3LS5L

Anti-tetrahydrocannabinol fab fragment, free form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPTTMAASPGEKITITCSASSSISSNYLHWYQQKPGFSPKLLIYRTSNLASGVPARFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSIPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural insight into the molecular recognition of a (-)-Delta9-tetrahydrocannabinol and the development of a sensitive, one-step, homogeneous immunocomplex-based assay for its detection
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Light chain of antibody Fab fragment
total genus 53
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L01
3FMGL 4KROC 2DQGL 4B0MM 1BFOB 1K4DB 3CZFA 5ENWB 1TCRB 4JDTH 1AGDA 1CGYA 1UWXH 1HQ4A 3K7UA 1HXYA 3HRZA 4YK4C 1NFDA 1RULH 3DHJA 2FBJL 4JN1H 4KK6C 4G6ML 1TNNA 1KFAL 4Y4KB 4XGZB 4KVCH 2DN7A 1IEBA 3FOMA 2QLVB 4NPYB 3ARXA 5IVZB 1SJHB 1YEFH 3VFMB 3FB8B 3C08H 3MJ9A 2C7UB 4UIKH 2VDPH 2KZWA 2R4SL 5C7XH 4NRZB 3GSWB 3IDIA 4PJ8B 3BEVB 4MDJB 2J6EA 3L3KB 4R0LC 2CRZA 5IB5A 4IDJH 1KT2A 2OJEB 4P23D 2A74B 4Y19E 2F74B 2VXVH 4K3DH 4XCCL 5KN5B 1OW0C 4X4XA 4XAKE 1C7SA 5IGXL 1Q1JL 2AJUH 1I3UA 2BVTA 1KJVA 4ZO8A 4S0SD 1IFHH 3HC3H 1JGEA 2A9NL 2R2BB 4QYOB 1G7HA 4P5TD 1U91B 4CJ0A 4XNQB 1KJ2B 4OZFG 4UDUA 5IJKA 4M4RA 2EIBA 1RD6A 4JFOB 5TDPA 4DZBB 4LGPB 3BT2H 3VFPB 5F6IC 2EEAA 5BS0E 4PB0L 5DMYA 4OLYL 4MJ5A 2QKIB 2QSQA 1FN4B 1U8IB 1KFAH 3RU8L 4R7DB 2NW2B 1FYTA 1QBML 3MV8D 5CKAA 3BJLA 2PUQT 5BCAA 3TN0C 3KLHC 4PR5A 5DQJA 5EO0A 2WQ8A 3DGCR 5IQ9B 2E7MA 1RK0A 2DLTA 4Q7DA 3FQXB 2RB8A 1WZKA 5IHUL 2XOTA 1CK0L 2WUCL 1Y6MR 2VERN 3QDJB 4LSQH 5DYOB 3GMQA 3HNTH 3OB0H 3N50A 4GG8B 4RISH 1NC4D 4Y19B 4Z7WF 5KS9F 1FH5H 4ISVA 3ARFB 1FVEB 3NZHL 4OM0L 3RZCA 5HDOA 4JKMA 3FO9A 4OLWH 4XCCH 3BSZH 2ICWB 4IRJD 5SWQB 3NFNA 1IGMH 5JOPD 2IH3A 4V2CB 5T3XD 5BXFB 3QFJA 3QEUA 5F7WC 1ZT1B 2VL5A 2VH5H 3K2UH 4TQEH 4HV8A 4IJ3B 2K9UA 1BAFL 4YLQT 3A6OA 1TETH 3BRGC 1EZVX 4KUZH 1YJDL 3LPWA 4NNYB 2H9GB 2NX5E 1FNEB 1CFNB 4ZXBB 3QJHA 3D1MC 4LLYB 5D2NC 1MLBA 4JRXE 1FAKT 4QOKE 1KLFA 4PV8B 4TVPE 3O41A 4WHYH 1V3LA 5FDYA 2XZQL 2OLDA 1K4CA 1XIWB 4P2OA 4UQ2A 1FP5A 3AAZB 1GRWA 5CJ5A 2IADA 2JB5H 4RAVA 3H7BB 5FDWB 1K8DA 4IRJB 4YHKH 4C59B 3I2CH 5D9SA 4XPBL 3NZHH 2CLVA 2Z35A 4O2EA 1R6VA 3KPMB 3AS1A 3W0WB 4U1IB 5FGSA 3QHFH 3FFCA 1SM3L 5ETUB 3KPPB 4I8DA 4YDKL 1IEAA 2EO9A 4ZUSB 4GKSA 5JUEL 4G43A 5D5MA 4LAJH 3RWIA 1MI5D 2WZPD 3TIEB 5F1KC 4U1KA 3EDDA 5KVDL 5BRZD 5F1NB 4QGYA 2H2PD 1KEMH 4F7TB 3VGBA 4P57A 1QOKA 3FZUC 1IT9L 4XH2B 3ROOA 4TRPL 2NY5L 3O8XB 1J0HA 1JHLL 3WSQH 4PUBH 3LKSA 1PGRB 1U8KA 1UADC 2CKBB 4PGCB 2J88H 4FQCH 5I1CH 2VLMD 5EUOA 3O6LH 5F7DA 1FCCA 2X9XA 4MJID 4Q6YA 5C92A 4GXVL 2DBLL 4NFBA 4P0DA 1S7WB 1DBBL 3QDHA 4KQ4L 4M5YL 5JOFA 1J8HD 4LMQE 4N0YL 5EFIB 5KSAB 1QSFD 2RCSH 5ISZB 4NT6B 1IAOB 3E6FB 4XPBH 1CGVA 5DEGB 3BGAA 5DK2A 2VLJA 4APQD 1Q1JH 2AJUL 4LGSB 3IFLH 2J3SA 2HG5B 1K2DA 1QNZL 2O5ZL 3OGCA 1DANU 4Y1AE 4I5BB 3VXSA 4G3YH 1KJMA 3SDAC 1G7IB 3P4MA 2A6DA 4JR9L 1JTTA 1TLKA 3DRTA 1C1EH 3SGKC 4X80L 1CYGA 3FB5A 4XP9L 3VE0A 4CDHA 3S9DB 4H26A 2DWDA 5KVFL 2DIJA 3CFKB 3JV6B 1S7TB 5JOEA 1LO5B 5A1AA 3MUGA 4QLRA 3D2UD 3O3DB 2R8SH 2Y7QB 2APBA 1W0YT 1XGQB 5KSUB 2JCCF 3DTXA 1JHLH 1ORQA 4M8QA 4ZPVB 5FM4A 3VXTB 4FZEH 5CIPA 4HWBA 4QRRD 1UM4H 3MCLL 3G6AA 1CDUA 4JB9L 4JE4B 1OGTA 3DJ9A 3L95B 4MCYB 4L9LC 2ZG3A 1S7UA 3LEYL 2X9YA 5CJXA 3ET9F 4R2GD 2DJSA 5EORH 4APQB 3U7YH 3KPLB 3GDBA 4U6XB 1F11B 4GSDH 2UWEE 3LAFA 1ZHKA 4PJBB 3NACL 2ATKB 1IAMA 2HJFB 1A6WL 3TH3T 1NCCL 4E41B 2ICWI 1A6ZA 3NA4A 4EJ1C 1FJ1A 5FYJU 1DP0A 1CL7I 1PLGH 4QXGL 4O51B 3P40A 4JVPA 4KPHL 5FYLE 3QA3A 3VG9B 1H3GA 5ELIA 1AY1L 2W9LA 1VGKB 3U4EB 1C5BL 1LO2H 1QFOA 1BZQK 4QNPF 3BZ4A 1NBYA 3NTCL 4EN3B 5IKCA 1QUNA 3GSOA 5EC1A 4ZUTB 1IAII 3VXSD 4QRRB 4ZSOE 5K9JH 5D7JC 2Y5TA 2NTSP 1G7LA 1QEWA 2YA0A 3MLTA 1YEEH 1J1PH 1NMBL 5K9KB 2I26N 4JFFD 1EFQA 3D18A 3KPRA 4X9HA 1INQB 1DSFH 3IXTA 1YJDH 4HGKC 1OD7A 1S5IH 5AZ2H 4ZO7A 2BY2A 1O0VA 3DTXB 4M8QB 5T1DH 2EZ0C 3U30B 4FTVD 1CDGA 3O3DA 5I8KL 1OSPH 1UQSB 4JRXA 3EDFA 3RVTC 1N2RB 2VJXA 2XA8H 5JQ6L 4UV7L 1YYMH 1J8HE 1XEDA 2GJZA 4RSVA 4C56E 4H8WC 2H32A 5DHYB 2W38A 3AROA 3U0TB 1HWHB 3RX5A 1DEDA 3EOAB 1CBVL 1F5WA 5H2BA 2C3WA 5FHBL 3TO4A 4EN3D 4ZOCA 3MX0A 1FFQA 2B39A 3HI1A 5FYJE 2C3XA 3QXAB 4ZYKA 3W11D 3OPZL 5I1EH 1NAML 3RA7H 5ADOL 5DK2B 1NAKH 5C0BE 3W39B 1J5OH 5C09E 2J5LB 5CIPH 5I8EB 1IJ9A 3FFCD 1NDMA 3CDYA 2H2PC 3K1DA 5IM7A 5HVWA 4LSVH 1WK0A 1CDCA 3FQUA 4TVSa 4U1MB 5GGTH 5GGVY 4MD5A 3IKCA 3DBXA 5I1LB 4MHHI 4AZ8A 4UAOB 4D0CA 4YH6A 2X4PB 3UTZB 3QUXB 4KRLB 4PG9A 2ADGB 1VEPA 1G7LB 1QEWB 3MLTB 4U1LB 1S9YA 5C08A 3TJEL 4LOUD 2IPKA 4I3RL 4PREA 4MXWH 5CP7B 3V6OC 3O6FB 2UVEA 5DMGD 4PJCE 2C26A 1GGCH 2HP4A 5IJVB 4HG4K 4OT1H 4HFWA 2Q3ZA 2BHUA 3RJQB 3KVQA 4U2ZA 1EAPB 4TTGA 3QG6A 4MAYB 4DKEH 1P7KA 1R5VB 2VDMH 4G8GD 3SGEI 3FFCB 3OX8A 4YDIL 2WUCH 4CN4A 4OFYD 4GAFB 1NGPH 3QXUA 2CRIA 2DJ4A 3C5JA 4PYGA 5GGSB 4K2UL 3ZKXB 1CR9L 3TBSB 2J4WH 5J57B 3T77B 1I9IL 4IDJL 2VDRH 5E1HB 2B1AL 1IC7L 3QIBD 5DSCB 3AB0C 3HAEG 1WV7T 2NPLX 4G9FA 3L95A 3BZDA 3VXQA 3V7AG 2NCMA 1BX2B 3UZQA 