3LS5L

Anti-tetrahydrocannabinol fab fragment, free form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPTTMAASPGEKITITCSASSSISSNYLHWYQQKPGFSPKLLIYRTSNLASGVPARFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSIPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of antibody Fab fragment
publication title A structural insight into the molecular recognition of a (-)-Delta9-tetrahydrocannabinol and the development of a sensitive, one-step, homogeneous immunocomplex-based assay for its detection
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 53
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L01
1A5FH 3CH8A 3FTGA 4LCWE 4BJLA 5DMGC 2R8SL 1MCSA 1G0XA 5B4MC 3RAJL 4Y2DC 3MOBL 2KUTA 2IANA 4DTGL 4WUUB 1FBIL 4WGVB 4KTDH 2XY2A 1ZT7B 5F7YC 4B41A 4JFED 3QEQE 3MTRA 4JZJA 5H2BA 3AY4C 4L3CB 4ERSL 2FWOB 4LLDB 1MCHA 1FGVH 1OTTD 1WBXA 4M6NL 3U30C 3LS4L 4HIEA 2V5SA 2VZ1A 4YO0A 4LLUB 2EXYC 3SKUD 1XF3B 2D03L 4NT6B 5FV2A 1OAXH 3RU8L 5BW7C 3STBA 3LRGA 1I9IL 3ULUC 2R2HA 4PTTA 2J8OA 1U8PB 3LKSA 5B39A 2ZNXA 4OZFG 4DQOH 5BXFB 1OARH 3MBEC 2RIKA 1F58L 2VKXA 2E8ZA 2NY3C 1CLZH 5I30L 3LS5L 1DVFD 3ARDB 5T1KA 4Y0GA 3SKMA 4JDTH 5C0RL 1I1AB 1MLCA 4N0UA 5HYJE 4RNRA 2PO6B 3DSFH 4EUPG 2VITA 3IXTA 4PB0H 3KLAB 1RIVH 1X5JA 4U2YA 3V52L 3VRLF 5F89B 3VGAB 2R39A 5HGBB 4ZD3H 5JDJA 5ANMA 5ALCL 5MEOB 2ADGA 4LMQE 1C7SA 5C07A 3C87A 3H9SD 2YEZA 3SGEI 3SDCC 4E9LA 2Z31A 5KG9B 5E94B 3SBWA 1GGTA 1FSKB 4PJ7B 2HVJA 3CLEH 1KJ2L 5HYSA 1KNOA 3IJSB 3MLXH 2WSKA 4FTVE 1ED3B 5MEND 1T6VN 4RMVA 1NGZB 2E7MA 2IPKA 2LABA 3O9WD 4HT1H 4KRPD 2R2EA 1A4JA 2FYYA 1NFDA 2BNRD 2FJHA 1IEAB 4XPFH 5DFVC 1ZANL 4P9HH 4NQEA 4LHUA 2CDEA 2BC4A 5F1IB 1TPXC 5BQ7B 4OGYL 2YN5A 3V0WH 3RA7H 5F8RC 5E4IA 3CUPA 4HKXA 1RK0B 4ZTPL 3KPOB 4X5WB 3I6KA 4F2MB 3QIUD 1XCTB 2BXYA 2DQDH 1FZMB 4IJ3C 5E2UL 2W60B 1VB9A 3T8XB 4QCIA 5HDLA 4XMLH 1R0AL 4PBWD 4PRNA 4M7ZB 2JK5B 1J8HD 1FN4B 2HTLD 4DZ8B 3DV4B 2VXSL 3VXMB 2DYPB 3NGBB 1RUML 4RBPK 2DTMH 5EU7E 1EHAA 3QIBC 4KDVA 5LBSL 3VFPA 2DLTA 2KZ1B 4PD4J 3MUGA 2WQRA 2OSLA 3V5HA 3WEXA 5K9KA 1F4YH 5I1DA 3KPTA 5D7LA 4LEOA 3CSYA 2BSSB 1YPZE 1LEIB 4PJBF 3RP1A 3TIEB 1JGUH 1FFOB 4OLEA 1YJDC 4PRPA 2P5EE 2ARJB 4FNLH 5D7SL 3G6JF 3VXTA 3F58H 3DYOA 5I6XC 4MA7H 3HR5A 2QHLA 3GIVA 3LV3B 1NBQA 3EFFA 3EBAA 1BOGA 1S7SB 2DQHL 3PJSB 2Q20A 3FQNB 3GNML 1A8JH 2ICEB 2WWKT 2ERJB 2ZSVB 5SWZB 2CUHA 3L6FA 3V6ZB 3QWRA 1HQRB 2DLGA 1CFNA 1S3KL 4J3SA 1GC1L 3CCHB 1D5MA 5LGHH 4G7YL 1QSFA 3V2AR 3RL2B 3GI9H 3LD8C 4O4YL 3ZO0A 4UIKL 1MI5D 1UWXK 3CFCL 4F9LC 3P0YL 1CK0H 4K7PL 3SJVD 3QDJA 2LU3A 3CX2A 4MS8D 1YUHA 2UVFA 2UWEF 4X4MA 4ZO9A 3WS6C 2DJUA 5T3ZD 1TVHA 1ZLWK 5TE7H 1LILA 2Y36L 3V6BR 2NY4D 2GSGA 1KELH 2WNGA 3VXPB 5T1DH 2CXGA 4JPKL 1WK0A 2MQ3A 4IRSA 4F33A 3B9KC 2W9EH 2IANB 5CEZL 7FABL 1FORH 2P5WD 5C08D 4F7EA 3NA9H 4RGNB 1RSFA 3O4OB 5FYLH 4JZJB 1DCLA 5D7KE 2DBJA 4XC1H 1U8OB 4PLJD 1SJHA 5D2LE 4HIEB 4YO0B 3GSVA 2GTWA 3S3SA 3MFFA 1DQTA 3IJYA 1DUYA 2J5LC 4GT7A 4EXKA 2UZXB 2APWA 4OGXL 2R2HB 4MDJA 4Z95H 3RGVA 2O5XH 4L9DA 3LKSB 4F8TA 5B39B 1OAZL 1RZKH 4GKSA 4LLYA 3ULVC 4Q7DA 1MCRA 1C16A 1MCIA 3TT3L 5JOPE 2GJZA 4QWWD 3M07A 3SKMB 4ZAKC 5BVPL 5JQHC 1TFHA 1MLCB 3PDDA 4H88L 1A6TA 4WU5B 2RAMA 1GH7A 1H3TA 2HFTA 5C6TH 1UA6H 4MWFB 4RNRB 2IH1B 1TNMA 3CFIC 3DLQR 2VITB 3FRPG 3IXTB 4X6DA 4ORGB 1PLGH 3ZSTA 4I2XA 1A7RH 4XP1L 5AZ2H 5GJTL 2FGWH 4L4JA 4EBQL 1FNLA 3ZKMC 5C07B 5K33A 2YEZB 1UG9A 2Z31B 2VUOA 1CDCA 4NNYA 5I74B 1AKJA 1AO7B 3KAAA 1A6VL 4Z18A 4OI8A 5DWUL 3EDFA 4LGSB 3TO4A 1F13A 4UOW0 3UC0H 3V7MA 1NUDA 4EQ3A 3KPNA 5HDOA 1VKXB 2R2EB 1TXKA 1A4JB 2FYYB 1NFDB 1AGCA 3P9MB 2FJHB 3LN5A 4ZPTA 1VGKA 4NQEB 1CGVA 2CDEB 2BC4B 3DSNA 2ESVB 1MFAH 4UT7L 2OM5A 3CUPB 4HKXB 4OTXH 3I6KB 4K94C 4ETYA 1X5LA 2J3SA 5F9DC 5CBEA 4QCIB 5J12C 4D9QD 2D9QB 3NFPA 4PRNB 1DL7H 1KCRL 3BXNB 5K93A 4G9FD 4N0CD 1JGLH 1H15A 2I07A 1C5BH 3D3VD 5IBUB 3GSQB 4DKEH 3ARQA 5C0EB 1AQKH 1JV5A 1H5BC 3FT3B 1NGPH 1PYWA 3VFPB 3Q6FA 4CADA 4PTUA 3RKPA 3MUGB 2AKRA 3A67L 3MRHB 1HN1A 2OSLB 3WEXB 5DRXA 2BDNH 4JZNB 5D7LB 1I1FA 4LEOB 4N9OB 3RTQC 4P2QE 5DVLA 4PRPB 2GTZA 1OB1A 5C0GA 3B6SA 3VXTB 2A9NH 15C8H 3TH4T 3GIVB 1A1MA 3R1GL 1YNKL 3EFFB 1BOGB 3FN0L 2E27H 1FRGL 2ZOKB 1XR9B 4Y4HC 3L6FB 4XI5C 5T1MB 3KJ4B 1CFNB 2XPGA 1F4WH 1KLUA 4O51A 1WTLA 1I3GL 1E4KA 2IJ0C 2WMPA 5FOBA 2DMKA 4R0LC 1QSFB 4Y5XC 5IROC 3S5LB 5EUKA 3HKFA 4QEGA 5DJCA 3OL2A 5I1EL 3LQAH 1FDLH 1Q94A 4QHNA 1BAFL 2EH8L 3QDJB 4ZFZB 4KZEL 3RL1A 4JJHA 4JO1L 1I9EA 2DBLL 4L4TB 1YUHB 1X5GA 1I7ZA 1UXSA 1TVHB 6FABH 1EMTH 2BNQD 2GSGB 5KJRH 1JE6A 3VD3A 3MV01 4XPGH 4S1SL 1S9KC 1CT8B 4IRSB 4F33B 5F1NB 2CJUL 3BPLC 5I9QC 4UI2A 2DL9A 4M7JH 4CN6A 4F7EB 5GIRA 5GRJH 1Z5LA 1UB6A 3H2WA 4WJ5A 3QG7H 2P4AB 1E27A 2XACC 4H20L 4KJWD 4G8GA 2RCSL 4WFHD 3QI9A 3S7GA 2XG4A 4PJ8C 3MFFB 4U3XA 3IJYB 5IW1A 1W0VB 1VEOA 2IG2L 5FGSA 3TNMA 4MDJB 1DBMH 1FYHB 1KN4H 4S11A 3UPCA 4GKSB 1CBVL 3D9AH 2YZ1A 1C16B 1DLFH 2GT9A 4XPBH 2GJZB 4OLUH 4XWOD 5L0QB 2ICWJ 3UBXI 1A6TB 4HZAA 3MA7B 4IMKA 2HLFC 4X6DB 1CLOH 4U49A 3VFGH 2EKSA 2QHRL 1EHLH 3CZJA 5GRVL 3GBLA 2Y06H 4HJJH 2XKNA 4R4FL 2JTDA 