A 3GK3A 3C45A 3EVDA 2XXAB 2CKMA 4ACBA 3CGGA 2XMCA 3WISA 3WV4A 5B64A 4KCGA 1QQ6A 2J4DA 3GOQA 1J99A 3EXAA 1OXSC 3ZE7A 2OV1A 5L53A 1RC0A 2A35A 2E4UA 2I6GA 4R8MA 4E7PA 4R2HA 1RPTA 1P6QA 3F5SA 1AU9A 1SKUA 1Y7IA 2D5AA 1Z37A 1KZ6A 2A9OA 2PYIA 3CSUA 3U9TA 4AN0A 1LCIA 2W0SA 2FX5A 4K9MA 4AMGA 5GOTA 3SK0A 3S8EA 2ZXUA 1PSWA 1XLTA 1U94A 1J2RA 1G9SA 1LLUA 2XQJA 2IEDA 2CXPA 3HHEA 1RYMA 2R00A 5T3UA 4B47A 2E85A 2XF2A 1NYLA 3TIFA 3TW8A 1S1MA 3U31A 1S4MA 3BUSA 1IBRA 1Q7TA 4I4TA 1FP4B 3BZWA 1J22A 4BLQA 2VJCA 4N01A 2A86A 3B48A 4B6QA 2B4YA 1A69A 4FFBA 3KLPX 4LXTA 3BSSA 2QW1A 2YCLA 3CNNA 2NADA 3TH5A 2NUTA 2R25B 1AJEA 1QMGA 3F6RA 2ZSUA 3JAMA 3TTWA 1FVHA 3GY0A 3TKAA 5DBEX 4NE2A 4XOUA 2IH2A 3DV9A 4C0KA 1RAIA 4IVNA 1CUCA 1O94D 1FRFS 4ONEA 4AURA 5A6VA 3JRWA 1GFSA 1Q1EA 3CRW1 3LS2A 3AW9A 3GJYA 5EKSA 3OEEA 1Q1NA 1QQTA 2XUHA 3F8WA 3GJ4A 3QTTA 4I5GA 4JOQA 4UNSA 1HT0A 2UZIR 4BC0A 4CCWA 4D43A 4POOA 5B4VA 3MW8A 3IEKA 2ODTX 1QRTA 1SD1A 4KNWA 5MF6A 3VH3A 4EBFA 2AF4C 4UMDA 2CW5A 4ZCQA 1HO3A 2OR3A 3CY6A 3EASA 4NG5A 4OMCA 4TKZA 1BNCA 1Z2OX 4ZEWA 1IOWA 2VPXA 2YJ4A 2RK4A 3NASA 8OHMA 1KO7A 3LCRA 3G89A 3M7IA 1NONA 4GKJB 2H63A 4ILEA 2ARKA 1GEGA 3QSGA 2A1TR 2P0YA 2P9CA 4MCHA 1ZLYA 3FDZA 4LRXA 4QGGA 4N6NA 5H5JA 4D9NA 5FPKA 3HA5A 1TGYA 3N2IA 2GNAA 1Y9AA 2NXNA 4B81A 5I7WA 4F4UA 4BNXA 1J97A 3VBCA 4ZZ0A 2J5RA 3G85A 3I1IA 4FCVA 2IZOA 3L18A 4YROA 4LDZA 1KIFA 4ZO4A 4CM8B 2P6UA 2IEBA 4BNVA 1CYDA 2D8MA 4IIDA 4AX4A 2X0KA 2BEVA 3AJ9A 2OA0A 1EK2A 4BV2A 1K6IA 3FVWA 5DBGA 5JTTA 3WQRA 3R5HA 3NP9A 2ZUEA 1JPJA 3W8RA 1QJCA 5CFOA 1DJMA 1YZYA 3GJQA 3ACCA 3BXHA 4EG5A 3R09A 5FA8A 2BBSA 1AHHA 2HMUA 3GVIA 5L3ZA 1WAMA 2EFDB 1KETA 