3LS2A

Crystal structure of an s-formylglutathione hydrolase from pseudoalteromonas haloplanktis tac125
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
278
structure length
278
Chain Sequence
b'LENISSVKVSGGWHKQYTHSAVSTHCTMRFAVFLPPGASESNKVPVLYWLSGLTCTDENFMQKAGAFKKAAELGIAIVAPDTSPRGDNVPNEDSYDFAQGAGFYVNATQAPYNTHFNMYDYVVNELPALIEQHFPVTSTKAISGHSMGGHGALMIALKNPQDYVSASAFSPIVNPINCPWGVKAFTGYLGADKTTWAQYDSCKLMAKAEQSNYLPMLVSQGDADNFLDEQLKPQNLVAVAKQKDYPLTLEMQTGYDHSYFFISSFIDQHLVFHHQYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-formylglutathione Hydrolase
publication title Crystal structure of an S-formylglutathione hydrolase from Pseudoalteromonas haloplanktis TAC125.
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 93
structure length 278
sequence length 278
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ls2A00
3S2ZA 1DQZA 2CEKA 3I2FA 2QKYA 5E4TA 3W04A 4FMPA 5JAOA 3N2ZB 2VT7A 2XQKA 2XDWA 1AZWA 1IZ8A 4P08A 5ALNA 1K5PA 4X93A 1CUYA 3ESCA 2IITA 2XMCA 3T4UA 4Y2YA 1E8MA 1YAJA 4C88A 1Y7HA 2RI6A 2WIFA 1H22A 1Y37A 5ALXA 4EY6A 3WK4A 3R3ZA 4EB0A 5AKLA 1CUVA 4Q82A 2J3DA 2BFNA 2R11A 1AURA 1FFAA 3HJUA 4RNCA 1MN6A 4E46A 4IH1A 5LZ8A 2C58A 2OCKA 3OG9A 1E3QA 1EK1A 4RPCA 4ITVA 3LP5A 4A5SA 3I1YA 4PW0A 4DMFA 1X2BA 3M83A 3BJMA 1QE3A 4B80A 2QUBA 3G8YA 3DD5A 4YK7A 2JF0A 5A2GA 3ZLUA 3R0VA 4GBGA 4H7EA 4UBIA 3SWWA 1JKMA 1XZJA 2OCLA 2CJPA 1CIJA 5EFZA 4KE9A 1UK7A 3PFBA 1LPAB 1UXOA 2OG1A 5AK4A 1YB7A 4B82A 1IZ7A 4UFOA 1SFRA 4UUQA 4CG3A 1BEZA 5JATA 3AINA 4HS9A 2G5TA 3VJKA 4W1QA 4ZV7A 1N5MA 2EDAA 5I9IA 4Y2TA 5JD6A 5JZSA 3E1GA 2JGLA 5E4JA 2BCEA 2XUPA 5CTAA 1OCEA 1CUHA 1QFSA 3C6ZA 2GYWA 4QEKA 4WFKA 3EQ8A 3F67A 1UK8A 3WWDA 2O7RA 4F60A 1VA4A 2VAXA 1SCQA 2O2GA 4PQEA 3BXPA 4X3CA 2BAGA 4FLMA 2J4CA 1YASA 2WHPB 4BCCA 3STWA 1UKAA 4I4CA 4IO0A 2ZVDA 2WLSA 5BV7A 1UKBA 2HA3A 3ZPXA 4DNOA 3WL6A 4FOLA 4OB6A 1DINA 3AZQA 2AJDA 3M81A 3CN7A 2GBFA 1EVEA 1LPPA 4RE6A 3WA7A 5HF8A 1DX6A 2QUAA 1QTIA 4E14A 1NU6A 4EZIA 5ALHA 2OQIA 2VQ6A 5ALWA 5JARA 1ZD3A 1KU6A 3G0BA 4BE4A 2HA5A 3WZMA 3D7RA 4CCYA 1YCDA 2ONCA 2PBLA 4DGQA 5ALQA 4UHBA 1EDEA 2ZJ7A 2HM7A 3QPCA 1CUXA 4U2DA 2WJ6A 4CIBA 3H2HA 2XQIA 3LLCA 3WKDA 3B12A 2XQGA 1QZ3A 3OPMA 4B7ZA 4PO3X 5D7BA 1CUWA 1EX9A 1RYYA 4BZWA 3BIWA 1IUNA 5FP0A 4WDRA 4XIIA 3A70A 4DMCA 4M0EA 3FNBA 1VZ2A 3UUFA 1R3DA 4KE6A 2OGTA 3AFIA 4MXDA 5K3FB 3WWPA 4UBMA 4BCBA 3WKCA 1Q83A 3PUHA 2DQYA 1XZCA 1EK2A 3DNMA 1G4HA 4HTAA 2WTMA 3WL8A 4QDOA 1C7JA 4QE3A 4J0HA 5CH5A 2YH2A 1F0NA 1WM1A 1JMKC 2G4LA 3FYTA 4BATA 2FX5A 2C0QA 3HACA 2C5FA 3PI6A 2B20A 5AICA 1ZD2P 3RM3A 4EA6A 3DL4A 4DM7A 1LLFA 4CIAA 1D07A 2HU5A 3DYVA 3C6XA 4B6GA 1SCIA 4G5XA 3W9UA 3F8SA 5HCUA 1XRRA 1QIFA 3HRHA 3BDIA 1E5TA 4KYVA 3FWHA 1JFRA 1X2EA 3U1TA 3I6YA 5DYTA 3ANSA 4HRXA 1WOMA 1E89A 1EB8A 5ALVA 3GBSA 1W1IA 4AZ3A 5C7YA 1TCAA 2VF2A 3R3UA 5K3CA 5YASA 3GELA 4AMZA 2D0DA 5AP9A 2AJBA 2PU7A 1JJBA 1J06A 4KJXA 4X92A 3VJMA 3SX4A 1LGYA 2WQZA 1UK9A 2QJWA 2VA9A 2PSDA 5AHXA 5LZ5A 5LZ7A 1BEEA 5AOCA 3VDXA 5FRDA 4BE9A 1MPXA 5CBKA 5CMLA 4LXHA 3KXPA 5LZ4A 2FJ0A 2B4KA 3R3XA 2WG2A 1YA8A 1P0MA 4ZXFA 3H18A 2XUQA 5IVIA 1VE6A 4DLNA 1PV1A 1YR2A 4X91A 1XQYA 1CLEA 2HDWA 4B85A 2XUKA 2CKMA 4GECA 2HRRA 3DOIA 7YASA 4X7BA 5K5EA 3WL7A 3ZWQA 1RWQA 4OB8A 3D59A 1A7UA 2I3DA 2ZJ6A 5AIAA 4U2BA 4AO6A 1F8UA 5K3AA 3BL8A 4GW3A 4AMYA 4WY5A 2DHEA 2QTBA 2OCGA 4DTCA 2OPHA 3QMMA 2QOEA 5T4BA 3WWOA 5C8ZA 2WJ3A 4P9NA 1EHYA 3D2CA 1R88A 4INZA 4AB1A 3ZI7A 3C70A 3ICVA 5LZ9A 2BUCA 3IURA 2WKWA 2BKLA 4P93A 5AKZA 1QFMA 4N8EA 5JD4A 4HAIA 4EY4A 1QIDA 3KD2A 4W1PA 3BDVA 4DNQA 4QWMA 4LIPD 1XZHA 2VJBA 3PUIA 3M3DA 3H1BA 3IUNA 3WZLA 4MYDA 1G42A 5IVKA 1XKTA 4I19A 1SC9A 1BN6A 2XMZA 3QM1A 4FFWA 4ETWA 1ZICA 1LBTA 2HA2A 3FOBA 4MEBA 4EHBA 2B9VA 2JGFA 4RGYA 1VE7A 4G1FA 5KWJA 1AUOA 1B41A 2I3ZA 4GHWA 1P0QA 4PSUA 3FYUC 4MEAA 3R3WA 1EB9A 1AMNA 5AO9A 4KRYA 1VZ3A 3PE6A 2JEYA 2WIGA 3EQ9A 1MJ5A 1JI3A 3I2JA 4ZREA 2WJ4A 5LZ2A 1ACLA 4AXBA 3G9XA 1MAHA 1AQLA 2XMDA 3QZUA 3FYUB 1J07A 3JWEA 4N8SA 4C4XA 3B3QA 4G4GA 5E2IA 5HF9A 3BJRA 2WUGA 3F98A 4BP9A 3VKFA 3W06A 5AOBA 2J4FA 4WCVA 3AZOA 2BUAA 4LYDA 2J3QA 4K6KA 3PFCA 4KACA 1PFQA 4UHFA 3JYHA 3B5EA 4Q1VA 5AKHA 3DLTA 3I6ZA 5ALOA 5F4ZA 3DJYA 2ECFA 3PICA 1P0IA 2H7YA 2Y2VA 3O9MA 1L7QA 4BDSA 2ACEA 1AKNA 1EDBA 2PU5A 5C8VA 5AI4A 3I2IA 1NU8A 2CB9A 3WI7A 3ZLVA 3FAKA 5IH7A 4Y2SA 1FSSA 2X76A 1ORWA 2HA4A 2GYVA 1Z68A 4Y7DA 1E8NA 1SOMA 4UHHA 5D6OA 1EA5A 1G5FA 4H7DA 4C4YA 3L1JA 5EHNA 4HXGA 4B84A 2QXTA 4ZI5A 2HIHA 3O9VA 4L72A 2ES4A 2GBCA 4M0MA 5EHXA 5EI5A 3QITA 4F21A 5DJ5A 4EUSA 4A23A 3C6BA 3H1AA 5DYYA 1VLQA 4UFNA 4Y2QA 1XZBA 5AJHA 5CT6A 4KE8A 3AZPA 4Y2VA 1QOZA 2PL5A 1THGA 4GEGA 2Y2UA 3H0CA 5DNUA 4N5HX 5SYMA 4D9JA 1UK6A 4JUIA 5DTIA 3WJ1A 1N8SA 3W9BA 5ALFA 1CUZA 1E8DA 2VJCA 4X71A 2QR5A 1VXOA 3H19A 3PF8A 4MYSA 2WUFA 1XLWA 2EEPA 5HFAA 1Y7IA 1FFEA 1T4MA 3FCXA 3BF7A 2JIDA 3DL7A 3D4LA 4H35A 3AJAA 4AQDA 4FTWA 3IB3A 5LIPA 5AI8A 2WHPA 4DMHA 4MQLA 4C4ZA 5ALTA 4NVRA 2W22A 3NUZA 5FLKA 5AK3A 3OOSA 1HQDA 3G9TA 2WFLB 1H2XA 1MO2A 4HXFB 2ZSHA 4B0OA 3MGAA 2WTNA 3CCBA 2Y6UA 5BOVA 2YASA 1H2YA 3G7NA 4W1SA 1MTZA 3ZV7A 4ZWNA 