2VIRB 3TV3L 4P4KA 5DJ2B 3VRIB 5LGHL 3LQAH 2VIRA 2FBOJ 4ZPVA 1CE6B 3U9PL 3BE1H 4G9FB 4S1RH 1I8KB 3WDIA 1FNEA 1U8NB 4NKOA 4JFPA 4R2GC 4PP2B 4JFXB 4HBQA 1OP5K 1UA6L 2B1HL 4IIQB 5SX4I 5DURB 2EDDA 5FM5M 1FYTD 4YHNB 4MAYD 5E9DB 3BOVA 3Q6GL 2R0LH 2EE3A 2GK0B 3LN5B 1EUTA 3QEUB 4K7PX 1HNGA 5D1QB 3ULUC 3MRGA 4KKBD 5ANMB 2NYYD 5CJOH 2H45A 1PLGL 5ALBH 4FFWC 3NPSB 3VFTA 4FQHB 3ZE0E 1R3JA 3KPQB 4ZOEA 1OARL 4R4BB 4QTHB 3S4SA 3DI2B 4I2XE 5DVMA 5I66B 5C08E 3OJ2C 4KI5F 4PJGF 4OI8A 1SMAA 3H42L 5BJTB 3MLUH 1XGUA 1S3KH 4GRLA 3GZKA 3ES6B 2IH1A 3SKOB 2EC8A 3OSKA 5ILTL 2A83B 1U3HC 4TUOA 1Y6NR 4NRXB 2BSSA 5EUOB 3QUXA 3U79A 1YDPB 4KK8C 3D39E 3EO9H 3PUCA 2GFBA 1S7SA 4PJEF 5D96C 3C08L 4FZ8L 1QD0A 1P9MC 4PGEA 4XPFH 5F89B 5TQ0L 3QDJE 3OKKA 4YHOH 2A83A 3BGMB 1MRDH 2IAMD 5C2BL 1VFAA 3O2VH 4KGLA 2WMPA 4F7TA 2VXUL 1PY9A 3ULVF 5FV2A 1QBBA 5C0BA 2CDGA 4C55A 4N0UA 2WBWB 3VXME 1DUYB 2E9JA 4CVXA 3O6FC 2APXA 3HZYB 4IOFC 2QSVA 4NJAL 3TA3B 4M3JA 1N0LA 4G6KH 4S11A 4S0TD 4KUCF 5E94B 3JV0A 4Q74A 2PR4H 2XTJE 5BOPA 4R96B 3QXDB 2YZ8A 4KFZC 4KTDH 2CUIA 5KW9H 1EO7A 1N7MH 1ZHBA 1G6RL 3OB8A 5IEHA 1JZ8A 5L0QC 2RCSL 1K6QL 4RAVB 1I9JH 5F88B 3PXHA 3AXLA 1N2RA 4K94H 3NCYS 3ECBA 4WIQA 5TE6L 1YYLL 4MNGA 4NNPH 1L4IA 1Q72H 3QFDA 4NZTL 4RFNB 5I75B 1LK3L 4H5SB 4HLZG 4R90L 3P0YL 2KL6A 3OR6B 5EOTB 2WUBL 3DMMC 3HE7D 5EO1B 5E5RB 3BEVA 1BQHG 3PIQB 3IDJA 2HFGH 1MJ7H 3CCHB 4XPFL 4E42A 3KPRB 3QJHB 1V7NL 3BGMA 2E27H 1I75A 1CLZH 4M7ZC 1LEKB 2LVEA 3DARA 4PGEB 2I9TA 2DQHL 1EGJH 1P7QD 1X5JA 4XAKD 4HXBL 4QTIL 1T80A 3FN0H 2HTKC 2GY5A 3SBWA 3IDNB 2YPVH 1UYWL 1AGBB 4OBRA 4TUKH 2FEDD 1XGTB 1F3DJ 5FAAA 4LK4A 1T2QL 1ZT4B 4ZO9A 5J56B 4NP4H 1TCRA 1HHGA 3QIUD 5ENWA 1NGYB 3RZCB 5GGQH 4PRPD 1QRND 3QO1B 1HHGB 4WHTB 1QPXA 1HKLL 3DUHA 4WW2B 2R0KH 3BH9B 5DQDL 3MYJB 2YBRB 3MRGB 3NZ8B 2YA1A 4BSVB 3Q1SH 3LQAC 1HHHB 4C83B 3L3GA 4JZOA 2DAVA 1AGEB 5DUML 4S2SA 2CGRH 4MCYA 3DX9A 3NVQA 4WI3A 1IKNC 1P7QB 5IVXE 3QDMD 4P46D 1U8NA 4NKOB 3KS0H 1QHPA 5C0RL 3L7EA 1ETZB 4FMKA 4HUXB 3BYTA 2DI9A 3RZWA 4CL7A 1EV2E 1RIHH 2WUBH 4P4KB 4WV1A 1OP3H 2E27L 1KB5H 5I71B 5GRJL 3DUUA 3DVIA 4XPGH 1KCUL 3KYNB 4KJPD 2WBKA 3QIUB 4HWBL 2XN9D 1N0XH 1EFXD 4O58H 2VLKD 4YGVA 4XBPB 4XPTH 1G7HB 4KV5F 1N5YH 1CF8L 1G6VK 5HHQB 5IBLC 4IRSC 5FGBA 3MJ7A 3BKCH 2GEEA 3CFEA 3HPLB 3JV5A 4Y4FB 3U0TA 3BPOC 3C5ZA 3SKJH 5EULV 4GRWE 4HKZA 5J89A 1S7QA 4UOW1 1PX4A 4UV7H 1BBDL 1SBSH 3VDBA 1NUFA 1XFPA 2VLRA 2VLRD 1F4XH 1WBYA 3RWCA 1QQDB 2NR6C 3MMEB 5DT1L 2AJSH 3C5ZD 3LV3A 1A3RL 1E4XL 1R5WB 1WFOA 2ZNXA 2J8OA 7FABH 3EYFA 4P5MB 3T2NH 3LPGA 2DIBA 2XN9A 3IJHA 4N0UE 1NANH 5EUKB 3O8XA 1S9XB 3D48R 3K80A 4JREC 2XN9B 2PCPB 4PJCB 1MRDL 1YN7B 4U1HB 3S35H 2X1OA 1E6JL 3UTSE 3RTQC 3TF7C 1FAIL 4WRLA 5C0ND 2WIIB 4JO4L 5D2LB 2BZDA 3TP4A 3FFCE 5J8OA 1G0XA 4ODUB 3WNPA 4X6EB 4ZTPL 4ODHL 4P2YA 4A6YH 2ICCA 4GH7B 3C5ZB 2Q3AA 4K8RL 4OZIA 1QLFA 3E3QE 2VDNL 3CFEB 3MJ7B 3SE4A 4I77H 5F3HB 5I1JL 1C12B 5B22A 1MELA 1WC7B 2JJUA 4EBQH 4EI5D 1OAQL 4JFZL 2HFTA 4R4NC 5DGQA 3T65A 1J0YA 4AEIH 3SJVE 4FN0A 1WIUA 5A3ID 2DJUA 4PJHE 4PJAB 3RWFA 5GGVH 1T3FA 2DKSA 4WW2F 2H32H 3W81A 2DLGA 3HE7C 3MRNB 1YEDA 5GJSH 2FD6H 2NX5A 2Q76A 2H26B 3UJJH 2WW8A 1QSEA 5I8OH 1CFNA 4NQDA 4URTB 4GRLD 3GSNH 3P0YH 1Q0YH 3RVTD 1P7QA 3AS2A 4Y4KC 3LEXA 2OI9C 4S1SH 1L0QA 3V6BR 1O7VA 4QHKJ 3ZTJH 2YOCA 4XMKH 3DRTB 1FZKA 1SBBA 4OIIL 1T1WA 1TMCB 5DRNA 1BFVH 2A77L 5D7SL 4TVPH 3SQOL 1NL0L 5I74C 3IJYB 5IOPA 4UBDC 4MB4A 3A67L 4KKAD 1D6EB 3UTTE 1UG9A 4YNYA 3EDKA 3CIQA 1ADQL 2R9HD 2VDNH 3O0RL 4JQIL 4FMFA 1PZ5B 5F3BB 3UTQA 4LSSL 4S10A 2XYCA 1LEGB 4MS8D 1A7RL 5D2LA 4KROD 2AQ2A 1CLOH 3DRQA 1T2QH 1JI1A 5TE4L 2GTZA 4OV5B 5DLMH 4FFZH 2G5BB 1RVFL 5B3NA 3OKEB 4Y2DA 2MQ3A 3V7AE 3K1KC 3GNML 5J6HB 4PJCA 3MV8E 5K59E 2VAJA 4NSKB 3ULSA 3LKSB 4OQTA 2ITDB 3U6RA 1FGNH 1FZOB 1WSST 12E8H 3VWJA 3R06B 4LOUC 4R7DA 4E42B 1X5LA 5IMMB 3EYFB 4Y5VB 1KNOB 1XGPB 1JGVH 5AAWA 1R5WA 4UV4H 4AT6B 5I73B 5IM7B 2BVPB 2HN7B 4OFYA 1S7VA 1A7OL 4OI7A 4U1SA 1OP9A 5EWIH 5DVKA 1LD9A 1MRFH 3N0PB 4WGWB 2HJKB 1HH6A 1N5AA 1LO2L 4NKIH 4HIXH 3TN0B 4XAWH 4JPIA 4MQ7A 3U36A 5C09A 2X4NB 4OB5H 3BWUC 3REWB 5HY9B 3GJFH 1D9KD 5FHBH 3TO4B 2F5BL 1WIPA 2O93L 3PGCA 1YQVH 1LO4H 3NN8A 4GS7B 2YEZA 3RL2A 5DD5L 3O41B 1BZ7A 3QAZC 1MCSA 5GRXG 3KXFB 5E8NA 5ID0B 2IQAA 5D2NB 5EOQH 3CFCH 3WEXA 3KLAB 3HKFA 3IAGC 1JWMA 5JQ6H 3KR3L 5I71C 2QR0A 1AQKH 1OSPL 4FQCL 2FEEL 1RZKH 5IROC 3EFDL 3G5VB 1X44A 3QDGA 5TDNB 1MHCB 4PJFF 1P7HL 1I7RA 1KCVH 1JPGB 2VKWA 1U93A 3GJFB 3WFHA 2FZ3A 3O3UN 2FLRT 3GSQB 3TA3C 4NPYA 2BSSB 1II4E 2DOCA 3TN0D 3ZDXE 5KSBF 3K3QA 3WD5L 2YUXA 5HYSA 3DIFA 4KKBC 4BK4A 2GT9B 4X9GA 3TO4D 4M8VA 4OLWL 4D9QE 4PP1C 1VGKA 1V7ML 2KBGA 3ISWA 1KIQA 4GRWB 1CGTA 3QIBA 1OAXH 4M7LT 2VISA 5DO2D 3VXNB 2V5TA 4L3EB 4WY7H 2YS4A 3KJ6L 1AKJB 1N8ZA 4OLZL 5D6DA 3BN9D 4F15B 5C71A 4H8WL 5I75C 2DS4A 2D4DA 5F6IB 4WGVB 3DVNA 5CMAA 1KACB 5LBSH 4R0LB 5DFTA 4GXUM 3RKDC 3QUYC 4PRIB 1JZ5A 5JXAH 3RIFF 2FX7H 2OYPA 4JFXA 4FRWA 3QEQB 3D85A 4P3WA 1WAAA 3GBNL 3MRHB 3GMOB 4LQFL 4NQEA 3ZKSD 4U0QB 3WIFB 4QOKD 2EDBA 3G6AB 3X3FL 3MBEA 3WS6A 1ORQB 3HAEB 3A6BL 2I27N 3QFDB 