2W93A 3X1ZA 1S2LA 1Z2DA 3TLGB 1E0DA 5EIXA 3N8HA 3GPDG 2GPJA 4JJ7A 3AEQA 4NYIQ 1KMCA 4A7PA 5KPDA 4L95C 1SVOA 4COOA 4JAVC 3WMXA 2QLFA 2KI5A 2I62A 2Q3DA 3DNFA 3KKLA 4MI6A 2I2XB 2IV3A 2O7QA 4QBKA 4XVQA 5ANRB 4Q1EA 4Q9AA 4D5EA 1K8ZB 2IUYA 5EFOA 3ZZ1A 3SE7A 1YJBA 3ZZUA 3NBMA 4K05A 3K70C 4LY3A 1I0LA 4XZ3A 1ZS9A 5ENDA 4GP7A 3MRVA 4M7OA 4A0GA 4K0KB 4GT1A 1WCXA 5A0VA 2DH6A 3VC1A 1ORVA 4G4IA 3M4JA 1RCFA 4ADSG 2OUIA 4YAGA 1U2EA 2WABA 3DXYA 4BWGA 1NX9A 5JCPA 1QHGA 5K8VA 4LF7B 1E9FA 1BX0A 1LVHA 4MUJA 5GZ6A 3A7EA 1THGA 4A5OA 3S2IA 2QN2A 1DC8A 1I2ZA 1K9VF 4QXAA 4Q4LA 1XWIA 4R1NA 3TSCA 3OZDA 3QF7A 1E3DA 2BBTA 1P91A 2VUSA 2CLMB 1XC7A 5KVSA 3RWMB 3E3OA 5AKHA 1ZL0A 2H4YA 1V3TA 2YUTA 2GTIA 1L1QA 4UBNA 1LBIA 1FS5A 4YONB 3NU1A 2R97A 2X4IA 3QLJA 1MMFB 4M8IA 4TKLA 3TNFA 1WDWB 4IINA 4II7A 5JO9A 1KGSA 1ZH2A 1Y33E 3RKUA 2XH8A 3V8MA 1OI3A 1THZA 4H1UA 1JZQA 4F7WA 3RF6A 4G6ZA 1TADA 1V47A 3KHSA 3LZDA 4EJ6A 3T4UA 5AVJA 1KWKA 4FFMA 4MJXA 4YRPA 4D56A 1A8IA 4NCHA 1QP0A 1R27A 2G6BA 3UF0A 2PVSA 3A9TA 2AZ4A 2JS7A 3MIIA 3QITA 4I08A 2W6MA 3UAYA 1GQSA 3HYCA 3A32A 2GWRA 2F1IA 3B3GA 1UJ4A 4HNSA 5F52A 3UWDA 6NULA 4IKOA 4LVOA 1MJFA 4AQ7A 2O8EA 2QLTA 1XRRA 2UYYA 2BJVA 1JALA 2XSZA 3ILHA 4KU4A 3NNSA 3NYQA 3K0BA 3PEWA 2OV4A 1BE1A 4B4VA 4EZEA 1IN4A 3QUTA 3FSGA 2VT6A 3HB4X 4EB6A 5MN6A 3PFHA 5BUCA 1XD2A 1RLIA 1U11A 4C01A 4Q1DA 4UBMA 3FN4A 4RY8A 4FMCB 4J0CA 2EHJA 4P84A 4R4JA 5FI0B 2C82A 3EZ6A 2GYYA 3VMMA 4ZYLA 1ORIA 2IPLA 2KM1A 4L9AA 3ZXSA 4AJ4A 2PPLA 3G2LA 3PJFA 5E9JA 1AZSC 5JJIA 3SSNA 4EW1A 1YKGA 4HH4A 4RHYA 1ORRA 5CT8A 2DLNA 2R8PA 1ML4A 1AOXA 1CJVC 1DCFA 2OCGA 1DBSA 2V59A 3KXIA 1GYPA 1HTTA 1AY0A 5DTIA 3RNLA 4YV1A 