3LS5L

Anti-tetrahydrocannabinol fab fragment, free form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPTTMAASPGEKITITCSASSSISSNYLHWYQQKPGFSPKLLIYRTSNLASGVPARFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSIPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural insight into the molecular recognition of a (-)-Delta9-tetrahydrocannabinol and the development of a sensitive, one-step, homogeneous immunocomplex-based assay for its detection
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Light chain of antibody Fab fragment
total genus 53
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L01
4HIJB 3SDDC 3IU4H 4OIIH 4PJBB 2AI0H 3LKQB 2VXQL 4UV7L 4PG9B 2R1XA 1AQKL 2AJVH 4MNQE 4ZFZA 3MRNA 1TTGA 3G6JB 1IILE 4OLXH 4WFGD 4MAYD 3TVMA 2B20A 4IDLA 1UACL 3M1BA 3MNVA 1JMXA 2FX7H 5HY9A 4ZNEA 3DMMB 1EEYA 4OFVA 4M1DL 1W0YT 3F7YB 4KI5E 4Z7WB 4X6CA 5ICXA 4M7JL 4MQTB 4PRBA 3D5OF 4MZ2A 4HLJA 1L7IH 3L3GA 5TFSL 3BD5A 4QNPE 4QTHB 1R5VA 2Z8SA 5C0BA 1LO4L 4YWGL 4F9LA 4MSWA 3O45A 3LEVL 2Q7YB 4WTZG 5GGUA 5B22A 1K6QH 3SDYH 3EYOB 1JPSH 2W0FB 3G08B 4I8DA 3QRGH 4K3JH 4LSVH 5F1IA 3KPRE 3FZUD 3NZ8A 3EFFA 4B7LA 3B6SA 4U1NA 4UOW1 3MRDA 4KUCF 5LCVH 4WTZA 1FH5L 3GBNH 2ZOKA 1MY5A 5D70H 3UBXB 3S88H 1E4JA 1VCAA 4ACPA 2OZ4A 2DQIH 2A6DA 5EU5A 2EE9A 1A14L 2BVPB 4A6YA 4G6FB 4NKMA 4P2RA 3DUUA 3FKUS 3VMPA 2B5IB 1RUAH 1LVEA 5I16B 3KNBB 2VQTA 1I4FA 4CMMB 3PWNA 5IJKA 4IHOB 3LKOA 4I0PA 1K8DB 1RHHB 3D3VA 2FCBA 3LMJH 3MLUH 5HHNA 3TBVB 4B41A 1MREL 5CGMA 4PJGB 5E94B 5EO1B 3QQ9D 3RU8H 3O41A 1V05A 4WUKH 4JHWH 3FOMB 1HSAB 5I17B 2EDNA 3VFTA 3A67H 5JPMB 2YUXA 2V7NA 1UADC 4NWTH 2BNRD 2AJXL 1OLZA 2B1HH 5KVFH 3VXSA 4GUPA 3MRQB 3MRJB 3UJTL 2MQCA 15C8H 2J88L 3K2UH 4X5LA 4EOWH 4EDWL 1DQJA 1HXMB 4U6VH 3O2DL 3MUZ1 1FNFA 5AG8A 4JJ5B 1WIPA 4NPYA 4U7KA 3T09A 5J12C 3RIFF 4JEGB 2ITDA 5BZWA 2R2HA 1FFNB 4V2BA 5IEHA 1GPOH 1OSZA 4PLNC 4U6HB 4JHBA 1KPVA 3LIZH 4I2XE 4YIQB 4PBVC 2NY0B 3LN9A 3F6LA 4KJQD 3NA4A 2H32H 5CCKH 5TPWH 1XF3B 4UOJA 4DQOH 5T1DL 1FNLA 5KW9H 1KXVC 2FLBT 1NEZA 3IDNB 1GCFA 3VFPB 1J05B 5EU3A 1KLGA 2FIKB 2BP3A 4OV5A 4JY6B 3ARFC 3AM8A 3KPOB 2VLKB 1FIGH 3TNNA 2YPLA 1PKQE 3G6AB 4LCWA 2QHRL 1M1SA 1IAOB 3WS6C 5BS0B 3GI8L 1XGYH 1FAIH 5JW4R 4FZ8H 1RZ8A 5EOTA 4MB4A 3LS4H 4Z7UB 3OXRA 3VRLE 5BJTB 5KJRH 2YOCA 4ODXA 1JMZA 1P84J 3VGEA 3CDYA 4YDIH 4CN4A 1U3HA 3GBLA 2W60A 2V2XB 1MHHA 4GMSL 1BD2A 5B21A 3VXUE 3T0EC 1DLFH 1F6LL 1PFCA 1ZHBA 1QA9A 1DLHA 4LSTL 3SCMB 4HKZA 1II4E 4OSUL 1UG9A 3FQRB 3PGCB 3MFGB 1OGTB 2E6JA 3QEQE 5HHQA 1TENA 3WJJA 4NHCH 5HVWA 3CVHA 3NIDE 5B3NA 4HS3A 5GJTH 5DR5L 5ECJE 4XP6H 5HHME 43CAB 2ILLA 2FLRT 4Z5RB 1KELL 2P5WB 1S9XA 2NW3B 3S34L 3WDHA 1YYMH 3FAXA 4PTTA 3ALPA 2EDLA 4CRPA 3VGBA 3TIDA 2MMXA 1JHLL 3MRFB 1H3PH 1AR1C 3F5WA 3ZLQC 1U93A 5DJXB 4J6RL 1YY9D 1KJMB 3B9VA 1YEGL 4PR5A 5DD5H 3SGKC 1GOFA 4KDTC 5AAWA 2J5LB 2VZVA 4XHQA 4S10A 3U36A 4QRPE 1DQMH 1HHGB 2WUCH 3VRJA 2ORBL 4F58H 2P46B 2B0SH 1UCTA 1BJ8A 5AD0A 1OARH 4TTDD 3MUJA 1HHKA 5CBEA 1P4IL 2FGWL 2NQCA 5HDQH 2JB6A 4L4JA 2QADC 4KK8D 2JJTA 3W81A 5I18H 3IDUA 5I71C 3OAYK 4CVUA 4NQDD 4K55A 3HUJA 5H35B 1KJ2L 4JM2A 1YEKL 3C9NB 1A4JB 3FJTA 3O2WH 1XGQA 2M1KA 4NNXB 2GSIA 1PBYA 4G5ZH 3UEZA 1EHLH 2DLFH 2A9ML 4EI5C 4JQVC 2A1WL 1NMCB 3UYOD 4KROB 5AYQA 5DMGD 3NIFE 2HJFA 3MLTA 3HMXL 3WUWG 1UM6H 1BAFL 1DN2A 4EVNB 2OI9B 3GBMH 3FT2A 4JQXC 3X14B 2JTDA 2Q6WB 1GXEA 3QYCA 3BUYA 1I7UA 3EDJA 3GMPA 3E3QE 4JAMA 4LPYA 2X4RB 5E4EC 4RA0C 4RNRB 3SDCD 4AMKH 3BQUA 3CCHB 3GSUB 1OT1A 4OGXH 2VR9A 1IBGL 3RWDA 4P4RA 5KSBB 1OW0C 2VYRE 1S3KH 1VESA 2OR8A 4UU9A 4IRZH 4D9LL 3FHQA 2E5EA 4Z9KB 1HXYA 4Z7OF 5IVXA 5I66B 4HS8L 4JCMA 1U2HA 3VXUB 4RA3A 1W8OA 4TUOB 1NCTA 3DLQR 3DO7B 4PG2C 4LRIA 1G7LB 4I0PC 3LSOA 1FL5A 3MLSH 4HD9A 3RPIB 4A6YH 5I1KH 1AE6H 3DETC 5T33H 1JGUL 5D1QC 2C1PB 4UNTA 5HD8D 1F13A 1F6AB 4MQ7A 3BT2H 4U3XA 4NKDB 2YBRB 4LLDA 4OZGF 1QFWH 4N0FA 4NJAL 2P4AB 3Q6GH 2NY5C 2HLFD 1RZ7L 4ZSOB 4OZIE 4PRHA 1AGFA 1JYVA 3W82A 2D7MA 2GK2A 4BFIB 1JTTA 3N9GH 3QJHB 1AGBB 5JA8B 2RBLA 1HILB 3IKCA 3TCLB 1OAKL 4Z76A 5IK3B 3THML 3RL2B 4LHJB 2C3XA 3GM0A 4K7PY 3O9WC 4HUXB 2F19L 4BSWB 1MIEH 1HYRC 2Y23A 1D6VH 2A6KB 2DM7A 3E0GA 4YDVB 3PWVA 2BJMH 2Q20A 4RZCA 2C3VA 1G9NH 2VL5B 1IGFH 1RUKL 1BVZA 1QFPA 4LCCA 4X9BA 2EC8A 2EECA 2P5WD 1LQSR 4M1GL 4XPBH 4TUJB 2NY7L 3HFML 4HS6A 1R3HA 2R23B 4L3ED 3MCLH 1GGCH 4MYWB 3B4NA 3MBXH 1IC5H 5C07A 3F7QA 4L29A 5HYSA 4F9PA 4IMLB 4JO3H 3P30H 1SY6H 2NW2A 3RKDC 3UMTA 2HN7B 4FTVA 3B43A 5D96B 5GRVK 2UY7A 1D9KA 4GRLA 5IEKA 3C5ZA 3GHBL 1F3RB 3ULVC 5DO2D 2YRZA 2OJZH 4OZHA 2V9TA 3DX8B 1I7ZA 5E9DE 5JNYB 5GRYA 4F57L 4UIMA 5DUPH 2XRAH 4AL8L 3R8BB 1HYSC 3U9UB 5HHXH 5C86A 4Y4FC 4ZG1A 4OFYA 2CRMA 3QEHA 1CE1L 2VDNL 5L7XL 5A43C 3NH7L 3S37H 4YDJA 1U95B 5JHDA 2E3VA 3A6BH 1T7WA 3ZKNC 2DJSA 5CD5C 4IRSD 4XMKL 1T1ZB 3FFDA 5GGRB 5D7JB 4U1HB 5I19H 1YJDL 5DJ8A 2ZPKL 4HWUA 1AR2A 3UZVB 5JLZA 3DBXA 1B6UA 4G6JH 3MRMB 3LN4A 3ZKQD 1LD9B 5JZ7C 2HT3D 3C09B 3S88L 4Y19E 3IDYC 1JRHL 5GGRA 1R0AL 4TUKL 1JPGA 2VIRA 2NY5H 1SMOA 4Y5VB 1INQB 5IMKB 1J88A 1SEQL 2VAAA 3K1KC 5DK2A 