1IQDA 4DGVH 4AYFA 1AKJB 3C60D 3I9GH 4BZ1H 1LWRA 3TO4B 3MR9A 5L2JB 4LLMA 1XF5B 1IC5L 2QQQA 1Q9WB 3ARBC 1NJ9B 4U1LA 5IHZA 3TZVC 4PP1D 1KB5H 1AGCB 4IRJD 1U36A 3LN5B 4PJIF 1YNLH 4FA8A 3O8XD 2VH5L 4U3HA 3T2QA 1MQKH 3P0GB 3JWOH 5E2WH 5FUOH 4M1CD 3UO1L 4AG4H 3C5ZC 4QRRE 1YEJH 4EI6A 4BQCA 3NFPB 4I3GA 5ESVB 1KXQE 5I1AA 1H15B 1DVFA 3LKPA 3MO1B 1RZJC 2Z0BA 3WLBA 1JV5B 3VRJA 1J0JA 1PYWB 1D5XA 2A6DA 1SY6H 1IQWL 3MROA 5CGYD 3TNNA 1HYSC 1KSRA 1CXEA 2GTZB 1II4E 1OB1B 1T83A 5C0GB 3B6SB 2BSTA 4GXVL 4FABH 3WFCL 1EVUA 1Z2KA 3GHEH 4L3AA 3MLRH 4NKQB 1BREA 3OB0H 4U4BA 1NFIA 4Y4FD 3QNXB 2IC2A 2BNRA 4MJIE 1N3NA 5MHSE 1MFNA 4I18A 2XPGB 3OF6A 3B2UC 1KLUB 4FOMA 1AR2A 2F8XC 3RNQB 1LP9A 3AMLA 5FOBB 1EHXA 2XI9A 4FQXA 1H0DA 5EUKB 4K7PX 3T0AA 1T4KA 4RQQB 5DJCB 2DQTL 2RFXA 3QHZL 5D2LF 4WY7L 3NTCL 4XP5L 4QHNB 5HHVH 3WFZA 4NJAH 3RL1B 4OIIL 1J9CT 3D5OF 1J8HA 2MTPA 1EERB 2A74A 5KVDL 2VXVL 4DK3A 1G6RL 1UXSB 3L1OL 5F3BA 1QO3A 4W6XB 5D2NE 1NL0H 4LARL 2WUBH 1VDGA 2EIDA 3T65A 1CDIA 4JB9H 4LLVB 1QD0A 4JANA 4GG6A 3NCEB 3NFNA 2VKWA 4GSDL 4M6AA 3ZKSD 1Z5LB 5EU6D 2H32H 5DVMA 4JGMA 3AB0C 4XZUA 2NMSA 1UB6B 4WJ5B 2R8SH 2LAGB 1E27B 3MOBH 3JV6B 1IARB 5T33L 1CFVH 2J8HA 4G8GB 4DTGH 4XNYL 1MLBA 4ESKA 3AFLA 4EOWH 4Z7VA 1CVRA 5IW1B 3MRNA 2GUOA 4M6NH 3LS4H 3IAGC 4FQJL 4YH6A 2C1OA 4JFXA 3O4LB 4TULH 3AS3A 4OI7A 3P4MB 4QRPE 1YNTB 2JJTC 1R6VA 3EIFA 1JNLH 3CFKA 4ZS6D 3HZKB 2CKBH 43C9B 2CK0L 4RFOL 3L95A 1P2CB 3SJVA 4G6JL 1IC1A 4N5UA 5I30H 2EKSB 5DQJB 5DRNA 4XAWL 3PWNA 4X4XA 4UZGA 2EIEA 2XKNB 3T1FA 3U36B 3OB8A 3UXFA 1T7XA 5I73B 2W0PA 3GBML 3SY0B 5DJXA 4ZXBC 1WAAA 3BEVA 3OX8A 1I7TA 4Y16B 4PJDE 4LLMB 1MH5A 3H3PL 5DHVH 1LGVA 4U1LB 1SEQL 4PGEA 2P5WA 2C7UA 5IHZB 1N7ML 4O5LL 1RFDL 4MQXC 4YBQD 3DUUA 1ZS8A 3IB4A 4MNQA 1K2DA 3CU7A 2VLME 4H8WC 1NDGB 4R90L 1FYTE 1JHKH 1PZUB 5LKNA 1DJSA 4JCMA 3MLUH 1Q8MA 5J0BA 4XNZC 1MVUA 2GK2A 3QEUB 1NDMA 5FGBA 3HRZB 2HMID 4EI6B 3BJ91 3H8NA 2AEWA 3G5ZA 1ORSA 3HI1B 3ULVL 1JGVL 1KIQA 1RJZA 1MCDA 2D2OA 2OTPA 1UACH 5IBLD 3ZTJH 3LKPB 5KW9L 2AXJA 3DI2B 4LVEA 3WLBB 3VRJB 1NH6A 4H25A 4ENEC 1D5XB 1Y6NR 1U8JB 2A6DB 5HGDA 2VXSH 2L7UA 3SE4A 5D72L 1MJ7L 3V6OC 1RUMH 1AJ7H 2YUVA 3QQ4A 3MROB 1L9NA 1UWGL 3TNNB 3P4LA 3WN5A 4KKLC 2EDQA 2EDDA 3LSOB 3ILPA 4MCZB 1GVIA 4MJ6B 3U79A 2G5RA 2BSTB 1UKTA 2X4TA 1OQOA 1T5WA 5D1XB 4YFLI 4N9GA 4RA0C 5ISZD 5KN5A 4H0GA 1NFIB 2MKWA 4EI5A 1IAKB 5D7SH 4GBXD 1SJEB 2YR3A 4YHYC 4BQ6A 2YA1A 3DBXA 3IU3B 4I18B 1JRHI 4KQ4L 1AH1A 3L7FB 2DQHH 1E4XH 2G2RB 2VDPL 1LP9B 4PJAE 4FQXB 4K94L 2CDFA 5D7JD 1S3KH 1ZKAA 2RFXB 2DMCA 3T1WA 1GC1H 25C8L 3VXQA 4G7YH 5J9PB 4XX1G 4X4YA 3FZUD 5D8JH 3ARGC 3SOBH 4Y5YB 4WV1A 3ULUF 1A9BA 2A74B 3HFML 4PD4K 4MX7A 2B1HL 1QO3B 3CFCH 5F3BB 1A14H 4NC0B 4K7PH 1XZ0A 4QHUA 4TSBH 3V4VL 4NOBA 5GSVB 4P57A 1TTGA 4F7CA 3T65B 4OB5L 5A2IH 1KOAA 1R3LA 3GJFK 2BOBB 2GI7A 3OJDA 4GG6B 3OKEB 3NFNB 4JQIL 4N90E 5D1ZA 4FFVC 4K9EH 4JPKH 5EA0L 1FNEA 2IFFL 4PJEF 3WL9B 4XCNA 4GW5A 2ADFL 3QEHA 4PJFE 3DVNA 5CEZH 4P2OC 2ZCKH 1MLBB 4G8FA 4ZSOE 2A0LD 4N5EC 2AP2A 3MRKB 4P4KC 4Z7VB 5AWNH 5I1GL 3O6KH 4ZUUA 2GUOB 4J2XA 5ENWB 2NYYC 5IGXL 4JFXB 4U1HA 4JCLA 4PJ5D 3GJEA 4NP4H 3VWJC 3CFKB 3GGWA 5DRZA 3KWWA 2VXUL 3PP4H 3LEVL 3L95B 1D7FA 4TOYL 2GJ6B 1FVCA 4WWKB 1EZVX 4JFQA 5EORL 5F7EL 5GRUH 5DRNB 5BVPH 5K59E 4X4XB 4M48L 2VAJA 4J6RL 1FFQA 1QKZL 3QXTA 4M5ZL 1UGNA 1NGQH 1OP3K 3JXAA 5GJTH 3BEVB 3OX8B 4HUXA 4APQC 1I7TB 4WW1A 4JRXB 1MH5B 3OAUL 4M6OL 4YUEL 4HH8A 4PGEB 1CXLA 3WJLA 2KBGA 4X7TA 3BMVA 3EDKA 1EEQA 1M71A 1ZS8B 4MNQB 1K2DB 2IGFH 5E8NA 4L4TD 1YEFH 2QSQA 1OOAA 3IFLL 4PJCE 1IM3A 2R1XA 5DD5L 3UYOD 4HEME 2DQIL 1S9YA 3OGOE 1MVUB 1U8IA 4JHAH 2R0WH 5CEZD 3WMSA 1NDMB 2AJYH 5LGKA 4UT7H 2BSED 5A2KH 4Y1AB 5EU7C 5E03A 3Q48A 2DL2A 1D9KC 1RJZB 2DM7A 2F54A 4KK5D 1JF1B 4NNXB 1YYLH 4E41D 3IJHB 4H25B 1INDL 2GEEA 5F9OL 5HGDB 2FJGA 4M6MH 3T04D 3TBTA 3VWKC 2DN7A 3QQ4B 5FKAA 4JLRA 5GZND 5FA4A 1B88A 2YPLE 5BRZE 1CE6A 3HUJE 4JQXC 4OUOA 3WN5B 4XMPH 3S6CA 3ILPB 3PUCA 3N1PC 1YYML 1T03L 4U7KA 1MFCL 5E0QA 3BDXA 3PABA 1T5WB 4X7SL 1EFQA 5LJYH 5BS0E 4J3XA 4JM2C 1KEML 4WTWA 4I9WE 1F2XK 1CICC 2GITA 4NM8L 4EI5B 1WCQA 2APBA 4R96B 5F21B 4POYA 1URLA 3TVMD 1OWWA 3ARTA 4NYLB 3DBXB 4XHJD 4BFGA 3H3KA 3F7RA 3BQUC 4P9MH 3GSOA 4MLIA 2YUZA 3DPBA 1EJOL 5IMLA 3PHQB 3R8BB 3I84A 4HLJA 5IT2H 4NHCH 3VXQB 3K46A 4PJHB 2CIKA 3MRBA 1A7NH 4IDLA 5HYQA 4X4YB 1ND0A 4DEPB 5TE4H 3ZKXB 1VADB 5IVZA 1A9BB 4L5FL 5I1EH 4MX7B 1B6UA 1RZJL 2P47B 2HT3D 4F7PA 1XZ0B 4Y2OA 1SM3L 1U8NA 4Z7UF 4KZEH 3DURB 2DBLH 4PJGE 4P57B 1JNHA 4F7CB 1GIGL 4RGOL 3GDBA 4MZ3A 1GSMA 1R3LB 1XIWD 3OJDB 3OR7A 5E8DH 1MCPL 1KCUH 2JCCE 4KMTL 5D1ZB 2Q8BH 2XTJE 1E4JA 3HI6H 1FH5L 1FNEB 5DC4B 4XCNB 2FECL 3FFCD 4GW5B 3OAYK 3QEHB 2YXFA 5IQ9A 3DVNB 4JFDD 4G8FB 1I8KA 5C2BH 4YDLB 4MA1B 4PJBA 3DETC 1G7HA 4Y4FA 4F8QA 5I8KL 4U7MA 1CD0A 1V8HA 3G04A 1CG9A 3G6JA 4ZUUB 5CZVL 4PP2B 4QHKJ 5CJBA 4PJDF 3ZYJA 3QIWA 4U1HB 1NCDL 2QADC 3CLFL 3GJEB 2VR5A 2W38A 3UTPE 1KB5A 3QUKB 3GGWB 5DRZB 3KWWB 4L9LA 4X5LA 1FVCB 1RPQA 4DW2H 1MJUL 5IFAH 2YWZA 3S8WA 2AJVH 2A6KA 1F02I 4NWUL 4EIZC 3JUZA 3U4EB 5C3LD 2SEBA 1AIFB 1GGBL 