3NCCB 2FD6L 2GI7A 4NNYA 5FOBB 6FABL 2BNQA 3GMMA 3MREA 2ZCLL 3T77A 1CG9A 3FB7A 1FLTX 5GIRB 4M6OH 1T0PB 1TVHB 2ORBH 4LU5L 1YPZF 4DGIH 4PJDA 3QO0B 3ZHKA 4A2MA 2A9NH 4RMRA 4EVNA 3MC0A 4Y4HC 5FB8B 3OG6B 3D3VE 4QHMB 5KN5A 4LSSH 1MFNA 4MJ6B 3QWQB 5H94A 5L9DH 4OCSH 1LEIA 4ZFFA 4LVHB 4JRYD 3TA3A 5C0JA 4JRYE 3LKRB 5E95B 4OF5A 2QADB 2BRRH 4XB8A 2WP3T 4EZMA 1JF1B 4YPJA 2HA1A 1OTSC 2CK0H 3S35X 2E5EA 5DFVC 1RIUL 3BQUC 4IOSD 2VB5A 3V6OA 43C9B 5AD0B 4WO4D 4Z0XA 2HAZA 4S1RL 2YPVL 5E99L 4GS7C 4PJDF 3NCMA 4NZDA 3BE1L 4N8CL 1YPZA 2ZG1A 4UAOC 3VH8B 4NBZB 3IDMB 5DJCA 2Q8BL 5IVZA 3ARFC 5T1DL 1UCBH 1IEBB 3FOMB 2OK0L 1MFBL 4PTTB 3ILQC 3A6BH 3IGAB 2NW2A 2XTLA 1ADQA 4A6YB 1G84A 1NC2D 4YBHA 4NZTH 2IFGA 5I15L 1X6NA 3PHSA 4QRTB 1T2XA 2DQCL 1E4KA 5ACZA 2VUOA 2W60B 3VFOA 5CSGA 5E00A 5A2IH 2IF7A 2D7NA 4XWGH 1T7ZA 2BSTB 5IVXF 1PG7W 4FQHA 3RA7L 3VRJB 1LVEA 1UWGH 2OI9B 4RFEB 1PD6A 1JGDA 2BXZA 2R0WL 3GO1L 3RDTB 4BH7B 4NKDB 2XZCL 5T3ZL 3V95A 4RQQA 4OLEA 5H2BB 3EOAA 2JTDA 3QZWB 4LPTA 3TEUA 3VXPA 4F15C 3MROB 4HIXL 4KI5C 2ESVE 1BHGA 3V4UH 1FNAA 3O4LA 1MPAH 2F53D 3G6JB 1JRHL 4LSRH 1VPOH 5DD3H 4O9HH 3VA6A 4C54A 3NFSL 5F96H 1BVZA 5C2BH 3SN6N 5JNYB 3DURA 1VKXA 1IAKB 1RZJC 5CEYB 3FFDA 2R15A 4O2FA 4XP4L 4QOKA 3IU3A 4KJPC 2ADFL 4DGVH 1U8QA 2C3VA 2ED9A 1KLGB 3H9SE 4PBXA 3D85D 2PTUA 2FNBA 3BH8B 5KSBA 4YC2C 5I76B 3PL6D 3BT2L 3EFDH 2IAND 4M7JL 4XZUA 4XGZA 1UZ8B 1WWCA 3BKML 1O5DT 4ETQA 1AGFA 1N64H 3B3IA 5DUBA 2B2XL 5HGAA 1R0AL 1KB5B 4WUUD 1U58A 1CT8B 1AGDB 3CUPB 1Q94A 3VXMA 1FV1B 3QFJE 4JM4H 3ARGD 2X1WL 1ACZA 2NY3B 1KG0A 4LBEA 5T3ZH 2CXKA 5KVGH 3BZFA 5HI3C 1HCVA 4XCNA 1JZ3A 4QKXB 3QNYB 4L8CB 4HKXB 3RNQA 2Y5EA 4OZHE 5C08B 4TULH 3FT4A 3BUYA 3PQYE 4Q2ZB 3EIFA 4DTGL 4Y2OA 4OCRH 1F2QA 3M1BB 4WWKA 3B2VH 4KZEL 4GQ9H 3U1SL 5J12B 2BNRD 5DD1H 4Z7OF 4U1MA 3K8KA 35C8H 1F6LL 2YPLD 4PJDE 1C5CL 4DWHA 2YN5A 4L3AA 1IE5A 3P0GB 4N68A 4I2XA 3MBXL 3MJGX 2DDQL 1X4ZA 4X99B 1A7QH 4ALAH 2EYRB 4HHAA 3R06A 1MHHB 3B9VA 4GBXD 4AIZB 2FX9H 1MWAA 1CLCA 4B41A 3MO1A 2E7BA 1OPGL 2UWEB 4ZTOH 3Q1SL 3AREC 5BRZA 5IWLC 1Z3GH 1JPST 1SJXA 3OKDB 1RAMA 4XXCA 1C5DB 2YSSB 3WUWB 3OKEA 4Y2DB 3GSVB 1WZLA 3BN3B 1EDQA 5INCA 5KVGL 2O5ZH 4J3VA 1R0AH 3WO4C 3SDXE 2JB5L 3CUPA 3P73B 1J88A 1OTSD 1LK2A 1IGYB 1A21A 4Z7UA 5D2LF 2OM5A 4A6YL 2VXVL 4K3DL 2ICWJ 4P3CL 5JHDE 1U8MA 3J8F7 2PYED 3BKJL 3TO2B 5C6TL 5ICZA 4MSWA 2I9LB 4HK0B 4QXWA 5I76A 5I17B 3BD5A 4LCYB 2V9RA 1N6VA 3BDXA 3EW3B 5IQ7L 4P57B 1IKFH 5F1SA 1IZJA 1G0YR 2APVA 3N06B 3WKML 1T7XA 4TNVK 3TBWA 3S35L 5DD1L 2X4UB 3HZKB 3FFDB 2J8HA 2CDEB 2E7LA 2GITB 2ADIA 5E0QA 4GKNA 4PJ9B 3D69B 4LCIL 3T0ED 4HK3J 4Y2DD 3S34H 4TVPD 4XP9H 4YGAB 1YECL 2FGWL 4YQXL 4D8PB 4PY7B 1I9EA 3KPPA 4PJFE 1OF2B 1P1ZB 3NPSC 3ZLQC 3NABH 3QNXB 3ULUE 4MVBD 5IB4A 2JK5B 2NY1B 4X4YB 2Z35B 1RZFH 1DCLA 2CLVB 1QLEL 3KXFE 5HD8D 4HCRH 1WC7A 2JJTA 3QIWD 3LKNB 4CVWA 4IRJA 4JO3L 4LPCA 3WXVL 4Z76A 4X6FA 4EOWH 1FL5B 1XGRB 3VXRA 3ARDB 1IVLA 5AYQA 3WFEH 2QEJA 4U7KA 1T21A 3L9RB 1WJ3A 4I0PC 4UMGA 1UWXK 5T3XE 5TQ2H 3FQTA 4U7SA 1IL1B 1MFEH 4D8PA 3D0VB 1QSVA 1MAKA 4U0RB 4NWTH 5GS1B 1X4YA 3PWJA 4QRPE 1A4JA 1CXEA 1XGQA 3ROLB 2GIYA 1QSED 2ADFH 2ERJC 5LGHH 4G9DB 4PTTA 2NY5H 3FQNA 4LLUB 1ZLWK 1U3HB 3QR2A 2F54D 4Z7UF 1HILA 2F54E 2HWZH 3VFSA 3BEWB 4HKJB 5CGYD 1WT5C 1JYWA 1IRAY 5GRUL 1MCEA 4LCYA 3VXRE 2NZ9D 2ED8A 5AD0A 3MCKA 1HE7A 2R69L 2WANA 3WIHA 3PHOA 1J05B 1MVUA 2R0KL 4EI5A 4WTXA 1FBIL 1S7RB 1L0XA 2EDQA 5IMKA 4HDIB 3THMH 3KAAA 4Z7UB 1Q9LB 1U9KA 2GJ6A 3S8WA 4YHYC 2NY6D 3CFDB 1CICD 1JL8A 2G75B 4MD0A 3CFDA 3ME0A 1EHLH 3MLWL 2R1XA 2J6EH 3S88H 1HI6B 1PY4A 4KKNA 2VE6B 3BDBA 4BJLA 5JMOC 4Y4FA 5EPMA 3HRPA 2WBJC 1T0MA 4OJFH 1FFRA 3HUJE 5IQ9A 5FO9A 1KCRL 1U3HD 4BFEA 4N0CD 2G9HA 4U6HA 1PKQA 2F54B 4F9PA 3VXOB 4MWFB 3QRGH 1OTTC 1IGCH 3IFOA 5GRJH 1FQ9C 4IOIB 2YD4A 4G9DA 2VAAB 4NN5C 3RVWC 4NHUA 4RIRB 5L88H 1JGVL 4U1KB 1UB5B 2EDFA 4JFDA 1J1XH 4N8CH 1N6QH 2DQIH 3PWJB 5GS1A 1WICA 1G6RB 4A2LA 1MIEL 1IEAB 5DO2C 3VFUB 5LBSL 5DLML 4OKVB 4D0DA 3KLDA 4G3YL 3M1BA 1TTUA 1G6RH 3ARED 4KJWC 3C2AH 3AVEA 3BSZL 5DVLA 4X6FB 3CC5B 3VI3F 1SBSL 1EH9A 3REVA 4ELME 1JHTA 3JZ7A 1S8DA 4NOBA 4MCZA 5JPMA 4XNZB 4XVTL 2OTWA 1FE8H 3ALXA 2DWEA 4RAHA 3BZFB 4I3GA 2HVJA 4LLWB 3T2OA 3BKYL 2JLLA 4XCFL 4S1QH 1M71B 1OF2A 1P1ZA 2VYRE 3FO1B 5C07B 5EZIH 5T33H 4Z7NE 3MZTA 3S4SG 3RBGA 5A16A 5EU3B 2PO6A 2FL5A 2APFA 2ZCLH 4DVRH 2BP3A 1ITCA 1QZ1A 3WDHA 5KJRH 2ICEA 1CZ8H 1FHGA 1VGEL 4U6YA 5HI4C 3DMMD 4Q9RH 3T08A 1YQ2A 2A1WH 3DX7B 5CSZA 1XCQA 1AXIB 3GK8L 4NQXB 1AXSB 4KXZI 5C3TA 1YNKL 3GMRB 4EI6A 2XZAL 1K8IB 1XGYH 1RUML 3E1F1 1A3LH 4PRBA 3MUZ1 1SYVA 4HUMB 1MCIA 4IS6A 1T66C 4Y5XA 3QUMA 5FYLH 3QFJB 4LPYA 3SKMB 5CEYA 5FCUH 1RULL 2UY7A 3KGRA 1BZ7B 1DN0A 1MY5A 3FO9B 3LZFH 5AUMA 3MRCB 5DD5H 1DQDH 4UNVA 4EBQL 2XN9E 4YHYB 4P59H 4QRSA 5TDOA 3TYFA 3U7WH 5GGQL 4XC1L 2VQ1A 1QLEH 1NEUA 3LD8B 3BQUD 4L1DA 3O6MH 1JMZA 2WNGA 3QWOB 1JN6A 4G8EA 1QFWI 3BWAA 5ITFB 3EJJX 1F6AB 4UINH 4JPIB 3U46A 4PRHB 1NFKA 3O3AB 1YUHA 3ILPB 3X11B 2PYFA 4GKZA 4DUVA 1EJOL 5KSBE 1CGXA 3WJLA 2ARJA 4U1SB 4WUUA 4R26H 3DMMA 4AT6A 4MYWB 5C0EA 4XVSL 3U4BL 3HA0A 