3DVGB 1QP1A 1CVSC 1U8IB 2BVQA 4J3UA 5EWIL 2AEIT 4R26H 5C0RL 1O0VA 3MRKA 1I7TA 1S7XB 3MV8A 4P3DB 2H1PH 2XN9B 4P5TA 4BZ1L 2PYFA 5BVJB 2QEJA 5DI8B 1S8DA 5L6YL 2BNRB 1NC2B 4FFVC 4JO4L 1S78C 3JTSB 3ZHKA 1YYLH 1G9MC 4ZYKB 4P5TB 1KJVB 2NY2D 1KIRA 3U0PA 1FVDA 1HDMA 1XF5B 1ZK9A 3QUKB 5C0BD 1AR1D 1C5DB 2P1YA 1HE7A 1LWRA 2NR6C 5DJZB 5DVNA 1ES0B 2NZIA 3ULVL 3QZWA 4JRXB 1OPGH 1UWEL 1E6OH 1VFBA 4P2OB 4U05A 4EUPA 4Q7DA 1C5BL 4PJXA 1H8NA 2F5AH 3E6FB 4LCIH 2OTUB 4WTWA 4FXKA 4WHTA 4FQPA 3VD5A 4L4VA 4HF5L 1CFSA 4EOWL 4N1EA 5I1HL 1FBIL 4PJDE 2FHBA 1UVQB 3I50H 3CFBA 1OQOA 2Q8AL 1YDPB 4LVEA 1YEDA 1OAXH 4WW2A 5EUOA 3TCXA 4TNVF 3VD7A 5T1KA 1FNGB 2YEZB 1BZ9A 5FKAB 3AB0B 3IXAB 3KLSA 4QOKA 1WZKA 2VN4A 3RX5A 5IK3A 1WAAE 1DFBL 3EYSH 4JZJA 4XBPB 1IAMA 3BZFA 2PNDA 3IB4A 1UCBH 1ACYH 1MIMH 4QHMB 3ZYZA 3TF7C 1AC0A 3QJHA 4NKOB 4EN3D 2NY0C 3RUGF 3DV4A 4GKOA 3RDTB 1LK3L 4FTVB 2VDPH 3OJVC 4P2CG 1IM9A 3LH2L 2ATPB 1G1YA 4MX7B 4N9OB 1XH3B 4EI6A 1F02I 4HG4K 3TC9A 1B4RA 4M5YH 4WW1B 1BJ1H 1V3LA 2BVOA 3QP3A 5D1ZA 3VWKD 4NUGH 1UXSB 4W6WB 5IW6B 3QG7H 4Y4HC 4JHAH 1RSFA 3T65B 1IKNC 1G7LA 4G42A 2AABH 2K3TA 1VFUA 3P40A 1W8NA 4M6OL 2DQJH 4YHZH 1GHFL 5C8JB 5HDLA 3FQXB 3D0LB 3MOQA 1KCSL 3FAWA 3VDBA 1VDGA 5DR5H 1EUUA 3P11L 2M8XA 2GJJA 2GTZA 1NBZA 1WICA 5JHLL 4M02A 5CINH 3PDOB 3PWPE 3OAUL 5F9OL 1F90L 3PJSA 1HSBA 5IV2A 3LD8C 5GHWH 2R8SL 4P5KA 4NN5B 2ZSWA 4TOYH 3N1MC 2FJHB 5MENE 1UXWA 2C5DC 1RZJL 1AGFB 1X4XA 2XZQH 4K3EH 1WZMA 1BQLL 1DVFD 4U7SA 4CGTA 2Y6SD 5FYLH 1MCHA 4KDVA 1A7QH 5FM4A 5J12B 1YPZA 3PWUB 4OZFG 3QIWB 4YPGB 4L1DA 3HN3A 2C1PA 2CO7B 3GJFA 4GG6B 4XNMB 3PIQB 2CKBL 4GKZA 5D5ME 5LAXA 4K71B 2APTA 4JQIL 4UILH 1G84A 2AEQH 2J8UF 4LSQL 4G43B 1P4IH 5K9OB 5GS0H 1QHOA 3MV9B 5C6TL 4YBQD 4JM2B 1WWCA 4XWGH 4NNPH 5EBMA 2MNUA 1F3DJ 1CXHA 1DBKL 2W9EH 5C08E 4MJ2A 2BC4B 2K9UA 3EOBA 3KPPA 2HMIC 2JCCA 4YGVB 4HPYL 2VDKL 3W2DH 4U2ZA 3FCTA 1EFQA 4Q9RL 3C6LA 4NN5C 4O00A 3CUPA 1N0XH 2CXKA 4ZUTB 4C54A 5A2KH 2ZG3A 1J0KA 3O2DH 3QNYB 1DBBH 2EDRA 1HHGA 4NM4L 2FBJH 5KSVA 5EC2B 4IOIA 3I6GA 3QUZB 3DROA 3MPCA 4Y7MA 4OLUH 4LLYB 3NAAL 5MEPB 3HMXA 4F33A 1BPVA 4R4FL 4ODUB 3RUGB 4JZNA 1SMAA 4HMCA 5EU4B 3QG6B 5DJ0B 2R1YB 3A0OA 2VDLH 4WI3A 1FFOB 1EFXB 1RZJC 1VPOL 4HQQH 1A7RL 2NW3A 1QBLL 3MOBH 5I8OH 4S1DC 2E7BA 1KIPA 2QKIB 4S0SD 3V5DA 3BPNB 1FVEB 1Q72L 4MWFB 1FN4B 4JGUA 5IMMB 4UTBL 4U1IA 4HS3B 2Y9RT 4OBRA 3QH3B 3T4AB 5KSAA 4Q6IA 4OF6A 4GMTH 3N1GC 1X3DA 3EYVB 2ZUTA 3WE6B 5KS9B 2VITA 3CIQA 4JFXA 3TFKD 5AZ2H 1RIHL 4PY8I 4N90D 3SGEI 1Y18B 4UBDC 2SEBA 3LB6D 1YN6B 2XY1A 1JGVL 2QQLH 3BRFA 5SWSA 4PD4K 2NX5A 3I6LD 3TA3A 5ICYA 1JPTL 1AJ7H 4LOUD 5C0BE 2IH1A 4ZXBA 3T3ME 4IS6B 4WUUE 1UWGL 4LCWD 3UCRA 2BZDA 2EZ0C 2R0LH 5SV3A 1LNUB 1M05A 4PJFB 5IG7B 4UZGA 1PG7H 1ZVHA 1HINH 5KG9A 4NHUB 5HGDA 3WKMH 4ETQA 3HPJB 3ZE0F 3ZKND 1KJMA 4XP6L 3PGDA 5JW4Q 5HHPB 4G6FD 1AHWA 1RU9L 4YX2L 1FAKT 3I3DA 1I8KA 1S7WA 5LCVL 3MRFA 3K1DA 3TIDB 1QSED 3ZO0A 1IRAY 1OP9A 2FRGP 2IADB 3KLHD 4UNUA 2VTFA 4MGXA 1S9XB 4O58L 1RAMA 4XI5D 4UT9L 1EUTA 5EZJB 1QYGL 4XPFH 2VLJA 1X5KA 2CLVA 3B2VH 3H3KA 1A14H 1K2DA 4X9GA 2V2TB 3HHRB 5DD5L 3ZE1E 4HBCL 4NOBA 1ZT1A 4POZD 5IF0A 2NY2C 4XP1L 1JP5A 4X9FA 3FQRA 3GHEL 3HUJF 3MRLA 4HIEB 1LO5B 4XP9H 1KFAH 1FZJB 2WNGA 4O5LL 1HXMA 3U4EB 1BEYL 4M1GH 4XP4H 5CJBA 3RZCB 2NXZD 1BIIB 1U58A 2VDQL 3D0VA 3VXSB 1YEHL 3MRHA 4KRPD 5C0DB 1EERB 2MTPA 4C56A 4LQFL 1JZ2A 4FQ1L 1MCWM 2Y5TA 4JFQB 1OCWL 3TBWA 4ZOCA 5F1KC 5H37H 3UBXI 3IDMB 4LSVL 4BJLA 3VD4A 4WFED 2NY4D 1FL3A 1AY1L 4K2UH 4ZUWA 3UC0L 5L8KB 1AQDB 3P9LB 4L8DB 2VC2L 3VFPA 1NFIB 4U2YA 3TBVA 4E41D 3QUXA 5D7IB 1EO8H 3H6JA 3OL2A 4MNGA 3UTQA 2F8XC 1IGIL 2OR9H 3MGOB 3O0RL 2XRAL 5ADOL 2DWEA 2UWEE 4PV8A 4NQDE 3S96B 5BZDA 4YHIA 1CDUA 5E6IB 3UYRL 2B39A 2V17H 3GBML 1U8MA 3MODH 2AXFB 4WHCA 3B83A 3G5ZB 2PTTB 2QQQA 4JDTL 2GAZA 5J1TC 4G6KL 3WLWD 2XKNA 4K7PX 5HHOB 3JWOC 5CJQH 1JPST 4KGJA 5BS0D 4I18B 1IM9D 4M61B 4F7CA 1R3IL 4HW6A 1DQJB 4Y4FB 4GXVH 2ZOKB 1KJ3H 2UV3A 3NTCH 4U1SA 4HX1B 2C7UA 4U6YA 3SKOA 1DANU 1EHNA 4WNQA 2BRRH 4D9LH 1S7TB 4WU7A 4YE4L 1G7IA 2JJSA 4QYOB 4JRYB 4OF8A 4R96A 4PLKD 2PO6D 1G6RB 3H9ZA 2BFVL 3OKDB 4FQQA 2CLZA 4PBWD 4QLRA 3QUMH 5C0BB 2B1HL 3BPLC 4AG4L 5KVDH 1EHAA 4JFEB 4NQXB 3RVXD 5F7HA 4A6YL 1D9KC 1AE6L 4NFCA 5A2JH 3ULUF 4LPCA 1UH2A 4LKCB 5I16A 5JTWA 4MJ5A 2YRLA 4XMLL 1RHFA 2W9DH 1CGTA 1W2KT 4JFPA 2X4NA 3CMOH 4ZTOL 1U3JA 2BY2A 4P2RB 1I8LC 4OCRH 5JXED 4J1UA 4PGCB 3ULVH 2BERA 1H0DA 1HZHL 3G04B 5DS8B 4R2GB 2PR4H 3H42H 4XNYL 5EG6C 2XZAL 3H7BA 2H6PB 4M7LL 4GSDH 5FYKU 1WAAA 4WJ5B 1U91A 1IGJA 2ZCHH 5DZOA 2AJ3A 35C8H 2B5IC 4OLYH 2AV1B 5T1LA 5I1EL 4UTAH 3B6SB 4U1NB 5ACMA 2VB5A 4LVHB 4U1GB 4E9LA 4LLMA 4J3WA 3NFNA 3VFVB 1E28A 2VQ1B 1J7VR 3B9KB 3EYOA 1WITA 5FGCB 5GGUB 2IFGA 4F7PB 2BJML 4R9HA 4TPRH 1FJ1B 4PRIB 5F7MC 5E8EB 3TIEA 4NO2A 1JGLL 1N3NA 1KN2L 3VWJD 4NZUH 1DFBH 3EYSL 4F58L 3NZHL 2NY1B 3CLFL 1A7BA 2VABA 3FO9A 4PJGE 5A3ID 3CX5K 3CPLB 3HFMH 4YC2C 3HNTL 3HR5B 5DJYA 1ZHNA 2AS5M 5I75C 1NGQH 1TITA 4FQ2H 4KROD 1I1RA 1MCIA 1ND0A 4P99A 1J0YA 2YD1A 4OTXL 5I76B 4Y1AB 2J6EH 3W11C 1L0XA 2YUVA 5C70A 