2JEZA 5FDFA 1XKLA 3A6ZA 2HA0A 3BF8A 4X6XA 3O4HA 3L1IA 1LNSA 3WKAA 4TPKA 3STXA 2ORYA 4NZZA 1JJFA 4IQ4A 2RIPA 2DQZA 4BZZA 3AIKA 3W05A 4X6UA 2PKYX 3FSGD 1U2EA 4GI1A 1GGVA 3LCRA 2GZRA 2XQFA 2Z3ZA 3DDUA 3RKSA 1W4LA 3BIXA 4FNMA 1YB6A 4U2EA 2P8SA 3WIOA 1DX4A 5JAPA 5CW2A 3M82A 5FKJA 4AZ0A 2JGIA 2DCMA 1DQYA 1QGED 1TKRA 3A2NA 1UOOA 2PX6A 1CUGA 4G4JA 5ALYA 4PF1A 5A7GA 4Y2UA 1MX5A 1QIKA 2RHTA 1A8QA 3G9UA 5CURA 1LPMA 1F0PA 3AUKA 4X95A 5ALPA 5AM1A 2XI4A 3K6KA 3WQHA 4UFPA 2C5GA 4DSAA 3NOXA 3O95A 1USWA 3I1IA 1SCKA 5K3FA 4L3WA 4MJ3A 3BWXA 1EINA 1TCCA 3WK6A 3ZLTA 1AGYA 2XT0A 2C7BA 5I8PA 1VXRA 4H7KA 3D2BA 1EI9A 1K8QA 3SK0A 3G0GA 3MUOA 2OCIA 1QO7A 2XUHA 4GWLA 2OAGA 4BVLA 1JJIA 4MWSA 1CUBA 3Q8WA 4UBLA 3GFFA 5ISMA 3I2GA 3WIBA 1L7AA 1XQVA 3V1NA 2XUOA 4Q05A 4J0GA 1ZGBA 3WK5A 4QZVA 1QONA 3WJ2A 2XMGA 4MQMA 1XRMA 5AH0A 1YSCA 3D3NA 4BP8A 2V98A 4L0CA 5A7FA 4BAUA 1WHSA 2ZSIA 4DNPA 4GXNA 3VVMA 3T52A 5IKXA 3G9ZA 1XQWA 1YS1X 3QMWA 5CT4A 4KAAA 4H0CA 1H23A 3C6YA 1VOTA 3EF3A 1MNAA 2DHDA 3LS2A 1ODSA 3V48A 3WL5A 4GDMA 1JMYA 2D5LA 1EDDA 5D3ZA 1ZI8A 5CXUA 3HLKA 4PSDA 2Y6VA 4M0FA 1LBSA 3FVTA 5FV4A 2XMSA 2CBGA 2XUGA 4NMWA 2UZ0A 3QMVA 4HVTA 2WHRA 1O6GA 1R4ZA 2E3JA 4J0KA 4OB7A 4BYMA 3AIMA 1U8EA 2XMRA 5CT9A 2R8BA 1ORVA 2XQJA 3KDAA 1WCYA 4RE5A 4E15A 5JYCA 2WUDA 4JYMA 3CXUA 4H18A 4MWTA 3V9AA 1DU4A 1I6WA 3E0XA 2G5PA 3H2JA 1QLWA 3KWJA 1UKCA 4KRXA 4YPVA 2V9ZA 1BN7A 4J0IA 4AX4A 1W6RA 4E11A 2JGEA 3KOOA 4FDMA 1TIBA 3QPAA 4OU4A 2V97A 5HF5A 1WB5A 1GKLA 3A2LA 5KWIA 2LIPA 3G0DA 1IVYA 1OXMA 4Y2JA 3HI4A 5EIHA 2OXEA 5HF6A 5AKXA 3WWCA 4PSCA 5FUMA 2K2QB 1DT5A 5EGNA 1A8SA 2PUHA 2XUAA 1PJAA 4AO7A 2XLCA 1ZIYA 4FKBA 5ALIA 2HA6A 2WHQA 5H3HA 1Q0ZA 4Q3OA 3IIIA 4G8BA 2YYSA 5AM4A 4WJLA 4BRSA 4B9AA 1ODCA 2HRQA 3WWEA 1FFCA 1UT6A 5HFNA 2WSLA 3WKEA 1HLGA 1U65A 4OPMA 5CT8A 4W9RA 4HRYA 3RARA 2HU8A 4F0JA 2RONA 1WB4A 4ZV9A 1XQXA 4OCZA 4OSEA 3FLAA 2Z8ZA 3R3VA 5AKYA 1VJ5A 3GA7A 1BCSA 1CFJA 1DWOA 1R9MA 3H04A 3BE8A 3QBJA 3DEAA 1XLUA 4LKOA 3NGMA 1ODTC 1IMJA 5HQ3B 2ZYIA 4JEIA 4WFIA 3FYUA 1R9NA 2HL6A 4DIUA 2VT6A 5AKJA 5AKKA 3R40A 3YASA 3DOHA 4UPDA 1QTRA 2DSNA 5IVHA 5ALDA 2CUTA 4J3JA 4CG2A 2RGUA 3E4DA 4JYPA 5A62A 5ALGA 5T4HA 2ZYHA 5K3BA 4QA9A 5DLPA 1ZD4A 4KAFA 1XLVA 1ZJ5A 5EIAA 3W2TA 1K63A 2HA7A 3ICWA 1VKHA 1ZIXA 1BE0A 4OYLA 2PSEA 3RLIA 1CQWA 2AJ8A 2EDCA 1JT2A 4Q3LA 1CEXA 4Y2RA 1FFBA 5JANA 5K3EA 5AI5A 3IBTA 4J0CA 3O4GA 1XZGA 5CRIA 1B6GA 5DWDA 1MU0A 2ZYRA 3D0KA 1UWCA 4AO8A 4C01A 5C8XA 1KU0A 1WHTA 3U0VA 5AM3A 3E3AA 1ZI6A 4H7HA 3D5EA 3IA2A 2I03A 4DSZA 1YA4A 4BVJA 1MNQA 1UFOA 3VISA 4Q3KA 1QJ4A 5ALKA 2RHWA 5E4YA 3DKRA 2QT9A 3R3YA 2DHCA 2VATA 1GPKA 3C43A 4WY8A 2WU3A 2IIVA 1J1IA 2ZYSA 3ESAA 5CXXA 2HU7A 2O2IA 3WK8A 5ALZA 5ALLA 2GYUA 1NX9A 3C8DA 1GQSA 2WIDA 2XUDA 3I2KA 5KREA 3F97A 5T4EA 1BCRA 5C81A 1LPNA 3SC2A 4V2IA 5LLSA 3IDAA 3EQ7A 2BGNA 3IUMA 2WU4A 2JGKA 3DYIA 3G0IA 4X94A 2QVBA 5AIBA 5J3JA 1MX1A 3O4JA 3F9CA 1GPNA 2JBWA 1JU4A 3ESDA 4BTVA 2OLEA 3FLEA 1P0PA 2WFLA 1EH5A 4KEAA 3WKBA 3D2AA 4FWBA 5A6VA 2OQVA 4XX1A 6YASA 3VJLA 1BS9A 4QDZA 4W1RA 1DWQA 2PSJA 3IVMA 4FFVA 4XVCA 4IH4A 4N8DA 3JW8A 3PDCA 3OTQA 2H7CA 4UBOA 4LXGA 4QDXA 1GZ7A 1CUIA 1YS2X 4AN1A 1CVLA 5BWBA 1VA5A 1CRLA 4IHAA 1XZIA 1MAAA 4X6YA 5LYYA 2NW6A 1CUUA 5HK9A 5JALA 1TRHA 5AM5A 5JD5A 3UUEA 1XZKA 1N1MA 4YASA 1CQZA 1DT3A 2X5XA 4HXEB 4G8DA 4J03A 4LYEA 3K2IA 2WFMA 1ZOIA 3NWOA 5JADA 4BBZA 4EY8A 2XUFA 3IUQA 2WG0A 2HFJA 3I28A 5FPPA 2QJRA 1QIGA 3DS8A 4C89A 3HYSA 2QM0A 5LP1A 1J2EA 2PSHA 2Y1KA 4EY5A 5LKAA 5FPQA 4QWWA 3QH4A 1DWPA 3IUJA 3QPDA 1C4XA 2XUIA 5DNWA 2OGSA 4FHZA 1ACJA 4Z49A 4FNGA 3QVMA 3N0TA 5HK8A 4CG1A 2H1IA 1L7RA 1XZFA 3L1HA 1YAHA 4S0XA 1CUAA 1XZAA 2AJCA 5A7HA 5FXMA 1ZGCA 4KR0A 4BB0A 5ALMA 4P92A 1XZLA 4W63A 2BGRA 1WB6A 1XZEA 5EHZA 2CZQA 1E66A 5IVDA 1ETHA 4DMKA 2O7VA 3OM8A 1Q0RA 5AM0A 1QIHA 1U4NA 5I7UA 5DNVA 3HC7A 4YX9A 4G4IA 1R50A 2RAUA 1IUOA 1CUCA 5LKRA 3AILA 3HABA 3STVA 3GROA 3RK4A 4G9GA 1JU3A 2XLBA 3G0CA 4H7JA 1KEZA 3STYA 1EXWA 3FCYA 4K6GA 1GKKA 5AI0A 1H2WA 5AKIA 2WILA 1XRNA 4UBNA 3V1MA 1GXSA 2WIJA 3KWFA 2HFKA 1XRPA 2HADA 1WPXA 4KAJA 4NS4A 3S8YA 4IH9A 4LXIA 1BRTA 4X85A 4B9EA 5JZ9A 2ZJFA 3OURA 4Y2XA 5JIBA 2BJHA 4B81A 1G66A 1T2NA 3IULA 1M33A 2GZSA 4CCWA 3V1KA 3VVLA 2VSQA 1WPRA 4OU5A 1QIEA 5SYNA 2Z5GA 3FLBA 5JZBA 1BROA 1W75A 3F96A 2BUBA 4FLEA 5HKBA 1MT3A 3MUNA 1QO9A 1ZD5A 4UHEA 4U2GA 2HHAA 3EBLA 1LPOA 5D3KA 4PNZA 3WA6A 2VJDA 2XUJA 5KBYA 2WG1A 2G63A 1GT6A 4CCYB 1HKHA 4UHCA 3UMJA 2FJPA 2QZPA 3C87A 3KSRA 5DTJA 3HXKA 3WK9A 3MVEA 3LIIA 1OILA 4J0JA 4PV7A 3GUUA 3K9BA 1ZJ4A 3WK7A 4CFSA 2CMFA 4OUKX 4U2FA 3VXKA 1UZAA 3C8HA 2Z8XA 1UOPA 4G8CA 4OD0A 4B0PA 4FLFA 1QIIA 1GPLA 5ALRA 2XMQA 1TCBA 5ALEA 4K2AA 1R1DA 4QLOA 4QNNA 4Y9SA 1CUSA 2I78A 1K4YA 2VTVA 2PSFA 1LZKA 2IX9A 3WYDA 1Q84A 1UOQA 1EVQA 4TVKA 5ALSA 4XWGA 5HZGA 3CN9A 1C7IA 3C5VA 3AIOA 2QS9A 4X90A 3STUA 5JAHA 2PVSA 5AOAA 4AN0A 4A16A 4TGLA 2WUEA 5AK5A 3LIPA 5K3DA 2O2HA 2W6CX 2JGJA 4J0DA 1BU8A 2Z3WA 1FFDA 4C87A 1CUFA 4WFJA 4HZGA 1CUDA 3EIOA 3ED1A 4H7IA 4K6HA 4QLAA 3V1LA 5EHQA 3FBWA 4BC0A 2X8BA 1A88A 5AM2A 1LZLA 1CR6A 1MX9A 3WLAA 3A2MA 1QIJA 1X70A 3Q0TA 4KE7A 3DKKA 