3L07A 4DCTA 1FFWA 2G72A 2HIAA 2EARA 2QT0A 3T3HA 1C1DA 3BOSA 4FZ3A 1ESEA 5BMVA 1MVLA 1HLGA 5JHGB 1ZGHA 1C29B 1NR5A 1T9ZA 2CHEA 1QGZA 3O47A 4GUDA 2IF0A 1UBNA 4Q4HA 5K0CA 4E0BA 4TYQA 4JYCA 3U81A 1E99A 2GBGA 3E8XA 1C3OB 5B4TA 2AMFA 4WVFA 1F6WA 1JP7A 3H3XA 3ZWYA 3R5JA 5NULA 2Q1TA 3TQCA 1QBKC 3YASA 2VHJA 3R8CA 2ERCA 1QS0B 3OMXA 4AF8A 4Z4IA 1DU4A 4MZXA 2BTEA 2O5CA 4NMLA 2A92A 1ZWLA 2Q6TA 4JJ4A 4UPEA 5B36A 3PZRA 1GKYA 5A3RA 3DFZA 4JLNA 2OAP1 4ZC8A 1NUTA 2BSXA 1CIJA 3AM5A 1HWYA 2VHTA 4J6FA 2FW8A 3IAAA 5ILOA 1C1YA 1L8QA 4KTTE 3FYUC 1GNRA 5G1NA 3JW8A 3BGDA 1Y34E 4B3GA 3AR6A 1AV6A 1UDXA 3OSUA 4DWWA 1L5FA 3V2UA 3OOEA 4IUCS 3K09C 3ZWQA 3IPYA 5A2QA 5LLDA 3QEBZ 3TQFA 5FI5A 1P9NA 3I6MA 1KJ8A 2F55A 3KR2A 2WWWA 2ATEA 2EFJA 2X5KO 5G0SA 1EDBA 4BZZA 3ZDAA 1JSZA 2YDXA 1NNSA 3UJ3X 2ZDQA 4URWR 4X84A 1C9NA 4Z99A 4A23A 4BEBA 1IVYA 4DHEA 3GT4A 4MW0A 2J32A 1RI3A 4IIXA 3U9SA 1KJQA 4YBRA 3DLTA 3WGNA 1KXJA 5GIPE 1M34A 3HA7A 3ZU2A 2PA3A 4IHJF 4BBPA 4NNPA 3VVMA 4WKGA 4EGAA 2R751 1W4RA 2C4TA 4GXNA 1GA6A 3KQWA 4I1UA 4NFYA 4G8CA 1NN5A 5TQ0A 2NSHA 4AS3A 2JC3A 4JBYA 1FVOA 5JCJD 4M8KA 5E6RB 5K20A 1CQIB 1W5AA 2D5IA 1TYZA 3GRYA 4EYSA 2SECE 4RGQA 4EHFA 3TD2A 4PTLA 2HEIA 1F2DA 4QBGB 2C94A 3TRJA 3CKKA 4XLLA 1DKNA 4QARA 4MGHA 1R66A 2R65A 1NUQA 4AX8A 4EY4A 3WNBA 1JJ7A 2EF1A 2JFNA 1SQ6A 1C8LA 4YCSA 3NHUA 3SD7A 1DEKA 1X9IA 2V4MA 2B3DA 5K4HA 1WG8A 4MW4A 2E48A 4IZ6A 2LPMA 1DQNA 1AKRA 2WYOA 3A25A 1DRUA 2HY7A 1DPFA 2R8RA 1OW3B 3CH6A 3CT6A 3H5IA 4DPKA 2BIFA 1PNQA 2VYQA 3E84A 1N6OA 1O2DA 1G8MA 1GLGA 4L4YA 1MLDA 1RI1A 1XPRA 4UE6A 4EI9A 3GO4A 3LUGA 1GNPA 3JD2A 3Q3GE 3R44A 4NP6A 2ZUWA 4E5SA 2Z57A 2ZB8A 4B6JA 1ZCZA 4Q4HB 