2BMKA 2KH2B 4Q6IB 5ALBL 1JBJA 1D5ZA 2UWEA 4HUXB 3QWOB 5GS0H 3GSNL 4M03A 4WW1B 1L7TL 4U1SA 4UT9L 4NPYA 4DCQB 1ZVSA 3TA3B 3WE6A 4X7TB 1BFSA 1SY6A 1HHIA 3T0ED 2D4FA 1IC5H 1T0PB 2ATKA 4HDIA 3BKJL 4KPHH 5E8NB 1IAMA 5LXGH 4QKXB 3OTTA 2R1XB 5CJXC 3IDNA 1OT1A 1S9YB 4F37F 2O5YL 2YXMA 1RUKL 1TJIH 3IVKA 2HFEA 3BZEB 4BQ9A 5FGRA 1MFEH 2VH5H 5HDQH 2NCMA 5IUSA 3K3QA 3ULUH 2F54B 2JJVA 4KY1L 1FCGA 4HIXL 4YIQA 1KFAL 3QCVL 2R23A 2YD2A 3LKOA 1FAIL 4X9IA 1UZ8A 2MPAH 5F97E 4U6HA 1CZ8H 3VH8A 2FJGB 3TBTB 1EGJH 1J1PL 1MRCL 2CLRA 2GK0B 5FA4B 3BYTA 1AFVH 1CE6B 2ZWLT 1TQCC 3WXVL 4YGVA 1SBSH 3TYGL 1L6ZA 5HDBE 2D0HA 3S9DB 2ORBL 3TLRA 5CZKA 1A1OA 3RZCC 3SKNB 3PABB 3W5MA 1BBJA 3VXSD 4P4RA 1J87A 5GGUA 4LVOB 3RPIA 3L5XL 4JFFE 1XF1A 5GS0D 4LPYA 4PRHD 4XBGB 1FC2D 1HEZA 4KTYA 4H8WL 4HD9A 4S1QL 4HBCH 5DMGD 1A22B 5B4MD 5CFHA 4Y2DD 2AGJH 4PJFF 3QDGA 4Z5RA 3I85A 4MA8L 3UX9B 4QXUL 2CIKB 3MRBB 2ZPKL 5HYQB 1ND0B 5E08H 5IVZB 2UUDH 3IFOA 3D1MC 3OV6A 1EEZB 3NTCH 3UZVB 2FATH 3IKKA 5ILTH 4NQCE 4HCRL 2DF3A 4I0PA 5F72S 5K9JL 4C56D 4HUVA 1T0NB 5E5RB 3WNKA 3ULUD 1G6RH 1O0VA 4P0DA 4R97B 2CKBA 5CJQH 1LDPL 4Y19B 3TCLA 3MBED 1R5IA 1FC1A 4QT5B 4U1GB 3VXRE 1OPGH 1ITCA 3IDYB 1QBMH 5J3HC 1BZ7B 1I8KB 1YJDH 4KI5F 4P46A 1MCOL 3ZDXF 2X4UA 4PJBB 4HS3A 1BJ1H 1G7HB 1K4DA 4GBXA 1UWEH 4NZRL 3G04B 3G6JB 4A6YA 1K8DA 4NGHH 4U7SA 4ELME 3QIWB 3SDCD 1S7UB 1WJ3A 5DHVA 1A7QL 5C2UB 4OD2A 5DUPL 2OX5A 1KB5B 5FB8A 2AJXH 3DUSB 5L88L 1A3QA 5D7JA 1MQ8A 5EO9A 1NQBA 1KJ3H 3KDMA 1G0YR 1XGUB 5DMIL 3SHSA 4NBXB 4OZFA 1DN0A 3JZ7A 5DFVD 1T66C 1HKFA 1VFAB 3BRGC 4S0SD 3QEQA 2A6KB 2CK0H 4O58H 1G7MA 1NEZG 1X5KA 3GI8L 4LDLB 2SEBB 1MF2L 2BMKB 5FUZL 2BZDA 1D5ZB 2EDEA 4PY8J 2X89D 4ZDHB 2UWEB 4I5BB 4NO0D 4LU5H 4JG1L 3IRZA 4IOIA 4JFZH 4DUXA 5J11C 3MZGB 4U1SB 5IMOA 3MGTB 4L4VE 4NPYB 3IGAA 2PTTA 4IOSD 3WE6B 2IPTL 4IRZL 3NAAL 2ED7A 3RI5K 3DYMA 1HHIB 1L9MA 4NO2B 3H3PH 2AXGB 2ATKB 5DK2A 5E95B 4HDIB 3QIBD 3VXUA 2Z93A 5EZOL 3IDNB 4OLYL 3CSBA 2UV3A 1YQVL 1P7HL 5CKAA 5B3JF 3IVKB 1IAIL 2HFEB 5L2KB 3N1QC 4HFUL 4JY4B 4TNWF 5IK3A 2AK4E 4PJ5A 3U4BL 5CUSL 5DVKA 5K9OA 1MCQA 4U1MA 3UJTL 1C12A 2YOCA 5GGVH 2R23B 3L7EA 3UPRA 3LKOB 1UZ8B 5FUCE 4U6HB 3VH8B 1UEMA 4MZ2A 5I75B 4NQDE 4KTEL 5GJSH 1IGTA 3LH2H 3NZHL 3NFSL 5BO1L 5I1CL 3PGFH 5FEBA 4HMCA 4N68A 2DD8L 4M43L 4XVUC 4WFEE 4D9LL 4QHKI 2ARWA 1P5VA 1A1OB 1WBZA 1UWGH 3GMOA 1F11A 3VFTA 1BBJB 4FQ1L 1CF8L 4P4RB 3PWPA 1I85A 5GGUB 3WYRA 1J12A 3RPIB 3P73A 2HRLA 2ITCA 4YFDB 1KLGA 1HEZB 5C09D 4PR5A 4W70A 3BP6A 2R15A 4G6AC 4R2GC 1S78D 2IMNA 4OZHE 3BD5A 3LQZB 4KJYA 4Q74A 3QDGB 5EUOB 4Z5RB 2QSCH 3KPSE 4O2CA 4MXVF 4QOKD 1WC7A 2EIZA 3TC9A 4A2MA 4K94H 4X6CE 3QCTH 3SGJA 1F3RB 4JGJA 1H3PH 4OGZA 3EUUA 2IFGA 3LOWA 2OS7A 4I0PB 4J3WA 1I1YA 3D87B 4HUVB 5JNYA 1XGQA 4M02A 1L6XA 2VLJD 4PJ9A 5E99L 3FB5B 3EO1A 2CKBB 3TCLB 3V4VH 3ULVD 4OB5H 4ZAKD 3MRPA 3D2UA 2I26N 2A6IB 3Q3GA 1VA9A 3HCVA 3U9PH 5DO2C 2X1QA 4P46B 2EECA 2WW8A 2VMFA 2P8PA 2X4UB 4HS3B 5CGTA 1K4DB 4LNRA 4PJXB 1QRKA 5AZEL 4DOHE 5IFHL 1C8PA 4A6YB 4AH2A 1K8DB 3ZKMD 3QUZC 2OXGA 1YN6A 1WZKA 4MDIA 1NC4D 1W0WA 4YE4L 5I1GH 4UQ2A 2BVQA 5FB8B 3HMXH 5DJZA 2IAMC 2O5ZH 1A21A 4J23A 4OSUH 2VL4A 5EO9B 5HVHC 4V2CB 2DQGH 1S7VB 3KDMB 4GAGH 4FQIL 3I6LD 4OI9A 2NZ9C 5F88B 5D6DC 1DTUA 1WIUA 1DN0B 4OZFB 5HI5C 1WEJH 3QEQB 3RNKA 5E6YA 3LEVH 3D69A 4YC2C 1J8KA 5D2LA 5J13C 2YRLA 4Q6YA 3QUXB 5EORH 5F7EH 1AGEA 4EUPB 1MWAA 1FZJB 1YA5A 2LV4A 5IOPA 1U6AL 3MGAA 2OR9H 3BKML 3WD5H 4ELKA 3W39B 4M48H 4J6RH 1KG0A 2NY5H 2C3HA 3D85A 5EO1A 5IMOB 4XGZA 1BF2A 4Z0BH 3STZA 3S88L 3JVGA 2DMBA 4WFFE 2H8PA 3X3GL 2F5AL 4RMRA 3OAUH 4YUEH 5DK2B 4JFDA 3WFBH 3VXUB 2Z93B 2HT4C 2V7HA 2GHWB 2DQFA 2IALA 1EAPA 4MB3A 3RTQD 1KT2A 3ZHDA 1LO4L 3O6LH 3IFLH 3KVQA 1VFMA 4C83B 2ZJSL 5DD5H 1QLEH 1WT5A 5K9OB 2WBJC 1BQHG 1T80A 2A1WL 3VI4E 1C12B 4KXZI 1DQDH 4YAQB 3C6LC 1TVBA 3MRMA 4MB4A 1B2WH 4FMFA 4Y4HD 3QA3A 4XI5D 3HLAB 5SX5H 1BZ9A 3MLVH 1IGTB 4D0CA 1INDH 1DSFH 5HBBA 4YXLL 5F9OH 5FAAA 2QV2A 3QUYA 3S34H 5FKPA 1WBZB 1BIHA 2VLRD 4IIQC 4KJPC 5JXAL 4WRLA 4RDQG 1F11B 3VFTB 1A7PH 1QBBA 5DXWA 1EVTC 1LK3H 1YYMH 3PWPB 4HK3J 2YK1H 5MI0B 1MFCH 2C4XA 3P73B 4PGBA 3QFJE 2ITCB 4JDZB 1UZ6F 1IAOA 4HGWB 3T0EA 4HIHA 3D18A 3FQRA 1NCUA 4PR5B 2DIJA 1P4LA 2R0ZL 3FO9B 3BP6B 2J4WH 1DQLL 3ZKNC 1S9XA 2E7LA 3WIHH 3RBGA 5KSUA 5IBTH 4WUUE 3UYPA 5CMAB 3TJEH 4O2CB 4B53A 2YD5A 1ZOXA 2AQ2A 2YD7A 3OZ9L 5F9WB 3L5WA 1BJMA 2P5EB 4OQTL 1JVKA 1KBGH 3KPRA 5DQ9B 3WCYA 2X40A 1BWWA 4JRYD 1IE5A 1QBLL 4D0BB 4PJ8D 1MHPH 2G5BB 1T2JA 4K71B 1A6AA 5JNYB 1VSCA 8CGTA 3LHPL 1KJMA 4PYHA 2VDNL 4X9GA 4PJ9B 4FQLH 1RZJH 4XXCC 3BVNA 3EO1B 4OD3L 2A9MH 4CW1A 5ADOL 1YY9C 4XVJH 3OKYA 2XFXB 3MRPB 4ZS7H 4RX4D 1ZHKA 3BN3B 1KB9J 2X4PB 3D2UB 2R0KL 1NCWL 4K3EH 5HHOE 3Q3GB 2OTUA 1ZMYA 1CWVA 2HLFD 3PIQB 3HB3C 5CBAA 3QCUH 3VXSA 2OJEA 1FIGL 5ID0B 4LNRB 1SHMA 1LEGA 2AI0H 4AH2B 3LMJH 1F90L 2OTWA 1RULL 4PRHA 3SO3B 1FFRA 1PKQA 4PJ7E 3PG2A 4MDIB 5F7KC 4LVHC 1W0WB 1HDMA 3K2UL 4UQ2B 2BVQB 3BRFA 4MNHB 4Q9CA 5DJZB 2OBGA 4LASH 4Z7WE 3PV7A 3ARBD 3QO0A 3TZVD 4PV8A 3BH9A 5JW5A 2BFVL 5GXBB 1CLYL 3CDGA 4XNMB 3RNKB 3CU1A 2AABH 5DD0H 5AAMA 