5D2NB 3NIFF 3C8KA 3EO1B 3TNMB 4MA8H 4LRIC 4XBGA 1RULH 2H8PA 3RGVB 3D85A 1SYSA 3MFFA 1LE9A 4U6XB 5I73B 4G8GB 5TF0A 4NBYB 1C8PA 3IJYA 5CFHA 5FCUH 4HUNB 4XBGB 2UWEA 4FTVD 1HQ4B 5L9DH 3RY6A 2QV2A 1CT8A 5DD0L 4RWYL 4L8SB 3OKKB 4R6UA 3O3DA 3SDAA 2DL9A 3O3UN 5E2VL 1VA9A 5JHLH 4OUOA 5FO9A 1MFNA 4U1MA 3MLUL 5JXEA 1BOYA 5T1MB 2J6EA 2QSCL 3CZFA 4LBEB 2Y1VA 5DFTA 1I1YB 5KOMC 4NCDA 1WCBA 3MRCB 4PJ9D 4I77H 3HI5H 3F6IA 4R2GC 4UIKL 4GKSA 5IHZB 5JHDD 1K4CB 5A2LH 2LV4A 2VABB 1WBYA 2DLGA 2CXGA 3HE6C 5L2KA 3QDJB 5CIPB 5EO0A 3ZDXE 3F12B 5GJSL 1AH1A 3QCUH 4PJAE 1A0QL 3NABL 1UB5B 3UTTB 3LB6C 2AJXH 4HUMB 3SE4A 5TE6H 3X3GL 3U6RA 4PREA 5EOQH 2J4WH 1D5BB 1CL7I 4R96B 3O3AB 2G60H 3QQ3B 4F2MB 1AGEB 5C7XH 3G5VB 3WIHL 3TM6A 4G8IA 4OI8A 3IJSA 3FFCB 2YPVL 3OAZK 4PJDF 3GSOB 1ZA3B 1U91B 5BMFL 4HH9B 4K71C 3H7BB 1NANI 4RCAA 4GBXC 1I75A 4R3SB 1H3WM 3DOSA 1OAZL 2CUIA 3CDGA 1JPFB 2MHAA 2AJZA 1DBJL 1UYWL 3PQYE 2OXGA 5DEGA 3RI5K 4P9HC 5E2UH 2ZSVB 3RFZC 3OB0K 2DM4A 2VL4A 5H8DA 2Z91A 5D7LE 5HTSA 4LHUB 1J5OL 1YQVL 3K4AA 2R4RH 1A1NB 1RIUL 5FGCE 5GS3A 4Q0XL 1NFKA 3BE1L 1T7YA 3BZ4A 3VG9C 1B0RA 2OS7A 1G6RH 3DX7A 4Y4KD 5J11B 2CRYA 4P9HH 3P4OB 2AV7B 3H9SD 3O6FD 4AYFA 1PZUB 2O5YL 1BQHA 5EZOL 2FO4A 3SOBL 1TFHA 4HUVA 4TVPE 1IGMH 2AK4A 1UWXH 2CK0L 3KYMA 4X7TB 1G7IB 3IT8D 4PJ8C 5C71A 3CU1A 5E56A 1MPAH 2R69H 4CU6A 2DB8A 4KRNA 4KZEL 5GSVA 2V5RA 1CFQA 4A2MA 4PGEA 2I9LB 2OCFD 4PGDA 1CLZL 4P4KA 4M61A 4FQIH 3WUWA 4LARL 1UQSA 3VXTB 2X4PB 1CDGA 5DC9B 3GHBH 2GAZB 3MBEA 5D6CA 4GAGH 4HC1A 4JREB 1RZIB 1QFWI 3OX8B 5EU6B 4Y2DA 5A1AA 5L2KD 1NEZG 4HIHA 3CC5B 1CYGA 4X0KB 2DQIL 2XPGA 5I1LA 4PJ7B 4MNGB 3MLZL 3TH2T 1MHPL 2EDEA 4I0KA 4FQXA 4P2QB 3GDBA 4L8DA 1C12A 3QUXD 3MRBB 3QQNA 4KKBC 2FIRT 4NQDA 1LEGB 1MQKL 3PL6A 5CZXD 5SX4I 4OD1H 3FT3A 5I19L 1KB5L 4JGJA 5FGRA 3TT3H 4OFYD 2IPTL 3U1SL 2NY3D 4UT6H 5C0FB 3ARDC 3RRQA 4I4WA 4XXCA 4H88H 3TWCL 4S1RH 2HJLA 2CRZA 4YAQA 1B0GB 5DJCB 5KG9B 1X5LA 3AREA 1GAFL 3DTXA 2H2SC 2PXYD 3Q1SL 4JLRA 1QO3B 1JRHI 5EBLB 2AXHA 2CR3A 2DIBA 4K7FB 5HVHC 1JV5B 5CWSA 4G7YL 4MXVF 4NQEB 5DQ9A 3ZHLA 4J3XA 4YQXL 2LAGB 2AJUL 3MNWB 1Y18A 4QF1A 4U0QB 2VKWA 5KS9A 4V1DD 1GZPB 2OTPA 2YN5A 2FB4H 4Z7QE 1P2CB 5HGBA 3D39B 4XP4L 1E4XL 2X9YA 5IMMA 3Q6FA 1DBAH 1MWAB 1G7JA 2NYYD 5SWZD 3SO3B 3KS0J 2EEBA 5BV7B 2PETA 4M43H 4OZIB 2CMRL 1OCWH 1QR1B 1BFSA 3IDXL 4WI7A 2CPCA 1F4WH 1KCUL 5D7LB 3FO1B 1MF2H 3K4DA 3QB7C 1PQZB 1A7PL 4DGIH 1QSFE 3HG1D 3EOTH 3N1FC 4ODVL 5KW9L 5FB8A 2L7UA 4J23A 5T3XL 1LO0H 1VACA 4RAVB 2WSKA 3FZUC 4DGYL 3ZKSD 3DGCR 3QUZA 4OGZA 3CU7A 1P4LB 2GK0A 2IH1B 3BI9X 2CD0A 5FOBB 3DI3B 3FFCD 5ICYB 3P3YA 2V17L 4N8VB 3SDCB 3MODL 2DI8A 4AK1A 5I6XB 4Z7VE 5J57B 4XPGL 3QHZL 2AK4D 4HKBA 1ULVA 4HUWB 4Z7UE 1T04A 3IVKA 2YA2A 4KVCH 5GS0C 1VFMA 4R0LA 1KENH 2F58L 3QNZA 3S35L 1F3DH 2HLAB 4HZLA 4CUCA 4ZS7L 3FRUA 1MRCH 3BP4B 4OZHF 4LGSB 3WNLA 5F93C 4LVHC 1NLDH 3I3BA 3MV9A 4JFDA 3EJZC 4PTUA 1BVLA 3T77B 3ZL4H 5E5UB 3PP3K 1MJ7L 2XTJE 3BT2L 1SY6L 3MCKA 4HXBL 3CVHL 3VWJC 4C4KT 1NBQA 2IPUK 3HLAB 5GJTL 3QIBC 3TYFA 4XB7A 4JPKL 2R1YA 2C3WA 3CD4A 1RIHH 5JXAL 1ZT7A 3RNQA 4IRSC 1P7HL 4JZNB 4LPWA 4R0LB 3BYTA 4EUPG 1KC5L 3KPLB 3KG5A 1JNJA 1JPTH 1UENA 3HS0B 2E27L 3T2NL 2J8UA 2AK1L 4QCIA 3OGCA 1FVCB 3CSPA 5EUOE 2HWZL 2XWBA 1T5WA 4GW4A 1HHHA 5D7SH 2P43B 4CAGA 5F3HA 2GY5A 5D8JL 4QY8B 2G9HB 1TVDA 1J9CT 1D5XA 4NRZA 3OWEA 3BKMH 5DWUH 4Z18A 3LRSB 4UUJA 4APQC 3FQNB 3IJHA 3RVVC 1A9EA 2ZP0T 5IW3A 2QBWA 3S37X 3T4YA 4KWUA 5DUBB 2B1AL 5EIIB 3UZQA 3FO1A 4NQEE 3KPQB 4HJ0C 3K81A 4CJ1A 5F9JA 3VWKA 5IW6A 3TN0D 1CXLA 1U3YA 5CILH 1BOGB 2Z92A 4UDTA 4R0LC 1MFAL 3Q6FB 3QIWA 2MJWA 3F62A 3IF1B 2Z8VC 4ONGL 1NAMH 4XC1L 3QIUC 1A3LH 2KKQA 4NZUL 1HNGA 5L6YH 1TCRA 5FYKH 5KSUA 1GZPA 2I9TA 1IEAB 4TSBL 4G80B 1VEMA 3M17B 2D7QA 2AABL 3RDTA 2X4SB 1P7KA 2CDEB 4ZPVA 1U6AH 3HC0A 5F3BB 3OKNA 1SJHB 1MNUL 1NANH 2ARWA 1EGJA 2LU3A 2W91A 2AJYL 4WEMB 4LMQE 2EDJA 3AREB 3EOAA 4QOKB 1ADQA 4IJ3B 4XMKH 5TF1H 1AY1H 1A1OB 1NGXB 4H25A 4LP4A 3MJ8A 4IRJB 3NMEA 5MENA 2BXYA 1O7VA 1F2QA 1KUMA 1YDPA 3GI9H 3MV01 3UJJL 5B38B 1NCCH 4EN3C 1VEPA 3ZKMD 4YNYB 4Q9BA 5DMYA 5FKPB 3T0BA 3OZ9L 4X99B 2VZUA 2A74B 4H20L 1OAXL 3VGFA 5TGBA 5EOCH 2E7LA 5F97E 5I1LB 5INDB 5GGSA 2X1WL 2Z9TA 1HH9A 1M71A 1BF8A 4LVNB 4PJXB 4PGBA 5DSCB 4Y5YC 5E4EB 3HG1B 3WDIA 5IR1A 3K80A 4YFLI 4RFEB 5IUSA 2JJWA 4OM1H 4HCRL 4XZUB 4KK5D 1OAYL 4PBXA 3QXWA 3ARPA 5T3ZD 1LK3H 4B5EA 1J8KA 4APQA 5B3JE 4FXGA 2HTLC 4AY0A 3PP3H 1OP3H 5CP7A 2JJUA 1E4KA 4NO0B 4DOHB 5GJSH 1UWEH 4CBPA 1C5CH 1WT5A 3K74B 2XN9A 3FB8A 3S34H 3MXWH 3O6KL 4WW2B 4ZS6C 4JHAL 4X6EB 4HUVB 2MWCA 5HGGS 3Q0HA 4NZTL 5C7XL 1QSEB 1T66D 4GW1B 4M6OH 3V6OA 4BFEA 2XA3A 1JVKA 3P0VL 2FEEL 3CMOL 1ODAA 4L4VD 3WS3B 3MJGX 1DUZB 4KJWD 1SJEA 5I1IL 3C8HA 3IKKA 5FV1L 5AYUL 1QSFD 1Q94B 1Q94A 1P69B 2FATH 5LXGH 1B0RB 3DX7B 2D2OA 2FH6A 2YD3A 4QEGA 3EO9H 5E6ID 4HWZA 4U1JB 5DJZA 2NY7H 1JGDB 1HKLL 5DA0B 4JFFE 1U8OA 1C5DA 1UCBL 3QEHB 3ZTNL 1IC1A 5I15H 5I1CH 4L3EE 1RIUH 4WUUD 1F4XH 2RB8A 4K3EL 3JTSA 5T5FL 4ALAH 1YMMA 5E2WH 5FYLL 3FN0L 3LQAC 1QFHA 1KLFA 1PX4A 5C0IB 3S35X 3A6OA 5ENWA 4ZXBD 