1SRQA 4WZBB 2H3EA 1DUVG 4K87A 2GXSA 4N0PA 3FAZA 4MVYA 4MS1A 1CQIA 2IJGX 2VRBA 4C07A 2PNJA 4MQFB 2DCMA 3CLVA 1JG1A 1YB7A 3GVCA 1U7UA 3I9JA 1RKQA 2F1JA 1WUYA 2OECA 2GESA 3VU3A 2SKEA 1C9DB 4AZVA 1X1TA 3RTAA 1XXHE 4L2IA 2FU5C 2WWTA 3JCZA 4QGSA 5M04A 2R84A 1ECLA 3F6PA 1XFDA 2XIQA 1LRJA 3KUKA 1CEEA 3FYUA 4QKQA 3FHLA 1NL3A 3DOCA 2HA3A 3BWVA 2WZDA 5EAIA 3UWKA 1EVQA 1NI3A 3L8CA 1XRPA 5T67A 1HEUA 2D00A 1OH6A 3WGTA 1OAOC 2PGDA 1QK3A 2YOFA 2DH5A 1H3EA 1SBYA 2ZYGA 3PIDA 2EKZA 4LJ6A 3Q5EA 4LE1A 4MQ5A 5LUBA 5IH7A 3A4IA 4UD6A 4C2UA 1WQ1R 13PKA 1CF2O 1GAXA 3MWLA 2D3WA 4MVJA 3V1LA 3EQ6A 2FOXA 2GN4A 3MCAA 5BWNA 4QPCA 2J7KA 1VIYA 2XMBA 3LO8A 3ZKWB 1IMOA 1T9KA 3PS9A 3U40A 2VDJA 2VTEA 4UAGA 3Q7IA 5LVAA 4JLBA 3A3KA 1X9GA 2IYRA 2J0VA 3SVLA 5FOTA 4BDSA 4XQ9A 3GFOA 5JCOC 2VHZA 4G5YA 1EGVB 1MCZA 1KYWA 2LKCA 3MYRA 1AB5A 3IYLW 2X23A 2RKBA 4JQCA 1BGVA 1SO8A 2WU8A 4FFVA 2YZ2A 1G8JA 2NZUG 1B7GO 1A2QA 1USUA 1WW2A 3QKTA 1PLKA 1E1CB 1OGYA 4L3OA 4RFSB 5F35A 4ECEA 2OVBA 2Q9AA 1BDBA 4FJ1A 2HK8A 4BNMA 4DBVO 3KU4A 4QPZA 3V4OA 1I30A 1D6JA 3IS3A 4MW1A 4DARA 4UQLA 4MYHA 2C2GA 1DT5A 1GAJA 1O77A 2P4HX 1VDZA 4FQ7A 1UBTS 2JGEA 2YW9A 2HA0A 5D3ZA 4ZICA 4IEIA 1CERA 3IODA 2XBLA 4OHUA 4MI9A 4ZAFA 4DCVA 5HF8A 4GRIA 3JTEA 2HOQA 3WGGA 2WOJA 1ETUA 2G5PA 1NTRA 2EV9A 2GN2A 4BVJA 1UF9A 4INZA 3UXMA 3OH8A 2XOEA 3PDHA 1X80B 3ENKA 4O0LA 1R4NA 5A05A 3RC7A 2FPOA 1WPXA 2PFKA 3JQGA 1ULBA 4JLUA 4L3VA 5C37A 3KJNA 4WACA 1PFUA 4DLAA 3EXEA 3ZD8A 4JLAA 4YJ2B 1IHOA 2CUNA 1IZZA 3QLVC 2NTNA 2YTZA 3VR5H 5MFZA 3VNVA 2GPBA 1GV1A 3VYVA 2I55A 2IC5A 5ELLA 1XCJA 3JWPA 2PSSA 4D4MA 4KE7A 1C80A 3PGXA 1PBNA 1EWVA 2QX9A 1DBQA 4OHMA 2VO1A 2VKQA 2DTXA 