5D2LB 3BZDA 3KYNB 4KJQC 5JMRA 5BW7A 1GGIL 4U31A 3VW3L 1MWAB 5JO5B 3C5ZD 4NWUH 2L4OA 4ELKB 2C1PB 3GB7A 4R7DB 1LHZA 5DJDA 3E1F1 1KG0B 3D85B 4XGZB 5ALBH 3T08A 4ALAL 1N2RB 5BV7B 3M8OH 5B22A 2HRPH 1NGYA 1HIMH 2H8PB 3LVEA 3BE1H 1EGJA 3GSNH 3SDDC 2J6EA 4F15C 1L7TH 3KR3H 1RV6X 3CVHL 4RBPH 3MA9H 1CTOA 1OGAD 4GMTH 4PJEA 5C71A 4PLKC 5DYOB 1LE5B 2V7HB 4NQSA 3PL6C 4JM2F 1HYSD 2DQFB 4G6FD 1EAPB 2IALB 4Y5VB 4E42A 1S7QB 1KT2B 3G5YB 4HULB 4G6KL 3K4DA 2XRAH 3UBXG 1QFUL 3VI3F 3BP7B 4N0FB 1KN2H 2J1KA 5SWZE 3V4UH 2ZUXA 4DJMA 1TVBB 1VENA 4S2SA 2BOCA 4U1KA 1I9RH 3A6BH 3QA3B 3QUMB 3ZE2E 2VDLH 3B2UD 4HIXH 4DAGL 3LCYA 3ROOA 4D0CB 2FEEL 5CKGA 1FAIH 5CCKH 1IFHL 4QTIH 5HHQB 2I5YH 3EO9H 1JGEA 3QUYB 4U6YB 1BWMA 4K7PY 3IU4L 3QNZA 5DURD 1YDPB 3WXVH 4J1UA 1UKSA 1G7LA 2DIBA 3RWJB 1VGEH 5DTFB 1BGXL 4DK6A 3HE7A 4DGIL 3F65A 2FL5B 4PGBB 5GS1C 2MQCA 4NFDA 7CGTA 2P49B 4HIHB 3RWFB 2X7LA 3D18B 4BSWB 1P4LB 4KHTH 4UOW1 3DVGA 4NKIL 3S35L 4RIRB 1IILE 4EVNB 1JZ6A 4P99A 5CHNA 2UVEA 2JB6A 1ZAGA 3QRGH 3U1SH 3PGDA 4J8RA 4M3JA 2W92A 3MRQA 4H8WH 4WCYL 4S1QH 5DLMH 3RIAK 4GLRH 4GQ9L 3MRFA 4JO2L 4UU9B 3KPRB 3DX7B 3VXOB 2M1KA 3QDMD 4UILL 4MA8H 4L8CA 3E6FA 1LVEA 3U0TA 2NY6D 5KVEL 5ERWB 2EC8A 2ZPKH 5LAXA 3FONA 2XTJC 4QRTA 2OJZH 1A6AB 1V3MA 2OR7A 3BVNB 1OY3B 3NABH 4HCRH 3S37X 4CW1B 1A02N 2Q8AL 5K9JH 2UZYB 1MFDH 4QY8A 1JHTA 4YK4C 1E6JL 1UENA 2WWKO 3O11A 4N0UE 1ZHKB 1X7QA 2EDXA 4NZUH 1BX2A 4F9LA 2OTUB 5CBAB 4AEFA 3QXWA 1Z9SA 1O5DT 3ROLB 3NIGE 5J1AA 3ARSA 5ANME 3WS6A 1LEGB 5DJ8A 5C07E 1GAFL 4HKZB 3BH8A 2OTWB 3ARVA 4YHKL 5D2NA 4G7VH 1MCOH 2FB4L 3T3ME 4ZXBD 2WUCL 1HDMB 5IB3A 4HF5H 2CUIA 3B9KA 3CXHK 3P0VH 1WZMA 3NCYP 2F15A 4NCC2 3GSWA 3QO0B 1NFDE 4NRZA 1HH6B 3DRQB 2XZAH 3VA6A 4PV8B 3BH9B 4MQXD 5L88H 3BSZL 5JW5B 5MEPB 5D7IE 3CDGB 4IDJL 2OP4H 4LCYA 5LWYL 1MHHA 5FHBL 3OSKA 5DMIH 5HYSG 5EBLA 3C2AL 3K8KA 4GKNA 4HXBH 1B4JL 3LKQA 3VI4F 2EDNA 1GHFL 3TBSA 3TF7C 3PQYA 4UDUA 4HWEH 4YHML 1CTNA 4JDVA 3GB7B 1BHGA 4RDQF 4Z7UA 5FUZH 3RWEA 2BCKA 4LHUG 1KJVA 1NGYB 2NY3B 3CMOH 5TGBA 1GYAA 3DV6A 1G9MC 1CR9H 3CVIH 1N59B 1OAKL 1VERA 4HC1L 4ENED 2VQ1A 2R9HD 2WP3T 5D7LE 1D6VL 2YMXH 2QQNH 1JJUA 2D4DA 4JPVL 1LO5A 1JPFA 4P23C 4KKLD 4PRPE 4TSAL 3SO5A 4E42B 5GGRA 2GJJA 3LDBB 4B50A 5IBUG 4Y7MA 2LVEA 2G9HB 3ARYA 4ONHA 5FO9A 1IAIH 1RIHH 1N6QL 5CSGA 4HFUH 3ORJA 3W0WA 4PJDA 4P59L 5CIPH 5FA3A 1ADQA 2B0SH 4S2SB 2BOCB 5D1QC 3UJTH 1QPXA 2YD3A 4HFWA 1IZJA 1BOYA 1DBAL 3EKCA 5IESH 1QSFE 3GSRA 3IS1X 3VG9C 2YPKA 1HQ4B 1AXTL 4OM1H 4WEBL 3WXWH 4LVNC 4BH7A 2D7QA 5T1LA 4O9HH 2N56A 3QDJE 1JN6A 1SEBB 4QRRB 4X4ME 4J1UB 3ARGD 5DUML 4CNIB 35C8L 4N8CL 4LCWD 3HE7B 4WI9A 5HGGS 4U1JA 3VGGA 1A3RL 1H5BA 2JB5H 3W9DA 3DVGB 1ACZA 4S1DC 3UYRL 5HYFA 5CHNB 1CD8A 2DQUL 2JB6B 1PKOA 4BZ2L 3PGDB 4J8RB 4MNGA 1JMXA 2DQEH 3MRQB 5I71C 4FFVD 1J7VR 2EIBA 4R26H 2OI9B 4ZOAA 3ZYOA 4LEXL 4QXTB 3THML 1PG7X 5B8CA 3SGEH 4P2OD 3E6FB 4JY6A 4WI4A 1YEEH 4N5ED 1YEHH 4P4KD 5LAXB 2DWDA 2V17L 5C8JA 1FZKB 3WSQL 5T3XE 4QRTB 2CD0A 1QNZL 1CQKA 3PDGA 4MSWA 4NKDA 5KSAC 1DQML 3HMXA 3H42H 2N1KA 2NYYD 4MJIB 2NW2A 4Z7QE 2LU7A 4Z7WF 5HYJD 3TWCH 4JY5L 4Y5XA 4N0YL 5HHXL 5IROA 1JHTB 4LPVA 1EFXA 3VWJD 3WNNA 3C8HA 4EXPX 2CO6B 3BKYL 4HIJB 1X7QB 5EIVA 4KZDL 3L3KB 4ODVH 4TQEH 4H1LG 3D39A 4I2XE 4OZGF 3S37H 5J1AB 5DJ8B 3P4NB 2Q3AA 3K0WA 2AAVA 4FTVD 1Y6KR 5D2NB 1ZT4B 4DFHA 4OIBA 1NGXA 5AZEH 4M7LL 5IB3B 4APQD 2VAAB 2AXFB 1MIEL 3B9KB 3MRIA 1R3JA 3GSWB 1UJ3A 1I7RA 1HH9A 4RFNB 2MWCA 3BZ4B 4YDIL 4LPCA 1KCLA 2AJSL 3AVEA 2PETA 4PJFA 5EBWA 1FFNA 2YBRA 4HS6B 4FQIH 1P69B 4JRYA 5F1OB 4PJ8A 5INCA 5EBLB 5SWSE 4QXWA 3LKQB 2HJFA 3TBSB 4CDGC 1ZGLM 3Q1SL 4NSKB 4LOUD 1S7XB 3RDTC 2FBJH 3IDMA 1D9KD 3NPSC 1ZEAL 3O2WH 4NKOA 3W81A 1IGCL 5TGBB 3ZE2F 3MRGA 3BKMH 3DV6B 3LZFH 4LHQB 4RX4A 1PFCA 6CGTA 1NBYA 4OCRL 2VQ1B 1ES0B 1QLRA 4P49A 2YD4A 1AGFA 3NIDF 2YC1B 1LO5B 1JPFB 5F71A 2DQJH 5GGRB 1I8LC 4OLVL 3FKUS 3LPWA 5F7MC 5F93C 3O45B 4BK4A 4P3DA 4ONHB 3RPKA 4JM2D 1J5OH 2NNAB 2CLZA 3W0WB 3BPOB 4PJDB 1TCMA 1CICD 1LO4H 3ARBA 5FA3B 1YY8A 4MXQC 1MVFA 5LGJA 2BNUB 4NFBA 1IL1A 3WIHA 2W1NA 3IDXL 1MAJA 3MGOA 4HFWB 1S5HA 3HG1A 3MUHL 5D70L 3GSRB 5TQ2L 5E4EB 4HV8A 5HHME 2H3NA 3U2SA 1FYTB 3QBTB 4BH7B 2BRRL 5T1LB 2UYLA 1ZT1A 1JN6B 1BVKB 5ICYA 5J89A 4YXLH 2VDML 4O02H 3QAZC 5FCUH 5FGCE 3GK8H 4MJ2A 3UP1A 4Z7OE 5JXAH 3AXLB 4XNXH 2A77L 1FVDB 3MUJA 4EN3C 3SE9H 3WS3A 3W9DB 4Q9QH 1OGAA 5D96C 3U0WH 1J0IA 3JBG7 1YEIL 4MNGB 3NH7L 5BRZA 2Y4SA 5TQ0L 5EU4A 1GJIA 3NIGF 3P40A 4G8GE 3FO0H 4OLZH 5B8CB 3KPMA 2HG5A 1JZ5A 3OPZL 2GY5A 2VWEE 5C0AD 2WM0A 3TIDA 1YMMD 2XWTA 4M9OA 3DETD 1ZSDA 3OZ9H 5EU3A 3T3MF 1NCCH 5C0ND 4MA3A 2UZIL 1NAML 3L3IA 2HKHH 5JOPD 4MSWB 3K80A 4OT1H 2B1AL 2AEQL 2I24N 3UROR 2NW2B 2CPCA 1PG7H 1QBLH 1WISA 2QADD 4YX2H 5JR1L 1RI8A 4HPOL 1EFXB 3ZE1F 5IEHB 5D7IF 5JXEC 3MXVH 3HPJA 4NJ9L 3D39B 4NCDA 3MYZA 4OCYL 3HR6A 2GIYA 1DANT 4GJTB 2MCG1 1NCWH 5I1IL 3REVB 4ZOCA 1W2KT 2EKJA 4LSPL 1U3HC 1SJXA 2Z92A 1RULH 3MRIB 5I8EA 2Y5EA 4Y4KA 1JZ7A 1BJ8A 1R3JB 3B9DA 4BH8A 1UJ3B 1I7RB 3WBDA 4FZ8L 2XXCB 3LEXA 4YEEA 1ZHBA 2BERA 4UNTA 2NY0B 4PJFB 1FFNB 5CAYB 2YBRB 3BW9A 1CFTA 4XP9L 