4D3CH 2JCCF 5EZOH 5FDWA 4R90L 1MFBH 1HHIA 2D31B 4MNQB 3SCMC 1D5BA 3G6JE 4O5LH 1XZ0B 1SM3L 4M7KH 5IMKA 2F53B 4Z8FH 4M6AA 2G5BB 3VGDA 4FQHA 3MV9E 4JRXD 1XGUB 4BH8B 4FFYL 2HRPL 4FP8H 4ZUUA 2AAVA 3MLYH 5C6TH 4NKIH 4FQ1H 1FZMA 1FRGH 3HZVB 1CXFA 4DFHA 2PYEA 4PFEA 4OZ4A 3BEVB 4KRPC 4RMVA 2VDNH 3L95B 3PABB 2JJSC 4XAWL 5E00A 3I9GL 1BFOB 1U9KA 4R8WL 4YUEL 4OTXH 1XIWB 1IGCL 5ALBH 1LMKA 1R5WA 4XXDB 5DD3L 5IIEA 4GAGL 2HH0L 3RTQC 2BX5A 2Z8RA 5HHOD 3EOAB 4I1NB 4BK4A 4PJXF 1MHPH 5B39B 2JE8A 4Y88A 4JFOB 3IJYB 3QHFL 1ZOXA 3LRHA 4G8GA 5DD0H 4PJHF 1TXKA 4JFYB 4NP4L 1LP9A 3M17A 4YLQT 4HLZG 4XP9L 4J4PD 2DQFA 3J8F7 3MLSL 1ROWA 4UT6L 5BRZE 2DDQH 1LE5A 4KJYA 1TZGL 3FT4B 2W65A 4XNXH 4H88L 5EFIA 1TCRB 3QXVA 3VXRE 4JRYD 1FDLL 4EXPX 3AS1A 3JWOL 1M7XA 2WM0A 2VXTL 4PRPA 3KGRA 3EJYD 5EULV 3GMMB 5ICZA 4HGMA 5KS9E 5C0AD 1F4YH 5E24E 1G1CA 2EH8L 2J1KA 1AD0A 3MV9D 4JRXE 3D1MC 3W0WA 3QIBB 4LCIL 2EH7H 3PWVB 4K2UL 4PG2A 3Q5YA 3W5NA 3UTSB 1I9JH 3CMGA 4LNRB 2EKSB 3MBED 2FX8H 4NUJA 4NRXA 1OL0A 4WUUB 2IG2H 3TIEB 3FN9A 2IQ9L 1IGIH 2OR9L 3V0VB 2AKRB 3TV3L 1Q9OB 1PG7L 4HJJH 1HINL 1DN0B 3B9KA 5ERWA 4WDIA 3EJYC 4OI7A 5B4MD 2C4XA 4OB5L 3RVTC 1U8PB 3BYYA 1SEBB 4YBQC 1ORQA 1CLCA 4JN1H 4Z0XB 2AQ3A 1WFUA 3GMPB 1GGIH 2IANB 1IGJB 2X4QB 1DVFB 4DGVH 5SWZE 5F88A 2FNBA 3H3PL 4XH2A 4KTDL 4EVNA 5I1EH 1GC1C 2EE2A 3ULSA 4OAWA 1G9EA 3B2VL 4OUUA 2FD6L 3CSYA 2N4IA 1DCLA 4DW2L 3B3IA 5F7KC 3GZKA 2H3NA 3GRWH 3C5JA 3FMGL 4KI5D 1WFOA 1X6NA 2HT4C 2BSRB 2GSIB 3ZT7A 4M5YL 1T1WB 4OCYL 1ZWIA 5L2JA 2PW2A 4ZO8A 2GUOA 3FRUB 4K7PL 3P0YL 2VWEC 1XCQB 1AJ7L 4OLZL 3PWJA 2VXVH 3KPRD 3UTTD 1P5UA 5CGYC 4YHZL 1CXEA 1NC4B 3U30B 5F7YC 1OF2B 1EBPA 1YNKH 3WNOA 2XKSA 4QYOA 1MAJA 1MRFH 4WU7B 5EN2A 3ZKMC 3ZKXC 1SY6A 2ESVD 4JG1L 3S98A 4GBXA 5EH1A 5GQBA 2GK0B 1P4BH 3QDME 1TDQA 3NPSB 3KPSB 4TNWF 3OG6B 4LCUA 3BPCA 5FFLA 2XYCA 3PWPD 4MA8L 1M7DB 2D4FA 5DTFB 1ZEAL 5GGQL 4G6JL 4UMGA 1A2YA 1J18A 5KVEH 4TOYL 4JR9H 3D25B 3QFDA 3MRPB 1G7PA 3FHAA 4K9EL 4OCNC 3UYRH 2GSGA 5D7LA 4IRSB 4MA7L 5C92A 2HFGH 1C7TA 4X4XA 5TQ0H 4P5MA 1RZKC 4NNXA 2X89D 3GHEH 3MGOA 3QIBD 5FYJE 4IMKA 2BVEA 4PJFF 2QR0A 4QRSB 4CJ0A 4R4NC 3TGXA 2HKFH 2VERN 2X41A 4KHXL 3U9PL 1A5FH 1QQDA 3NZHH 2AEQL 5HPMB 3PGCA 4KUCD 4PY7A 2PN5A 2AGJL 2XG5A 4XRCB 2I25N 5I8KH 4JFQA 4K8RD 1NMAL 4PP1C 1BD2B 1DBKH 4IRJC 2GQHA 3VXSD 1OP3K 3L5HA 5IROC 3U36B 2O26U 3H9YA 1BFVL 3SDCC 4ODXB 1CZ8H 1MCLA 1EXUA 2HVKB 3U4EA 4APQD 4YAQB 4NM8L 5ESVB 5H94A 5BS0A 4DK6A 1TLKA 4RAUA 5HJ3B 2F54A 5DD6A 3FT3B 3O0RH 3SPVB 1LEGA 3PL6B 1T2JA 3V95A 4KV5E 1CBVH 5EIVA 4OT1L 3I2CL 5GGTL 1J05A 1I1CA 3IDNA 5L9DL 4H1LG 4Y4KB 1ZVYA 5MEQA 4IIQB 1X9QA 1EGJL 5CJQL 1DBJH 2EXWD 43CAA 1KIUA 2P8PA 4R4BA 4RGNC 4DGIL 1A4KB 4GSDL 4NO3B 4JKPL 1CVRA 3UTSD 2DAVA 2YA1A 2VKXA 4IRSA 5F8RC 3QEUB 3RL1A 1TQCC 4MD5B 5FO7A 3MOBL 3PGDB 1AGDB 1FYTE 4MXQC 5DJ2B 1F5WA 2VDPL 2R56L 3NPSC 4JO1H 4KHTH 4XAKD 2HVKA 1M7DA 1I1FA 3PWPA 1A22B 4Y4KC 5IG7A 5FF6A 1ACZA 1YMHA 4F7EB 5GSVB 3LKNA 3PQYD 3WKNA 3IDIA 4KVCL 4RAHA 1N64L 1YN6A 1CIUA 5GPRA 3KXFE 1OF2A 2DQDH 2M2DA 5LJYH 3CGTA 3GB7B 3WE6A 1BLNA 5I1JL 2O5XL 3VH8B 1RUQH 4MWFA 1MRDH 1B6DA 4LSPL 1SJVA 1X5FA 3P11H 5IBTL 4BELD 2BSRA 2IGFL 2OP4H 3LN5A 3T1WA 1FFNA 2QQKH 4DJMA 1EFXA 5F6HJ 4DN4H 3B3IB 1J5OH 3ROOA 4V2CB 4N8CL 3JWDC 3X3FL 1A7NL 3CDCA 4ZOEA 3ULSB 5FEBA 3CXHK 4ZPTB 2HWZH 5IOPA 1RPQA 1CFBA 5HGAA 3UAJD 5C9JB 4R2GD 3ILQD 1KEML 3NN8B 5D8JH 3L3OB 3QIUA 4RIRB 3KYKH 4Y5YB 2B4CH 2RIKA 2HTKD 3WLBA 1MQKH 1KCVL 4UV4L 3K4ZA 1GJIA 3B5GA 2CKBH 4HGWA 2VAJA 3EO9L 2P5ED 3QQ3A 5CUSL 3O4LE 3O3AA 5LGHL 3W0WE 5DGQA 5LWYH 1ITBB 1ITCA 3QCVH 2EDFA 3MRRA 2CDFB 4ODWA 5I15L 3PL6D 4LL9A 5AG9A 3GIZL 3PWJB 2MFNA 3VXSE 1R5VB 1AIFB 4KZEH 4Q9CA 5DFVC 5I6XC 4I0PD 3QDJE 4LLQA 2FHFA 1ZWIB 5IHZA 1CXIA 5A2IH 4MDJB 4MD0A 6FABL 3F7VA 3PDDA 4HK0B 1JNHB 2EEDA 5TE6L 3M1BB 3MNVB 5E08L 1ZS8B 3O6LH 4RMSA 3DSFH 4XT1C 2X7LA 2AXJA 3BHBA 5EO9B 1A6WH 4EKXA 1X5HA 3ARGC 4A6YB 5EIQA 4NDMB 3CSYB 3GJFB 3GRWA 4BFGA 2IPKA 1S7RB 3CSBA 1T6WA 4G6MH 3W9EB 3J7HA 3RWIA 8FABB 4FQXC 2X4QA 3S36X 1F4WL 1T22A 3L1OL 3MV8E 1HI6A 5FHBH 3LKRA 4BSVB 3EOTL 1SYSB 4MXWL 4HKXB 3ZDZF 4E42B 4CU7A 1FYTD 1LDSA 1YEFH 1DN0A 1YQVH 5CKGA 3QQ4B 1ZHLA 3QR2A 1FORL 1QEWA 1IAKB 4WHDA 1A02N 3O2DA 4CN6A 3L3GB 4WUUA 3NFSL 3ZE1F 3KPRA 1I8MB 1R5WB 4MHHG 1RK1A 4XXDA 3CVIH 1A6VH 5FO8B 1OWRM 4XPGH 3BP6A 2R9HC 5ID0B 2RCSL 5IHUH 1FC2D 2A38A 3T65A 5DJYB 1A1MB 2F15A 1MCFA 1BFOA 3X13B 2QQLL 3L95A 3PABA 3OMZA 1JE6A 2ATKA 4MJIE 3LKQA 3L3IB 1ZE3C 4QNPF 3DVNA 4MDIA 3WXWL 5IQ9A 2HFEA 2OM5A 2G5BA 1PEWA 3QSKB 4ZD3H 3CFCL 5DXWA 4CNIB 2ZOLA 4BYHA 1PJ9A 4MNQA 4RSVA 4G3YH 4U6TA 3DV4B 4XNZB 1UM5H 2BVUA 2BNUA 1F8TL 1EX0A 3DECA 4PJEE 4WI9A 4OCMC 4V1DE 1BM3L 2XZCH 5EU6E 1ZANL 1DJSA 2VLJE 2JIXD 3MJ9A 4JFHE 4P46D 3JVGC 2H45A 1H0DB 3HC4L 5DVLA 3K2MC 1U8OB 2NZ9D 5DUML 1WISA 4W81A 1IKNA 2C26A 1D5ZA 5C0CE 5CEYA 1MJ8H 2D9QB 3O4LB 1TJIH 4PYHA 3ARYA 3V5KB 3G5YA 5IKCB 1PG7X 1FGNL 2JCCE 1OTTC 3IXTA 4HFUH 5LBSH 1KPUB 2V2WB 3QA3A 1FZMB 1EA9C 5IQ7H 2B1AH 1C1EL 2FGZA 5F72S 1MRCL 4ZUUB 1VFBB 4WHYG 3L3DA 2VLRE 4KY1L 3HE6A 