2XCQA 4YWHA 3I53A 3RIGA 3LF1A 4DJTA 3Q0EA 4DPLA 4YHHB 2YV4A 1S2DA 2QYTA 1EB9A 1EA7A 4MQEB 3K70D 1IJFA 4TLEA 3MNFA 4YLGA 1RACA 2NG1A 4WH0A 1L7OA 4HEJA 2VRCD 1CZUA 1DDIA 1AGXA 4AQDA 5I5GA 1ZHFA 3EZ9A 1ECJA 2IZ5A 1CNEA 2MYTA 3BIXA 3F47A 1M0SA 3QOWA 1VKHA 4RMGA 1GUBA 1I7PA 3TR0A 1AKMA 2FPIA 4ESVA 1E5VA 1UBGA 4G63A 3RFTA 4Q7KA 3PHCA 4MVWA 1V7CA 3LWNA 1TKCA 3L7IA 2PSEA 3EEIA 3LWDA 5IUKC 3JQPA 3RFXA 1GZ6A 1U0NA 3LW8A 3ESAA 4EA6A 1XZIA 1L6RA 2J1LA 3A6PC 1GN9A 1TW3A 1XKQA 2EIXA 4XJVA 3VHXA 3PC8A 1LEHA 4KR7A 3DO5A 2GH1A 3QWAA 2IU4A 4M55A 4Q3BA 3HXOA 3PGJA 2A1UA 2PZ8A 1SKMA 5L9AA 4B2PA 2C5FA 2QZ9A 4Q6BA 5DRTA 4KOAA 1SC3A 1ZJZA 4U4AA 2C58A 2E5LB 3KZNA 1Z88A 1KZ7B 5TARA 2VDPB 2WSSA 3OLYA 3QVSA 2PMBA 4FI3F 3KFXA 4M0UA 1OROA 4O63O 4W5JA 1ZN8A 3EHDA 3H2YA 2P91A 4KN8A 5H81A 3RJZA 4DDHA 5JOQA 1A77A 1WUHS 4FFBB 1YR7A 2L17A 4EY7A 1VE3A 2SNIE 2HJSA 2VJAA 4IRMA 4AWXA 5C8XA 1IN6A 1WXFA 1VI5A 1C3EA 1XN1A 3R4VA 3SZOA 2MCFA 1IHYA 1P75A 4A1OA 4DUZB 1NW4A 1N5OX 3N6VA 4KQFA 3K5WA 4AG3A 5EWJB 4EG8A 3VYWA 4G65A 2ZUSA 1AVTA 3IO5A 3LQQA 4WKOA 4BVLA 3W4KA 4DLVA 4OQYA 5MGBA 4NENA 2J31A 4QGBA 5DCLA 2JGKA 4EI8A 3U13A 2C4KA 5COAA 2YYAA 2CZQA 5K5EA 3NDBB 4PSAA 2DHDA 1BCRA 1ZNYA 3OPNA 4RADA 4W1QA 1NYTA 5BYBA 3ETEA 3RJMA 2BGRA 4EFMA 3JZFA 4URXR 4K81B 1ZM4A 3S2GA 3K9QO 4CTNA 4R8KA 3K1TA 4TS3A 4CR7A 5HGXA 3H16A 4GVLA 4YVFA 3IDAA 5H70A 5IM4A 3CX4A 1JU9A 4EJFA 2FMFA 4RTSA 1R6DA 4QSHA 5KNDA 4ZI7B 1MV5A 2CV0A 1NZDA 4AKTA 2BP7A 1SNYA 4W5OA 3D1JA 1JHYA 1KJWA 3WL4A 5ESRA 3RIXA 2YFKA 3C3AA 3PYMA 1Z0IA 3EWNA 4H2DA 1JV2B 2K2WA 1MC5A 4EF4A 5A4DA 3BXFA 5KREA 3QTBA 4EX7A 1TA9A 2AXPA 3HBAA 1LDMA 4IBOA 3AT1A 4RAQA 