3QHTC 5BVPL 5IMMA 3I9GL 2VXSH 4OLVH 4D9QD 2DM4A 4WVRA 2IPUK 1F8TL 3B9KA 3IETA 3L3DB 3OJDB 4TYUA 1YUHB 4P2RA 1JRHH 2HT3D 4HIHB 1HWGB 4KJYA 3IS0X 5GRWA 4DZ8B 3S3SA 5CEZE 2VQTA 4Z0XB 3SGJC 1BBDH 2CO6B 3GSXB 3VFWA 3ES6A 3S5LG 4JY4A 43C9A 5HDQH 3NA9L 4N90D 3CNKA 4FFZL 1HI6A 3MLPA 1RZJH 2YK1L 1V3KA 3EYQD 1CLOL 4YHIB 4PRHD 4OF8A 3F6IA 5BVJB 1L7TL 2XG4A 3S96B 4WI4A 4BZ2H 1PZ5A 5F3BA 2XQBH 1UACH 3KPNA 1DN0B 2FIRT 1ED3A 3G6DL 3DGGA 1OT1A 3MV7E 5GSRB 5ANMA 3L5IA 4KDTC 4PB9H 2D9QB 5D1QC 1N26A 4ETQB 3PHOB 1DBBH 3MODL 2I07A 1UZ8A 3CVIL 1JGLL 2IAMA 15C8H 3RVUD 1B0RB 1MAMH 1WAAF 3VGHA 43CAA 1L7IH 4UV4L 4YO0A 4I3RH 1QFWL 1XR8B 3RGVB 1ZE3C 4C4KT 2D3VA 1MCFA 1U8QB 3PWVA 5HHMB 3U4BH 2OTPA 3MLRH 3LQAL 4JGJA 5IFAH 3JSSA 3N1GC 4X7TB 4HF5L 1IAKA 1MLCB 4EDXA 1J9CT 4JY5H 3WIFA 1IL1A 4AL8L 2R29L 5FK9B 1XH3A 4Y19D 5D71H 4JHZA 4ZDHB 4PJ5D 1MCNA 1BJ8A 2NTFB 2E8ZA 4I48A 5EC2B 3V6FB 3VMNA 1VFBB 1C16B 3ZL4H 4PLNC 3JV4A 2B7DT 4I77L 3QZWA 4GAJH 5C07E 4UB0L 4YR6B 1H5BB 4HC1L 4JZNA 1HKLH 5FIEA 4XBEH 2VR5A 2YZ1A 5IT2L 4G8GE 3CMOL 3UJIL 1BVLB 4OGYL 3MLXL 4NFCA 2ARJQ 4HWEL 5DJ0B 5HPOA 4TNWF 1IQDA 2P8PA 5HHMD 4E0RB 4GAGL 3P0VH 4LLVB 4NCC2 4JDZB 2G60H 3LSOA 2ITCB 5DZLA 1RZ8B 4Z77B 4OIBA 2XTJC 2C1PB 5CEZH 1PKOA 4GBXC 1CXFA 3GSNL 1MHEA 1U95B 2W65B 4FZ8H 1QFWH 2DD8H 4U6TA 4D3CL 3TGXA 3QCUH 4U6VH 2IQ9L 3VRLE 1Q72L 4PJ5B 3QT2A 4Q9RL 5JW3L 3OZ9H 2I9LA 4NJ9L 4PG2A 2HVKA 5ICZB 4Y8DC 4NQCB 1IC7H 3TO2A 4I0PA 1AI1L 3OKLA 2XRAH 1JFQL 2UZYB 1CXLA 5EA0H 1UM6L 32C2B 2QQKH 3GMNB 4H8WH 5FXCH 4CMMA 3W0WD 3T3PF 1GH7A 1LK2B 4LSRL 3G5YA 4ZNCD 1EHNA 5ITBH 4UIMA 2BXYA 1RU9L 1WBYB 3H7LA 4NQUA 3W39A 4LLDB 4I9WE 3VD4A 1OSZA 5TPWH 5GZNC 2JE8A 4KHTL 5I1KL 4HKZB 3W9DA 4RA3A 4RWHA 2XWBA 1KELH 1S7RA 1CFSB 4KXZH 5HVHC 3GBMH 3OF6A 1B4RA 5BRZB 4WHYG 4JKPL 5E7BA 4R9HA 4XPGL 5K59F 3FL7A 1MWAB 2C1OA 4MQXD 4X7SL 3EYVB 1R3HA 1BF8A 4M03A 3ULVL 4XVSH 5F7KC 5T1LB 5GRVK 1OCWH 4J3TA 3FJTA 2JJTC 2AEQL 1MF2L 1UKSA 3I6LE 3DROB 3MNZB 4NQSA 3E8UH 1O7SA 3CFJB 3T4YA 1QSFB 1FPTH 1EERB 5F7UA 4RMUA 3N85L 2PW2B 1E4XH 1XIWC 4ZG1A 3RIFK 2QQQA 1XCTA 3FT4B 4M43L 1ZLUH 3GIZL 4KVNL 4FG6D 2BVOA 5HDLA 3NZ8A 3DYOA 3NIGF 1UB6B 1NANI 2XACC 3H8NA 5LGKA 2A9MH 2XIDA 2EDYA 1L6ZA 3U4EA 4LIQL 1NBVL 2FO1A 5JLZA 1ZT4A 3H9ZA 1KB5A 5HHOE 1OWRM 1BQUA 1CXKA 2MTPA 4YNYB 4PJ9A 1HYSD 4Z7VE 2AXGA 5JXEC 1J0ZA 3QCVL 3DYMA 1ZHKB 1GGTA 3BAEH 4XVUC 1SYVB 5IFJA 2HLFC 3BH8A 2Z31A 3C8HA 2YWYA 5K9QG 1XCQB 3CVHA 3FKUS 5KZCB 4M6AA 2FJFB 3WLWC 5IFAL 4D2NA 3IDXL 4HMEA 3H3PL 3BRDA 1FFPB 4G42A 3F7VB 3U82B 4OCYH 3QWRD 5E8PB 3TZVC 4PJ9C 1IGYA 4GKOA 5DJ6B 3TVMD 4OZIF 1CDIA 4OJFL 5D2LE 3ALPA 2DQTL 3S36X 2BVQA 5JZ7D 3CFKA 3JV6A 2O61B 3NN8B 1IKNA 4ZUWA 3CDFA 2HRLA 5L8LB 2OJZH 3RTQB 1BLNA 3PDGA 2Z8VC 2EO1A 1RZFL 2QADC 1XAUA 4KTYA 4Y5YB 3WIIH 1Q9WB 4QWWD 3HFMH 1WZ1H 1RZ7L 5JIHA 4ETYA 1WBXA 3SY0B 4LHJB 3JTTA 3TNNA 2VWEE 2OZ4H 1JNLL 3PGDA 5FM5O 3PJSB 3QI9B 1NL0H 4KQ4H 4M5YH 1DUZA 4YHOL 1GHFH 5SWZB 5SWSB 4X5WA 2X5PA 3ARPA 1ZT7A 2V2XB 1PX3A 1UM4L 3MCLH 2OR7A 3EYVA 3IDXH 4I18B 1XF4A 1ZVYA 1KCRH 4Z7NF 3C8DA 2A6IB 5FYLD 1JYVA 4GRWH 4K9EC 4R3SA 1SYSB 5AWNL 3F7YA 1A5FH 3MOQA 1B4JH 5J1TC 1HHIB 3H42H 5CWSA 3AS0A 1EHXA 3WFEL 1IM9D 2CJUL 4JKKA 4MX7A 3B6SA 3L3JA 3KYOA 3WXVH 3GI8L 3MSPA 4QRPB 2HKHH 4PS4L 1Q94B 3VXMB 2G75A 3NCFB 5D5MF 3NBNA 4X7EC 4XNMA 3QI9D 5J6GB 4QHLA 3PDOA 4WWID 2CIIA 3G9AB 4DKFL 3P30H 1V05A 3MLSH 5JORB 1OTUC 1J05A 1OQXA 2PTVA 1QLRA 4HKBA 4WUUE 3TCLB 5IHUH 1JE6A 7CGTA 2BVEA 4WJ5A 5DRXA 1I8KA 4G6FB 3DOSA 2R23B 2GK2A 1LE5A 3IF1A 4FQ2H 1FL6A 3GFUA 3CMGA 2KH2B 2DQJL 4ZUVA 3MGAA 4X7SH 1CD1B 1MLBB 5I15H 1YEJH 3P4NB 4RWYL 2YD8A 3B8SA 2NX5B 1MAML 1YEDB 4RX4D 1T3FB 4NOFA 4V1DA 4TNWK 1NQBA 4WHDA 1C5BH 3DV4A 3BDYL 2D2OA 4NNPL 1AO7D 3DXAA 2YA2A 4HK3N 1BP3B 1M7IA 5K9JL 4G8GB 2AEIT 4KAQL 2HT4D 3MYZA 3P9MA 4NRYA 4HG4J 3VDCA 3DO3A 3HI5H 4Y4HA 5F7LB 1NCBL 4NZUH 1CD9B 4NO3A 4WNQA 2AERT 1EAPA 1NDGB 4F80A 4KI5D 1DFBL 4LCWB 3OAZK 2JF1A 3WHE0 3FTGA 3NCBB 4NC0B 2MPAL 2OXHA 3BW9B 4GG8A 1A8JH 3GMQB 3LCYA 2B1HH 3DIFB 3O6FA 5KS9A 5CP7A 4F57H 1OM3L 4JGMA 4MLSA 3MOBL 1DBJH 4KRMB 4U3CA 1GCFA 1IKFL 1KLUB 2DMKA 4JVWA 4P5TB 5J13C 1DVFB 2IANE 2J8UE 5EBMB 5IVXA 6FABH 1UVQA 3QPXH 4JHAH 4PBVC 1JPGA 1K3IA 3UPRB 2C4XA 4GAGH 4FFYL 4UT9L 4UUJB 4RZCB 1HSAB 1JWMB 4K3JH 3TBVB 2V7NB 5HJ3A 4L1HA 4LHUB 3MACL 4FFWD 5FUCC 2R2EA 4JFOA 1P69B 5TDPB 4DZBA 2Y1VA 4J1UA 3VMPA 5TE4H 1BZ9B 4H88L 1QQDA 1J8KA 4HPOL 2EDJA 3ARTA 4P49A 3MLVH 4DKEL 4KK9C 1MY7A 1AXTH 5BV7H 3OKOA 4KAQH 1I8MA 5E8DL 5JHLL 3OBAA 3LEVH 1TIUA 3U36B 1IEHA 3OKOB 1ZGLA 3QDJD 1AC0A 2H32B 3H9SD 1QRNE 5DHYA 3TN0A 1KN2H 3I02B 1YEGL 3H9HA 1U8OB 3L3DA 1VB9A 1J0IA 1XR9A 3QUZC 3F12B 4OTXH 4OM1H 2IAMC 2W1NA 1H0DB 4N1CA 3JWDC 4PJ5E 1S78C 5EBGA 1P4LB 2GTWA 3P77A 1CFTB 5DMJB 3KPTA 5E8OB 5IROA 1RZKL 4K23H 5M95B 2OK0H 2HMIC 4IOFD 2DDQH 1BIIA 1UENA 2B4CC 1SVZA 2YRLA 3WSQL 3U0PA 1KCSH 1L7IL 4HUUB 1T1XA 2ZUYA 4ZXBD 1P53A 2GKIA 3FO0H 4RMVA 1A3RH 2IH1B 4M1DH 4YHZL 3UPAA 4P9HC 3MR9B 4HJ0C 2DLEA 1AY1H 3BH9A 1I85A 2OTUB 3NIDE 1HQ4B 5HI5D 3FT3A 2Z93B 2ZOLA 4QTHA 2AK1H 2I5YH 4WW1A 1CT8A 