3SKNA 1ES0A 5HDBF 2HT3C 4ODHH 3HZMA 4X6EA 4LOUC 4YXHH 3GSRA 1CLZH 2FEDC 5FDWB 1KJVA 3TBSB 5F7LB 4U31A 1MFAH 4W4OA 2FX7L 1DTUA 2FSEB 4XPHH 3TFKC 2C7UB 1CG9B 5D6DC 1S8DB 4MB3A 4NRYA 4OJFH 5ISZD 3OJDA 2DQUL 1P5VA 2X4UB 5MHSE 3QI9A 4ERSH 4JKMA 4IRJD 4QHUA 3T8XB 4FFYH 4L9LB 2DF3A 3ILPB 2A83B 3NGBB 5F96H 3D9AH 4LKXB 3UBXG 1FE8L 4QHLA 3SJVE 5IR1B 1K8IB 2APWA 3SDYL 5MERA 4JDTH 5ID1B 4K3JL 5DSCA 4YHIB 2DBLL 1Q9KA 2NY3C 1KJ2A 3ZSSA 3LN4B 1P4BL 3MMEA 2FHCA 2FDBP 4FQXD 3C08H 5K9QG 3QI9C 5CMAB 1U2CA 3HE7D 3SDXF 1QSEA 1QTYT 4GW1A 2IAMA 4L9LC 1MH5A 5JOFA 1PYWB 1DQDH 5L88L 4Z7VB 5I30H 4MB5A 3G9AB 1CR9L 2Y5TB 3VRLF 2CKNA 1UZ6F 3BIBX 3GK8L 4QWWC 3TVMC 4FQCL 1A6AB 3S3JA 1BJ1J 3WO4C 2KUTA 5K59E 4FXGB 3FO0H 5BO1H 3WEXA 1HIML 1CF8H 3OKMB 4P23C 4ZFFA 2CDEA 5T1KD 1P9MC 2WAHA 2XTJB 4LPVA 4XMLH 1UZ8A 4OZFB 4QRQA 2C3HA 2A6JA 4MNQD 2DBJA 1BQSA 4KK5C 1J10A 4HLZH 4NKQB 4FHBD 4MJ6B 5D1QD 1SQ2N 5HYSG 3IAGC 4V1DB 4PGBB 2V2TA 2DQGL 1ZVSB 2VLJB 2PR4L 1H9VA 1HWGB 2AVGA 5MI0C 1A7OL 3JVGA 1KC5H 4WFHD 1BQHG 4OZFH 4YNYA 1QHPA 3S36L 3KPQA 3FQWA 1PSKH 2C3VB 2GHWB 1AXSB 3NPZB 5JO5A 3MREB 2WBJD 5HI3C 5AYUH 3HPJA 4U3CA 2DMCA 2VZ3A 3LVEA 4CMHC 4YHOL 2VLKD 1DE4B 3QI9D 3RL2A 3QDAA 5E1HB 2YKLH 4Z76B 1DUYB 3AY4A 3NFPB 2FR4B 2EICA 3HRPA 5ILTH 4X5XB 5DJAB 3H3PH 5B8CB 1RD6A 4QT5B 3HNTH 5DDHB 5ANMB 3V4VH 2W07A 4GRLD 4ZSOA 5GZNC 3FO2B 2J8UB 1NGQL 3FB7B 4XCYB 2HTKC 4WIQA 4QXTA 4OQTA 3SE9L 4F9PC 4XCFL 1P53A 3CVHH 2L7JA 4LIQH 1SVZA 3SCMD 3MJ6A 2NR6D 1VFAB 3AU1A 1FVEA 4D8PB 3GSVA 2XNAB 1A6TA 2PCPB 4F3FA 1IEBA 1QLFB 3GUTA 2VZTA 4X7SL 2Y07H 1RJLA 3MCKB 3PV6A 3ARBB 3P73A 4X8JA 1DLFL 1RZGA 4U1LA 1J8HD 3DNKA 2DQDL 4HMEA 2B8OT 3O9WA 3MYJA 2XOTA 1MHCA 4MNGE 1MNUH 2NCMA 5AEAA 1QZ1A 3H9HA 2DQTH 4S2SA 3Q3GB 3OTTA 3LHPH 3GMOB 4KMQA 2WZPD 4XCCH 2R2EB 3MUGA 3REWA 4Y8AA 4LHQB 1HHHB 3TLRA 4O4YH 4GW4B 3O2VL 5GGVL 5IBUG 4Z7NE 3C6LB 1UEMA 3BUYB 5IGXL 5ITBH 3NOIA 4UINL 1F4AA 3LD8B 1A9BA 2ESVE 3TJHD 2GTWA 1G6VK 4L4VE 5INCB 4HMDA 3BFOA 3BZEB 1CD9B 4WEBL 2KL6A 4ZO9A 3QNXA 4PJCF 4P2OD 3QCUL 5D2LB 3VI3F 4E5XB 3NIDF 3VXPA 1C08B 1REIA 4R90H 4YHPA 5TE7L 4KHXH 2FB4L 3GUTB 2DQCL 1RI8A 1ZLVK 1IEBB 5TDPB 1BVLB 1FDLH 4JCLA 5KS9F 3ROLA 3BKJH 1JNNL 2HKHH 1NL0H 1MWAA 4KKNA 2E7HA 5F89B 5I1AB 2X5PA 4HXAH 4IM8A 4GKNB 4XAWH 5DQDL 4AENB 4RFOH 4NGHL 3IRZA 1A7PH 4OM0L 3ARXA 1VKXB 5KVFL 4DVBA 1UXWB 4BUGA 3MRGB 3DSFL 4DAGL 1PVHA 5HI5D 3QUZC 5IV2B 2PF6A 3AAZB 4X7EC 4Y19A 3GMOA 4PRNB 3P0VH 2DIAA 3DTXB 2UVFA 4YHLL 4JZJC 1Y6NR 3D3VE 3KLDA 1NDMA 5JUEH 2X4TA 5KOVC 2H26A 5SWSE 4OI9A 3FQWB 2WBWB 1EZVX 5ANME 3I02A 3HAEB 5EC1A 3MRBA 3VFSA 3I75A 4GW5A 2F58H 3ZTNH 5JW3L 1SJXA 2PCPA 4HWBL 4KTDH 5I1CL 4XNXL 3CFJB 2IQAA 5LVEA 2R0WL 5CHNA 2ID5A 1ZLUK 4BQCA 5E9DA 1MJUH 3CFIC 1I9IL 5F6IB 3SY0A 4JPWL 1MCEA 5DRWB 4KHTL 3B5HA 5B39G 5BW7A 5BXFA 4X83A 1P7QD 4F9LC 1X5IA 5ANMA 4ZS6D 5BV7C 3LY6A 5D71L 3RI5F 1T03H 1YY8B 4OD3H 4JFDE 5IVNA 1S5HA 1A47A 2O5ZH 4KRMB 2GCYB 1N64H 3V7MA 2OTWB 4G9DA 2VLRA 4AM0B 2FR4A 2OZ4H 1MCOH 4LPTA 3WO3B 3WXWH 1ZTXL 3OAZH 4X80L 1S9WA 1J1PH 5DJCA 3IXAA 4M6ML 2QQNL 1EJOL 4WGWB 1ONQB 4QXGL 4P46B 3MREA 1I1AB 3M8OL 3RVUC 1PYWA 3KPOA 3EYQD 5FM8A 4DN3L 4OCLC 4U4BA 1UM5L 4HH8A 1Z6JT 3C8DA 1IKFL 3R1GL 3K3QA 3MR9A 4M93B 1BM3H 2YN3A 4P2YA 2VR4A 4L4VB 4P2QD 1JNLL 3CC5A 1XF3A 1G7HA 4U1KB 4H1LA 4KKLC 1AC6A 4HEPG 4NFDA 4EUPB 5KSBF 1WK0A 4P2OA 3IU4L 4JRXA 2CKBB 4G7YH 4D94A 4X7CC 4DVRH 4PJ8D 4PJEA 5CILL 3P9WB 2ZSVA 1UQSB 1HDMB 3TO4D 3OKOB 5DEGB 2GT9A 5HYJD 4P4KB 1UWXK 4KGLA 4R3SA 4PRAB 4ONFL 1NGPL 2D03L 2F9BT 1ORSB 5BRZA 4G8IB 2ESVA 1RIVH 3C6LD 1CQYA 2DKUA 5IMOA 4WO4A 1HSAA 3MRKB 5I17A 3VXNA 5I2IA 5I18L 2P7TA 2XWJA 3VXOB 1A3QA 1KCRH 3HE6B 2EH8H 3SKNB 1INQA 4NWTL 5DFWH 1WBZB 4K8RC 5LGKA 2X9WA 1B88A 4ZUVA 4OCSL 6FABH 2WUBH 4X6DB 1RJYA 3U2SA 2Q3AA 1T2XA 3HZYA 4NC1C 2DICA 1LD9A 4LDOB 4NCC1 4TTGA 1A6WL 1Q1JL 1OSPH 4Q9QL 3O6FA 2DLFL 2R15A 5EORL 5GSRB 4FFZL 4Y16A 3MMEB 4WWKD 4M62L 1CE6A 3BZ4B 2A2QT 3D3VD 3KNBA 4MVBC 3UJJH 1LDPL 4HKJB 5ESQA 2CK2A 1F3JB 4E0RA 1DQLL 5C2BH 5ID1A 3MZTA 4TRPL 4Y2DD 3I2CH 5JHDB 1QVOB 5CIPH 3WN5C 1NFDA 5DVMA 1BX2B 4UAOB 1QLRA 3ESVF 4QRTA 4L9LA 1FLRH 3BWUC 2MHAB 5TPWL 5FHBL 3MO1B 1WAAF 3UO1L 3VFNB 2ZNXA 1I7ZB 3FRPA 1J87A 3LMJL 4HV8A 4CVXB 3C5SA 4ZS7H 3WHXB 3I85A 1LO2H 4AEHH 4Q6YA 1MAMH 5IESH 1UJ3B 1J0IA 2P24A 5HPOA 3BUTA 3GO1L 3GSRB 5FYKD 2HN7A 1P7QA 3RVWD 3ZE2E 3DGGB 2ZJSH 1UACH 4PP2A 4NYLA 3AXLA 4PLOB 3DYPA 3VD3A 3P0YH 1ND0B 1X7QB 3HNSL 5GISL 3CFEA 1L7IL 5TFSH 1CF8L 1FSKB 1KULA 3PHOB 4PJ9B 4P3CL 3WFCH 4PG9A 1X5JA 3S97C 4LVOB 4PJBA 3GMLB 2HFFB 3Q5OA 2Q87A 4NO2B 2GFBB 4PJHB 3KWWB 3VFGH 1HQ4A 1NSNL 5GS2H 3QQ4A 4HAGA 1T7XA 1N7ML 5D72H 3MNZA 1E28B 2VQ1A 3D48R 1BZQK 3C87A 3QUYC 1OW0A 3GNML 3RZCD 2EIEA 1V7MH 4KPHL 2WWMC 1JHKH 3PQYA 4GH7B 3SKJL 4U33A 5T5FH 4DW2H 2VN7A 2X1PA 4WJ5A 5C09B 2X1OA 5D96C 3VMNA 2BNRE 2NY1C 2ENYA 2HFEB 5I8CA 5FYJL 3X11B 4Y1AA 1GH7A 3G04A 4MQ7B 2X09A 5DS8A 3QJFB 1RUKH 3PG2A 1NAML 4XPTL 4ELMB 1XGPA 1VGEL 2VLJD 2ATKB 2DQEL 4NDMA 4ONOA 2BVTA 1H15B 1N4XH 3NCYS 4R7DA 1INDH 3RWHA 5LWYL 3ARFA 4FRWA 4GFTB 