5E6SB 5E3IA 1NJ1A 3H4MA 4BN5A 1JEDA 3RF7A 1LDBA 3MB5A 5DI9A 1MTZA 4TV8F 5DTEA 1EFKA 2IYYA 1MIOB 3P9IA 5GIOE 1Q11A 2QLLA 2FK7A 3GJ5A 4HO1X 3P8ZA 1L1RA 2DBZA 2CXQA 5H8WA 1H65A 5FWYA 5L6LB 1II0A 1XLUA 1MB4A 1MXFA 2FR1A 3LPLA 4RA6B 2BYTA 5KYUA 2DC1A 1GCAA 4OMDA 3RBZA 3A9CA 3DQPA 1F14A 1ULTA 5FADA 3HV2A 4A9AA 1O9GA 1QQ5A 3HCCA 1J2EA 1CK4A 5BNTA 1YE3A 3ONEA 2FW6A 3FSRA 3T15A 1N2GA 3OJXA 3VVLA 2F1KA 1Y48E 1L4UA 1OZHA 5LQRA 5LXTB 1TAUA 3HY4A 1N8KA 1ZMRA 2YHSA 2Z3ZA 4J0QA 1KJIA 3D8BA 3L8HA 3SJBA 4FHZA 1K27A 4OFWA 3ZV5A 5ICCA 1A27A 1IPHA 3NOVA 1AQNA 3ZJUA 1XHEA 2HJVA 4MDHA 2VDWB 1XKXA 4RMNA 2E0IA 1NYQA 1X42A 5ADHA 1QYVA 3QZUA 4LNHA 4KFCA 1Q1AA 2Q2OA 3DEFA 3EDYA 5HDQA 4B76A 2FPMA 1NVEA 1BWSA 1F12A 2PWZA 4A15A 4POAA 3ROEA 3TOZA 2I8AA 1AHIA 3ELDA 3KE9A 2AS0A 4MKFA 1BA2A 4OUDA 3OHSX 2V97A 4LYFA 4OH1A 4PBTA 5MN4A 1JQ5A 2AUNA 4F4HA 1R18A 4PXAA 3DFUA 4YAJA 5CG1A 1M2JA 3LHFA 4G8JA 4QQFA 2AW3A 3VDRA 4LOLA 4DUGA 1IZ9A 4LVCA 3WMWA 1G2IA 2BCGY 2IOFA 4TTAA 5JWOA 3FI9A 4LJRA 5C7OO 5HMMA 4AJPA 4Z4FA 4C76A 4XVHA 3GJ7A 3QOXA 2GDZA 3ECCA 5LLSA 3SMQA 3V7UA 4GKBA 4OHYA 2C4WA 3MWDB 2AUMA 3DGEC 3T4PA 2OGTA 3CF2A 1T0HB 1F51E 3B9QA 3O3NB 3QKWA 2XZLA 1FJHA 1UODA 1KI3A 2MSDB 3NBKA 1FEZA 1GZSA 4HDQB 4IMJB 2QD3A 3M49A 3F8TA 1R0BA 1AURA 4I1OA 1AH2A 1TT5A 1WUTA 2ZPAA 4TTJA 4LZPA 3IH5A 1G7CA 1HC7A 4P5DA 4C0LA 3AVOA 1ZOIA 1M76A 2IRWA 1FDUA 3GT3A 5ECWA 3CH7A 5DZSA 2ZWPA 3F5FA 5B58C 1UINA 3CUSA 4BEVA 2JH9A 2EP5A 3PP8A 1CEQA 3IPAA 4ZP1A 1UZLA 2A0UA 2QAIA 7ADHA 5L95A 1RCUA 3O8DA 1KDTA 3P2IA 2H9YA 1JR6A 2B4KA 4OFBA 5AVUA 2AOWA 4BFWA 2OO5C 5BT9A 2EKBA 2AQHA 2JRCA 3LQ2A 4DBZA 2J4CA 3ICPA 1E0KA 2DF8A 1KU6A 1TVEA 