1GVIA 4BFGA 5KAQG 3MLVL 3DWTA 2VZVA 4OT1L 4G7VL 3ULVC 5HGAB 1NCCH 4FXGB 5CGTA 3Q6FA 2HKHL 5D1QA 3NAAH 1F8TH 1JNJA 4XWGL 2UYLA 1T5XB 1K8IA 1RZKC 3GMRA 3T0AA 4EI6B 1AXSA 4AM0A 1KULA 1KC5L 4XB7A 1GC1C 4BH8A 1LO0L 4LCIH 3MFFB 4L29A 5D96B 2OMBA 4V1DB 4WI8A 5GHWL 5LAXB 2H6PB 4MQTB 4HC1A 2C3VB 4CDGC 1TENA 4PJAF 1NEZB 4WI2A 3KLAA 4XHJC 3AU1A 4XVJH 1U8JB 1CFTA 4FTVE 4YDLB 1IC1A 4Y2DC 1NMAH 4LHQB 2YEZB 3RL2B 3SHSA 5FF6B 4MNGB 3QQ3A 5C8JB 4PJFA 1JZ2A 1KXQE 5EU6A 1K5NA 1FYTE 3BKYH 3QXWA 2ZZUT 4PRPB 3TCLA 4QT5B 1U3YA 2VSDA 3LD8C 4NWUH 4ZFGH 4R7NB 3MRQB 3WL9B 3UYRH 2ZUQC 2VRAA 3JWDL 3T0VA 5JIKA 1JHTB 5JPMB 5L2KD 2AGJH 2VITB 2XZZA 4UB0H 3EKCA 1J8HB 4ZS6D 3OXSB 2AJYH 3QIWC 2EECA 4QHLB 1P7KB 3S97C 1IAOA 3E6FA 5DEGA 1IAIH 1TJHH 1AR1C 2KUTA 3HI5L 1KCKA 5ISZA 5ISZD 3TNMB 4NN7B 1LD9B 4IMLA 4AMKH 2HN7A 1RJLB 4NQDD 4X4MA 4YDVB 1XGYL 2HRPL 3MRPA 3MBXH 2DI8A 3ULUH 1HHIA 4JFYB 5C0BB 3V4PL 1TQBC 2RBLA 4P9HL 4XT1C 2BVUA 5L8JB 3PNWA 1SYSA 3T09A 2VDKH 1QACA 4HGWA 4HAFA 6CGTA 3G5ZA 3V0VA 1CLZL 2Z92B 1A1MB 3RUGF 3P4OA 5D72L 1RPQA 4HIIA 4NM8L 3VGAB 5IFHH 4LARH 2APWA 1T22A 2VC2H 5IW1A 1RJZA 2WBJA 4X98B 3LH2L 3MNVA 1DDHA 1YYLH 1FIGL 1PW3A 4L4JA 1KPUA 4DGYH 2VDML 1Z2KA 1G9MC 1ZTXL 1F58H 3UJTH 2KKQA 4NN6B 2AGJL 4NC1C 4PJCF 1FZJA 3OR7B 2NY6C 5HDBF 3SJVA 2A6JA 3DSFL 1XMWA 1R3JB 3UYRL 3DVGA 1I4FB 2XNAA 1NDGA 3BO8A 1HYSC 4NWUL 4ZFGL 3MTRA 3HE6D 1MREL 3SKNA 3T1FA 1SEQL 2YN3A 3KNBA 1KYOJ 3X14A 1HNFA 1NFDE 2CJUH 3AMKA 5D1ZB 2QHRL 2VZUA 3K46A 3TT1L 5J06A 1I1AC 2OQJA 3TJEH 3RTQA 1NCNA 4Z6AT 4IIQA 1VADA 3PV7A 2XZQH 3ZHLA 3CK0L 1G7QA 5D7JA 1NCDL 1EGJL 1AJ7L 3KLSA 1I1YB 1MIEH 4XCYA 5I1AA 4Y7MA 3UTTD 4F7EB 2AABL 1QYGH 3PE9A 4DGVL 1WFTA 5GS0H 1UM5H 1NGWA 2BY0A 1DQQB 5DQ9A 1T1YB 3ARQA 3HCVB 4F8QA 1T21B 3QEHB 4O4YH 3EJYC 2UYLB 1HQRA 3SOBL 8FABB 1E0OB 1HXMB 4PRIA 3V6ZA 4OGAC 3UP1A 3MRJB 1W72L 3BESR 1E6OL 2IJ0C 4WW2A 1CDBA 1OAUL 2Q86A 2YC1A 2A6JB 5H8DA 1J11A 1HH9B 3MGOB 2WWKT 1IC4L 1I8IA 5IF0A 2FGZA 1NCWL 3ZTNL 1F4XL 5F1OB 2AK1L 4BKLA 3QUKA 2Z8WC 5BZDB 1KPUB 3H9SA 2XKUA 4KK5C 2J7LA 4G6JH 4XMPH 3B6SB 4Y4FC 2J2ZA 3S34L 4LF3B 4XTRC 2DQEL 4N0YH 5CWSB 4KDVA 3UTTB 1F3DH 2ATKA 3WD5H 2JCCA 1G9NH 1SY6A 3N85H 4GT7A 5HI4D 1CQKA 4KMLB 3O2VL 4YBQC 3HMWH 3QDME 4L4TA 3AY4A 1CGSH 5TFSL 3QG7L 1QFUL 3VGDA 5I17A 3CCHA 1JZ4A 3I3DA 5E6YA 1Q9KB 1J18A 1MOEA 1LWRA 3BZEB 1U8LA 5B4MD 1KEML 4F7EA 1NMCB 4JY6B 2BNRA 3MMEA 5CJXC 3F12A 5MP6H 4LVOB 1QRNA 5C70A 5HGDB 4KDWA 3QI9A 2FRGP 4D0BA 5GS0C 1LO5A 3P11L 1NCAL 5IT2H 2EDEA 5IIEA 2DWDB 1MSPA 4M62L 5CUSH 1EMTL 4LCUA 5HYJB 2B4CL 2EH7L 4R4FL 2OQJB 2YSSA 1QR4A 2NXZD 1TXKA 3MV9A 5C86A 3WIIL 1Q9WA 3QXDA 5J0BA 4J8RA 5KG9B 5I1GH 2UWEA 1H9VA 4X0KA 1RUAL 1CK0H 2DM3A 3Q5TA 4X4ZA 4LDLB 1ZANH 4X6DB 2YXMA 3EJZD 1F2XK 2BRQA 4BM7A 5ICYB 1ZWIB 5HVHB 3ALWA 4NKIL 1GGBH 4Z0BL 4P4RA 1E6JH 1ES0B 3HE7A 1J1XL 4G42B 4HJGB 2IANA 1RUPL 1F6FB 3OKLB 2H6PA 2BNRE 1EO8L 3MA9L 5FUOH 4I4WB 4KMQA 4LVNB 4S2SB 3CX5J 3T0WA 5C0AA 3WKMH 4NZRL 1G0DA 4UILH 1TVBB 2GQHA 4NRXA 2Y36L 4WUKL 3UDWC 3D9AL 3ZYOA 4TUOB 5T5FH 5DJ8B 3RWDB 4JDTL 4QRRA 4ZUTA 1MCOH 3DUSA 1EHAA 1D9KB 1EEZB 3GRWL 4G6MH 1OM3H 2GAZB 1V3MA 3HFML 3WO4B 3R0MA 1Q0XH 3GB7A 3S4SB 1BFOA 4Z18A 5CZXD 1LEGA 3FT3B 3NFPB 5HYQB 4OM0H 3QH3B 3KG5A 4ZUUB 2OSLB 3KXFD 5ESVB 4OD1H 4R4FH 5DXWA 3K4AA 2FHFA 4RGNB 1X5YA 5D1QD 3Q5OA 3WNOA 5BZWB 4FXLA 1NMAL 2MKLC 3CDCA 2DMCA 4PGBB 4R8WH 2VXQL 1BIIB 1MIMH 4L9DA 4NQTA 2J1KA 4PRIE 5F97E 4NN7C 1JF5A 1MF2H 4MZ2A 3DV6B 4N1EA 1H15A 4EDXB 5JOPE 1FGVL 2W9DL 3GKWL 3UCRA 4MXVE 1H15B 1CIUA 3OXRB 4LVEA 2DQDL 4HBCL 5DJZB 2EICA 1YEEL 2CR3A 5JHDB 4W4OA 2D03L 4KDTA 5E2TH 4ZS7H 5GHWH 4YO0B 4PV9A 4KK9D 3BN9C 2CUHA 4WO4A 1DTUA 4FOMA 2WQRA 4PJEB 3K8LA 4EOWL 4PJXE 1MCWM 4RGND 3HB3D 3RKDD 1M6OB 3Q6FB 1QR1B 4GAJL 5HYQA 5B38A 2BNUB 3TH2T 1K2DB 3OGCB 3ZDZE 3IDGB 5E94A 3TBTB 2BSTA 3JUYA 2CDFA 3WCYA 3TPUA 1G9ML 5BVJA 4MB3A 1PAMA 3HC0B 2F15A 2MKWA 3I3EA 4NO5B 5HJ3B 4U4BA 5JOFB 2V7NA 3B5GA 3GSXA 3LZFL 3VFWB 2R1YA 4M1DL 4YHZH 1MRCH 3B5HA 3IVKA 2BNQD 2NY0C 5CBAB 1UVQB 3OJDA 4JAMB 4P2OD 2DD8L 3TVMA 1S9XA 4GW1A 3WFDL 3KHQA 5EUKA 2X2YA 4LSPL 4HIEA 3SKOA 2H41A 1NLBH 5F72S 4OM1L 2CIKB 5B4MC 3BHBA 1BFTA 5ID1A 4Q0XH 4YE4L 3LSOB 1NDMB 2J4WL 4JFYA 12E8L 5DT1H 2YRPA 4ZNEE 2A1WL 5K33A 4MDIB 1FO0H 1U6AL 4G9FE 3RWIB 5E8EA 5IMLB 4K3EL 1RZ7H 2D7TH 1W0VA 1OVZA 4BZ1L 4FQXA 5ALCH 1KENH 1XR9B 3IDYB 1BVLA 2OZ4L 3H3KA 3DO7B 4Q6IB 2ZSVB 4TOYH 3MRMB 2DF3A 2MWCA 1WISA 1QNZH 2FATH 1OLZA 4EQ2A 3J7HA 3BKCL 1MEXH 4HLJA 1I8MB 4PJGA 2LAGB 1HSBA 2K3TA 5IR1A 1X5FA 5HHQA 1M7IB 4OLXH 4WCYH 4WO4B 5FHAH 3MRQA 2VQ1B 4PRHE 1KB9K 2PXYA 3HNTL 3GMMB 2BNQB 1P84K 3CJJA 5EU6B 1CD0A 5HGDA 1QRNB 5DJ6A 5KANG 1TTFA 4MQXC 2BMKB 5HPMB 3HAEA 3P4NA 3O6LL 5DD0L 4QXUL 3ZHDA 1NGZA 2BFVH 5D7LB 4XP6H 3MXWH 4WU5A 1VSCA 5I2IA 4P46B 3DVFA 3LS5H 3D39D 3JWOH 3UJJL 4R0LA 4QHUA 2NMSA 4JFEA 4RFNC 1P84J 3QRGL 5HHNA 4HPYL 1NBYB 3P3YA 4EN3A 4JHWL 2I07B 2Y6SC 2IC2A 4QY8B 5BS0D 2MHAB 5MHSD 3ABZA 3IAPA 4FG6C 3FT2A 4DKFH 1QP1A 1FVDA 3OKNA 5D1ZC 1FVCB 4TPRH 5CZXC 4KU1A 3RWEA 4CVUA 2F53B 3MLXH 1PG7L 4QRPA 3QPQD 3F7PC 4XC1H 2JIXA 