3WO3B 5GGVY 2HH0L 3AREB 1UM6H 5DJAB 4YFEA 3IDMB 4FP8H 2CO7B 1L0XA 5TPWL 3O2DL 1MY7A 4XVSH 2PYEA 3RWGA 2A2QT 5E2TH 1CGSH 1NCAL 4P2QD 1IBGH 5EFIA 4ALAH 3BPNB 4M8VA 1NAKL 1F4HA 1CGXA 1C08A 1AGFB 4FFZH 3CVHH 1KC5L 4LSVL 5HYIA 4L8SA 3N9GL 3DX8A 4WVRA 3FCTA 4U1IA 1H8NA 3O6FC 4CJ0A 4P3DB 3SDAD 2Z91A 5DHXB 5MERB 2CLZB 4G6KH 3BP4A 2F58L 5IB5A 2BNRE 1HK6A 5LGJB 3C09C 1IL1B 4IRJC 2HT2C 4CVZB 1NMAH 4OCMC 3MGOB 3HG1B 1FO0L 4NQTA 4YZFE 4HV8B 2H3NB 3BIBX 4YFLF 4JJ5B 2YKLH 3UJIL 3MRCA 4L29A 2NY1B 4PPTA 3QQ9C 1ZT1B 4NRXB 5ICYB 1J8HE 3QSKB 5EC2A 3VGEA 4FQ2L 2IEPA 2OCFD 2DDQH 3OGCA 4ZUTB 5JIPA 1G9ML 3KYKL 1EXUA 3DI3B 2JELH 5I15L 2EDTA 1EO8L 3WS3B 1BGXH 3OR6B 4JO4L 3VG0L 1T6WA 4WI8A 1FL6A 1KIPA 1EA9C 5DJYA 2AV7A 4BFBD 5BRZB 4NKIH 1QPPA 2NXZB 3HUJB 4OZIE 5EU4B 2AV1A 1JYNA 1NAMB 1S8DA 3KPMB 3DYPA 4Z7VE 3TIDB 1MRFH 4WCYH 1T7YA 4PS4L 4E5XA 3H0TA 2XWTB 1PG7W 5EU3B 1E4WH 4GQ9H 3DROA 3ARDC 4JO2H 5C0BA 4B5EA 4MA3B 5IVXF 1BFOA 1I1AC 1R5VB 1JI2A 2W0FA 4JFFA 3JTSB 3D48R 2IH3A 2PO6C 5KVEH 4XT1C 4WO4A 4K3GA 1F8TL 2F5BL 3B83A 3VGAC 4HUUA 4R4BA 4NN7B 3J7HA 4K3HA 4UV7H 3SJVE 1U8LB 2YD8A 5C0DB 4HJ0C 1F3JA 3PE9A 4C4KT 1FSKC 1T66D 4P5MA 4GS7B 2P8MA 1TTUA 1OVZA 4G3YH 4P5TA 1GGCH 2AJUL 1X5YA 1WAAE 2ARJQ 4ZFGL 2XY1A 5F7NC 2W65B 2WIIA 1GAFH 1OP3H 2Z92B 3QEGH 4TUOB 5I8EB 2P5WE 3VGDA 4WI2A 4Y4KB 1TTFA 3LIZL 4NQVA 4Q2ZA 4BH8B 1MUJA 2JCCB 3VJ6B 5IQ7H 2KZWA 3PWJA 3C08H 3LEXB 3B9VA 4XTRD 4MNQE 4PV9B 3VCLA 1I8IA 1ZHBB 3OKDB 1IGFH 4P2OA 5BCAA 4KH2A 5IVOA 4M7ZC 3WUWG 1N0XH 1JI1A 4MYWB 1Q72H 4P4KA 3V6FB 3BW9B 4KV5F 3BSZH 1NC2D 1CFTB 1CDUA 5E5UB 3NGBC 1A6UL 4IDJH 3W2DH 4JR9L 1QR1B 5F7FA 1BVLB 5LWYH 3INUL 1IKNC 1J18A 1P53A 4BKLA 1AE6H 1NEZA 5CIPA 5HGAB 3JTTA 4FFYH 1JGDA 5E00A 3R0MA 1GHFH 3VWJA 4YHLL 3V5KA 2X1WL 2CSPA 1KTRL 1WCBA 2PYEB 3RWGB 3QJFB 1MNUL 1U8HA 4NZTH 5EFIB 2XKUA 5HD8C 1DBKL 1C5CL 8FABB 2MCPL 3QXVA 2ZCHL 4HWZA 2R1YB 1T1XA 4QRUB 2E7CA 4L8SB 4R4NC 4XVUD 3DX8B 3H9ZA 5HI4C 3QJHB 3HC0B 3NZ8A 3N06B 3EYSL 4AIXA 4TSAH 2Z91B 2BXZA 5I2IA 3BP4B 1YQ2A 5IB5B 4L4VA 2CRZA 4JQVC 3O3BA 5I8OL 3OG6B 3SEPA 5C0CD 2QQKL 3HNTH 3CSPA 1KCVL 3K1KC 3P9WB 4MCYA 3AS1A 5FYLE 1MCWW 3G6DH 4NFCA 1QRND 5ECJE 4OCSH 3MRCB 1OP5H 4OLXH 3G6AA 4NWTL 1LO0L 3EDJA 1JWSB 3SGKC 1CFSA 1IM9A 3DO7B 2AK4A 4G9FE 1NUGA 4WEBH 3D3VE 2NY7L 4ZODA 1EXUB 3KXFA 4RGNC 3FQUA 4CGTA 4UTBH 3O4OC 4TN9A 4XVTH 35C8H 3RGHA 4JZJC 1ODAA 3WIFA 1QA9B 5ICXB 3KJ6H 3ZDYF 3VWKA 1M7DA 1FL6B 1A3RH 4JGUA 1JNJA 5DJYB 1SVZA 1RZGA 5EZIL 1G9NC 1UYWH 4P3WA 3UYRH 2VN4A 1S8DB 4BZ2H 2MHAA 4ODTH 4WUKH 5IHUL 2CR6A 5DO2D 4JM2A 3OKNB 4E5XB 5FYKL 1CICA 3CNKA 3SE3C 4LEXH 4QRPD 2VQUA 3DROB 5C0BB 1BFOB 3CJJA 2I9LA 4JFFB 1MIMH 4LP4A 3QUZD 5CD5C 1UQSA 2IH3B 4ZUVA 1U93A 1KXTB 1AGDB 1ZLSL 4WO4B 3BQUA 1K5NA 2BJML 1QLFA 1T3FB 1IC4L 4HUUB 3SCMA 4DGYL 1XCQA 2IAMD 4I77L 5JOEA 4R4BB 3BKCH 3IFNL 3VFNB 1X5FA 5KSBF 3REWB 2NZ9D 1F3JB 3KPSA 3SBWC 1CFQB 5I74C 5HHXH 5BZWA 5HI5D 4DN3H 3BKYH 1X3DA 1HZHL 5DSCA 3MJ9L 4P5TB 3WDIA 4KUCF 3B8YA 4NQCB 2FHFA 5C7XL 2IBGA 4R7NB 3MNWB 4D3CH 2R0LH 2WIIB 1V7ML 1PX3A 2VXQL 4NQXA 3SDYL 1OAYL 3EYVB 3HRPA 4NQVB 4OAWA 4Q2ZB 1H3GA 1HE7A 1MUJB 4X5XA 3V0VA 3MODH 4DUVA 3KPQB 4M7LH 5TFSH 1E6OL 3NACH 3PWJB 1UEYA 5K9QI 1Q38A 3VCLB 4WFHE 2DRUA 2X41A 5C0AA 2E8YA 2PXYB 4MD5A 1R3KA 4R8WL 4KFZC 1YMMA 1VFBA 4LCCA 2HT4D 5TH2A 3D0LA 5CILL 4KQ3H 2EYSB 4XAKD 4N8VG 4ELMB 1KYOK 1NEZB 5CIPB 3QG6B 3JTTB 2F54E 2ATPB 3HMWL 5E00B 2XN9D 2DQCL 2XA8L 2V2WA 1RZ8A 1JRHH 4KROB 4EDXA 3Q1SH 2BVTA 2P45B 4L3EA 1WCBB 4WHYH 3UTTA 4OCNC 3C6LD 2R29L 1MAMH 3BDYH 2CQVA 1ZEAH 4DVRL 1F6AB 1U8HB 5D6CA 3MUY1 3U9UA 4UT6H 5I66A 3VE0A 4RWYH 4OCRH 5HPMB 2Y72A 1EX0A 1XGPA 4LRIC 2DI7A 3VRLE 4ZPVB 3KJ4C 2FECI 4M7KH 1UVQB 3P11H 4KJPD 3NZ8B 1BVZA 5JOFA 2XV6B 4YNYB 5DK0A 1XH3B 4LSSL 4L4VB 5DK3A 3O3BB 3BGAA 1J0KA 3GMPA 1CDJA 3HTLX 1ZA6B 5GISL 4MCYB 4YHOL 4LSUL 3ZKND 3PDOA 1ZHNB 4WEMB 4OZIF 4MVBC 2KL6A 4NKMB 1FG2A 3V9FA 2P8LA 4YHZL 4PG2A 2I27N 4PBVC 4K8RC 1B9ZA 4RMSA 3WFEL 4HWBL 5TQ2H 1PQZB 3P4OA 2AK4B 4IRSC 4OJFL 1HINL 5EWIL 4JVUA 1MSPA 5IJVB 1NKRA 3KXFB 4N90D 1A9EA 2VDMH 3X12A 2OL3H 4BQ8A 4S1RL 3WIFB 1I3RA 3MRDA 1FNAA 2VTFA 2ID5A 5HY9A 3IDGA 3VWKB 4I3SH 1M7DB 2B39A 1IEBB 3RUGF 5DGQA 3SDXF 2OZ4L 1EO7A 4LPXA 5E6ID 3HZVA 3RZCA 3EW3B 3V79C 2DI9A 5FECB 1Q0XL 3B9AA 5I18H 3AU1A 1AI1H 4BUHA 3HB3D 1NBZA 3G6JE 5TQ0H 2IBZY 3U7YL 2HKFL 4K7FA 5L0QC 1J1XH 5KZCD 3GMLA 2NX5A 1DLHA 2AK1L 4CMHB 3DGGB 5EU5A 4ZUVB 1TJGL 3BQUB 1K5NB 1QLFB 3MV11 3ZE0E 3SCMB 1XCQB 4ZYKA 3HS0A 3RIFF 4GRWF 2WLYA 1LO3L 3UZQA 2VZ3A 1H9VA 2JE8A 2LE9A 1JYXA 1V7NL 3KPSB 5JR1H 1QVOB 5FYJL 1FL3A 2FGZA 3VDBA 5DFTA 2IQAB 3TO4C 2EDBA 5DSCB 3NN8A 4NJ9H 2W0LA 2UWEE 4KJQD 1F5WA 5L9DL 1LK2A 5B38G 5FO8A 1EIBA 4J3TA 5I8CB 1MCLA 3V0VB 4OAWB 1A3LL 4NUGH 5CINL 5D71L 3P9LA 5DEFB 3SDDD 4NM4L 4K23L 5FDYA 3SQOL 4GOSA 2OMBA 4MD5B 5HHOA 1R3KB 1U58A 3VFWB 2AJZB 3DMMD 4LCCB 3CDYA 4FZ8H 4GLRI 4PLKD 5TH2B 3PL6D 4DOHB 4B7LA 1G7QA 1V5JA 2MMXA 4FQCL 2K7PA 3MV9D 5AAWA 2V2WB 1RZ8B 3TJHC 4XP9H 2LAAA 1FNGA 5TE6L 4EDXB 4L3EB 2A6JB 1HHJB 4ODSH 3UTTB 5C9KA 5HI3C 4DVBA 2YPLD 2WQ8A 3CD4A 