5T4FA 1LPSA 4JH0A 1XZMA 3O0DA 3X3HA 2WFZA 1XRQA 3H17A 2XE4A 4CI9A 4N5IX 4X97A 4DYHA 5ESRA 3TRDA 3C5WP 4K5QA 5HQ3A 4F5ZA 2DFPA 1HPLA 5FOQA 1K6EA 3FSGA 4WDQA 2YXPX 1TQHA 2OAEA 4FBMA 1AC5A 3ANTA 1TAHA 1H2ZA 2H9YA 5CT5A 4H77A 2PM8A 1N5RA 2FUKA 2AJLI 2XMBA 5CH8A 4G9EA 3QYJA 1F6WA 3FVRA 1HDEA 3DQZA 3H2KA 4C6HA 3GZJA 2Q0XA 5EIEA 3G02A 3HEAA 3CCCA 4ZRDA 2C0PA 5HKAA 3H2IA 1S8OA 2B61A 2H7XA 2VJAA 4B83A 1XZDA 3OC0A 2JGMA 4FBLA 3I2HA 5ALJA 4BDTA 5DYWA 2GBGA 2OGZA 4ROTA 2XB6A 1HBJA 1XFDA 4OYYA 3H2GA 4ARBA 5AKEA 5AI9A 4BAGA 4BCDA 2WIKA 4ZGBA 3P2MA 3TJMA 3WMRA 2VEOA 5JASA 2VAVA 4BC1A 4BVKA 1CV2A 4L9AA 1CUEA 1DTEA 5A71A 1A8UA 1AX9A 3WYNA 3TEJA 1FJ2A 1O6FA 4UBJA 4X00A 1IUPA 5AK6A 4QDUA 2GBIA 4QDTA 4LHEA 1LPBB 2DR0A 4BAZA 3STTA 1RP1A 4EY7A 4UHDA 2ACKA 1XRLA 1ISPA 4Q34A 4XJVA 5ALUA 2WM2A 1HL7A 4EBBA 4JNCA 1TK3A 1CUJA 5AI6A 3I6MA 5JAUA 4I3FA 2QRUA 2QMQA 3ESBA 5AKGA 1W52X 4BTLA 5BWCA 2PPLA 2PUJA 3DCNA 1W76A 2C4HA 3TGLA 4U2CA 1ZI9A 3HSSA 3R41A 1QIMA 4DNFA 3C45A 2AXEA 4O08A 4H7FA 1CPYA 3O4IA 4J7AA 3PF9A 4UBKA 4GLBA 2QXUA 4ARAA 3ILSA 2ROQA 1GQRA 2V96A 4BRZA 3HZOA 1THTA 5CH3A 4Y2PA 1XROA
chains in the Genus database with same CATH superfamily
3N0XA 3L7AA 4FDVA 4DLXA 1LWNA 2NSHA 4LVUA 4OQLA 1DQZA 3ZQ6A 4TS9A 2K7FA 1KZHA 2PL1A 3I2FA 1JAXA 1M2VA 3RYIB 1CR4A 2QKYA 3B9PA 1WU7A 1D0VA 4LHYA 2HT6A 4KQFA 2NVOA 2ZJ0A 1UIMA 5E4TA 3RFUA 3I37X 1CEYA 3W04A 4WTOA 1NBMA 3SDBA 1UMBB 2VSFA 2DPXA 1U5BA 7MDHA 5INTA 5JAOA 2BEWA 2HJRA 1H5NA 4TXJA 2AMFA 3HDQA 2E55A 1XPUA 1HQCA 1WUJS 2VT7A 4ZOLA 5DTMA 4UBMA 1DRKA 3L9WA 1AZWA 1IZ8A 2CFIA 1JHMA 4L50A 2CLCX 4P08A 5NLLA 3VU1A 1QDLB 3NVKI 3TIFA 1K5PA 2GCEA 1BDBA 2FP4A 4EO9A 3ESCA 1L3BA 4JI8B 2IITA 4CZ2A 1D2GA 2NUAA 1GU1A 4GR5A 4K8RB 4KO1S 4HVLA 5HFJA 3TSAA 2TMGA 1XD2A 3MOGA 4QOFA 2DTDA 4GGMX 1VPDA 5CLLA 5ALXA 1Y37A 1HEUA 4M76B 1D6MA 3KPYA 3PHHA 4DRZA 2JFGA 1X7HA 2ZWIA 2WA1A 3TRHA 1BFUA 1KPIA 3ZX5A 3R3ZA 1Z2DA 3VAYA 1QGAA 2R84A 4ENPA 3Q11A 3PWZA 3WLPA 4CMEC 5FWYA 1JVSA 5TNXA 3QHAA 2QD5A 1EFHA 3OQ1A 1ND6A 1I9GA 1M10A 1JSCA 3FDXA 2OAP1 5I7AA 1DE0A 4CMIA 5HDQA 4E46A 2Z98A 3RADC 4IH1A 3S81A 1NW6A 2C58A 1XPOA 1T5OA 2OO5A 2ILTA 3LUAA 3FD8A 4A5SA 4OF4A 1WUIS 3I1YA 2PT7A 5CVTA 4PW0A 2XZOA 4AM8A 4ZO6A 1SVIA 1A1VA 4UNRA 4MRSA 2JIRA 2A5GA 4L8LA 4M1KA 1X2BA 4OHPA 1N25A 1GPDG 1Z38A 2J8ZA 3OAAA 5HSGA 4B80A 1BYIA 3L93A 3QU7A 3KQLA 2WYOA 4IP0A 1X39A 4HWOA 4XWTA 3HXLA 3GA0A 2JF0A 2R68A 3PDJA 3ME5A 1VIYA 2G83A 2QMEA 1WB9A 4TKVA 1HSOA 1I1OA 4AW9A 2I1QA 2QAGA 5B36A 4EJSB 1G7TA 2REBA 3VYVA 3SWWA 1VECA 3TW4A 5L6MB 1KOLA 1I7SB 4X9XA 3T4XA 3UXMA 4B2YA 1DPGA 4XIYA 1WV1A 1P1JA 4QHYA 1G17A 4YQFA 1FFGA 3EAGA 4NCIA 3L49A 3PLRA 3ABOB 2A9QA 1CIJA 2HWUA 2VZEA 3C5HA 1DBIA 3E2PA 2DAPA 4FP9A 4KE9A 1GA1A 3GLGB 3CPHA 1LPAB 3B1YA 5AK4A 5GJBA 3KJXA 1SVKA 2CCKA 5C4GB 2VF4X 1YB7A 4HT3B 5KTNA 4BX8A 4XI9A 2JFZA 2OWEA 1WLSA 4B82A 4QYXA 1E1CB 1QYIA 1A7AA 3RUCA 4E09A 3F47A 4JVNA 1T9GR 3R7DA 4DSOA 3R9XA 1OLSB 1KJIA 2IE0A 4BNVA 2IYAA 1A9PA 2N47A 2EBHX 4A4DA 5DXFA 3MCTA 1KAEA 5B2EA 4EF6A 1HQYE 5FNVF 4Q9AA 1HGXA 1W8DA 3NP9A 4OY3A 4OHUA 5BP7A 2IZ7A 3KLNA 4G26A 2BD0A 4O02B 2OHVA 1RRCA 3AJ9A 3R5FA 4Y2TA 1JYEA 3AHGA 2GN9A 5DYGA 3N39C 2AF3C 2O1XA 3E1GA 4INOA 5TEVA 4AJEA 4JP1A 5ES3A 1OSNA 2B4YA 1H9BA 1NAIA 2JPDA 3AHCA 4B8YA 1KFBB 2CLDX 2P9BA 3MJRA 5EUBA 4CLRA 2BT4A 1SC4A 1JQLB 2B8JA 3LO5A 5J3JA 1N33B 2X0IA 1PZFA 4QEKA 2JBAB 1JEEA 1U1DA 1SD1A 2O54A 4S24A 1K3TA 1AO0A 3CPJB 2JLCA 1AT1A 4WFKA 3F67A 2VZLA 3SFZA 1DAHA 2VAXA 1NW8A 1T6XA 1X7YB 2O2GA 3GQVA 4L8VA 5HDBB 3ZZMA 2J7KA 1ZIDA 5HKOA 4J0FA 3GPBA 2Q0SA 1G1MA 5FWDA 3RKRA 1VSVA 2EVWX 3G23A 4Q24A 1AIPA 2BAGA 2E21A 4AP5A 3QELB 4FLMA 4RV4A 4UVIA 1JF8A 1U7XA 4O2AA 4ZQEA 3U9SA 4D9BA 4BCCA 3BREA 3DWFA 1QF7A 1QMPA 2W8BA 4Q1EA 4I4CA 3TW8A 4OFBA 2ZM5A 1SG9A 4LDNA 3K5PA 3TW6A 3VMFA 5BQXA 3KEFA 3R20A 2R65A 4XPZA 4V0RA 4B71A 1SU4A 1DO0A 3EZNA 2FWJA 2NU6B 3SIXA 1Q0PA 1EFRD 4CE6A 1L8QA 1DMRA 3OEHA 4B48A 4NKRA 3K1ZA 1JN0A 1DPFA 3VNQA 1TECE 6AT1A 4I50A 1RAEA 1GADO 1G8FA 2FPGA 2GLXA 1JDVA 3VOTA 4YAGA 3RV4A 4C5AA 2VSOA 1YRHA 3QLEA 5FO0A 5TDHA 1HX7A 4MGZR 3PXCX 3UTCA 3AZQA 1Y4AE 4HLUA 1P9WA 1P7CA 1T91A 3CKMA 3CN7A 1D03A 1MZVA 3EDOA 2PH5A 3MTAA 4IKPA 4XE5A 5H5JA 1SUDA 5BQ3A 5IF3A 1W4BA 4HMOA 5HF8A 1YKSA 1EWVA 5FWXA 2ETXA 2I4RA 4IW3B 1BSVA 2FRXA 3H9EO 2EOAA 1BKYA 4DILA 2Q27A 3QKTA 3G2KA 1ZW6A 4E14A 4KQ6A 2BC9A 8ADHA 5TE9A 4B3BA 2B2NA 3N2LA 3DB1A 5G0SA 1CZOA 1WCV1 1C8KA 2XWBF 3WIUA 4DLVA 3RVQA 4MR7B 4QL3A 1KK2A 3O75A 3RHFA 4MW9A 3V6LA 5FTWA 1G5TA 1I3OA 2B9EA 1MRSA 5F78A 4BFZA 2Q1XA 4EZIA 1I5OA 2YVAA 1NNI1 1B0ZA 4D57A 1W48A 2QVZX 2WF6A 2ZQZA 1OWNA 2Z9CA 2XHZA 1QO0D 5A9RA 5GM1A 4R05A 4ZQFA 1Z0DA 2KSQA 3MGGA 4Y0NA 3UGJA 1KU6A 1BWQA 2D1SA 2HA5A 4MHSA 3PC8A 4QRDA 3WZMA 4YV0A 4LDPA 3IMCA 1DARA 4MKRA 6Q21A 5AUQA 5K8VA 2ONCA 2PBLA 3FCAA 1IAVA 2GD2A 2JLQA 2YV5A 4ZKDA 3T1HB 1NWCA 5HOEA 1KJ9A 1KEKA 1J9ZA 3DWGA 3X1MA 3QWHA 4HRAA 3D6UA 4BLPA 1LVGA 2DPLA 3MCVA 4G01B 2CD7A 2PL9A 3DOFA 4CLHA 6GPBA 4BP3A 1UZMA 1NLYA 2BFBB 2WUWE 3HEMA 1GSHA 1DC3A 2Z0MA 4E11A 1P39A 1RKVA 3SZUA 5AW4A 1CUXA 4D25A 2WJ6A 2WU8A 1Z7EA 