3HG1A 2ESVD 4DFIA 4Y19A 4TOYL 1B0WA 4PGJA 4UQ3A 5F7NC 4KKLD 3OF6D 4YHKL 1GAFL 4Y4HB 4WENB 5C09D 3IDNA 1S9YB 4YEFA 3DSNA 3UTZA 3GSQA 3F65A 5C6WH 2BOCB 1SHMA 5DQ9B 5SX4H 3B9KB 3IETB 3MNZA 1I7RB 3K0WA 4ONGH 3KYKH 1DLFH 4RDQG 4YXKL 2DTSA 2IANB 4YPGA 5DVOA 3IJSB 4NM4L 3M8OH 1FC2D 5BVPH 3NIFE 1IGTB 4GG6A 2BX5A 3WHXA 1CD1A 3C5SA 4HUWA 4JFHE 1GGYA 4WUUB 2CLZA 3ELAT 1T4KB 2P7TA 1E27A 3MJ9L 2NY4C 1S9VB 3HE6C 5CEZD 3WFCL 3I02A 5MENA 4RGNC 2UV3A 3U46B 1ZGLB 5GJTH 5C09B 1WUNT 2XWBB 1I4FA 2CIIB 2DLFL 1R3IH 3O0RH 4JQIH 1UACL 3DETD 3PP4H 4D0BB 3B43A 3VFRA 1IBGH 2F74A 3B9KD 1VA9A 3HUJB 3JVGA 1MCRA 3SO3C 4JQVC 3MNVB 32C2A 2YPLB 4X98A 4PTUB 4K8RC 4U1GB 1FFPA 1HSAA 5JA8B 3VI4E 2V7HA 3A0OA 3VWJC 1I3RA 3EJYD 1BVKA 4M6ML 5F7EL 5DJDA 2BK8A 4H20L 5IFJB 1GPOH 3SGEH 2CRMA 4W70A 2UVFA 4OGAD 3BP5A 1VFOA 5HHXL 1RMFL 4Y4KA 3NIFF 2B5IC 2V2XA 1X7QB 1ZT7B 2FEEI 2J8UA 3GMPA 4YDVA 4G43B 1XF2B 3X17A 3QA3B 4EKXA 5CILL 4JM2C 5M94B 5E08H 2PF6A 4P99A 4P23C 1M71A 3C6LB 1D5IL 3JTTB 1A1OA 3O4OB 2DLFH 5IOPB 4ZMAT 3MNWA 1SEQH 3LKNA 2FH8A 3VXSE 2A6KB 2AK4E 4Y1AA 1A9BA 3QSKB 3H7BA 5FDWA 3EGSA 2JJSA 1HZHL 3QEHA 3WNNA 1GYAA 2V9QA 1EEYA 2YUZA 5CEXB 2FGWH 4RMTA 4C56B 1C08A 2HT2C 4K7FB 3GJEB 1HIML 5ESAB 4CU6A 2FO4A 3VXTA 5EU7C 5FYLL 2BSRA 2Q87A 5TE7H 1IGIH 1DQJB 2ZSWA 5HDBE 3BP5B 3MRLA 4OLYH 2VN4A 3NH7L 1WT5A 4M5ZH 4Y16A 3VXOA 3HMXA 1LE9A 5DMIH 1F97A 4S1QL 2OXGA 3F5WA 2NY4B 2O26U 1FCGA 1YMMB 5KJRL 2Y9RT 3SKNB 3T1FB 1OQOA 1K6QH 3W5NA 1RHFA 1Z9OA 2EYSA 2WAHA 1I7TB 3GKZA 1TFHA 3OWEA 1D5IH 3S96A 2Z93A 4X9FA 1FZMA 4PRNA 4O00A 3G08B 1N64L 5KSAA 4U7MA 1AC6A 5DYOA 3MRKA 3GIZH 5IJVA 3NOIA 2Q7NA 1CF8H 1IC5H 25C8L 1UH3A 4P2RE 4Q6IC 4F2MB 1N59A 3FRPG 1T22B 1RK0B 4MXWL 1FO0L 1U6AH 3BIAX 2CKNA 4Z7OE 3X3GH 4YEEA 3AS3A 3P4OB 4PG9B 3ARBA 4ALAL 2X4PA 1OAZH 1CLYL 3PGFH 5DR5L 5J7CC 1T4KA 4J3WA 1GIGH 4HHAB 2EEDA 2EYRA 5DWUH 3M8OL 3FQNB 4Y5YC 1TETL 5TF0A 7FABL 4HD9A 2IPTH 3LRGA 3KPSE 1IGTA 5EUOF 4GG6B 5CHNB 3WN5C 5CCKL 1SVCP 3TYGH 1ZHLB 1CICC 5FYKH 4XNQA 3HLAA 1TJIH 5CFHA 2BOCA 2DQEH 2HFEB 5J1AA 2A73B 1NLDH 1EJOH 1DE4B 3BP7B 4R6UA 1F6AA 5EBWB 2E9WA 4KUCD 5AG8A 3RL1A 4Y5VC 3WXWL 4OGXL 4FP8H 4X8JA 4XC3L 2R39A 4Y5YA 1NUGA 4OD2A 4HT1L 3AM8C 1TCMA 3PHQA 5IBTL 2IADB 3RVXC 5CD5C 2DKUA 2UUDH 1UH4A 2XQYK 1IAIM 2NY2C 3CVHL 4IIQC 2NQCA 3RVWD 1M1SA 4MGXA 4YHPB 3BPNB 5I1IL 1I9RH 4DOHB 1YNLH 4CMMB 2F8OA 4IS6B 2ADIB 1N4XH 2WLYA 3QEGH 3K2MC 4K23L 2X4UA 3HZKA 1UJ3C 1WEJH 3T0XA 3U9PH 2IBGA 5B38G 3PGFL 5D1XA 5ECJE 4CKVX 3RNKA 1A4KA 4LMQI 5BXFA 4QO1A 5EU3A 2CXGA 1A6TA 3DGGB 4JM2D 2DI7A 4XBEL 1H5BC 3ARBC 3V52H 1QKZH 4LRIA 5E2VL 5HI5C 4EQ3A 3QP3A 4LLMA 4RMSA 2P5WD 4OD2B 4LKCA 1SY6H 2D31A 5HHOA 3MR9A 3SE4C 5INCB 3CSYA 1A22B 1DJSA 1F4YH 3RL1B 3WUWA 1IGFH 2HJFA 1KEGL 4RQQB 2QSCH 3V4VL 4L8DA 3U2SA 4GW4A 3T4AA 4OF6A 5SWSE 2ILLA 3BKMH 4P2OC 1MRFL 4Z7WA 3VG9C 2PYEE 1AFVL 2ORBL 1LP9E 1WBZA 1OGTB 5DC9B 4HGMA 2BDNL 3T3PE 1UXSB 5FFLA 4OFDA 4ZFOL 1FL6B 1NJ9A 4I2XB 5EDXA 5ISZE 4H5SA 2EE6A 5KVFH 5MEPB 4MWFA 1MHPL 1JWSB 4WJ5B 3U1SH 1MRCL 3ZKQD 2R8SL 4DTGH 2ZPKH 5JXEA 2P5WB 3FB5B 5E6IC 4KTEH 1NC2B 3P0VL 2PETA 1DBJL 5E56A 2R1YB 4LSDA 3VWKD 2VE6A 4JJ5A 4MXQC 2R1XB 5CKGA 1F4WL 5LXGL 4XP5L 1GOHA 4QRSB 3IDUA 1A6AB 2NY3C 1HOCA 2B20A 3JWNC 2VLJB 4G80B 4JM4L 1YEHL 4EIZC 1AR1D 3L3JB 4YXHH 3EHBC 3GUTB 5E7FA 1P5VA 4BZYA 4HUNB 4GXUN 4EVNB 4XP1H 2R1WB 4GAYA 4IMKC 2EKSB 3PWLB 2N7AA 4PJEA 3W0WE 1UYWH 1TVHA 1MI5E 1RIVL 4S1SL 2D03H 5CS7A 4WWKC 1N6QL 4G6AD 5KTEL 4DK6A 4PV9B 3SE3A 4NQVA 3UC0H 2P5ED 5C9JA 1LP9B 3O2DL 4XH2A 3ROOB 2D9CA 5KVDH 1LK3H 3FQRB 2IBZX 2ICEB 4O2FB 1KPRA 1KXTB 5EN2B 2EZ0D 1J86A 3PGDB 4BQ6A 4W6XB 1QO3A 1JGLH 3D85B 4ENEC 4MNQE 1A6UL 4FHBD 5I6XC 1MCBA 1ONQB 3SDCD 5KANI 4G8EB 4X9BA 4G8GA 1A0QL 2FEDC 3RP1A 2FWOA 1K8DB 1I1AD 1RZGA 3NABL 4Y16D 4OBSA 3PL6A 4H88H 1H8SA 3CGTA 1UJTA 4YFLF 4WFHE 3RGVD 4JN2A 1QO3B 5E8PA 1UM5L 5DTFB 4HUVA 3DHMA 4CMHC 3LQZA 4QCIA 4RDQF 5T5FL 3WN5B 1TZGH 4RGOL 3MLZL 5C08D 4IOIA 4NZRH 3VD5A 3GI9H 3N1PC 1CI5A 2HYMA 3CD4A 1JNNH 1OHQA 1TVBA 2IMMA 4ODVH 4F9LA 4Z7WE 3GBNH 4MJ4A 4YXLL 1RQ5A 3O4LD 3G5VA 4I1NB 3B9EA 4NC2B 3ZO0A 1HEZB 5DRWB 4D9LH 5E2UL 4HIJB 4J12A 3S37H 3VFVA 3BMVA 2R2HB 3SCMB 4HFUL 3KYMB 3P73A 5T5NG 3FO1A 4RRPA 3HZMB 1MFDH 4HH8A 5LG1A 1NCWH 4NQCE 5BOZG 4ISVB 2IG2L 3MV7A 4LLWA 3OGOE 1A0QH 1VDGA 2YUWA 1JF6A 1MCHA 3H3BC 1X5GA 2AQ3A 5DEFB 1X5AA 3H6JA 2XTJD 2RIKA 2P47B 5LGJB 4RNRB 4R3SB 1R3KB 3M17B 4HIHA 1E27B 2F19L 3BVNB 5I9QC 4OLUH 5D72H 3LS5L 4WI6A 2QHLA 1QA9B 4XPHH 3MV01 3QIBC 5D7KE 2P48B 2W92A 2VDKL 4ZFZA 4Z78B 2SEBB 3STZA 4NM4H 1H3XA 1A1NB 1UB5A 2SEBA 4NHUB 4L4VD 4YHMH 1R3HB 1WF5A 4BK5A 3GMOA 4JFFA 4OAWA 5JIIA 5JUEH 4HCRA 3T0BA 3STBA 2UZIL 1F42A 2XWTA 2NY5C 4FQLH 2DRUA 2F5AL 3SO3B 2HRPH 2DYPA 5CSBA 4MAYC 3DXAE 5DRZA 5C0CD 2GHWB 3UAJC 2XTJB 1R5IB 1F02I 2HH0L 4XNYH 4DAGH 3THML 5EOCJ 5HHOB 3NCYP 5KBNC 1TDQA 5I1JH 1Y0LA 4OZFH 3UZEA 1BD2B 3D0LA 5MHSE 2R2HA 4Q9QH 1FVDB 2NY1D 1D5XB 3I6GB 3CH1A 3MGOA 4W4OC 4BFIB 1LGVA 5FECB 3GEWB 4LEXL 2VABB 1CE1H 4JDVA 1KTLA 5C0GB 4OIIH 5GZOC 3OAYH 3WJJC 1PSKH 2AVGA 1GOFA 2H1PL 3HC4L 4XMLL 