4Z7WA 4YBLB 4JKLA 5IB4A 5DC9B 5BOZG 1PEWA 2HFGL 3O2DH 5D6CB 5KS9F 1BD2A 2E7BA 4XBEL 1NSNL 3IFPB 3U9UB 3MLSH 5BS0D 3ILQC 1SQ2N 4MJ5B 2H1PL 3VE0B 5I66B 1NCAH 1FNSH 4OZGA 1NAKH 3JV4B 1GZPB 4GAJL 5IMKB 2YSSA 4JO3L 1KC5H 1E4KC 1DFBL 1R5WA 4I0CC 4LSVH 5JOFB 5DK0B 4L8DB 4JFOA 2G60H 3N9GH 3NCFB 3TEUA 3QPQD 4K3JL 4CMMB 3GMPB 2X6MA 1BQHB 3GZKA 4W6YB 5JQ6H 2VRAA 1OAUH 3PDOB 4PRBA 3QDGE 1QZ1A 2CH8A 2P8LB 1FO0H 3BMWA 2YHGA 4I0KA 2ITDB 3NMEA 5IR1B 3P4OB 3UJIH 3VMPA 3ARFB 3C6SA 1K85A 1UC6A 4MAUL 3RY6A 3UTSD 2ED9A 1A9EB 2XTJD 1FJ1A 4WHTA 5KTEH 1I3RB 1ZTXH 5HY9B 1T2QL 3DGCR 1G9MH 3IDGB 3X13A 5JW3L 1DBBL 4X0KA 4QTHA 4P2RA 2GY7B 3GMQA 5EOQH 3UZEA 4QGYA 3RZCB 3TFKC 2FX7H 4RFEA 5LCVH 3AU1B 4ACPA 4X98A 1NBZB 2IPUG 4K7FB 4K55A 3UTPD 3GMLB 2NX5B 5C0CA 3L3GA 2B4CL 1IAII 4OKDA 5EU5B 3FHQA 1JHLL 4MQTB 5ADPH 2P24A 4XP6H 2H6PA 4NHUA 3D25A 4F57L 5IV2B 1QRNA 4ZYKB 3LKNA 4Z78A 4F58H 4WFGD 2Y07L 1F8TH 4LMQI 5E7BA 2F5BH 3OJ2C 3O41A 4I48B 1T1YA 2XWJB 4MAYA 4Y16C 4O2FA 1TETL 4UV4H 3NN8B 4M62L 5CLTA 2FIKA 2X5PA 2QKIA 2Y6SC 4PLOB 1UM5L 3CMGA 1LK2B 1KEGL 5FO8B 2Y23A 4RA3A 2AJUH 4KUCD 3ZYIA 3MJ7A 1G9NL 1MHEA 1WWBX 4HKBB 3IDJB 4XBPA 3P9LB 2VDOH 4QLRA 5DR5L 4W68A 3RWIB 2DLHA 5I16B 1NFKA 3E0GA 3TBYA 1HSBA 3VXUE 4QHLA 2FIRT 3UJJL 5HHOB 1U58B 3ZTJG 4XXDA 3ARUA 3PNWB 3OXRA 3P30H 4I4WB 1YC8A 1G7QB 4P23D 4PJ5E 2NY2B 2DAVA 2VISB 4KHXH 1RHHA 3VXNB 3QH3A 2IAMA 4JR9H 1FNGB 2BY0A 1YEGL 1JPSH 4DVBB 4Z7WB 4NC1C 2VR9A 4JVPA 5FO7B 5IB4B 5E9DD 2RJMA 5D6DA 5D1QD 1JNNH 1T83C 1BEYL 2ZCLH 4X9BA 5D1XC 4GW1A 1X5HA 1CS6A 5ITBL 5MEQB 3ECBB 5D7IA 4LSTL 4HUNB 4LRNL 12E8L 1MNUH 4HG4J 2ZZUT 2K7QA 5T3ZH 5C6WH 3PWLA 3KYOA 5IM7A 3MFGB 1QG3A 3PWPE 1R5WB 4EDWL 1WBYA 1NUNB 1JMZA 2C3VA 3K81A 3A6CH 4JFOB 4FQXC 3QR2A 4YQXL 4LSRL 1TNNA 3KYAA 1KPVA 2VLKD 3UBXB 2Z35A 4I3RL 4M7LT 4CVXB 3TN0A 3FB7A 1TJHH 2Q6WA 2R69L 1G7PA 4Y5YC 4S1DD 3HAEH 5HVFB 4PJIE 5CEZE 2QQKH 3I50L 2P7TA 2D7TH 3I75A 4UAOB 3LRSA 4GRWH 4G80B 5DI8A 5CWSB 2W9DL 3ZYZA 4AEIL 2HWZL 4V1DD 1SJVA 2WBJA 3D0VA 3C6SB 5ABDE 3TP4A 1LO0H 1TQBB 1KENL 4G6ML 5DQDL 2X4OA 1FJ1B 4WHTB 1S7TA 5DRWA 4K3DL 3VXRD 2P46B 1NBVL 4WU7A 3ZE0F 4ZNCD 5KSAD 1VACA 3OB0K 3X13B 3ETBF 3EO0A 3ES6A 3QQ3A 3FO1A 1ROWA 4X0KB 4GW4A 1TLKA 1BIIA 2FX9H 3LN9A 4WW2B 4P2RB 1L7IH 4GRMA 3GMQB 1BJ1J 4WHCA 1FZOA 5SX4H 5GHWL 4PRDB 4RFEB 3G5XA 3SPVA 5DD6A 1P84K 5CEYA 4P9HC 3QT2A 2Q76A 3L3GB 4L1HA 4WWKC 3RY5A 2P24B 5FYKH 1KCSH 1MHCA 3FTGB 1LDSA 2PYFA 4NHUB 1QFPA 3MV7A 1S78C 3D25B 5J8OA 5T5NF 4U1NA 1XF4A 4XMKL 5DD1L 4K8RL 2EEDA 3LKNB 4Z78B 4RISL 4PRIA 3V5DA 2BJMH 2FD6L 3N85L 1RVFL 5H2BB 4YHIA 4ZFOA 4OD1H 1T1YB 4MAYB 2XQYG 1WBXB 3BP5A 4LSDA 4O2FB 2GCYA 2BSRA 1QHPA 2VDQL 3O3UN 4H1LA 3GO1L 4CU6A 2M2DA 4KRLB 2ZOLA 5IF0A 4YDKH 5JORA 2CUMA 4PTTB 5IHBA 3E3QE 1HZHH 3RDTD 5EC1A 4WENB 5E2VL 3F6LA 3QXUA 5CP7A 5EG6C 3WDJA 3MJ7B 1XGRA 1MHEB 3U7WL 5T3XL 5T1KB 5FGBC 4JFDE 4N0UB 3TBYB 4AL8L 5J06A 1HSBB 4TTDD 5C3TA 1RU9L 1TZGL 1QYGL 2IADA 1E6OH 4GKOA 4XXDB 5KSVA 3QPXH 2VQTA 3MX0A 3RZWA 3OXRB 5ESAA 4ONFL 5ANMB 1PVHA 3I6GA 2ADGB 1ZXQA 4ZMAT 3EZJB 3CFDA 1W8OA 3SE4C 2Y7QA 2HVJB 4B7IA 5HYSB 4Z76A 1KNOB 5CILH 3UTOA 5IKCA 1WZ1H 3QH3B 5IVXA 4NQDD 2P48B 2HFFA 3WN5C 5J56B 2IPKB 4Y8AA 5FYKD 2XNAA 1P7QD 4MXQD 4NO3A 4PGCA 3QULA 3MOAL 2NXYB 4WFED 4LHUB 5GRZA 4WDIA 4X8JA 4OQ1A 5JHDD 3TM6A 5D7IB 2H2PC 1OSPL 1HHGA 2AXHA 4EI5C 1IC7L 4DVRH 1RJLA 5DHYA 3MMEA 1YZZA 2F74A 2VJXA 5SWSA 1DEEA 3PWLB 3KYOB 1F6FB 1CD9B 5BMFH 1A6WL 1OM3H 2MKLC 1MREL 1F00I 1WBYB 4MD4A 2OL3A 3F12A 1VEMA 1FGNH 3T0EE 1KPVB 2ZP0T 3NPZB 3R0NA 2Z35B 2HAZA 4EN3D 2F53A 2CMRH 3TN0B 2EC9U 3FB7B 4HJGA 3P2TA 3L9RA 4ODWA 2Q6WB 4DEPC 1BM3L 3ZKXC 1T1ZA 3V5HB 2R4SL 5K9KB 2B2XH 5I1DB 3MNVA 1ACYL 4AEHL 3CSYB 3MV8D 4FS0A 2PKDA 1MFBH 5DI8B 4YHOH 2VSCA 3KPRE 1UKQA 2VDRH 3MV9A 3HR5B 1RUQL 2WBJB 3D0VB 5F6HJ 1QOKA 5D1ZC 3WFEH 4HMDA 4OJFH 2X4OB 2XA3A 3EYUH 1HINH 1K6QL 5DRWB 1U91A 3EFDH 2ZUTA 4WU7B 1VACB 2AERT 3GRWA 1I4FA 4YWGL 2VZVA 4OM0H 1D5MB 3FO1B 4YLQT 4GW4B 3T2NH 1BIIB 4MA1C 1B0RA 1Y0LA 3KLDA 4P5KA 4PG9A 4S1RH 2WWMC 4FG6C 4GRMB 3JWDL 5JXED 4OCWL 2FBOJ 2K9UA 1FZOB 4E0RA 1HNGA 3VXSE 5J6GA 32C2A 1OWRM 3VD5A 3SPVB 5CEYB 1GOFA 1OSZA 4PRHE 2BVUA 1PKQE 4GXUM 1C1EL 4ODHL 3CK0L 3BAEL 1MHCB 3TH2T 2HKFH 1SVCP 3MV7B 1U3HD 2Z8RA 3DXAD 3QHFH 3WO4B 5JW4M 4RMTA 4U1NB 4HXAL 1PX4A 1HHKA 4OFYA 3T3PF 3HE6A 1TJGH 1LO2H 3MRRA 3I02A 4PRIB 4Q6IC 2G75A 4QRSA 3V5DB 4FN0A 1JPGA 3SKJL 4YHIB 3PWVA 3GBNL 4Z8FH 3NCJL 1JFQL 1SJHB 3BP5B 1LO3H 2GCYB 5GGTH 3GSVB 2BSRB 2GTWB 3LEYH 1V7NH 4LQFH 2FEEI 5GRWA 3TA3C 3UTSA 3WJLC 4H1LB 5FYJH 1DUYB 3WHXA 3ULUE 4AMKL 4BA8A 2ZOLB 4KXZH 2QR0A 4WFFD 5IF0B 1JPTL 3RGVB 3RKDC 4J4PC 5EC1B 4YXHH 3TO2A 4U6XA 4GRLA 4LLYB 1QEWA 5CP7B 3BT2L 1UM4L 4TVSa 1XGRB 2PR4H 4J7RA 5F7LB 1AQDA 2BRQA 5F7WC 3BUYA 2X4SA 3MLYL 1A3LH 3MACL 4PJEE 4I2XB 5MP6L 5D71H 2E6QA 3ARFD 5KSVB 1CGUA 5ESAB 4K23H 4LLAA 3I6GB 1W72A 1PW3A 1OAQL 1QSEA 4NNYB 1A1NA 2Y7QB 3O6FD 3ABZA 3GIZH 4ZOBA 1AY1H 5IKCB 5IVXB 4NBYB 1RAMA 3LQAC 4KMLB 4QHMA 3SGDI 4Z77A 3HNVL 2HFFB 2VC2H 3KPNB 4FQCH 1N4XL 1T1WA 2XNAB 4NO3B 5ACLA 1UCBL 4JFEA 1A47A 