3ZTJH 5ID0A 2VXVL 1GZQB 3GIZH 3NCBB 3DO7A 5FUZL 4LKCA 1QR4A 2ZCLL 3FQTA 5DHVA 3EDEA 4MAYB 4HDIB 1BD2E 4X6BB 3SE9H 2MKLC 4XCFH 2DTMH 2EDTA 2IBBA 4B7IA 4HGKC 5EA0H 4NQXA 3DJ9A 5L2KE 2IC2A 3BO8B 3T0AA 1AIFA 1OGAD 3TO4B 4PD4J 5E8EA 1IAKA 1U8QB 2EC9U 2FZ3A 5GIRA 3UJTH 1CDCA 1FH5H 1OD9A 4JVUA 5AUMB 3EKCA 4JFZH 3RWDB 5FGBC 4QRUB 2DQUH 4DN4L 4Y0GA 4OGYH 5F1SA 3MRIA 2X4OA 1TIUA 2VDOH 2VISA 4LAQL 2CIKB 5HHXL 3GSXB 5C9JA 2B2XH 5AAMA 1YECL 4Y4FA 3H7LA 4PJIB 4F7CB 2JIXB 5HYIA 3LS5L 3ZSTA 2EO1A 3DPBA 3RWFA 1GOGA 4PB9L 2XKNB 4XBEL 4NNYA 4NQCB 4FTVE 3WD5L 4DZ8A 2A73A 3OAUH 3PNWA 3MACL 1NBVL 5GGRY 1U8MB 2AXFA 1EBAA 4F37F 3RWJA 3O3BB 1OAYH 1S7SA 3STLB 4Z7WF 3ZTJG 3VXRB 2R1WB 2F54E 3OBAA 1UJ3C 1T5XA 1UB6A 1VGKA 4F8TA 4FXLA 1BQLH 5IB1A 3VH8A 1NMAH 4C56E 2E6PA 4JFEA 1IGYA 2DYPA 5ACLA 3N06B 3Q2CA 4LSSL 1JYNA 2E7MA 4JPVH 1T0MB 3KXFB 5IB4B 4YFLF 5F7FA 1S9YA 1MHEA 4H26B 15C8L 2J88H 4HGWB 3HRZA 3K2UL 3P77B 5DYOB 1MCDA 4OLWL 2I5YL 5K9JH 1XF4A 1LEKA 3BAEH 3BKJL 4Y5XC 4U6YB 4B50A 1YMHB 4J3SA 4D0CB 3ORJA 4YR6A 3HMXH 1U58B 1MWAL 1BF2A 3CLEH 3QDGD 3PWPB 2L0DA 4NHCL 4LSPH 5T1LD 4WTXA 3IYLW 2J3SA 4OKDA 1AFVH 1U0QA 1OPGL 1W0WB 2IGFH 5HHOA 4JN1L 2FBOJ 3JV6A 3IFLH 3OXSB 3SE8L 4PRHE 2ARJB 5GS1A 1HKLH 3JZ7A 1MLCA 2DWEB 5SWZB 4GQPH 1J1XL 1LO3H 4H0HB 2X40A 4M93C 3EJZD 5MEQB 1OY3B 5E2WL 1D6EB 3L5WA 4JZOA 4UV7H 1MCQA 3NAAH 1OTTD 1KEMH 3P9LA 4MJIA 4LSDA 3DURB 3RZCC 4IBLT 2ICWI 3CX2A 3BWAB 2WINA 3KLAB 4FN0A 3SDDA 4L8BA 1FO0L 2R29L 3S7GA 1N26A 5H94B 1C16B 3QCVL 2VE6B 3MCLL 2IBGA 1EPFA 3LKNB 4KXZI 1ZSDA 1LO4H 1S7QB 2KBGA 1QKZH 4JO3L 4Z7UA 5DURB 4CKVX 4ZXBB 2LTQC 4NC1E 5LGJB 2ZKHH 3RHWF 3OJ2C 2ZG1A 4MA1C 1NC2D 3D85D 1FL6B 4LCWB 2H9GA 2QSTA 3P9MA 4ZO6A 5MP6L 3EYVA 5F6IC 1FFPA 1KLUA 1QFWM 2Z31D 4EJ1C 2O5ZL 3L3KB 5IW1A 1D6EA 2CLVB 4JZOB 5IBLD 5J9PA 4F57H 2Y4SA 4P59H 2HVJA 4JPIA 4FS0A 4AIXA 2I26N 1AHWC 3DXAE 4GAFB 3KJ6H 1I8KB 1S7WB 2R2HB 3DHJA 1FFOA 4Y16D 3DRQA 1MJ8L 3LV3A 5DD6B 3VXMA 4NP4H 1CS6A 1IAIL 4IJ3C 4OGXL 5GRXG 1A2YB 3RBGA 4LASH 1F90H 3CK0H 4PB0H 4MLSA 3QPQD 2JB5L 4J12A 2ARJA 1T20A 3HB3D 1M05B 4PJFA 3S4SA 5F21B 4K8RH 3BH9B 3I6GB 1ZSDB 2DWDB 3NFSH 1MI5E 3DUSB 3TA3B 5JPMA 4X98A 1TTFA 3CFDB 1SBSL 3EGSB 5J7CC 1HEZB 2JJTC 4EUPH 2SEBB 1NAKL 2XXCB 3FCTB 2UZIL 2DN7A 1KTLB 4R97B 5IB2A 1Q38A 1YEJH 1XF4B 5EO1A 2NXYC 2M26A 3T4AA 2Q1EA 3BESR 4H26A 1BEYH 5KZCD 5T5NG 2A9MH 2UZYB 4QRSA 2OMNA 3LKOB 4I0PB 1QSVA 3GIVB 4LSQH 5I73C 1NUNB 4FZEL 1JNNH 1B3JA 3VXRA 3CXDH 3LEXB 4KDTA 3STLA 1YPZF 3VXME 1Y0LA 3EO0B 3RIAK 4OB5H 4DZ8B 1DSFH 1T5XB 1UB6B 1W0WA 3BMWA 1U41A 4AIZA 1YNTB 3QUXC 4KKBD 4HPYH 1WIOA 2WUBL 5EDXA 5E2TL 4L5FH 3RY5A 1JHTB 1AI1L 4HWEL 1ZHKA 2A73B 3OB0H 1DVFA 1Q1JH 1CGWA 4Q9QH 3OPZH 3ALXA 4LCUB 1H5BC 2IANA 1YUHB 4IOIB 5JW4N 5KSVB 3S36H 1KTRL 1ZGLA 4P57B 1RZKL 2VRAA 4GBXB 2JELH 2W1NA 4OFKA 3C6LC 4WVRA 1MCBA 2P5EB 4RGOL 2AJVL 4R4FH 3KXFA 1T0MA 5IB4A 3QT2A 3VA6A 1JBJA 1WF5A 1TJIL 5CP3H 4HS8H 5T5NF 1A6VL 2Q7YA 1CR9H 4R26L 2AKRA 3WO4B 5T3ZE 4MSWB 2Q8BH 5J06A 2YHGA 2AJSH 1U8LA 5T3ZL 3TO4A 2V5SA 1XCQA 2DQHH 3BPOC 1FGVL 1VGKB 4YFDB 3IS0X 1EAPA 2AK4E 1P6FA 1CN4A 2YPLE 5DC4B 1XCTA 4WV1C 2EDWA 2LTQB 1GZQA 5J6GB 2ERJB 1FQ9C 3GO1H 1LP9F 4LSRL 1G7MA 4NQCA 3WYRA 1L6ZA 3Q6GL 4OAWB 2VUOA 1DEEB 1AGCB 1E6OL 1YC8A 4PJ5A 5I8CB 3TZVC 3RIFK 4JVWA 3BEWB 4I2XA 5CP3A 2W65B 5EFIB 4U49A 2EIZB 3DUHA 1IM9B 2DMBA 1AXTH 4OLVH 5D70L 5KVEL 5GISH 5F70A 4ELMA 4N0UB 4CL7A 4JFYA 2EIDA 1GGBH 4ZDHB 1YQ2A 3HI1B 2DQJL 3B9AA 3VJ6B 1U8PA 5M7QA 4HWBA 3KLHC 4JFOA 4I3SL 2Q8AH 1T0NA 1E4XI 1F42A 3U82B 4ZXBC 1D5IL 5DK0A 5AZEH 4LU5H 1CGVA 4D0BB 1RU9H 2VUYA 4NRXB 1YEEH 3C08L 2EKSA 2WP3O 5E99L 2N7AA 3GMQB 3VFGL 3D0LA 4ETYA 2DLIA 2EKJA 1U8JA 1IQDA 2ADIA 2C4FU 2BHUA 3UDWA 3NIGE 3W0WB 1C1EH 3ULUE 1JRHH 3TP4A 4G8EA 2IFFL 1RZJH 2MPAH 4U0RC 3MROA 4PUBL 3ARFB 3P30L 3HB3C 1CFSB 4QGTA 4NQVB 1T1XB 2YRPA 2ED8A 1XGPB 2XN9E 3MV7B 4PJAF 3EYUH 1A6PA 4JVPA 4M7ZC 25C8L 1CICA 3U0WH 4UQ3A 4UAOC 1F58H 1VB9A 1BZ7B 4TNWK 2ATPA 1LE5B 2F53A 3EBAA 2YD8A 3STZA 1AD9B 3D2UD 2LQRA 1HHIB 5D5MA 5GZND 4O02L 1DL7L 5F9DC 3BXNB 3BGAA 4MLIA 3DGGA 3ZDYF 4OT1H 3WIFA 1DZBA 5CAYB 4YZFF 1BQUA 2FYYA 3SKMB 3LQZB 1IAII 4XVUC 3QUZD 4BQ9A 1UJ3A 1C5BH 4EDXB 1G7QB 2F5AL 3L7EB 5CEXB 3MV8B 4LDLB 3P2TA 3GMLA 3EZJB 1YEDB 3NIGF 4YEEA 3REVA 4HCRA 2ZPKH 1JGDA 2VAAB 3ARRA 2KH2B 3VGGA 5HHMB 2P5EE 2QADB 3VFNA 2NY1D 4KMTL 4YBLB 5GRWA 1F3JA 4TSCH 5GRJL 4Z7QF 1JI1A 2YD2A 1CE6B 1R3JB 4QRTB 1X7QA 5GSRA 4L4TE 1OAQL 5C0AB 3PXJA 4WEBH 3U0TA 3L9RA 2R2BA 5AWNH 4RWYH 4X5WA 5D7LD 1FHGA 3BQUC 3QZWB 4WI8A 3OHXB 5H2BB 4BM7A 3KHOA 4LRNL 3VXOA 3FO0L 1TZHA 3BDXA 1GYAA 2DQCH 1L9NA 3NTCL 2A9NH 1RJYB 4ZUVB 2COQA 3ARZA 4LEXL 3NCYP 1EVUA 5GS0L 3C5SB 3CSGA 1BECA 3LH2H 4JQVA 2HFTA 3N85L 4W4NA 4Q97A 3O11A 4K23L 2ZJSL 4WO4B 3VGHA 1QNZL 1I7TB 1S7XA 3JWNC 4P3DA 4AH2A 2VDKH 4Q58C 4OD3L 1X4YA 1QLRB 4JY5L 2Z35B 3BP5A 5C0NC 4HF5H 5KN5A 4ZMAT 3RWCA 2UY6A 1E27B 1H3PL 1L4IA 3EUUA 1OD7A 3X3FH 1T2QH 3THMH 2I5YH 5K9JL 2N7BA 3MRMA 1GHFH 2HT2C 5E7FA 1HH9B 4M6MH 5CJ5A 1R3HB 2R23A 4LHUD 4RGMC 1SJEB 3F58L 4JGMA 1NLBL 5FYLD 