4G6AC 4YE4H 4M1CC 4FA8A 3ARDD 1JIBA 5I73C 4NQED 4W6YB 5C0FA 1LO0H 3EDEA 1KB9J 3UC0L 5K9OB 2FR4B 3QZWG 5C0FB 4KJQC 5GXBB 2C7UA 1QYGL 3MOAH 1FYHB 4L4VA 1NGWB 4U05A 3GSOB 5EC1B 2FJGB 1N4XL 5GJSL 1P5UA 3E3QC 4OZFB 1T0NB 3V4VH 4NBYB 4PJBF 1TZIB 4AEEA 1UWEH 2AK4B 5E1AA 5IHLB 1CXIA 5DK0B 3K2UL 1C8PA 2ESVA 4EUPG 2JIXD 3HG1D 2I5YL 1W0WB 4O51A 5FGCE 3G6JA 1RHHA 3UXFA 3CSPA 1BD2D 3OAUL 4EEEA 2MPAH 2PN5A 3V0WL 1X5KA 4PJGB 3V7MA 4PJXF 4N9OB 4KHXL 1FO0A 1QSFE 3HZVB 3KNBB 5DUPL 4U6XA 3RY5A 1YJDC 3REVB 2W0LA 5EC2A 2HKFL 3V6FA 4RFEA 2Q6WA 2EIDA 3DVGB 2JELH 1DE4A 3HN3A 4MA8H 1CICB 4XXDA 4X6DE 1HDMA 5FYKL 4BELD 1U36A 4OZGE 4YIQB 4XVJL 3T8XA 1S7VB 3VXUD 1QVOA 4JPWH 2EDTA 1FSKC 5DJAA 1AI1H 1X7QA 3TVMC 4GFTB 3QCTH 1U41A 3TVMB 1QA9A 3VU2A 3X3GL 2VLKE 1D6VH 3D25A 3ARBB 2EDHA 5SX5K 3V0VB 3ZKNC 3PWPD 2KDGA 3SGKA 1ZEAL 5FO9B 4QWWC 3DX8A 5CAYB 1CFSA 4PJBE 1PKQE 4Y1AD 4JO1H 4Z9KB 4XCNB 2OMNA 4LCCA 5A2LH 5F7YC 4OV5A 4IRSA 5FO8A 3HUJA 5CGMA 2E9BA 1OY3B 3AREB 4K8RH 4OIAA 1KIPB 1MREH 4IEFB 3TBYA 8CGTA 4KK6D 2B0SL 4KQ3H 5SWSD 3SDCA 3V5HB 3RPIA 3OKDA 4K3JL 1D9KC 4MZ3A 1PQZA 2OL3B 1T1WB 2RGSA 2MOVA 3UROR 4JB9H 3MLRL 3I85A 5FOBA 1K5NB 3L5JA 5C07D 2Y36H 3VFNA 1MHHA 5DR5H 1S9WB 1YY9D 3UTSD 3WV0A 2VDPL 2P45B 5I8OL 3K8MA 5C7XL 3N9GH 4W6WB 3WHXB 3TIDA 5F9OL 3ULVH 2FO4B 3MRNA 4PY8I 1U0QA 5SV4A 3L7EB 5L2JA 2XY2A 2L4OA 2P1YA 2X1PA 5E6IB 5LCVL 5CEXA 4AM0B 2NY7L 2VXTL 3GSUA 4PJEE 3W0WA 3FQWA 3L3HA 3BWAB 3ZSTA 1GC1H 3T65B 3UJIH 3QFJD 3CLEL 4WW2C 1A9BB 4BQ8A 3WXWH 1KCLA 1UGNA 4LKCB 4PFEA 2EDWA 1Z0NA 2WV3A 5GRVL 4P23B 4G6KL 5IBTH 1WIOA 4I0KA 1INEL 2IPUG 1RHHB 4DKAA 2F53A 1A6PA 1WVZA 2HJLB 4OCYL 2LFGA 3TZVA 5HGBB 1MCOL 3EZ8A 3D5OF 1D9KA 1EEZA 3BQUB 1P2CA 1S7XB 2EYTA 2VZOA 2YD6A 4N9GB 2MHAA 1FG2B 2GITA 3IRZA 2CDEA 1MCPH 4DQOL 2NX5D 4X6CB 2YKLL 2Z31C 1EIBA 1FNGA 2XT1B 5E6ID 1I3RB 4JO2H 4ODSH 2FR4A 3UEZA 2X44D 3EYSL 2MNUA 1RK1A 4HK0A 4GRMA 4MSWB 2R1WA 4GAYB 3GI9L 4J4PD 1WZMA 1JTOA 3FONB 4JDVB 1PJ9A 1RIUH 3WJJA 4YDJB 4QF1A 3MV8B 2EC9U 1LEIB 5EOCH 4K7PY 1INDH 4PS4H 3UBXA 3NFSH 5F96L 4U1JA 1AH1A 3I6LD 1NBQA 1BQLH 5HY9A 4JY4B 4PRPE 2G5RA 3C87A 1FNSH 4K9EL 3OAUH 1TJGH 3MRMA 4B5EA 3V8CA 3PABA 2AJZA 4X6CE 3ZE1F 3MV7D 1DVFD 3IXAB 3TT3L 5AG9A 1J7VR 4M3KB 2AEQH 4O2CA 4JM2A 5CP3A 3I75A 4HLZH 5HHME 2DMBA 3E6HA 4JZJB 1G7JB 3U30C 5HSFA 3V0AC 4FQJH 4LHUD 3WFDH 1A1NA 4FZEL 2EE2A 4JPKH 1OB1B 5GQBA 4O2CB 4M1GH 4L8SA 5ADPH 1XF3B 2H2SD 2G9HB 4HQQH 3ZE0F 3DX9B 5DS8A 2AJZB 1S7SB 2JJSC 3Q3GA 4KKCD 4PRHA 4FQQB 5FYKD 1CCZA 1AE6H 1CZ8L 2CK2A 1B88A 2XXCB 4CN6A 2QSCL 3RNQB 1YNTB 4FNLL 1BQSA 5DEFA 3TT1H 5FHAL 3QNYA 1D5MA 4TSAH 2DL2A 1FZMB 4PRNB 1BQLL 1MAJA 4JGUA 2VLKA 4XPTL 1PYWB 3TBTA 4YFDB 5BO1L 2GJJA 4YDJA 4S1DD 1D6EA 3F6LA 3B9KC 3VFVB 3FRUA 2XZCH 3SKMA 3QUMB 3F5WB 1FZKB 1JHKH 2W07A 5DMKA 5F44A 4HS6A 2J12B 5T1MB 4CADB 5GIRA 2NZIA 3CX5K 4YHNA 5CCKH 5JPNA 3HCVA 2AXJA 2FX8L 4ODBD 1I7UA 2IFFL 1NFDF 2WLZA 5AEAA 2BFVL 4DN3H 1ITBB 1EEQA 5HHXH 1RIHL 4PJHA 2DM7A 3PQYB 1MUJB 5EOTA 1TZGL 2X4SB 4U3XA 3VA2C 2HJLA 2GSGB 1LE5B 5F8RC 3O8XD 1I9IH 5I18L 2J6EL 3R1GL 2HVJB 4HS3A 1IM3A 1AR2A 3GJFK 5GSVA 1AHWA 4MJIB 4X8JB 1HZHH 5CP3H 3BIKA 3LKOA 1NSNL 4TSAL 4X4YA 4P4KC 2P24A 5C0DB 5KSAD 4OCSL 1UZ6F 2QBWA 1WFUA 3C6LA 1K85A 4Y5XC 1MQKH 3MJ8A 4HFUH 1OGAB 5L2JB 4NZUL 2JJVA 3ARGC 1IQWL 1W0VB 1UA6H 1ORSB 3QNZB 4AIXA 2WSKA 3L5WA 1FORL 1MJJB 2C4FT 3VWKA 5DJYB 2VXUH 4KK8D 2H3NB 3V79C 4JRWA 3FHAA 2Y4SA 4GMTL 5AZEL 3ARVA 5T1KB 3DBXB 5I1LA 2FECI 3I50H 1OOAA 5JW4Q 1GXEA 2AJXL 1YPZB 1MHCA 1IZKA 5KAQF 5EPMB 1JP5A 1N59B 5L2KB 2ZUWA 5HGHB 3QQ9D 1CFQB 2CSPA 4IMLB 4PYHA 4MD4B 4CJ1A 5I8CB 5ICYA 1RUAH 4R2GB 3L5XH 3CU1A 4JFFE 3L3OB 4MJ6A 2GUOB 3HMXH 3EOYG 1MI5B 1A7PH 4L5FL 1TITA 1INDL 1DBKH 1UWGL 2VKXA 4WY7L 4AQ1B 5C0BD 1ZA3A 1KCUH 2KQMA 5AWNH 2G2RB 3F62A 5F9WC 4F58H 5D7SH 4MAUL 3W2DL 3MJ9H 2P7TB 3QUZA 4KJQD 5GISH 3WKNA 5FF6A 3VFSB 3TESA 2IEPA 3MRLB 5FKAB 5C0AD 5T1KD 1U3HA 4XCEA 1U3ZA 4IRZL 4JFPB 4X99A 1JWSA 1UCTA 3I6KA 4WUKH 3BMWA 3EYUH 4G5ZL 1ZLSH 1DSFL 1GIGL 4ELMB 1DBML 2RR3A 3BP4A 4M6MH 5F7EH 4DN4L 5DJ2A 3VRIA 1KNOA 1XGPA 5ADPL 3D0VA 4N5EC 3RWFB 4GRWF 1Q8MA 4U1NA 1VGEH 5D1XD 2ZNWA 1KOAA 4KGJA 5KVEL 1FZOA 3KYKL 5C9KA 5DJXA 3L3GB 5FM8A 5KZCD 3BUYB 4NQEE 1URLA 5F6HI 4HWEH 1HHHA 4NO0D 3CK0H 4OLXL 4FFVD 3QXVA 1C12A 4RGMB 4JFQA 2CPCA 5CBEB 4FTVB 1AHWC 5I1EL 2AV7A 4LNVA 3M07A 4UDTA 4GW5A 2D31B 1FE8L 1N8ZB 1AKJA 1NBZA 3G5XB 1FV1A 4HEPG 4QHKI 4I13B 2GW5A 2LTQB 4S1DC 3RDTC 2ZUQB 2D7TL 4BZ1H 2E3VA 4RAUA 3O11B 1NUNB 1FJ1B 3FT2B 2WIIA 4UDTB 4HXBH 3GMPB 2YC1B 5EH1A 4OZFA 3GRWH 1TZHA 4IHOB 4KV5E 1U8HA 1M05B 4LAQH 1HXMA 2BJML 1UEYA 5D1XB 4ODWB 1WLHA 3IU3B 3MOAL 1U93B 1H3PL 3R0NA 4PGDB 5GGTL 1AGCB 5FA4B 3EYOB 4NO0B 5B3JE 5E8OA 3SDXB 1QFHA 5JNYA 2FB4H 2VABA 4NKMA 3LV3B 3OTTA 3GBLA 4MJIE 4ZD3H 5B39B 1YC8A 4R8WL 3LN4A 2X1XR 2JJWA 1JGUL 1BOYA 1KIRA 5IV2A 3BX7C 5D4QA 1IGFL 2W91A 5B8CA 1UKTA 5EIVA 2PR4L 4J6RH 2NZ9C 2IALA 1SY6L 1OGAE 1ZGLM 3AM8A 2GSIA 2IBZY 3SCMC 5MENB 1WCQA 3VXSB 5KW9L 1JGDB 2N4IA 5IB2B 5J9PA 3C6LC 1RU9H 2NR6D 4LVOC 4NKQB 3SJVB 4EUPA 2YK1H 4OAWB 3KYNA 1FPTL 