4PGCB 3QULB 3E6HA 5KOMC 4ZPTB 2HT2D 3Q2CA 1VGKB 3B5TA 3IT8D 4WDIB 4X8JB 5TE6H 1A0QL 1A7OH 5KAQG 1HHGB 1OTUC 5KSBA 1RJLB 2JIXD 3MMEB 1PZ5A 4LVOC 2F74B 4XBEH 5SWSB 3QQ9D 1DEEB 3QFJD 5CBEB 2AEPL 3MXWH 3NIFF 1O7SA 3DARA 4MD4B 1M6OA 5FYJD 2OL3B 1DBJL 3EYQC 1OF2A 2I07B 4WUUD 5LG1A 4KVCH 1YEDA 2F53B 4AIZA 4HJGB 3Q6FB 3L9RB 4CADB 4PTUB 2AKRB 1T1ZB 4YDVA 5DRXB 4ETQA 5D4QA 1XT5A 3JSSA 2HJKA 3T2OA 1IJ9A 1I1FB 4TPRL 3TT1L 1GCFA 5IFJA 3H9SA 3O3AA 1AR1C 4XC3H 2DKSA 5GRYA 1U92A 2VNCA 4Z7NF 1H3WM 4LF3A 1A1MB 1CL7L 1OGTA 2WP3O 4LSQH 5MENA 3KPLA 2DOCA 2VO5A 4U1GC 3O9WA 3ARDD 2IBBA 5E9DA 3IDYC 1U91B 1JPST 5D1QA 1I1AD 3EYFA 2PO6D 1I4FB 4O51B 4XP4L 3MNZA 1H3VA 3RWCA 1B0RB 1Y0LB 4P5KB 1A5FL 4LGPB 4U6VL 4PG9B 1D5IH 3QIUA 5HHMB 4XPTH 3FOLA 1DBBH 3QIWC 4HAFA 4E0RB 1Q94B 4OKVA 4HJ0D 1M05A 4KTDL 5J6GB 4UINH 4TVPL 5FV1L 4JN1H 1J88A 4IM8A 1I7ZB 3FO2A 1MRDL 3GKWH 4OLWH 1OSZB 5FGCB 3CPLA 1FGVL 3T2PA 2VLKA 3ZL4H 3V4PH 1P9MA 4J12A 1RUAL 1VFUA 1RZ7L 4KK9D 1HHKB 3HE6B 3N1GC 5GIRB 4DQOL 3MRRB 3I02B 4QRSB 1OARL 1JPGB 2ZUVA 4F57H 3RAJH 1MAKA 1CLZL 4OZIA 3PWVB 2P44B 4JDTL 1Q9LA 2CRMA 5AD0A 3QI9B 1FBIH 5KVFL 4OFKA 3S3PA 2Y07H 2NY6C 4O2EA 4YHPA 5ACZB 3DSFL 1RIVL 1UJTA 4D2NA 3VXMD 3WHXB 2EE9A 3BJLA 2DYPD 3L5IA 3PQYE 4ERSH 2VLJE 2QR0B 4ZD3L 3TNMB 1T0MA 1TETH 1GGUA 5HVWA 3LB6C 4Z7UE 2D03H 1ZVHA 4U6XB 4GRLB 3RU8H 1QEWB 1UM5H 1I9IH 2BY2A 1OP9A 3E2HB 4HK3N 2GT9B 3CLEL 1N26A 1MI5A 1B6DA 3MLXL 3DVFA 2D7OA 5DDHA 1F58H 3BUYB 2X4SB 2APXA 4WWID 4HT1L 2YUWA 5F44A 3RUGA 5HD8D 3LS5H 3SDXA 5C0RH 4XPFL 4P9HL 3CC5A 2CIIA 3WNPA 1AHWA 1W72B 3UDWC 4AM0A 1IQDB 5SWZD 3V0WL 3RA7L 1A6ZA 2YS4A 1QSEB 2WIMA 4R4ND 3V52H 2FZ3A 3WUWA 5DJ0A 1Z0NA 1A1NB 5HI4D 2DQDL 2WV3A 3BD4A 5ALCH 3W0WE 3MR9B 4Z77B 5C08A 2DM4A 2O26U 3MPCA 4JFEB 1KJ2H 3HAEA 3E6HB 3BN9C 3HZYA 4JN2A 4UDTA 3GM8A 5IJKC 1FQ9C 2NTFA 3MJ8A 5KSBB 1T7ZA 1BEYH 1W8NA 1PZ5B 1ZANH 3VDAA 1F4YL 1L0QA 3OKLA 5DZOA 5ITBH 4OGYH 4LSTH 3RDTA 4LRNH 4ZTPH 1JGUL 4EJ1C 1M6OB 1RJYA 4FNLL 5I1AB 5E2UH 4MA7L 1DVFB 2IAND 4AEEA 3P3YA 4ZQKA 1LD9A 1R0AH 1XGTA 4RGND 4LLQA 4EDWH 4KKAC 2R9HC 4IS6A 4UIMA 4YQXH 4ETQB 4J3VA 2PTVA 4MNGE 2Y5TA 1WFUA 1OW0A 2NW3A 2PF6A 5LBSH 4ORZC 3H9SB 4I0PC 2R69H 5LGHL 1EO5A 1I8LA 1CFBA 3QO1A 1NPUA 4K07A 3DRTA 3TV3L 1U92B 1N0LA 3EZ8A 2W07A 1CK0L 5MENB 1FLRL 5DJ2A 3W11C 3VFSA 4XX1E 3O9WB 2HWZH 4KRPB 2ICWI 2C4FU 2BNRB 1N3NB 1BFTA 3GMMA 1KACB 4GAYA 3QFDA 3EYFB 4HG4K 5CD5D 3MJ6A 1AP2A 5F7DA 1KENH 3GNMH 2J88L 3P77A 5T1DL 4P46C 3MNZB 3RWCB 3BWUC 4OGAC 1H0DB 4YPJA 1NBVH 3QIUB 1T4KB 5KS9A 4LVNB 1KXVC 1TZIA 2LTQB 3FOLB 5HYEA 5C07D 3D39E 1HWGB 4KRMB 2W9EL 3L3OA 2Z31D 1FORL 1FV1A 1JUFA 3NA9L 4WEUD 1M05B 1AO7D 1J8HB 4JPIA 5FYLL 2D0GA 4O4YH 1HNFA 4G9FA 4UIKH 1S5IL 3FO2B 5IEKA 3D3VA 1RMFL 4OBRA 4PY7A 3CPLB 3P0YH 4XCCL 5HXMA 3ZKQD 2UUDK 4UNVA 4D0DA 4HGKC 4NQED 1SYVA 2ESVD 2Y36H 3EOTL 4Z95L 4JANB 2O5XL 3MV8A 3QUXC 4S10A 1RZKL 2D7PA 4UBDC 1RZFL 4X8XA 5EO0A 4XZUB 3B9EA 1RIUL 4HEPG 4OZIB 4K8RH 1Q9LB 4NNPL 4JRYE 7FABH 4LKXA 3PF2A 3IXAA 5KAQF 1HYRC 5C6TL 3GEWB 3N85H 2PUQT 1DUZA 1RVFH 3ARXA 1AD0A 1A7RL 4UUJA 3MRNB 2RB8A 1PGRB 2M26A 4OIAA 2HP4A 3U82B 3HA0A 2C1OB 1DN2A 2EDKA 5D7LD 1Z9LA 4OGXH 4AJ0A 5JXEA 1M1SA 1MI5B 1GXEA 5DDHB 1OAZH 3UC0L 4PRPD 3SJVB 1U42A 2VL5A 3TT3H 4M93B 3RUGB 4CVWA 5JA9A 3TESA 3SDXB 5DVNA 3CC5B 3PWNB 4H88H 5DZNA 2CIIB 3T1FB 1AHWB 1MFAL 1T89C 2BNQA 2NY4B 3WHE1 4AL8H 4KI5E 3ZDXE 1A6ZB 1ZWIA 3AUVA 1F2QA 4XP1H 5DJXB 3EHBC 2FZ3B 4OTXL 3WUWB 2COQA 4EBQH 4ONFH 1QSFD 5GGSY 2P5WB 2C7UB 1DL7L 5C08B 2DB8A 4N8VA 4W4OC 4AQOA 1A6VH 5DWUH 4P48A 1QFHA 4WI7A 4JN2B 3HG1E 1C5BL 3DUUB 4UDTB 4DKEL 3QDJD 1AQKL 3KG5A 3ZLQC 3PGCA 1I85C 3MJ8B 4MVBD 5MI0C 5IW6A 5C0IA 2Q86A 2Z8VC 4K8RD 1KPRA 4LOUC 1OSPH 3GHBL 1IC7H 3G5ZB 1ORSB 2DM3A 4IRSD 5K9QG 1KIQB 4J3UA 2A9NL 5ITFA 3GMNA 5DFWH 1LD9B 4IMLA 4ZQKB 1XGTB 4LLQB 5EZJA 1MREH 1NCBL 1KCRH 4XNQA 4HQQL 1OGAE 2Q7YA 5F9WC 3SGJC 1Q1JL 1UXWA 3V8OA 3MC0A 1F4WL 2Y5TB 3GMRA 2NW3B 4RRPG 3NCBB 2FHBA 3RVTC 4K71C 3A67H 3QO1B 5T3XD 5FM5M 3C60A 2X4TB 3O6FA 4PJ9C 2E7HA 3RGVD 3S96A 4N9GB 5B3JE 1IGIL 3LQAL 3BGMA 1FDLL 5KN5B 1G7JA 4ZNEA 4QGTA 2DM2A 3ESVF 4H26A 1RUQH 4IRJA 4TYUA 3R1GH 1YNKH 1E28A 3GMMB 3QFDB 4GAYB 6FABL 3FN0H 1FRGH 1EMTL 2R2BA 1AP2B 5F7DB 3CFJA 3P77B 3RHWF 1ORQA 3O8XA 1K6QH 3NVQA 5JMOC 2CDFB 5FYKU 5KS9B 3C2SA 1TZIB 3SO3C 1I3GH 4NDMA 4M7JL 1JUFB 4LAQL 5GGTA 5F70A 1AKJD 4WV1B 4JPIB 1KCKA 5JTWA 4G9FB 4OCWH 3TO4D 4CAGA 5IEKB 1CDBA 3D3VB 5TF1L 3BO8A 1BAFH 2EH8H 4QHUB 1WV7T 3ULVF 4JO1H 1I8MA 4JG0L 4NUJA 2XTLA 4D0DB 1SYVB 2EDHA 3K2MC 4S1SH 1KN4L 1C1EH 3CK0H 3O2VL 4RAVA 4NT6A 3D9AL 3KS0H 1N5AA 2CJUH 1DLFL 4XPBL 4OLUL 1RURL 5E1AA 4JAMA 3IXAB 5EOCJ 4MXVE 1IEHA 2E5EA 1PSKL 5BV7C 4EZMA 1DUZB 3JVGC 1ERNA 3K8MA 4UUJB 1AD0B 1U3JA 5C0NC 2R56L 3VFGL 4H20H 2RCSH 1EPFA 3NCJH 2Y06L 4HJJL 4F9PA 2PO6A 1GPOL 4DGVL 2GQHA 3FFDA 1ZLUH 1CIDA 4X83A 5JIHA 4AMKH 4F37K 3I9GL 5F89A 2IG2H 3TJHD 2PYEE 1JPTH 4BZ1L 4Y5VC 5B38A 5B3NA 5HI3D 1CBVH 1N8ZA 3PXHA 4JFQB 4LGRB 5JDSA 1UM4H 2VL5B 2VZTA 1WT5C 3H7BA 4U05A 3EOAA 1KB5L 1OT2A 1OHQA 1YNLL 2FDBP 3ILQD 2BNQB 3BEWA 3SKOA 