1G9SA 1KJ8A 1QAMA 4Z0PA 3U7FB 2OCDA 4L4XA 1O4VA 3FKJA 1OZHA 1PN3A 3QNUA 1OQAA 2H65A 2XRFA 3FN4A 5A3VA 2HY7A 1L4MA 2VAWA 3GH1A 3IXLA 2YY5A 4NPCA 4OMUA 4UZSA 4AZ0B 4BWFB 4DLKA 4Z7JA 5C1OA 1XN1A 1PD0A 3JQ7B 2PNFA 4C0SA 3UH0A 4LJ4A 2COUA 1TAGA 1A7JA 1F4VA 4LZNA 2RDMA 3CPEA 3GMSA 4GZ6A 4UHJA 3CLSC 1YTUA 3NIFB 3DL0A 3IAAA 5IG2A 1L4FA 1VGQA 2QJFA 5E8JA 5JCOC 2JCYA 3TN7A 1C4WA 1SMKA 2FPLA 1V3VA 2X4LA 3BIWA 4YV7A 1Y5IA 3AEKA 4J16C 2JJ1A 4OBEA 2VYVD 4ZJYA 4O63O 5BSWA 4OHXA 4AK9A 4DV2B 4RJKA 1OAOC 4RELA 4DCGA 4DZRA 4WZBE 1YIAA 3FNBA 3V46A 1PGNA 1GAWA 1PVVA 2W43A 4RZ2A 5I45A 4GX5A 2NT3A 4BKUA 3BRQA 3GLIB 1C50A 2OGTA 3AFIA 3FX2A 4MQUA 2XODA 4BFVA 5CIYA 1B73A 1OH7A 2WIBA 4TM7A 3WWPA 2OZKA 3AFHA 1K97A 3HUDA 3LA6A 3MWDA 4HDCA 1J8VA 4M0LA 4PO1A 5H16A 4BCBA 3EMVA 2QBYA 1F2UB 1T9ZA 1G8PA 3L05A 3MYRA 3ROQA 1G5RA 1L5ZA 1KO8A 1Q83A 3E9YA 4KVFA 3PUHA 2R6AA 3F0TA 2DQYA 4JYBA 4UM7A 3IS3A 2IYPA 1VHTA 2A3RA 3E9DA 1XZCA 3UV3A 1OZAA 1G4HA 1EUDA 1JEJA 2DKNA 3KUCA 1NMEA 2RSLA 3IGFA 4RVNA 5GV8A 3JAWB 1BDHA 2HCRA 3C3WA 1T8PA 3CZCA 4QDOA 5LXTF 3WL8A 3WMXA 1EJ0A 1LA2A 1L5KA 1DAGA 3WRYC 5HOQA 4KNYA 2QE7A 4N47A 3S1AA 2GXQA 2YH2A 1MQ9A 1A71A 3V42A 3SC3A 2ZT6A 4NXMB 1NVGA 3ITNA 4OP1A 2B0JA 3A4TA 2CVZA 1JMKC 4CMBA 4IQ0A 5A4KA 1BFKA 2WT9A 3T35A 1SCAA 2G4LA 1AMOA 4BATA 1TUGA 4XDGA 4JL6A 3T4PA 1F12A 1A2QA 1L7XA 5EQFA 3BC1A 2FX5A 2C0QA 4R1SA 4WI1A 5AVRA 2F9MA 3JRWA 3MWGA 4UUNA 3OHSX 2IXAA 1KO4A 2C5FA 3BEDA 3GFVA 2B20A 3QX8A 1UBKS 4DFDA 4XWWA 5LM3A 1RMTA 1X3LA 1S02A 3RM3A 4KR7A 3MMSA 4P3KA 2XYPA 1DKQA 4WD3A 4BNKA 4I5GA 1H3EA 1KY5A 3C39A 4GE0A 3ZZUA 4L9RA 2LCIA 1D07A 2HU5A 3DYVA 1Y81A 5L4NA 2VJNA 2OORA 3L7BA 1VJRA 5TXGA 1T13A 3U3RA 3CVUA 4G5HA 3F8SA 1T9GS 1UFVA 3VR3A 1LSSA 1M8KA 1QV7A 1KO7A 2IS1A 2Y1FA 3FWHA 1O87A 4GSLA 2R7LA 4B40A 4BIIA 1M0EA 3PE3A 2GK3A 3CLTD 2H4XA 2QP9X 3I9OA 4URYR 1E2KA 1JDPA 2Z5LA 3EGCA 1T9DA 3OCUA 2CHUA 1SXJB 3UZUA 1B7GO 5JFTA 4L8FA 2I3BA 3NHYA 4DHWA 3C14C 1JSZA 3W79A 4KMSA 1EB8A 1TD1A 4YRTA 2Q1TA 3HHEA 4ZEXA 3WB9A 4AYWA 5GP1A 4CV0A 1ISHA 2GMWA 1ZESA 4JT8A 4ALJA 1PZHA 5AVQA 1MAWA 2ZJ3A 4IDDA 4RPHA 2Y9PB 5FIUA 2HT1A 2BBTA 4RNDB 4CQMB 4RD3A 5LFAA 3B7PA 2A0WA 2BFAA 5J1SB 2VF2A 2G17A 4ZAXA 4JVOA 4BKRA 2V8OA 2MYUA 5ICGA 1XTTA 4NYIQ 2REXB 2JLBA 4KMOA 2XBLA 1M9NA 3UICA 4ZN6A 3P2KA 3BILA 1O77A 2A67A 3N2GB 4TWIA 5LA6A 2D0DA 1MXHA 3RVBA 2ZB3A 3KYDB 5ENVA 1W5FA 3BHMA 4CF4A 3LUDA 4YIKA 1J06A 2XYRA 3OLYA 5BN5B 2VK1A 1N6KA 4RK6A 3HO8A 3V7UA 2QTVB 3ENWA 4UD2A 4XD7D 2QRKA 3ADOA 2YVQA 1PAUA 3CNBA 2OZLB 1TC1A 4RK4A 3GRZA 1U7TA 2PXAA 1L7DA 4R81A 1ZC4A 4JLJA 4ENQA 1ORIA 1MGOA 1VB5A 1WZCA 1IONA 3OIGA 4FDAA 4KUHA 5EVJA 2YQZA 2ATIA 4ZYVA 3ERCA 2LCQA 3QVGA 3HJFA 1NL3A 2OBBA 2XXAA 1MPXA 4LXUA 5CBKA 3I3OA 3DBVO 3FWKA 1JXMA 3KXPA 3NZEA 2FMHA 3OESA 4Q4LA 3MQ2A 2FJ0A 3G8AA 3NOQA 5IAKA 2X8JA 4B8WA 2ZB4A 3GLFB 1R8XA 3C7TA 3NKLA 3NASA 3NV9A 4W6QA 5HE9A 2AXQA 5CCXA 1G3UA 3QW4B 3JQBC 3ETJA 4QOIA 3IO3A 1D1PA 3S99A 1P0MA 3H18A 4IDAA 1X0VA 3F5QA 5DKFA 3IYLW 5DMHA 3P9ZA 1JFTA 2GEDA 4FFRA 1U99A 3AFNA 3EXIB 1FUYB 1S4MA 3TD6A 1HRDA 3OZEA 4WK0B 4LFCB 3W6NA 4LJ8A 1FY2A 1KORA 4CU2A 2JKVA 4ECEA 3LWNA 2B1IA 5KJFA 4HS4A 5JPCA 4B85A 2XUKA 1M8FA 2AE1A 2EQ5A 4BRUA 3HUFA 2HMAA 4R8LA 5C4MA 3Q7QA 1NW4A 2HRRA 3I52A 4BN5A 1RYFA 2JVKA 1C0IA 2ZTLA 3I4CA 4J43A 3N28A 3AM1A 2BV3A 2NU7B 1BH6A 2P35A 4JU8A 4KXNA 1KQOA 3K0KA 4S12A 3HB0A 4MRRA 4NHOA 5CDFE 2OCYC 1ESNA 2Q9AA 2Z08A 3AJDA 4UNNA 3LQ4A 2EYUA 4N0DA 1KY2A 3KHUA 3NC0C 3RTGA 5EN4A 4G5SA 3WL7A 3WRXA 4ZVNA 5LQAA 4W5TA 3PUZA 5FOXA 2ZUSA 3TZEA 3D59A 5JDIC 3T5TA 5E6SA 3F6YA 1DV1A 2I6XA 5ADWA 2VP6A 3G85A 4YJ3B 1NUAA 1PJ4A 4U3JB 2BGUA 4JC0A 1YQEA 3AKYA 4AMYA 3W8DA 3AB7A 4HJXA 1XDWA 2OFOA 5CW1A 1E0SA 5EUQB 4MMYB 3AG6A 4NENA 3FOFC 2OPHA 9GPBA 3QMMA 3HVJA 2JJYA 2QOEA 5T4BA 1O97C 4RBNA 2C9ZA 3ZHBA 4I5EA 4WZZA 2I3AA 2IVZA 5C8ZA 4WUTA 3NTQA 4ZVVA 3LSTA 1YCHA 2RCYA 3D2CA 4K9OA 3AVUA 1R88A 1RHMA 4OXYA 3CSDA 5WRFA 3KM0A 3JSXA 5LNK6 3UWMA 2HR1A 3MD0A 1N57A 1NRXA 3C70A 3ICVA 5LZ9A 5BW6B 2J3HA 3DTVA 4E5DA 1ZR4A 3VOAA 2V7VA 2QYSA 2HD4A 1Z2EA 3KZNA 3PXDA 4XPIB 2BKLA 4CEIB 4PLVA 3K71B 2LP4Y 1JA9A 4JU9A 2H4ZA 2QQGA 2W6OA 5AKZA 3UMCA 3HB1A 4I66A 3VR4A 1M6YA 5KOJB 1IVNA 4KTTE 1GL7A 3JQRA 4ZYWA 3CNQS 1QIDA 1IVSA 4P31A 4U9HS 4RW0A 4AP6A 4HY3A 5D3QA 4YR7A 4FMCB 2D59A 4S1NA 1WMBA 3OTOB 2FZKA 4PZ0A 1LTKA 2PWZA 3T5CA 3VSEA 4L4SA 4RWEA 3TS1A 1PTJA 3WLHA 1Z4LA 3HMKA 1VLLA 1SKUA 2PGIA 4BBPA 2P9JA 2DQSA 2IEIA 1MIHA 1S6YA 1LTHR 1CHDA 1MF7A 4GGOA 4MUYA 3WZLA 2V7BA 2CXSA 3AEYA 4ENUA 1AQNA 4MYDA 4NBTA 3M6IA 1PI3A 3R3JA 1WSWA 3H5NA 5DTEA 4KIJA 3AHIA 3CT6A 3HP4A 4OH1A 4HGQA 5B7PA 4U0JA 1ZGJA 1HI9A 1HA3A 2IV2X 1MOQA 1E1YA 2XMZA 1A77A 4PCLA 2FUG6 4LZJA 1DOHA 3MMXA 3PG5A 3UT6A 4U7HA 1ZICA 4ARUA 3JQAD 4EENA 4EGAA 2Z6UA 1DEHA 1XR3A 4MRPA 1MX3A 4CL8A 1ODKA 3CVVA 5HIJA 3RT7A 3UQZA 4R1TA 1WDWB 3D6MA 4LJ6A 3AHDA 3K09C 3K20A 4XW2A 4RGYA 4OFZA 1SELA 2GUGA 2I99A 1VE7A 3HVHA 3P0RA 4YDSA 3KJZA 1B41A 4FOTA 2C54A 2O3UA 3ZVKA 1E2IA 2A4KA 4MW4A 3GUVA 1P0QA 1TLFA 5IEBA 4PSUA 3FFWA 5DN6D 3ZS8A 1W0CA 4CLDA 3U80A 3IH5A 3S5JA 1QPZA 2OFPA 4QDJA 4N76A 3FH0A 