4PJCA 1MLBB 1T7ZA 3KPMA 5JDSB 4Z95H 4S0TD 2BOCA 2XFXB 3VDAA 4Y4HA 2VL5A 5CINL 4RZCB 3ZDZE 1KSRA 3WNPA 1A6UL 3R1GH 3SE8H 4LIQE 3MR9B 3EJJX 1MSPA 3ALWA 5ILTL 4BSWA 3IDGA 2IALA 1JF1A 3DVFA 1U42A 5GZOD 3E6HB 5I75B 3RY4A 5JNYA 3FOLB 2OJEB 4PRPE 5F7DA 3WXVH 4OKVA 3BVNB 2VLRB 4AM0A 5KSBE 1ONQA 3KYNB 4LIQL 1A7QL 4R7NB 4AT6A 3QULA 1D9KB 4EIZC 2NXZB 1LILA 2NNAA 1S9WB 5JIKA 4EBQL 5F8QC 4NWUL 3V5HA 1FO0H 4RX4D 4X7SH 4H0GA 2VDML 3QG7L 1XFPA 3BKYL 3MV11 2ZCKH 4U1KA 5E9DB 4S1QL 1T89A 1I3GH 2NY4B 3QXDB 3P4NB 4WWKB 4O2EA 4UQ2A 5TGBB 2E6QA 5FM5M 4Z0BH 2PTUA 1PD6A 1KCSH 3WKML 3NA9H 1I8IA 4I13B 4ZODA 1BBDH 3I02B 5I9QB 3OKEB 1ZGLP 2FEEI 4PJEF 5DRZB 4YX2H 1NDGB 1XR8A 4QHNA 1EIBA 5CEZE 4G8FA 2VC2H 1SBBA 5K93A 4XC3L 3QPXL 3MJ8B 3EDFA 3GMNB 4OZGE 5JDJA 4M62H 4L4TD 5E70A 2CIIA 3T08A 3HAEH 3QAZC 4PRNA 3T3PF 1IVLA 4OLUL 1QYGH 1QBBA 2P8LB 2DKMA 2WQ8A 3BKCH 5I8EB 4TVPL 3HC0B 3DETD 3MRGA 5L8JB 4ORZC 3HZKB 4XP1H 2XWBB 4EN3A 3ARBC 4NT6A 3PUCA 2XQBH 4QCIB 4KZDL 4XWOD 3QIUD 4ZOAA 1HHJA 4JRWA 4FABL 5M95B 2WIIB 4OZHE 4WFGE 5DMJB 4JQIH 2R0WH 3MSPA 3OR7B 4LAJH 1I9IH 3VGAB 3ROLB 2AEPL 4CU8A 5F1NB 1B9ZA 4YE4H 4L3EA 4UIKH 4BKLA 2NTFB 2ARJQ 2VDRL 1SBSH 3BPNC 5LQBH 1Z0MA 3UZEA 1JF5A 1E0OB 4WO4C 3IFNL 4PIRF 1YEJL 1T0PB 3T4YB 3HUJB 2YPKA 4OBSA 5KVDL 4ZO7A 4KQ4H 1ZANH 5DRNB 5INCA 4WV1A 1X5YA 1EO8L 2VJXA 1S7UB 3WL9B 3GSNA 2DOCA 2G9HA 4FZEH 3ZYJA 4ZFGL 5KSBA 1QSZA 2Y06H 2ED9A 3WFCL 5AD0B 3JUYA 5EPMA 1MWAH 4OCRL 1D6VL 4ODBD 3OKLA 5KTEH 4RGMB 1TVBB 2OL3H 5CD3B 3DVIA 2CMRH 3CCHA 2OQJB 4K94L 1L7TL 1T4KB 4MA1B 43C9A 3T0WA 1UYWH 3LZFH 1YMMD 2VDLL 1OWWA 1NSNH 1DBMH 1TVBA 5CD3A 3K8LA 3OKLB 5I1AA 1AI1H 3VFUA 1MCPH 5DMIH 2F53D 1S7UA 3Q3GA 3ULUL 1UT9A 1FNHA 3QEQA 4JPWH 2NTFA 4D9RD 4M48H 4YHPB 1ZV5A 3GSNH 1JWUB 4GMTL 4OIAA 3VXPB 4JDVB 4N1CA 3AU1B 4I9WD 1O7SA 3ARBA 2D9CA 3P73B 2HLAA 5C9KA 4EQ2A 1IGML 1Y6MR 1N4XL 2GTWB 3HTLX 1J0JA 3ARTA 1QLFA 1A9BB 1RY7B 4BSJA 3CX5J 2XNAA 2JB6B 4DFIA 5IWLA 3OGOE 5FUZH 5HGHB 4DZBB 1HN1A 1MPAL 4RBPK 5SX4H 4PV9A 1EJOH 4Y5XA 4WI6A 1HHJB 5GGVY 2UZXB 4JO2H 5SWQA 5DZNA 4N8PA 2J6EL 1Z2KA 4NT6B 1N0LA 1T83A 3RA7L 1N6QH 4M7LH 3T3MF 5I8EA 3RGHA 1MHCB 4N0CC 3L5IA 1LDPH 2VLKA 4XVUD 1ZKAA 4YHML 3OKEA 3GNMH 4DKEH 2CIIB 1DE4A 2P42B 5EU3B 3PP4H 1NGWA 1JGEB 4F3FB 1SHMA 4UQ2B 3GSVB 2E9BA 5C0RH 2BVYA 3ARFD 2NTSP 5FYJH 4YH6A 4MD4A 1Q9LB 4LU5L 4HULB 3TN0B 3KPMB 5JDSA 3EYQC 2WK2A 5D93B 3WFEL 4O2EB 4S1RL 2XIDA 5T3XD 4UOW0 3V5HB 1JZ5A 5E2JA 3VXTA 3QXAA 5FA4B 3VU2A 4ZFFB 2H41A 1L0QA 3OKMA 4NQEA 2I9LA 4PGDB 4PJ7F 4DKAA 1YPZE 3HUJE 2Q7NA 4MCZB 1W72A 5EA0L 3NFPA 4H8WL 1FPTL 3V6ZB 4OCSH 4NN6B 1B0GA 3QULB 2OMBA 3SQOH 4DAGH 3FOMA 2WP3T 3KYMB 2XT1B 4LFHD 1OOAA 3QDGB 3NVQA 1AXSA 3BVNA 4GQ9L 3AB0C 1MH5B 4XNQA 2DMKA 4P2RE 2V9QA 3B5TA 3E6HA 4X7DC 4L3AA 1G9NC 4PJCB 1IARB 1U6AL 3D18A 1P1ZB 2B2XL 1RHHA 2ERJC 4PJ7A 2DJ4A 3VI4F 3IDXH 5H37G 1FLRL 3V4UL 4G6KH 2BOCB 2XFXA 4PB9H 1B4JH 4M9OA 3TT1H 1W72H 3OX8A 4BFBD 5A3IC 2R2BB 4N9GB 4D9QE 5IEHB 4LHUA 1N7MH 5D72L 4MNHA 2A6IA 3WFHB 5E03A 3TZVB 2IAMC 1R3JA 4MCYA 3KJ4B 1GIGH 1MAML 5IT2H 4OV6F 4PGEB 5MERB 2K7PA 1MCSA 4IDJH 3QEGL 3VI3E 3REVB 1I7RA 3ILPA 2FSEA 5FXCH 3EFFB 1OTSD 3GSQB 2MQ3A 1A8JH 1INDL 3QO0B 3C6SB 1D7FA 4DKFH 3QUYA 5IBUB 3WNMA 4E41E 3SDXE 3L3DB 5E94A 2ZCLH 4GG6E 4FFWD 4X5WB 4TTDC 5HDOA 5D5MB 2QQNH 4QOKE 3V8CA 5HHNB 2DI9A 3F7YA 5M94B 1S78D 5EBWB 1NCAL 4KJPC 1CGSL 1CLOH 1L9MA 3OHXA 5H2BA 3LHPL 5EU7C 4K23H 2FX9H 3H9SA 2X44D 1MJJA 5JXAH 5DMKB 3U7WH 3L9RB 5F9OH 4JN2B 4JY5H 3U0TB 5I9QC 4JFZL 2BVPA 3O8XB 1MCNA 1JNLH 5DC0A 2ADJB 3MROB 3G5YB 3IFPB 3O3DB 3MGTB 3R0NA 3LEYL 4LAQH 3SDAB 4PJXE 5BCAA 4XVJL 3SKMA 1ZA3A 4DVRL 2W0KA 3F58H 3TPUB 5JORB 1G9MH 5FDYA 3MTRA 5J13C 3HI6L 1T6VN 4U6XA 5JW4M 3MFFB 1LE9B 1IAIH 4C83A 2Y25A 4JKKA 5F1IB 3TT3L 4LASL 5HI4D 2AP2A 4LNVA 4XP5L 2OL3A 1BZ7A 4NQED 5JOEA 5E8NA 3B8YA 2E7CA 1RIVL 2X05A 2V5TA 5EZIL 4HJGA 4M9PA 3VJ6A 5IQ9B 3QWOA 3RWEB 2V2WA 5IHBA 3L3IA 4NQVA 3SBWC 4MQXC 4DCQA 5MHSD 3D39D 2FECL 1YN7B 3MRCA 4EBQH 1Z3GL 1I1YA 3TVMB 5CSGA 4GRWE 3SGDH 4P2RD 3DIFA 3V8OA 2CJUL 3I3EA 4FFWC 3TYGH 3FB6A 4J8RB 1DBAL 1RURH 4NM4H 3FFCE 2PO6A 1QFOA 4PS4H 1IQDB 2ADIB 2UWEB 5JHDE 1MUJA 4QRRA 1DSFL 2R9HD 3PDGA 1XGRB 5ESAB 3RKPA 2VLLA 1BGXL 1BBDL 3LKRB 2BY0A 1HCVA 1CD1B 4JM2F 5E2TH 1H3UA 5EUKB 3R4DA 5A40E 1MAKA 3UJIL 3DARA 1KEGL 3EO1A 2Z93B 4FQLH 2H6PA 2R4RL 5D1XC 3SN6N 3AS2A 3BJLA 1NCCL 2XA8L 1WVZA 4MDIB 5F71A 1HI6B 3PGFL 1AGCA 4WCYH 1N8ZB 3B9KC 3I6LE 5E8OB 4H20H 4RGNB 1KIQA 2WIMA 4TULL 1K85A 4TVPH 5C2UB 1JNHA 3STBA 4PJ5B 1S7RA 3F7VB 3HR5A 4HK0A 4PLKC 3SDXB 4MAUL 2IPKB 4HAFA 1CQKA 4KQ3H 1ZLVH 4OQ1A 3VXRD 5CLWA 3HNSH 2GY7B 4GXUN 4DK3A 4OGAD 5IMLA 3BGMB 4OD2A 4JJHA 5J6GA 5GRUL 2R0LL 4WHYH 5FK9A 4QTIL 4GAYB 3CXDL 4PJ8B 1JK8B 2B4CC 1EAPB 2WBJB 2J7LA 4IOSD 2BNQA 4YO0B 2EYTA 1CFVL 1S9KC 5MEND 1ETZA 3QWRD 2ZUQB 4C56D 1P6AB 1VADA 3WHE0 3WLBB 1NCBL 4S1SL 2AV1A 3SKOB 5IB2B 1NPUA 3HC3H 4HX1A 4LEOB 1IC4L 5E2UL 5JR1L 4U0RB 8FABA 1ZLSL 3V6FB 1DANT 4WW2F 1HEZA 1V8HA 4N0YL 5HGAB 1FO0B 4KRPB 4C55A 5JPNB 1J1XH 1LO3L 4NZTH 2AK1H 3ULVD 3WMSA 4K3GA 