3MLYH 1ZWIB 5L6YL 2QHRH 1MQKL 2EO1A 3JWOL 5FUOL 4C4KO 4PJHF 5E1HB 1NLBL 4AG4L 4R4FH 1YEJL 2XKSA 4N8VB 5EU6A 2QBWA 1I1RA 1NUFA 1XCTA 3QUYC 1FZMA 1M71B 2YRPA 3HNVH 4DKFL 4U6TA 1U2HA 2JK5A 3PGCB 1IM3B 1FN4A 1Z6JT 1SY6L 2RR3A 2Q86B 1U8IB 1A0QH 1XEDA 1KPRB 2EE3A 2A73A 3J8F7 1R3HA 1TIUA 2E7LC 3UO1H 3VFRA 4FABL 4KAQL 3GMNB 4IMLB 1P1ZA 3MLRL 2BSSA 1LEIA 5C70A 1FFOA 1WUNT 5EZJB 4XNQB 3K4ZA 3M1BA 4JFHD 2Q7YB 3JV0A 5DEZA 3V6OE 1UXWB 3QRFM 3LV3A 4G8GD 2FX8L 5FKAB 4Z6AT 4JLRB 1S7SA 3GMRB 3PJSA 3FQNA 2XG5A 2ICEA 3V6ZA 4OFDA 5SX5K 4X9HA 3C60B 5AYUL 1IQWH 3SDAC 4TPRH 3TFKD 3S96B 3O4LD 5F6IB 3BGMB 3IKCA 5HHVL 2IQ9L 3O81A 5E8OA 4NJAL 2GITB 5C0BE 4C54A 3RL2A 4GXVH 4H26B 4FFWD 3WFCH 1TDQA 1F4AA 5D93B 2R2BB 1NL0L 3CFJB 4OBSA 4HWUA 4YXKL 3GSOB 3O8XB 4C55A 2H32A 3ZTNL 5IMLB 4JB9L 3TGXA 1WLHA 3VXPA 3SGKA 5HJ3A 2MOVA 3CXHJ 3JWNC 5L7XL 2H2SC 3WKNA 1HCVA 3EJJX 2DQTH 3QHZH 4Y16D 1CFVL 4WY7H 3K8LA 4XP5H 3DHMA 3BO8B 4F7PB 1U8NB 4OIIH 4EOWL 2ED8A 1I8MB 4TVPH 2QL1A 1JNHB 2Y6SD 5KVDH 1JK8A 2VXVH 4KDTC 4NUJB 1MRDH 1JP5A 3L1OH 1K4CA 1U8OA 1GOHA 1UZ6E 5FYJU 1LMKA 3OR7B 2KDGA 4LARH 1UB5A 3STLA 1XMWA 3FHAA 4TULL 1FNHA 1RUAH 3HI5L 4RAVB 1N5AB 5A43C 1V3KA 1RZ7H 1JNLL 5DS8A 3LPGA 1H3XA 5IQ9B 3QQNA 3RY4A 2CKBL 4GSDH 5E1AB 3X17A 4JAMB 5ISZA 2ZUWA 2PW2A 3DX9A 4Y4FB 3SE3A 3FJTA 1CG9B 5T33H 3X3FL 3BESR 3EDDA 4XNYH 4WU5A 5KVFH 4MWFA 2IH1A 5H37H 2OQJA 4ORGA 3FFDB 4A6YL 1KJ2A 4FQJH 4TNWK 5B38B 4L9LB 1OLLA 1N64L 2D3VA 1N8ZB 3LDBC 5JDSB 3H7BB 1AO7A 3EOAB 5D1XD 4RCAA 1TZHA 2K3TA 4Q97A 1I3UA 5C6PB 3FL7A 1EBPA 4RFOH 3I3DA 4M1GL 5KBNC 3RJDA 4K2UL 5SX4I 3BEWB 3SKOB 1VKXA 4QYOA 4G6JH 1F3DJ 3P9MA 3RRQA 1JHKL 4XAWH 3MLUL 3OF6D 2ESVA 1Z0MA 1J0ZA 3GBMH 1ZVSB 3GM0A 4TVPD 4FQXD 5EU6B 4HLZH 2YD6A 4L8BA 1UACL 4XTRC 2ZSWA 2DKUA 3OXSA 1OCWL 3EYOA 1SEQH 5F7UA 1N7MH 2X9YA 3BXNA 4O5LH 1RFDH 3EJZD 3HE7C 1MEXL 5I0ZA 1DZBA 3GSQA 1AJ7L 3G5VA 5C0EA 3ZMRA 4NZDA 2A73B 1YC7A 3FT3A 1T04A 4R90H 1R3HB 3H7LA 2APTA 4NN5C 3MRHA 4D9RE 4UOJA 4JZNA 3VFRB 3KXFE 3L3HA 4YIQB 1OD7A 1P1ZB 2V6HA 3ULVH 2OI9C 1JGVH 3M1BB 3OWEA 1T5XA 1EK3A 5KW9H 3QDHA 2CLRB 4ZFFA 4WGWB 1E4XL 2ZOKA 2YD9A 4KI1A 3AROA 4KK8C 1XR9A 4YGVB 3MYJA 4LRIA 5D72H 1MJ7H 4U3CA 5T1MA 1CDYA 1P7KA 4CVUA 2J8UF 1GL4B 3IKCB 5E8OB 5D8JL 3S5LA 3RVUC 4ZUWA 2JJSC 3SOBL 3TV3H 3VI3E 5DMYA 1A14L 2GJ6D 1FLRH 4WWKD 4ZFZA 2LQRA 4X7EC 4TSBL 1OTSC 4L4TA 2H32B 5HHNA 5EOTA 4KQ4H 2A83A 2GFBA 4PJIA 3TCXA 5D2NC 2J88H 2VDPH 2YA0A 4K9EL 5HJ3B 3HC3L 1GOGA 1CT8A 5F1NA 3IFOB 1P4BL 1J11A 4JRXD 3UMTA 4Q0XL 25C8H 4E41A 1C5DA 1ZVYA 3VMOA 2ZCKL 4M8QA 4RFNC 2WINA 3C8KA 4J3OC 3HFMH 1JK8B 5AWNL 1S5IH 3O6KL 4IBLT 4PFEA 1RMFH 2B1HH 3RVVC 1K4CB 4MNQD 3RX8A 4BSVA 2XZZA 4XCCH 5F9AC 1UB5B 3STLB 5AYQA 1R5IB 4WTZG 1FG9C 1W0VA 1M7IA 4NP4L 4MGXA 2AQ3A 4XCFL 3EOTH 5DS8B 5C0AE 2W59A 1BPVA 4HZLA 3MLWL 4JQIH 3PP4L 4Y1AD 1YMME 5ISZB 5EA0H 1RZFH 2IFFH 4RWHA 2PW2B 3DX9B 1RIUH 5GRUL 1B0GA 4GBXB 2ADFH 2VE6A 3TVMA 1INEL 2FH6A 4NNPH 2DJSA 3Q5OA 4FXLA 2FNBA 3MA7A 1BF8A 5DHVB 4OD2B 2OQJB 1JL8A 1YN7A 2W9LA 3CIQA 1NGQL 3ZSSA 4IHOA 4W81A 1KJ2B 3QWQB 4L3EE 5DVOA 5D7JB 5F96L 4G5ZL 3UTTE 5IGXH 2R1WA 2VZUA 2C9AA 4X99A 4CN1A 3BIKA 3M45A 1TZHB 2VXUH 2ENSA 3HZMA 2A38A 5L2JA 1G7MB 2H2PD 1XF5A 3BPOC 4YPGA 1Q9WA 3VGHA 1NJ9A 4TOYH 2IGFL 4EI5D 1YEFL 4QYOB 3DO3A 3ALPA 5EUOF 1NANH 3U7AA 5J4MA 4JHAL 2R0WL 4IOIB 1MCKA 1XIWA 2AJYL 1QKZH 4M5ZH 5E4EC 1G9EA 2KQMA 3IGAB 2PTTB 5FYLD 3CH1A 2DWEA 1R3IL 1MWAL 2LVCA 4L8BB 3FFCA 2ZSWB 1K9TA 2XZCL 1YYLL 3OXSB 4M6OH 3RVXC 2XICA 3EYOB 3B5HA 4MD0A 3F7YA 5ESVA 5BV7L 2EYRA 4HH9A 2ZUYA 3RWHA 4M6ML 1JCKA 3MO1A 3G5VB 4XB8A 2WAHA 5EBMA 3RVWC 5IK3B 5KVMC 1T04B 4KKBC 4PJ5B 4XMPL 2DQIH 5L8JB 2OMNA 4JKPL 1X4YA 4U1MB 1QHOA 5L8LB 3MCKA 3L3HB 5D1ZD 1B4RA 3GHBH 1SYSA 1EUUA 3SN6N 3L7EB 3UPRB 4PJXF 2JJUA 1KLFA 5I1LA 1T5XB 5B8CC 4I1NB 5IWLA 4LL9A 5TDPA 4ZFFB 5TF0A 1NCBH 4HQQH 2CK2A 5DT1L 4P9ML 3MYJB 2WWMD 3QNXA 4FG6D 3ALXA 1Q1JH 2HJLA 3QUML 1P7KB 1FFPA 1RY7B 3GMOB 5IT2L 2EEAA 4NHCL 4KUZL 3RNQA 5HSFA 1J86A 1E0OB 1A7NL 2Q87A 3LPFA 1T03H 1U95A 5TE4L 4HW6A 4ZUWB 2NX5E 4HK0A 4X7SH 1FPTL 4RQQA 4OCXL 1IGIH 1KEMH 1KLGB 1VPOL 1HXMA 4NM8H 3K1DA 2FH8A 3B8SA 5HHNB 5E8PA 1ZHLA 2R4RL 5EOTB 2A83B 2GFBB 4KJYB 4UTAL 4PJIB 5E8DL 5AEAA 4LFHD 1KCUL 2FO4A 2Q8BL 3HI6L 2NY5C 1WC7B 2EIZB 4PY8I 1EJOH 1WFTA 3Q0HA 4LLVA 4E41B 1C5DB 4NO5A 4M8QB 1UJ3C 4FXKA 4LAQH 3TA3D 5C2BL 5IMMA 1I1YB 2WINB 3C8KB 1XGQB 4L5FH 2E6JA 3JV6A 4WI3A 5TF1H 2NY0C 4BSVB 3RKDD 4J4PD 1SM3H 3MQIA 1GIGH 4JG0H 4RGOH 1M7IB 5E6IC 2VZSA 4IOFC 1M4KA 5EDXA 4HZLB 1MCPH 4KMTH 3HCVB 3S3JA 3O4LA 1CXFA 3AREC 1FH5H 2IBZX 3O2VH 3P4MA 1YNTA 2P8PB 4ODXA 2F54D 1B0GB 4DW2L 4AIOA 5J1TC 5IFAL 2VE6B 3HZKA 1RURH 2AJVL 3TVMB 43C9A 5I76A 1P2CA 1YN6B 4LPUA 1PSKH 1W0YT 5I8KH 2EE2A 1YN7B 3BPNC 2R56H 5DQJA 4IHOB 4U33A 5CZVH 4Y2DA 1G0DA 5GS0L 5J7CC 2UY7A 2W91A 2R1WB 3U36A 1HOCA 1GPOH 1NCDH 4X99B 3CLFH 3SY0A 1BD2E 4KI5C 5FFLA 3BIKB 3AY4A 3QZWG 3X14A 4Y16A 3HZMB 1V3JA 3D69B 4YPGB 1OTUD 3ARZA 5DC0A 4KPHL 4JREB 1U3ZA 1AGEB 1MPAL 2PNDA 4OZGE 5LXGL 4C56A 1KGCD 1MJUH 2D0FA 3O3EA 5IOPB 5ACZA 1KPUA 1FCCA 1TJIL