3FYUC 1LW6E 2J4DA 3DMRA 3EOAI 3Q5EA 1QH1A 1EB9A 5AO9A 4NLLA 3TQFA 2QNBA 4IXTA 2W4QA 3E3MA 4KRYA 3AR9A 3DMDA 3PPXA 3ZQJA 4BFWA 2O59A 2ZSBA 4DB2A 4B6OA 2WIGA 4TL7A 3NM4A 1BCSB 2OD9A 4Z2YA 4ALNA 4Z4QA 2DOKA 4NI5A 5FTMA 3QI7A 5IF9A 4L6CA 4B75A 4X1OA 1UBMS 3C16C 3J81A 3I2JA 3DD1A 4S05A 1EM8A 3K9QO 4EF5A 1ZSYA 4KLAA 2WJ4A 4L1KA 3L7OA 1I7QB 4D3XA 1I3NA 1PJBA 2Q62A 5IK2A 4JOBA 3RYIA 3MBOA 3M7IA 3U4MA 4GZ3A 2XMDA 3FYUB 1MFPA 4FCWA 4N49A 1J07A 5U9CA 4YRRA 4GPBA 4PQYA 1UMBA 4P34A 5E2IA 2CMHA 4DJEC 3HM9A 2PJRA 1FRFS 1U3FA 4M7RA 2FUEA 4R0MA 4QM7A 4L9WA 4TXHA 3TOCA 2OEPA 1YDHA 5KC8A 4XWOA 3KJHA 7ADHA 3L6BA 3L7YA 2P2YA 5MF6A 1F9AA 5AOBA 4UPVA 4WCVA 1KDTA 1UPXA 1Z5UA 3AZOA 3DDCA 1PP4A 1PT5A 3EH2A 4YJ3F 1WZUA 5C80A 5KSOA 3PCTA 4JLOA 3TEFA 1UH5A 3B1KA 3DAHA 3KTFA 5CCBA 1F7UA 3CT4A 4IXNA 3H9UA 1L4NA 1YRBA 2IXDA 1JE1A 3JYHA 3LRXA 1DG1G 3RUEA 2B7CA 1SK9A 3ASZA 4KQ2A 1VDZA 1W96A 5AKHA 4P84A 1ECBA 3DLTA 3RCBA 5J59A 4EHAA 4JVMA 3RDPA 5IUKC 4K7JA 3AM4A 3ZXXA 1EFTA 3NB0A 4U7DA 2HF9A 1L7QA 2FKAA 3O9MA 3QEKA 1YVRA 5EJIA 2O9JA 3UAVA 5C8VA 4HWGA 3JD3A 1U8AA 3SQOA 1YMUA 3O8RA 1NAHA 3CH6A 2AXNA 1F6BA 3LBNA 3C3XA 3GT7A 3BDAA 4PLWA 2NMVA 4Q1FA 1Y3BE 2DT5A 2VH5R 4M53A 4JJ6A 4Y2SA 5FX2A 2ZRPA 2VK4A 3B36A 1ORWA 2QA5A 3O2SB 2HA4A 4JXKA 1GNQA 4PICA 2Z3VA 1DIOB 1Z68A 4WK6A 4Y7DA 3ZWMA 5H4GA 2X7HA 4FCVA 5DNYB 3UKDA 3LC7O 4ZGGA 2Q5IA 1ZY2A 1O03A 1SBTA 3ACBA 1T2VA 3MBIA 4DG5A 4EPXA 2P5YA 4UUPA 2VHEA 5D6OA 5JZMA 3P0IA 3IPYA 4RQTA 1G5QA 1OTHA 4TUYB 4US1R 4LRXA 2PV7A 2JIPA 3F7MA 5CX1B 2BM9A 1VFPA 2PZAA 1GAJA 3I0NA 3U7HB 3E9NA 3R6DA 2YYYA 4JI2B 1RI2A 2HIHA 4MV5A 3O9VA 1YHNA 1Z4PX 4I81A 1NRIA 3PDWA 4N01A 4CMEA 4ALLA 1UKZA 3DMTA 1L4KA 3PFFA 4JOSA 1OASA 2BW0A 4ESVA 2HNKA 4PPGA 5EI5A 3TB4A 1QB8A 4H08A 5D8DA 5AK0A 3NM5A 4EJSA 5DJ5A 3UAGA 5ITZB 5KS2A 2W2KB 13PKA 2WYIA 3NHSA 2NTEA 3FW1A 3I0ZA 2DFLA 4INPA 4PG5A 3C6BA 2YR0A 4TTTS 5BN4B 3W3AH 4A0FA 1FTSA 1XHLA 4PCVA 2FWAA 3HJCA 2MYPA 1MC1A 1XWFA 2RGXA 4U02A 1UJ5A 4Z0NA 3SQNA 2WBLC 1VQ1A 1LF5A 4BL5A 1SBQA 2YW9A 1ZX1A 3GLGA 1GTL1 4LJ9A 5AJHA 2QX4A 4LV5B 2WY2D 2ZJAA 5TLSA 1NBOA 4JLNA 4DV6B 4P4LA 3DEYX 4PG6A 4P98A 5AVUA 3CW9A 4KBYA 1SRQA 4JENA 1M34B 3M3PA 3O8BA 3OOYA 4JLUA 2RFLA 1DAOA 1E1CA 3RUAA 3UUWA 4GEGA 4BV9A 3FGPA 3U19A 2QE6A 2Y2UA 1YR9A 1SJ9A 4QGSA 4XYLA 4D8XA 4NAVA 1Z26A 1NUTA 3W2TA 4XXHA 2AWNA 1H6DA 4K9MA 5DLDA 2AI3A 4DVJA 4UDXX 4KQIA 5EKXA 2B1JA 4IDBA 5IT4A 1KP9A 1XDUA 1GL6A 4MI9A 1ZQ9A 5EP3A 3R7BA 2M98A 3V7FA 3W9BA 3AI3A 3EEBA 4LZWA 1X38A 3UJ6A 2W48A 2X0NA 2C88A 3M1IA 3UMMA 4B76A 3H19A 3IKJA 3PF8A 4MGHA 5DT9A 4EJMA 1IXYA 2JBAA 1BCRB 1HTBA 2O6LA 3BXEA 1PL8A 3O5AA 4NOKA 4DT1B 2LZ0A 1C3LA 2QRGA 3UF0A 3IVAA 4R51A 1G60A 1Y7IA 1A2BA 1DDGA 2BIFA 2ZRGA 1KKUA 3UENA 3W2GA 4AJKA 4P2GA 1W5BA 1RZRD 1X7YA 1Q3HA 2PQ0A 1EVJA 2ZYUX 4JBXA 1JHXA 4R8KA 4RYLA 5C8YB 3LKDA 5AUPB 2DXIA 4RD4A 3DL7A 2HK6A 4LJRA 1V8DA 1GA4A 1K7XB 1P2DA 3QELA 3DDSA 1E79A 2C5LA 3D6FA 3F5DA 1CVRA 1IQ0A 2NGRA 3M33A 1TMKA 2PJUA 3JYPA 4DMHA 4W6ZA 3HE3A 4MQLA 5FBLB 1BGVA 1D5WA 3O73A 4NVRA 3FTNA 3GMDA 3RIMA 4C2BA 5JCJD 4O3MA 5I5EA 3NUZA 2J3LA 3Q85A 3GVHA 4ZA2A 3JWGA 3L6EA 5FLKA 1ZISA 1FS4A 2NU6A 1GZVA 1NM5A 2EX4A 2H5EA 3GC6A 3R77A 3G9TA 3SR4A 1WULS 4IDQA 1ZOPA 1KBOA 1TO6A 1ZD9A 2H3HA 1ZGZA 5CK4A 3C3JA 2CMKA 3NO4A 4B0OA 5KTMA 3DLHA 1TIPA 1X1AA 4DG9A 1YUBA 4TROA 3UJ3X 5JH7A 3E18A 3JALB 1V8FA 4UEOA 3ZW9A 1RRMA 3BYZA 4D9GA 1E20A 3OA2A 4TN1A 1BHQ1 1ZK3A 2AC7A 1P80A 2WTAA 1HTWA 3Q8XB 3OQIB 4UULA 3C0KA 4D26A 1KARA 2C8JA 3HSYA 4KXVA 4UXIA 1MTZA 1VHWA 1U7ZA 4EK9A 4DJFC 1R9JA 3WLFA 4MR7A 1E5DA 4GKVA 2OK7A 1DAMA 1W25A 2NO4A 3DLCA 1XC7A 2J9XB 2NACA 4RKYA 4F4IA 1BWRA 3VVCA 2GXAA 5JJKA 3CWQA 3BF8A 3O4HA 3WKAA 1IHDA 3MJFA 4NE7A 2BE9A 5DCLA 2H1OA 4TKUA 4OXRA 3BS4A 3RSZA 5FPKA 4BZZA 3S2SA 1VMKA 3AIKA 2VXOA 3BULA 3A6HA 4CMCA 4X6UA 4MDHA 5A5FA 2O2DA 1APBA 5EEHA 1JDZA 2HQBA 3RFXA 4FM9A 1CS0B 2ZI9A 4GI1A 4QDKA 2BDUA 1CIPA 3GP3A 1X86B 2IYNA 3LCRA 3FVWA 4AKSA 2GZRA 2QRMA 4LS3A 4OXIA 1VIVA 5I7VA 2QRPA 4G0NA 5A5EA 3ZGZA 3RKSA 1R0ZA 5KOYA 1ICEA 3BIXA 3AEUB 2BFBA 3HBNA 4FNMA 3MS7A 4QUJA 5E1MA 5JRDS 3WC4A 1Z45A 2G1PA 3GVCA 5EJ2A 2FDXA 2P8SA 3D1JA 4FR5A 4MPRA 1DKUA 2OVFA 2YUIA 1NQAO 2GPYA 2V1XA 3RR2A 2V03A 2HJGA 3E5MA 5CW2A 1J0EA 4IIJF 1ORDA 3T9CA 3VZBA 2OD2A 1WSBA 1SC6A 2LDBA 1XUOA 2WDPA 3REQB 3ZWBA 1HNZB 3JQ7A 3ZVRA 1E32A 4J75A 3ANNA 2FW1A 2DCMA 2Z56A 1DQYA 5AWFC 3SSAA 1HT0A 1WTAA 3G5MA 2JFBA 3QKWA 4XKJA 3EAQA 3L4SO 1ZGHA 4ZU3A 3RHTA 5LMUB 3GFPA 3WHKA 4LC9A 2QRNA 2EERA 2JFWA 3K9CA 3NCHA 2GVNA 4GOLD 2ZANA 3GLQA 1P2GA 4H6PA 4M88A 5ALYA 2E87A 4Y2UA 1U7PA 4R7TA 2JFPA 5EFOA 1QIKA 1XLTC 2A30A 2GJ9A 2QRHA 1S8NA 1XWWA 2A5YB 3QHQA 4GRIA 4JZKA 2XNKA 1A8QA 2OQRA 4RGBA 4XYBA 1LPMA 4WINA 5JHHB 1KQ3A 1SCNE 3LI2A 2G9UA 2VHQA 4LDQA 3FOCA 4ZVTA 1YRYE 1OXUA 1CXZA 3QJYA 1F2TB 1RE0A 3SS9X 4KVZA 3EASA 1SCKA 1C9EA 5DHTA 4P81A 4CI0B 2CYAA 2EG5A 3BWXA 2YJTD 1Q17A 2Z8YA 3ETCA 1P7VA 1F2UA 2EWWA 1FQWA 3ZLTA 2P9YA 1AGYA 2XNDD 2C7BA 3KSZO 2D54A 3OFSA 4JWKA 4LFAB 3K9HA 4KC0A 3EDMA 2WEKA 2OOSA 5JZVA 5CFLA 2O5VA 4CKCA 2WJJA 3GXBA 3AF3A 3UUGA 1PWHA 3JAWA 3H0EA 5ENDA 3K5IA 