3HLAB 3ARYA 3C9NA 1N0XL 1ROWA 4TTDC 4HH9B 1KTRL 1TNMA 3AC0A 1JNNL 4PLKD 5ID1B 5IFHL 2VZSA 1IGCL 1CDJA 3D39A 5GS0L 5GS0D 5E5UB 2ATPB 3CLFH 4HXAH 4OSUL 1EFXA 3ZE2F 1GPOL 4G6FD 1MCWW 4LQFH 1A3QA 1RUQH 3ULSB 3ETBF 5I0DA 1G7MB 3PNWB 2AJSL 2X89D 4Z77A 5CLWA 2NXZB 2V6HA 1D5BA 2EEBA 5EU4B 4MA7L 5T3XH 5JW4R 1GGBL 3MPCA 4X6DF 2JELL 1L9NA 4WHTA 3QO1A 3O3EA 4XXCC 1IC4H 3TJHD 3L5XL 1DL7L 2X09A 3SJVD 4MA8L 3MFGB 1YYML 3NIDF 5DUBB 1A7PL 3IT8D 5DDHA 1YN6B 5E9DD 5C0DA 4KJWD 2NY7H 5HI3D 3LPFA 4IRJC 4H1LH 2VITA 1CBVH 1HCFX 1AO7E 4JFEB 2VL4A 2A38A 3T04D 5BW7C 4XZUB 1ZLUK 4O4YL 1LP9F 1BOGB 3K4DA 2AI0L 4JG1H 1HQRB 8FABA 4Y0GA 3OZ9L 3W11C 4PRPA 2P8LB 4FQXD 4WWKD 5JHDA 3RQ3A 4U1NB 4YHML 1I1RA 3VW3L 2W0FB 3LHPH 4B7IA 5C0RH 4Z8FH 4J4PC 3O45A 1DQJA 3RAJH 3GK8H 3UBXG 1BWMA 3O6FD 4HUVB 5FUZH 4N5ED 2DB8A 4WV1C 4X4ME 5D1XC 3H9YA 4KUZL 4LPUA 5ESAA 3QEQA 3GJEA 4GQ9L 2X9WA 2P5EE 2V17L 2WINB 3WNLA 4M48L 2RJMA 1QLRB 2B0SH 1G9NL 3NCJL 5IR1B 4UBDD 3CX2A 1NMCC 1BGXH 1HYRC 4KY1H 2K7PA 2ZKHH 5FGBC 4ELKB 5JW4N 4NKDA 3QH3A 2AEWA 3FO2B 4EUPH 3X12B 3NACH 4MS8C 3TC9A 4KPHH 1T20B 5AAMA 3QIBB 2R0WH 3GO1H 4Y16C 4X6EA 4J3SA 1WITA 1NFIB 2F53E 4P2CG 3VG0H 2XXMB 5J12C 1FLRH 3BHBB 2CIKA 4IJ3C 1DZBA 1B9ZA 3IFPA 4M5ZL 3LKQA 2ADJA 3C60C 2R29H 1YEFL 4PR5B 5DQJB 5EO0B 1UJ3A 5HHVH 5FO7A 4JRXD 5JR1L 2ADJB 1MFBH 5C6TH 2DQHH 5DURD 1XF3A 2R4SH 2ZWLT 4POZC 3C2SA 4PJAE 3V5DA 2H3NA 4X5WB 3VCLA 5JW5B 1HIMH 5DJYA 1U8IA 5EO1A 2Q8AH 1C1EL 5I1HL 1LMKA 4UTBL 1A7NL 3KPRD 2R0ZH 3QIUC 5D5MB 5GISL 2VH5L 3QQNA 4R4BA 2V2TA 2BRRL 1OGAA 1IBGL 5A2FA 1OW0A 1ZANL 2E8YA 1T5WA 2FHBA 1V8HA 1JGEB 2R2BA 3GRWA 4JPVL 4J2XA 2YD5A 2HT3C 3JWDH 4N90E 4P3DB 1J8HA 3VI4F 4AEFA 5ITFA 5HYJA 5INDB 4LCUB 5KOMC 4MJIA 2DTMH 3WL9A 4R7NA 2HFFA 1T5WB 2B2XH 4X4XB 5E2VH 3Q0HA 4BSWB 5JO5A 5BV7B 4PLKC 4UT7L 2GSGA 1U8LB 4XNXL 4XRCB 1RMFH 3B2UC 4N0UB 5E6ZA 2CDGB 3KS0J 4WFED 3L1OL 4P9HH 4H0IA 1BF2A 4LQ1A 4LVHC 5F89A 1MFEL 3TA3D 3RFZC 4LSVL 5TQ0H 3BAEL 5F9DC 1RJYA 4FQ2L 1OD9A 5D7IA 3DVNB 1T5XA 4NGHH 2AXGB 3BZ4B 5DMKB 4KZEH 2A0LD 4P4KD 5ESVA 3RI5F 3HC3L 2GTZB 1MPAL 3O11A 4OQTH 1KJ3H 2FYYB 3TZVB 1KF9B 1I3GL 1FH5L 1I8IB 5IF0B 4X6BB 2ZOLB 3WIHH 2VLKB 5JMRA 3C5ZC 3PP3H 3KPQA 1A6TB 1P4BL 5ESQA 1RZIA 1HHKA 1AQDB 1DL7H 4ELKA 1OAUH 3KJ4B 4M02A 1MCKA 4MCZB 4XBGB 2P42B 4ZS7L 2V5RA 5DZNA 4QHUB 3MRRB 1LO3L 4KI5E 2DQDH 4UT6L 3VMOA 3LS4L 4NUGH 2FZ3B 4M1CD 1QSFA 3ARDC 3Q2CA 3DV4B 4YK4B 3DROA 5EO9A 5I1DA 1A7OH 3D39B 4HJGA 1OTTD 1ACYL 1EA9C 2X40A 3BKJH 1CE6A 3QQ9C 3DX6A 2VXQH 1P6FA 1JV5B 1TPXB 2G60L 2V5YA 4M9OA 4XRCA 4DOHE 3D3VA 3CXHJ 3IF1B 3NCEB 3HI6L 4L4TD 3VXQB 2XQYG 5KSVA 3B9AA 4EUPB 3WBDA 2FX7L 3ZT6A 3RZCD 5IB2A 5ACMA 4L4VE 5J9PB 1ZA3B 4TQEL 2AQ1A 5DHXB 5H37H 1KEGH 4LSUL 5D1ZA 2VLJE 2C5DC 3MV9B 3REWA 4Y4HD 5FYJL 3PV6B 1KV3A 5IMOB 2X89A 5D7KD 1FDLL 1YY8A 2F5BH 3S36L 4R96A 5DDHB 1WWBX 4WFFE 5A3IC 4KRPB 3ZYIA 3F58L 5IG7B 4MD0B 2Q20A 4PY8J 3CZJA 3VDAA 5DMIL 5TH2A 3QDGD 4MA1B 5DK3A 2Y06L 4OZGF 3QBTB 2X4OA 4YUEH 4EI5B 4ZSOB 2MCG1 3DLQR 4RZCA 1YN7A 4U1HA 3BPOB 3GSWA 4NRZA 5T5NF 4DJMA 4XP6L 1MNUL 3HR6A 2F8VA 2FLBT 5FO7B 3BPCA 3LKPB 3P9LB 5JDJA 2MSPA 3IVKB 3C8KB 4P5TA 4Z7VB 4BFBD 1QFWM 3GHEL 1E4XI 3ZKND 4TULL 4IHOA 4F2MA 2VWEC 5E70A 2ICES 4DCQB 3NAAL 5EIIB 1H3TA 1RJLA 5HTSA 3MRKB 1P2CB 1S7XA 2EYTB 4OZHF 1DUZB 1N3NA 3G08A 5I66A 2VDLH 2CDFB 3CZFB 4DEPC 1ZMYA 3PWPE 4CAGA 1IFHL 1WQVT 3IYLW 5FYJH 5ACLA 2X4RA 4Z5RA 5T3ZE 5D2NE 3V6ZB 1A9EA 2GK0A 3LN5A 4P5TC 1GZPA 5J13B 1A6WH 3OQ3B 3VWJD 5DJXB 3QQ3B 3K74B 1K4CB 4M48H 1NC4A 5E2WL 4GXVH 3ARWA 5CILH 1F3JB 1Z6JT 4G7YH 1WWWX 3B2UD 4HQQL 5H35A 4LIQE 5CJBA 3AU1B 3MGTB 5I1CL 2BSRB 3L1OH 4ELMA 4X7DC 3NGBB 3PWVB 2LU7A 1VERA 1PVHA 1AGCA 3BP6B 5FA4A 1F3JA 3UYPA 5EO9B 3GIVB 3STLB 3OJMB 1YZZA 1S9WA 2QV2A 2L7JA 3PL6C 4ODWA 2CKBL 2G2RA 3QUYA 3TBSA 1M05A 4WTZA 2V5MA 3HMXL 4PJ7E 1U8MB 1FL3A 1REIA 3ZT7A 5I1IH 1D5ZA 5ESQB 2ICWA 2MFNA 4W68A 2EDNA 4RRPG 5ERWA 1A1OB 5E03A 4N8VB 3OR7A 1YQVL 1Q9OB 1BQHA 1W8NA 4LRNH 1JK8B 3PP4L 3QB7C 5DUPH 1JPSH 4TTDD 2VDQH 1RZJL 3MLYH 3LY6A 2OX5A 3GM8A 4MD4A 5HYJD 4ODHH 5I8CA 1KJ3L 3Q6GH 3GB7B 4ORZC 2R56H 3JXAA 3GSRA 1DQLH 1RJZB 2WBJB 5CLTA 1VEOA 2Q8AL 5I1HH 5JW4M 2PO6C 3LH2H 1YEKL 4RWYH 1RFDL 4EI5C 5T1KA 5EU6E 2ADGA 1CFVH 5EORL 3RVUC 1YEIH 3IJHB 2Z31D 2V7HB 1OB1A 4H20H 3SDXF 4JREB 2ATPA 1ACYH 4MNQD 3RVVD 5DUMH 3TWCH 4M93B 5MEOA 4H1LG 5HHVL 3P30L 1YC7A 1KTDB 4CBPA 4DVRL 3ECBB 2A2QT 2CMRH 4GKZB 4TUJA 2OR9L 3CFBA 1ZXQA 4H26B 5INDA 3KJ6H 5LGJA 4J6RL 1KJVB 3BIKB 4PJ7B 5BV7L 3HZVA 2CD0A 2YD2A 4LIQH 1MI5A 4XBPA 4WI9A 1CL7L 2UZXB 3RWGA 2R9HC 5KSVB 4L3ED 4EDWL 1EUUA 3BPNC 4KTEL 2R2EB 1KT2B 4JHBA 1MH5B 4HIJA 3MXWL 4TUKL 4F3FA 5C2UB 2DQIL 4LLYA 4GRMB 4Z7VF 3V5DB 3FZUD 2DBLH 3KJ4C 5F93C 1I7UB 4FQJL 5F7DB 4PJIA 3T0EE 2FJFA 4K94C 5DF0A 3EO1A 4XI5C 3NH7H 3VFMA 1AGEA 4R90H 4L8SC 3HR5A 2F19H 3LKQB 4XNXH 4Y8AA 4JLRA 1KC5H 3KPRE 3B4NA 2C1PA 3WFBL 4QGTA 2CH8A 3VW3H 1RZ8A 2JCCB 1XGUB 5FKPA 4DK3A 1J87A 5IKCB 1TZHB 3LQZB 4M6NH 1JCKA 1IAIL 4QCIB 4XP1L 5IW3A 1J5OL 5BO1H 5GGRY 2JB6A 4R97B 5JHDD 5CZKA 1PYWA 1D5XA 4BFIA 1ZHNA 3OPZH 4GKSB 4AMKL<