1XEXA 5HCNA 4C7BA 1VMIA 1Q0TA 4EYKA 2C1XA 1SVSA 3PENA 4MB0A 4FIZA 1JJIA 1VA4A 1N77A 1A4UA 3THYA 4P36A 4NC9A 5BRNA 2CMFA 2EWMA 3HKDB 4UTNA 3O1JC 2P1DA 2YBDA 3CR7A 1A7UA 2GCOA 2Q3CA 1DLIA 2VQDA 3PNYA 4TQ9A 5DWVA 4DMCA 3QE2A 5K3BA 2B8EA 3E1SA 1Z0KA 4TMTA 4HNQA 5DBIA 3F2VA 5BURA 1MUUA 5SZIA 1JJFA 5JATA 4GYKA 1LTQA 4K9PA 4FPXA 4UEOA 1OIXA 2QMZA 1H5QA 1Q15A 1UAGA 2ADOA 2QVLA 4YFYA 3OC0A 4Y6SA 4BO3A 3CX6A 4ENUA 3V4RA 4JITA 4Z4EA 4RL4A 4OQQA 5AFSA 2YXNA 2YHIB 1JIVA 4XJSA 1KH2A 5PGMA 4AMYA 4C4OA 3K9HA 1S8OA 4DHWA 2Q4BA 5KWEA 3AL0C 2B0CA 2YC2C 1WSWA 3V8BA 1DO2A 4ZI7A 2AWOA 2LDBA 2ZB4A 2AFHB 4PO9A 4Q3KA 3WWCA 1VHLA 2BFEA 2Q28A 2AFIA 2FRVA 2FZVA 1TQHA 2JVKA 3GARA 3JYPA 3KWJA 4IOMA 4NOLA 2ECOA 1ESDA 4WIAA 3CPHA 1DBVO 4TRNA 1E8MA 3NYWA 3FKJA 3MSCA 3AQIA 4PM4A 3OFKA 2JGIA 1ZUHA 3INNA 2XYRA 2AA3A 4DL9A 4XOIA 4RD3A 3ZD6A 4BOYA 1UFOA 2Z56A 4X45A 5D6NA 2ZXEA 4CM3A 3A3PA 3RIYA 1ZAKA 3ZE9A 1Y3DE 1TT5B 3TVTA 1I7LA 4F8EA 3ISJA 2ZRFA 1EP1B 4MW5A 5A71A 1L5HA 1A71A 2OZPA 1CVRA 1B23P 3M6VA 3PR1A 4FGWA 4HAVA 3LFUA 2NTYC 2FH5B 1ES9A 3ROPA 4HYTA 4LYDA 4JDUA 2JAWA 5LMNB 4NPCA 2AWNA 2F4VB 4XCQA 3IAFA 2PX8A 1BDMA 3FCXA 3STUA 1O96A 5ALIA 4DA8A 3ND5A 1Z0UA 1TJPB 4UOZA 2OY0A 1SCBA 5HNKA 3NHAA 3N2NA 3UHFA 1K5DA 1JFFB 1RWXA 2JIBA 1J56A 3IRVA 4IRUB 5AVXA 3GLIE 4MUEA 4JFRA 3SX0A 3CT4A 2HD4A 5LOVB 1LSOA 1SK9A 1N6IA 4CCAA 1RRKA 2VC2B 1ZCFA 2D5CA 1IMJA 1P39A 4QBFA 1L7NA 3SEZA 4YMVA 1DBPA 2QL6A 4G0XA 3SC2B 3ZDBA 1ENZA 4NH4A 4S2EA 4DGQA 4I1PA 1PIWA 1YUMA 2NGRA 2XT0A 2OO5A 3C3KA 1UMBB 5ALZA 4DYHA 4PIMA 3SXUB 4UTRA 3O83A 4ZQIA 1JXOA 1DRWA 3IMEA 3CZCA 3K9GA 4EQ6A 2DHRA 2DG2A 1NG9A 4A6EA 2EZUA 1N7IA 4AQYB 5BSUA