3TBKA 4X1YB 2XE6A 4GSKA 1UWLA 1POXA 1B8VA 4TLMB 3E9QA 4GWLA 1EPUA 3CVOA 1HL3A 3A25A 3DNPA 4U7FA 3W5HA 1MC5A 4K6OA 2ZZMA 1K0UA 2R9VA 3S1LA 2X40A 2PLAA 1GL3A 2QVYX 4ARVA 2JCGA 3NAGA 4LJ5A 1UIRA 5ISMA 3P5BA 3SEFA 1PK7A 3MWEB 5K51A 2QTLA 5J1TB 4DC0A 3L84A 2OB1A 1XQVA 2VF8A 2XUOA 1RPJA 1AKTA 2XSZD 1UPTA 3EFBA 1PGOA 4HX5A 4J0GA 1LBQA 5KDLA 1ESZA 1FDUA 3W90A 3MLAA 1ZDMA 4Q4DA 3T8YA 4MGEA 5FYQA 3VPDA 3WK5A 2YJNA 1UQUA 2FN3A 1MP0A 1N5OX 2ARKA 2Q1WA 4ZPXA 5KMGA 3E58A 2X6QA 2LE0A 1QONA 3B6IA 3ZH2A 3SZLA 2UXCB 1EFUA 3I9NA 1P72A 1GZ5A 2VZ8A 4WY2A 4B4UA 3D3NA 3STHA 3LV8A 3FNEA 2NUTB 2V98A 5F7XA 3OIWA 3WLIA 4R5HA 1XA3A 4ZJUA 2Z04A 2ZGVA 2BH9A 1MOSA 1BO6A 2O2JA 3KK0A 3KSUA 1XTUA 2VO1A 3KAJA 4GX1A 1C1DB 4J3NA 2ZATA 2CL5A 3IJPA 1SXJA 4B73A 4ZDKA 4ZI7B 2CV2A 4RZQA 4TVBA 4YV2A 1EEHA 3CZ9A 4Q3EA 3LW7A 4I6JA 1J8MF 4XH9B 3G9ZA 4E88A 2AEMA 2CLLB 1XQWA 5EE3A 2DSTA 4PX5A 2ZP1A 3OJLA 5CT4A 4ZRMA 4CQMA 4H0CA 3DWIA 4MSUA 4BO0A 3ZCQA 2D7CA 2JZNA 1H23A 4ND7A 1N8NA 2EBWA 1A0OA 4J1NA 2C5BA 2H5IA 2ORVA 3M5PA 3E2IA 2DHDA 5K9ZA 4M9ZA 4AF6A 2RC6A 3R09A 1E7WA 1UPUA 4RCZA 3RRBA 3N2GA 1K27A 2ZJZA 1E1QA 3RAEC 2H8GA 1GN8A 2D5LA 3C2QA 5DLYA 3TSYA 3VNAA 3T5MA 4BV3A 5BN5A 4PGFA 3ZJTA 2P0EA 3KFXA 3Q3EA 2QMZA 2QTVA 3F73A 1NVVR 4C2TA 1L4EA 4OGFA 2JZCA 3KOZA 2OZLA 2RK3A 3FB4A 1E0KA 1T1RA 2OHIA 3SMVA 4J1TA 2C7RA 2PRZA 3FVTA 2VZ9A 5FV4A 3DV2A 4DC1A 3V4LA 2XMSA 4D6YA 2Z5FA 4ZVSA 4GAEA 3JZAA 4O0MA 1SBYA 4TYQA 1L3CA 4LISA 2XE7A 1IE3A 2EP5A 3GFSA 4EPRA 3QTLA 4U9IS 3EE6A 4CW7A 2VTKA 3K0FB 1O6GA 2GZMA 2IHTA 4HP8A 2C8KA 1USIA 3AIMA 4H17A 2QW0X 2C03A 3WGYA 2PUAA 1E2FA 2IZZA 3TLEA 3IMKA 1CR0A 2IGBA 1TOAA 1KOFA 3GF4A 1RBQA 3OFNA 2AL7A 4D98A 2ZJ2A 2BONA 2CHEA 3FPCA 3K16A 4P3XA 3EXIA 2J59A 3W77A 2XQJA 1V8ZA 4DJTA 4TV9A 3SIPA 3BJIC 5BXQC 2QZSA 1D5CA 5TJ9A 2A92A 2AFVA 5DCYA 1WCYA 1UUFA 2AEJA 2V5UA 4RE5A 3HBFA 2WUDA 1Y5LA 4H4EA 3IV6A 5BQ5A 1BJKA 1VFNA 3CXUA 1UT5A 4XSHA 5B1YA 3Q3GE 1BDIA 2B6NA 4UEQA 3SIRA 1I6WA 4G0MA 4F85A 1RZUA 3A36A 3NV7A 4TX1A 2YJ5A 2D2FA 1B3BA 2FG5A 3AGQA 2X15A 2KB0A 3HZHA 3F8WA 1T9KA 1U2ZA 3TJZA 4O8ZA 5A3QA 4L6IA 1UKCA 4ZD6A 3WLLA 4X00A 2QTGA 1JNXX 2V6MA 3OOWA 3OLWA 3EY4A 2VOEA 3NPAA 3OZAA 1L9XA 4G56A 5G02A 4GOOD 4U3JA 3VGJA 3N70A 3FUVA 3LWBA 4B5LA 3CCFA 4ARIA 2WDZA 2MR5A 2X8AA 3B2QA 1Y4DE 2F4NA 1R7RA 4ZCTA 1GRRA 1NTOA 1DIAA 1E2GA 2GVZC 1CU1A 2FA9A 2RAPA 1CY0A 2WWHA 2QF7A 4PVCA 4V0ME 4AX4A 4HHEA 1TMYA 2YYAA 4HWPA 1U0JA 2XD4A 1T6NA 3K2EA 1MEOA 1ATIA 3H6KA 2Q3CA 2Q7XA 3LFUA 3QVVA 4IIFA 2I33A 3IQIX 3P4YA 3QUQA 5TF4A 3GJZA 3IOBA 2F43B 2LIPA 5KWIA 2LWIA 4GM0A 4LMPA 4XD2A 1FC0A 5JEEA 3ZDZB 5JDIA 1QVAA 3H5AA 3NBZC 3R5XA 3FRJA 1JLRA 2PH3A 3AG5A 3PPYA 1Y9AA 5LBUA 2K87A 2R751 2V7QA 3I8OA 3TK1A 3SVTA 2XF2A 1DT5A 1GY8A 4XPIA 1RTKA 5I8ZA 1SUPA 2DLDA 3A11A 2X9VA 4EYGA 1NMXA 3QX3A 1T2DA 2C78A 2FE1A 4K26A 1H6AA 2YY7A 3WGGA 2FCRA 3D2LA 3ZV4A 3ZJ4A 4OEHA 3QEBZ 4HVCA 3T15A 1Q22A 5SZHB 1Z2PX 3GEHA 4W9NC 3ZKAA 4B4DA 4NOJA 2E6UX 2EKBA 5IDQA 5EE0A 3M9XA 4NMXB 4DJAA 3IEPA 3VHXB 3NBUA 5A9TA 4AS3A 1AKRA 1V6CA 3MINB 4R5MA 2WHQA 3T3IA 2RJNA 4RFSB 1B4DA 1DJNA 1NASA 2HN9A 3AKDA 4QSHA 3RANA 2C2KA 4KYIB 4N7BA 1OT5A 2YYSA 3KSAC 3QVUA 3ENNA 2A9KA 5G4KB 2E4XA 1MJGA 2QTFA 3JRNA 2RGCA 2AZTA 4CIWA 1ARZA 4JODA 5K6TA 1FQKA 3NWJA 3DE0X 4ZCLA 3QVSA 3RYFB 3ZC3A 2IOYA 2QV0A 2EKZA 2FF7A 3DQQA 3AF5A 3Q9LA 5K2MA 4IEEA 1UT6A 2GZHA 2IXTA 3WLTA 1YZ3A 4AJNA 3MM4A 3HXQA 4NNPA 5EIFA 1JFFB 4YRCA 4BQIA 3H1FA 1DC7A 4UUBA 3S2GA 3EZYA 3ZV5A 4E6PA 4DLTA 4CDGA 4E5YA 2YZGA 2IBMA 1KHTA 1QXSA 3L8CA 5LLDA 1KOGA 4OPMA 4IUYA 4YGXB 4YJ2B 3EQZA 1JEOA 4FXOA 4F5DA 3BWCA 2BKEA 2HU8A 3LTEA 1JXOA 4Q3AA 4WOCA 1UMDB 4DN6A 1IBMB 1U0BB 1WB4A 5FBWB 1ZH0A 2J9RA 1FE8A 4YQEA 3N87A 1N36B 2J7PD 3FLAA 2P8JA 1ENYA 4A27A 1QYWA 3ONNA 2XPCA 4ER3A 2W9XA 4OO3A 4X20B 5CD9A 1FP6A 4GE3A 5AKYA 3ZI0A 3HXPA 1QAQA 1BCSA 1JKXA 2I80A 3GWZA 3UJNA 4IXWA 3G2MA 5TF0A 2O8CB 5J2UF 1K9VF 1R9MA 1GZHB 3BZWA 3H04A 4KBGA 4U39A 5B2FA 4PFJA 1R15A 3TWOA 3GAAA 4EKDA 3ICEA 2BI7A 4NDZA 3WAJA 1HMPA 3IB6A 5JECA 4LKOA 2W00A 1GPBA 4CR7A 2P6OA 2ZYIA 3H2BA 4QXMA 4TMVA 4WFIA 3FYUA 4JN6B 4F12A 4ZHSA 2ONYA 3D6TB 2Q0QA 5FTJA 1IATA 2EX1A 2D5AA 2ISCA 1NQXA 1RTTA 2HL6A 5GOZA 4YJGB 5B55A 3FTFA 2R00A 4V1CI 1JDBC 4AS1A 4DIUA 4L8GA 4UU0A 3QXHA 4YQYA 1SWVA 2HF7A 2C3PA 3FFAA 5AKKA 2XZLA 3YASA 3FHLA 1YVUA 3OCZA 3DOHA 4GF5A 5IJ0B 4UDYX 1C1YA 1UM8A 3PNOA 4E32A 2NZXA 2H1FA 4TTRA 2J9FB 4G2NA 4KQXA 4P3OA 3V1TC 1KAMA 4D9MA 5TY0A 3WIDA 1P5JA 4CG2A 2RGUA 3KOYA 1QB7A 2H51A 4FGWA 5A62A 2QLMA 3BGWA 2E4AA 3IIMA 1KAOA 4ZARA 5LU8A 1VCOA 5MDHA 1IBRA 4KN9S 1DIGA 2BCGY 3PK0A 2C07A 4UCWA 1KJJA 1PBTA 2LVBA 1ZJ5A 1EVKA 1TKCA 2DX7A 2OXFA 1JDBB 2QTTA 4UPEA 4PGAA 2G1AA 3AF0A 2MSKA 4MIOA 3LT2A 3RO7A 3PDIB 3G2HA 4JB0A 1XTIA 2H85A 3I30X 4UOEA 1PQWA 4FI3C 1AA9A 5B1DA 4KR6A 2P9CA 1GNPA 2RG7A 3ICWA 3MTGA 1VKHA 1Z5ZA 4A82A 2X7XA 2C84A 3VI4B 2Z6QA 2I1WA 2J6HA 4FYIA 2ET6A 3CG4A 1UJ4A 5BPHA 3AX6A 2W6ZA 4U6QA 2WF5A 4J91A 4ED9A 1D8TA 1IOWA 3EYWA 4KN5A 1CEXA 4NXNB 2Y76A 4TUYA 1FFBA 4WLEA 3MMNA 5CX1A 5BQFA 3B8EA 3EVCA 2A14A 3HWRA 3CIOA 3DTNA 4TKLA 4RSMA 1XNGA 5SY4A 1BVYF 2FW8A 1ZWKA 2L19A 1QLHA 4ZU6X 3S2EA 3AHHA 3H86A 1VSUA 4HB4A 1GSAA 3U0BA 3OIFA 2FN9A 4KB5A 1Z36A 3NIBA 3C3KA 1KU0A 1MMFB 4E4YA 5ITZA 3U0VA 4DV3B 3AI1A 2W2KA 3NX4A 3TBHA 5BN4A 1RRGA 5JMTA 5LU9A 1WUTA 4K05A 4D7AA 1W4ZA 4NS1A 4H7HA 3D5EA 1C2TA 3CG0A 3GVXA 4DSZA 3EXFB 2LCFA 1MNQA 4NK5A 2E9SA 2Q5HA 5A02A 5CVUA 4LJSA 1JILA 1N5JA 2WAAA 2WSMA 1QJ4A 1LK5A 1M34A 4PXAA 1E7SA 2I2CA 3DKRA 5DNDA 4GVXA 4NBVA 1ENOA 3R3YA 4K88A 2DHCA 1EUCB 1JHYA 2DRIA 3AHFA 2VATA 3A6LA 2R6FA 3O83A 3QEOA 1GPKA 1GL9B 3P9CA 4YJ2F 1DKOA 4IJUA 3P4XA 1TVCA 2PX0A 5L7YA 1L7BA 2IIVA 4MV7A 1J1IA 4EHLA 4MGYR 2F3PA 3ESAA 1JA0A 5DX8A 5KUTA 3I01A 2HU7A 3V8QA 1X8XA 3T5BA 2PLRA 3WOVA 3WK8A 4C4TA 4LQCA 2YL2A 3KYJB 2P11A 2Q46A 1SUAA 4Z4CA 5DGDA 1YB5A 2QD3A 4JHXA 3VR4H 5F2NA 4TMTA 5G1OA 1QORA 3EH1A 2DLNA 2QL6A 3N2NA 4HVAA 1MO5A 5DU2A 5HBRA 5GJWC 1PYGA 5IC5A 2G6TA 2IEZA 1NF3A 1P1CA 2REOA 2XTMA 1FDRA 4TXLA 2J5QA 2NXWA 1BCRA 5T4EA 4C5BA 2IBSA 3KJIA 4DT1A 2HMYB 1OU0A 1YJBA 4BQOA 3RF6A 5KEIA 1YQXA 2XQVA 3FWYA 5FJIA 2AHRA 2DKOA 3EQ7A 2JRCA 2ZZKA 3IUMA 3S0JA 1BX3A 1RQ7A 3OLZA 1MB9A 2X0JA 1IHUA 3FAZA 3ESYA 4QSMA 2PS1A 4J7XA 3AUSA 5C8YA 3IHTA 3TQCA 4C3UA 2AVNA 2VN8A 1IL0A 3DYIA 4MX8A 2PIDA 1EFDN 2RGAA 2WV7A 5AIBA 4M1TA 1EXNA 2FPRA 1GTVA 1M2OA 1MX1A 3KELA 3IQHX 3O4JA 4IIBA 4DY6A 3TRFA 3WO0A 1GUZA 1E3LA 1YZVA 1TGYA 2AZMA 2Q2VA 3DE4X 4E1AA 4MAFA 1JDNA 2P3QA 3BTOA 2W6PA 1K06A 5CVVA 5JW6A 2Q41A 1P0PA 2NXEA 3DG9A 2H11A 4KEAA 4X7RA 4D43A 3QKIA 5EJ8A 1RAHA 5JT1A 4H4CA 1P77A 2CXXA 4Q37A 2BEVB 3OKCA 3FM9A 4ZIRB 2FYTA 3CZPA 1JQAA 3EEQA 5DK6A 4QLBA 3H5RA 1L4LA 1U9ZA 2PT5A 3CINA 3CEPB 4WK4B 5PNTA 1ZCAA 4DM4A 4YRKA 3TLKA 3EQ6A 4XVCA 2CXHA 2KJQA 2ZZNA 3IVCA 1JBEA 1KH2A 4N8DA 4QO8A 1RC0A 4UBOA 1LI4A 1L5RA 2JH9A 4TYNA 2PX3A 2D1FA 2WOJA 3V4ZA 4A6DA 4XX0A 1GZ7A 1Y5NA 3T34A 2Z09A 1CUIA 3N74A 2GR9A 1HWYA 3O0TA 4WZBB 1CVLA 2C59A 4D8VA 3FVQA 5K8LA 5KDDA 1GG5A 1EP9A 4K9SA 5FORA 3VU8A 4V0QA 1W2HA 1JX6A 4FS8A 3BRCA 1WXEA 5DFAA 1CRLA 5FPTA 3WLSA 4LDAA 4A0QA 1A2OA 2W6IA 3G9QA 1IJEA 3B1VA 1P44A 2H31A 4UXHA 4YS6A 3SN6A 3T3PB 3D4IA 1ULTA 4HFRA 5F3RA 2ONKA 3W5SA 1MAAA 2WAYA 4CLXA 2RHCA 1JEYB 3Q87B 1IQPA 2WKRA 5DZSA 3CLRD 1ADJA 3OU6A 5JALA 1CS0A 5KQPA 3IA7A 1EUZA 1FSZA 1LDYA 3EC2A 3FZGA 5K0SA 5KVVA 3SR0A 2POCA 3IMFA 4FI3F 4MQ4A 4AY4A 4V38A 5FUXA 4FD2A 2XWSA 4G8DA 3AEUA 3JVIA 4FR0A 4GU5A 1OZGA 4DWWA 9ABPA 1HO3A 3QVWA 5JADA 2REQB 5KNCD 2F62A 4MUXA 4BBZA 5LBTA 3VH2A 2XUFA 2E4YA 3IUQA 2RGRA 2QR3A 4DLBA 1QYVA 5EAIA 1QHFA 3RTAA 2HFJA 3ROMA 4K8OA 4QECA 4JL8A 3SVLA 4B3RB 2O14A 5CDSA 1MH9A 1X6VA 3REQA 1AKEA 2IXGA 5B30A 3VC2A 1GGEA 5LUAA 4O6VA 3HDYA 1EQAA 3EA4A 4PBTA 3SAJA 4XEUA 3DS8A 4WAUA 2NX2A 5D1NA 2J3MA 2QM0A 3DCIA 3HYSA 5GWXA 3SJCA 1J2EA 4JB8A 4D0SA 5FPQA 3R6LA 4ZGWA 3D5QA 5KO2A 1VPWA 4DV7B 3HJRA 2H92A 4FNOA 4QWWA 4QU8A 2L17A 2P79A 2DBQA 3QPDA 3E1SA 4XZ3A 3ER9A 4GC5A 3KG2A 3IV9A 3S7TA 3FG9A 5T6MA 3EZ6A 5DNWA 2HEIA 3TL3A 3DHWC 4X7PA 5ITWA 4HZUB 4CM1A 1PFVA 3V2UA 2CLFB 3QVMA 1SQ6A 3LPCA 1NR7A 4W82A 3VQTA 4CG1A 1CP3A 1UPFA 1J1ZA 1AV7A 1L7RA 3GZTB 1XCPA 1I3LA 1OGJA 4J90A 4Z8YA 5GPBA 3A2KA 1O0BA 2ZWAA 4AD8A 1XZAA 2JFUA 3K1AB 1U0EA 2QU8A 1GYQA 3G7UA 4DBLE 4G9BA 2C9MA 4B31A 1NIPA 4KDEA 3FPBA 1XNRB 3KT3A 1Z6YA 2J41A 2NXNA 4J7UA 5FXMA 1ZGCA 3RUDA 3T1OA 1G4UR 1DIBA 3IPAA 1GZ3A 4D74A 3C4QA 2HLDD 3RYTC 3IP1A 4ECAA 5KVSA 1K5GA 2NYUA 1G20A 1XLTA 1QU2A 2DUUA 4PRKA 1WZIA 1RYHA 1E4EB 2WSSD 2CMGA 5DM0A 4G8JA 1PEKE 1SXIA 5IM4F 3SSMA 4H15A 1Z2AA 2EG9A 4IVQA 3USES 3EZGA 4LGMA 4RL6A 3NBAA 3N6VA 4ZK2A 3TM5A 1EFKA 3CF2A 3OMLA 4RZSA 3PC3A 1ETHA 1GLVA 2GAAA 2H9AA 4CNQA 1PQUA 3MWEA 3I4LA 4DMKA 1GG9A 4IZHA 3LX5A 5LQJA 4B2IA 2BFPA 1G3MA 2BJVA 2B83A 1EGQA 4R54A 5LDGA 3ZXSA 2QX8A 5JJLA 4X60A 2RCNA 4JUBA 3C6KA 5I7OA 1TM1E 2TMYA 3H5VA 3OZWA 5AJVB 5DNVA 3VGPA 4Z7QB 1LQTA 1J23A 3L0SA 1LI7A 4Z3KA 4AY3A 2RAUA 3I5UA 2PLNA 2X5KO 4OJQA 2ZYTX 1DB3A 2XCQA 4F72A 4LY9A 2X0FA 3HYLA 4R40A 4COOA 2ZBDA 4RVUA 3HABA 4XJXA 2NUTA 3STVA 4BEVA 3GROA 3LL4A 3F2IA 1RXCA 2C00A 2ZVQX 1K2VN 3CXRA 4NESA 3VPXA 1U3VA 3STYA 3ZHQA 1PT6A 2BGKA 1C1DA 1LRKA 2V5VA 4K6GA 4Y98A 4GQAA 4DBVO 2OFWA 3V6MA 5ED4A 4KQGA 2OT3B 1CW2B 3QLUC 4ZI7A 1KMCA 3CY6A 3H2SA 5AKIA 3F6EX 5CCDA 2WILA 3B1WA 4O4IF 1A1SA 1CWUA 1E4YA 1WF3A 2XB4A 1SZPA 1WW2A 4HDAA 3X44A 3FOZA 1N2JA 4UBNA 1QF6A 4UHKA 1BE8A 3KLMX 5HGXA 5HW0A 3JZIA 2Q9BA 1TUEA 2OBLA 1NVDA 1BKDR 1Z0JA 1OWLA 1WPXA 4XTCS 4KREA 4GPTA 5L3SA 1X42A 1DC4A 5FPHA 1TF7A 4KAJA 3A4YA 4P53A 4EFDA 3S8YA 1XVVA 1UJNA 2DWCA 2GN4A 3CR8A 2HSWA 3K1TA 4IH9A 4RCYA 3KEMA 1FS6A 4CU5A 1BRTA 2PWBA 1KIFA 1BMQA 3UWDA 3MWLA 5KAMA 4DQLA 4E2FA 2INGX 3GJ0A 5B3JA 1RS0A 3CW2A 3Q6IA 2BJHA 4B81A 2BSAA 4IOJA 5IT5A 2GZSA 4Q4CA 4GGPA 3BH6A 1OT3A 5EP2A 3EIWA 2CHGA 4ZV4A 1WPRA 1ISSA 3F5MA 2BN4A 4FC7A 4OU5A 5IYZF 1T4DA 2RHGB 5AR1A 2FKNA 1E3WB 2XCRB 2OUIA 4V1CA 5E7JA 3FDJA 2DPGA 1S5PA 3LDGA 5ARCA 4B1FA 1C1XB 5JWOA 1W4RA 1RC1A 2OG2A 5JO9A 1MPTA 4ER0A 4XDZA 3PGMA 3E5HA 3BPSA 3F96A 3T9FA 2BUBA 4RLFA 2WVAA 1U0LA 4BUJA 1B76A 1FB5A 1R4MB 3NDPA 2TRSB 2WQ6A 3DFMA 1LSOA 2YHIB 3A0RB 1Z7BA 5DBFA 1QO9A 3T7SA 3K0FA 1SAYA 3ILXA 1Z6XA 4KXQA 2V9PA 2W37A 1ST2A 1PYDA 4UTOA 2GPAA 2W2PA 4G09A 3M6FA 5JWRA 3LWDA 3USCS 3ZIDA 4BO1A 3TZ6A 1MC8A 4TZ0A 2GN0A 4W7IA 2VJDA 3TLGB 4GWGA 3EG5A 3F4BA 3QPUA 3WHIA 5BYAA 1SQ5A 4MJXA 4LDRA 3AONB 4LVCA 4Q3DA 5JQGB 5TMPA 3A6DA 4UARA 4FFBB 1NF9A 2JAUA 3VR2A 2GF9A 3MAJA 1WQ1R 4FYPA 3VBEA 1Y3IA 2GT1A 2WWVD 3GLUA 1NVMB 1ORRA 2PGNA 3PJGA 1WZ2A 4IFEA 2DETA 1JG3A 4CCYB 5IU6A 2DWPA 3QEJA 2CWDA 2Y1DA 4WESA 2J9ZB 3NEJA 1G5HA 4LZOA 4WZAE 5DTJA 1NBME 1UKVY 2D00A 2R85A 2G67A 4DR6B 1FX1A 5EE1A 2IYSA 4LGCA 3UN1A 4J0JA 1J8QA 3E7FA 4ZOAA 3GP8A 3L7CA 4BXOB 2JDIA 4RLSA 1Z83A 1KZ6A 3K9BA 1V26A 1J24A 1V9CA 1ZM2A 2X6RA 3WK7A 2VNAA 2CMFA 3GGOA 2A1UB 3BERA 3VXKA 4KRFA 4IJ5A 1UZAA 4OQQA 5CVCA 4ZEOA 5IMBA 2G9NA 3UMSA 1EK0A 3BOSA 3W4JA 2Z8XA 3W34A 3ZCUA 5JAQA 4QATA 2C2XA 2PWAA 5KTOA 2NO0A 1UOPA 1KQGA 5TX7A 4D99A 1CNFA 3EVGA 4U63A 4D9FA 4OA8A 4JC5A 1G2OA 1QHXA 2VPYA 4R1LA 3GDHA 5KHOC 4HDOB 1CQPA 2E7ZA 2DYKA 2PZEA 3KPUA 1E2QA 4HXYA 4UASA 3GNTA 1MVNA 2B4AA 1NXVA 4LV6A 4Y9SA 1CUSA 3K05A 1K4YA 4PVDA 4FE3A 2F43A 3WE7A 5DIZA 4DLSA 2J48A 2O23A 2BGTA 2EQAA 4R8RA 1JLSA 1UOQA 3NHZA 4TVKA 2JLVA 1IM2A 2QN8A 1CZHA 2C42A 2Z8YM 4EGSA 3QWBA 4R2HA 3ZDRA 5CDUA 1CQJB 2V3WA 5JNLA 3QKSB 3I23A 221PA 4HD8A 3CN9A 3PTZA 2P2GA 4JLWA 4JXZA 2C5AA 3AIOA 3BMQB 3RSHA 2AA3A 2XIJA 3LC1O 4PAMA 5ARBA 1BXGB 4OX9Y 1KZ7B 5JYEA 3ZLJA 4MCAA 1NYTA 1FXWF 1XKXA 2UUOA 4AN0A 4E7OA 1G0NA 2GZAA 4AQ7A 1W7AA 2BVNA 4OHRA 3AQ4A 2AKAB 2ZFUA 2I9KA 4Z4GA 4ZQIA 3VHXA 3EWSA 3MINA 2A58A 5AK5A 4RFSA 1FLVA 3LIPA 4LQDA 2DFVA 3VNBA 4C9BA 4OLBA 3ELYA 3TG8A 2JGJA 1OPRA 4I1PA 4KPGA 1BU8A 4TOIA 5KI6A 3PTAA 3NP7A 2Z3WA 3DO5A 4XIJA 1YXMA 5G4KA 1I94B 4WKPA 3HJTA 5BUZA 3LPAA 4WFJA 2GRJA 4FGLA 2VTDA 2W93A 2RJ3A 3RYFA 4PG4A 1FP1D 3EIOA 3ED1A 4Y1GA 3MFQA 2NZJA 2QUHA 1GNVA 3KHSA 4NX2A 2PUEA 1ZP6A 1PDWA 2JCXA 3H97A 4MYTA 4W9NA 5EHQA 4PYNA 4B32A 1QMGA 1JFFA 2GJSA 2JIZA 3DTYA 1N5KA 4RTOA 2G8NA 3T9EA 3SQWA 3FNIA 2YWBA 3D5TA 3FBWA 3QU9A 3PNSA 4BC0A 2PQMA 3DOJA 2I7VA 3BK2A 2X8BA 5SY9A 1DHRA 1FXUA 3IDZA 5HRAA 1UAAA 1LZLA 2OL4A 3FB1A 2R7NA 4NFYA 1QV9A 1MX9A 1FMFA 3TTWA 4TVOA 3NMUF 1T36B 3TOVA 5BT8A 1ZNYA 3QHPA 2CV1A 1F2DA 3GGJA 5J4LA 1Z4OA 4KE7A 5REQB 1GM5A 4AN4A 5FAKA 1BVHA 1PFUA 3G6KA 4L5CA 1BDMA 1UBCA 1YB4A 5CXQA 3EPPA 3OKAA 4JH0A 3SHWA 4IDHA 4O8CA 4E12A 1TAUA 3V8EA 9ATCA 1CYEA 1DXHA 2O8CA 3ZGNA 5F3DA 3RC3A 3TR0A 1IQUA 3ZWAA 1NURA 2G4CA 3EIUA 3ZDQA 1JR2A 2EC5A 2QQEA 2WFZA 1XRQA 4R6WA 1X0XA 2F7SA 4W5HA 1R9GA 3RFVA 5KNLA 4WKCA 3IQFA 1G5IA 2FB9A 1E58A 1OGIA 4EIWA 4BNJA 4P5PA 3ADBA 2GERA 3TNJA 4QQKA 5BUQA 3H4IA 5DWVA 2DFPA 1TPZA 3IERA 3FSGA 3CNHA 5HZKA 2B0CA 2ESRA 3I9V1 4YJGA 4EHHA 4W7HA 3N3BC 5JZOA 3HVUA 5EPUA 5EUMA 5TT0A 4TWRA 3SJ7A 3PD7A 1E94E 3CUSA 1L7NA 1E2DA 1G6KA 1WMSA 1IEWA 3UWPA 1T5SA 1U2DA 5JYBA 3RLFA 3VR0A 2GN1A 1E5XA 1V39A 3TCNA 5IJ0A 2IP4A 3ZE9A 3KKMA 4G9EA 2J9FA 4CTNA 3O7MA 2PZKA 1XTQA 1Z4MA 1LLQA 1O08A 3HP7A 2X0DA 3L0PA 3B7GA 2YVUA 3OFKA 2F9FA 4NQRA 3U48A 4BQSA 1PLKA 5EMJA 1W85B 1YHZA 3KSMA 3KAQA 2RGNC 2HRZA 3LXUX 1DAEA 2OBFA 1U1IA 3LBFA 2IH2A 5J4KA 4GMHA 3LVBA 2B5OA 3GZJA 3K8ZA 4RIHA 4ZVKA 1RRVA 4NFHA 4F2GA 3ZE1B 4WXYB 5EIEA 5AW1A 3WDMA 1SU6A 4DYVA 5EMKA 3LHIA 5C4IA 3OX3A 2VYFA 1M5UA 2UYYA 3I42A 2X5JO 1TZCA 3PDIA 3Q3HA 4F06A 2QTZA 1PR1A 1CJCA 4IMIB 3A32A 3AY7A 5M3BA 5KQGA 1KYTA 1RVV1 4QYWA 5HKAA 3H2IA 1Y63A 3GJSA 1JAYA 2M6KA 4AJHA 4H6VA 2C04A 2JFFA 4PNHA 2FPXA 1SVSA 1GJRA 3PUWA 2QVXX 2PH7A 2ZKIA 3VFDA 5JJ5A 3RE1A 1AA6A 1SU7A 3PXXA 4B83A 1K7CA 1O6CA 3U4IA 1H9CA 3DEHA 3EVZA 4COKA 5ALJA 1SCDA 2O0KA 3C7DB 4IDGA 2FLWA 3IAS6 5BSEA 2H29A 2GM3A 4TTIA 2C2ZA 4JV5B 5HMMA 1KVQA 2FH5B 4HWRA 1XHFA 3PYLA 3ANMA 5F2EA 1FFWA 1GLGA 1O1YA 1TFUA 3G6WA 1N2BA 3WDKA 4DHEA 4P0QB 1O4WA 3PEVA 3VM6A 1ZC3A 3VHLB 5E7MA 1U98A 521PA 4EX6A 3AY0A 4BCDA 1E9FA 2M1ZA 4WK2B 4BU1A 3RSOA 3P2MA 1XMSA 2OAQ1 5AESA 3LY8A 4HH0A 8OHMA 3OH8A 3EEOA 5IJ9B 4BMSA 1TTHA 2BHTA 3KL2A 2D62A 3PU6A 1CZKA 1O96A 2ZYVX 2DFDA 4CM6A 4GYYA 3ZGOA 3MA0A 1QFZA 3HB5X 4BC1A 3KQPA 4MUEA 3F78A 4PIPA 2YZMA 1CV2A 1F4LA 4L9AA 3FCSB 4LHVA 4FEYA 4YBRA 2NU8B 1S3IA 4I9FA 1QBKC 2PUDA 2GWHA 1AX9A 5F7JA 2YJZA 3OJWA 1P19A 1WD5A 3PQ4A 3TEJA 1N7IA 1E5VA 3FZEA 5EMNA 3SCZA 4D9IA 2D4AA 1SKMA 3VV2A 4W7SA 5DHAA 4HFMA 1EUCA 1XHEA 1MIOB 1UMCB 2RGDA 1IBSA 2DT8A 2JJ2A 3AJ8A 3Q88A 4NG4A 1E6EA 5EZSA 4UNSA 1Z5PA 3ORFA 2QUZA 3A6JA 2D2EA 2WMOB 1A7KA 3CUEF 1GEGA 2ZIXB 4L73A 4UREA 1JR6A 1Z0AA 2QORA 5AW9A 3QYFA 4ND5A 1R5JA 4QDTA 3HA3A 1P9OA 5JD3A 4QUHA 1JXQA 1P31A 2WINI 3N6XA 3QA9A 2XH8A 4KRGA 4RIGA 2HQ1A 3QUSA 5KQRA 1HE3A 2GNAA 1I01A 2II6A 2OLKA 2Z5VA 2IOFA 4KLNA 4UW9A 2V6BA 4MVJD 3V8PA 3ZHYA 2PUVA 3HO6A 2C99A 4OA5A 1M6VB 5BSUA 3VZPA 1ISGA 2RH5A 3WB0A 1MG5A 1XOIA 4LCEA 4DIEA 3FPEA 3TMAA 2IXFA 3GFTA 2VDJA 5L4SA 4CNBA 4EQ6B 2VHTA 2ZB2A 2BMEA 1N3BA 5EY5B 4RA6B 1TRKA 4RPJA 4DMLA 3OY2A 3ICOA 3I6MA 2WP0A 1X8KA 5JAUA 4M0PA 1NQTA 5K03A 3U7JA 4LX8A 1ZU4A 2X2EA 5CLIA 3RW9A 2E5FA 4UAJA 2QMQA 4MUGA 2IUFA 4BJ6A 1O94C 1VPEA 2P2ZA 5CFPA 1J9EA 1C9KA 4WGGA 1EZZA 1A3CA 3UT0A 3ZY5A 4BTLA 1O6BA 1G8HA 4IMRA 5BWCA 3QLTA 3GUYA 1JIQA 3D3WB 1X9IA 2FPOA 2A0XA 2IODA 4OQYA 4WXRA 4IHJB 1J21A 1NJFA 4Q9IA