4MHHI 1V7ML 4RFNB 4Y5YA 3DXAB 3T0EB 3LOWA 2IMNA 1R3KB 5FYKE 2GJZB 5BZDB 5IROA 1HH6A 3RTQA 1NMCC 4AIZB 2HJKA 3UTPD 3UAJC 3MOAL 3UTQB 2GITB 3K8MA 2DQHL 1K4DB 4JY4A 4GS7B 5C0CD 5HHOE 3BMVA 12E8L 4QXWA 1ZLUH 4ZUWB 5I74B 3LEXA 1HQRB 1F4XL 3BX7C 3GB7A 4JPIB 2CLZB 3D2UB 2ZUQC 3IETB 3ZL4L 1M7IA 1HKFA 2D7TH 3EW3B 1FNSH 1JI2A 1NAKH 4ZFOA 3WSQH 3JXAA 2AW2A 3E2HC 5D7IF 5C0JB 5J11C 3T1FA 4JPKH 5FECB 3GSWB 4NWUH 1FFRA 3EOYG 3NN8A 3S5LA 4JRYE 1BIIA 5D2NE 1SM3H 2CR6A 3EGSA 4M7KL 4RMUA 5J89A 4HFWA 4X4ZA 1YNLH 4Q2ZA 1FZJA 1CK0L 3KPSD 1RVFL 4WY7H 5D4QA 1HOCB 2PUQT 3T2NH 2YPLD 4S1QH 4F7EA 1DQLH 4KV5F 3BH9A 5C2BL 3MLYL 4IOFD 3UPAA 3WN5B 5E6IA 1I85C 1H3GA 1JPSL 1NH6A 3LS5H 1K2DB 2QSQA 1MF2L 3C60C 2HVJB 4IIQA 5KANG 6CGTA 4Y4KA 2IPTH 3U1SH 2X42A 4B0MM 1WTGT 3C2AH 4MXQD 5E99H 2HH0H 4GO6B 4GRWH 5GGQH 4RGNE 2I07A 3KDMA 8CGTA 3AGVA 3IDMA 3HA0A 2F54B 2BOBA 4H0IA 4RAUB 3BKCL 3L3KA 5EOCL 4NO5A 4C56B 5D2NC 1LNUA 1R5IB 5T3ZH 4PJAB 5C08A 2NXZC 5HJ3A 1NGYB 3RZCA 4W6XB 1WIUA 2PXYC 3QCTL 4HFWB 1TZGH 4L8BB 5EOCJ 3SE3C 5LGJA 1QFUL 5DJ2A 1MREH 3BDYH 1FSKC 2V7HB 3IFOA 1S7VA 3GSWA 4LCCC 3QEUA 1LEKB 3G6DL 4P3CH 2Z8WC 4L8SC 4M43L 3N85H 2XTJC 3KLAA 3SDDB 1S9YB 4XRCA 1KCUH 3V5DB 1PX3A 2NLJA 4WRLA 3VWJB 3MLPA 2I07B 1H3XA 2XZAH 3ULVE 1JIBA 4I3GA 2GJ6B 4L5FL 3PHQA 4ISVB 5ETUB 5GS1B 2VZSA 4EDWH 1OM3L 2UYLB 2O93L 2KZ1B 3D25A 3QFDB 2ADFH 2HJKB 1DQQB 4GT7A 4XCNA 4TSCL 2DS4A 2E9IA 3SGJC 2A0LC 4I3SH 1IQWH 4X4XB 4CW1A 2XWTA 1R3KA 4F33B 4GLRH 5DLML 4HPOL 2KPNA 3PNWB 2GSGB 2O5YH 3OXSA 4YR6B 3KPSA 1W0VB 3BKML 4JDZB 5DWUL 3AMLA 4L3CA 5ALCH 1VGEH 2DM3A 4DQOL 5DYOA 2Z4QA 3DRTB 3VXQB 1FGVH 3S35H 3GSXA 1EV2E 3QISA 1MEXL 2VITB 4JFXB 1KG0B 5FECA 1EH9A 5C0JA 5JQ6H 2F5BH 1VADB 2FD6H 3QH3A 3VGAC 4U1IB 1A3RL 2BNQB 4YO0A 2EDOA 5IB1B 4OZIF 1NC4A 2PW2B 2QKIA 4FZ8L 3RVXC 1BMGA 4FQIL 3U0WL 1PKQA 4G43A 1QNZH 3QFJB 1IGYB 2DYPB 5K9QI 1K4DA 2GUOB 4B53A 3MUHL 3QG6A 5DJ0A 3LAFA 3ZDXF 3FQTB 5DHVB 4P59L 4YPGA 3X12A 1JWSA 2ITCB 3RTQB 1I3GL 1FYHB 3RUGA 3I84A 3MLZH 4JM4H 1GGUA 4XH2B 5DHVH 3WJLC 4P2QE 3QRGL 3MXVL 1NLBH 1MRDL 4JQXA 4JO2L 1XIWC 4GAJL 5EC2A 3GJEB 1LK2B 5AZEL 3AS3A 2W59A 3CFKA 1BP3B 2P47B 5EN2B 3RKDD 4ZUTA 1U8NA 1FG9C 4PJDA 4WEUD 2CIKA 4PJBF 2QTEA 3BW9B 5BS0E 4LEOA 5HBBA 5HYJE 2GTZB 3C5ZD 3K8KA 4UB0H 1E6JL 1ETZB 1RUPH 2NPLX 2O61A 2CGRL 3MA7A 4HDIA 5E6YA 4K3DL 3WLWC 1AD0B 1SYVA 4KUZL 3TJEL 1PLGH 3H0TA 1MFBL 3BO8A 5J1SC 2WUCL 1F2XK 3LCYA 4KH2A 4GKZB 4R7DB 1CFNB 3ILQC 3QQ9C 3DIFB 3WFDL 4MAYA 3TVMD 3QIBA 4NZDA 3MBEC 4Z77B 4QGYA 4NKIL 1YN7A 1CLYL 3RWHB 2P5WE 5BOZG 4Z0XA 1WGOA 1BJMA 5E4IA 1LP9B 3QJFA 4HZAA 1KXTB 5D6DA 5ALBL 5E8NB 2XY2A 3U46A 4J2XA 3HKFA 1HSBB 4BQ8A 5ITFA 3BZFB 5MEOB 4U6VL 5HVHB 5ADPH 1RURL 5EZLB 1WJ3A 5GRJH 1RMFL 1XF1A 4NUJB 3EDDA 1MUJB 4QRRB 2HFFA 3FQXA 5B39A 1H8OA 5E95B 1XF2B 4Z95L 4HIIB 4ODSH 5CJ8A 3O6MH 5F44A 4ELMF 4FQJH 5SV4A 4RGND 3BSZH 1IFHL 1M4KA 1W72L 2ADJA 3RX8A 1UXSA 3ZKXB 5CGTA 3BEVA 4OZ4B 5ICZB 1BX2A 2DIJA 3SKUD 5J1AB 4X6CE 1U36A 2OTUA 4PRPB 5J6HB 3RTQD 2VLKE 1XIWA 2FEDD 3AROA 4KI5F 4LEXH 1YEIL 4EI6B 3ULUH 5DRXB 2VXTH 4HHAB 3RJDA 2AEPH 3FT4A 4JO1L 3F7RA 4DCQB 4Y16B 4KK8C 1U92A 3LPGA 3BD4A 3QUKA 4D2NA 2VDRH 4GXUM 3RWEA 1KNOB 3U30C 5LQBL 2KDGA 4X6DA 4JANB 4FQHB 5CKAA 1I3RA 1YA5A 3EDKA 3JV4B 1UKSA 2J5LC 3WHXA 5DURD 2P7TB 4Y4FD 2ICCA 1NMBH 4MXVE 2J8HA 1F4HA 5BVJA 1WC7A 2P24B 3FRPG 2HMID 3GSQA 5GRUH 3U7AA 4ZAKB 1JUFA 3LEVH 3UPRB 5IIEB 4C57C 3CFBB 1ORSA 1R6VA 5FYJD 3V9FA 3AREC 3C60D 1U8KB 3IDJA 4E0RB 3IFPA 4K94H 3VW3H 4I9WE 5CJXC 5KZCB 1YYML 3TZVA 1CCZA 4PB0L 4JFED 1ZLSH 3HZVA 4WHTB 3MLRH 4JN2A 4N8CH 3N0PB 3SJVD 4AZ8A 2YC1A 3HCVB 4YDJB 2XWJB 5DJDB 1XF5A 4EEEA 1DUZA 4LVNC 2P49B 3U9UA 2XQBL 4QRPB 5B4MC 4YJZL 3RP1A 3U2SB 5DVOA 1FLTX 5TQ2H 5IMOB 2A77L 4ONGH 3P4MB 4XC1H 1AO7A 1FV1A 5C09E 1HWHB 1IC7H 2NXYB 4M1DH 2CDGB 5IB5B 3QDGA 5CUSH 2YD4A 5FYKL 5DI8A 1VENA 4P46A 3BKYH 2XG4A 4KKCD 2CO6B 1YY9C 5C08D 5KAQF 1LP9E 1K9TA 4PJEB 1X5GA 1WFTA 4APQB 5DD1L 3MLVL 3I9GH 1Q0YH 1FZKA 1H5BA 3D69B 5FA4A 1Z3GH 5TF1L 3UTSE 3OKOA 1G7HB 4EI5D 1J1OH 1UFUA 5IM7B 2A6IB 1BWWA 3SQOL 3WFHA 1IAIM 3RA7H 4G5ZL 1QBAA 4U1HA 4KTEH 2ICWA 2IQ9H 5FKPA 3ARGA 2F74B 3NCMA 1N5YL 3S3SA 3E2HB 1J86A 4YHMH 5GS1C 3BN9D 4MD4B 5B38A 1MELA 3QUMA 3WFBL 3KR3L 4KFZC 5C0AE 4HUXA 5CCKL 2FWOA 3FB5B 4NO0A 5DK3A 3H9SE 3BPLB 4I5BA 1RFDL 5D9SB 2ED7A 1MQ8A 5K9KB 2J8OA 5E8DL 2XXMB 4IRJA 5IEKB 1KGCE 5F3BA 4WI2A 3LKSB 2XA8H 5BXFB 1MJ7H 1IEAA 4QHKJ 1ERNA 1AQKH 3KYOA 2QSVA 4WUKL 2GCYA 5IHLB 3O6FC 4IMLA 5EWIH 3CH1A 4G9FB 4HS6B 2I9TB 4M4PA 3HE7A 2VZOA 2WANA 2A74A 1MCWW 4GW5B 1Q9WA 3RDTC 2Y7QA 3W9DB 3HE7C 3V4PL 4JDVA 5BV7L 4OSUH 4WU5A 3T0VA 5CHNB 1YNKL 3CFJA 1JZ6A 2A6KA 1N2RB 1CFTB 3RVVD 2BRQA 1NDMB 4L8CB 4Z78A 3RX7A 1TNNA 4RISH 1DEDA 2BCKA 4RQQA 2MCG1 4S1SH 4NQSA 1C08A 3IKCB 4QY8A 1A6UH 1GGIL 1OB1A 2EYSA 3UXFA 1C7SA 5I1DB 2VH5H 3GEWB 4BFIA 3HMWH 1T5WB 4DVBB 3BQUB 5FGBA 4RNRA 3RY6C 3SGDI 1OTUC 4P2OC 5D1XB 2R0ZH 5SWQB 4AENA 4N0FB 43C9B 1T4KA 3HC4H 5L0QB 3BN3B 3PP4L 5FAAA 4P5TD 1E4WL 3QWRA 2HFGL 1NCWH 2YUWA 2R4SL 3QO1A 5TQ0L 3X14A 1MFCL 1ZMYA 4HPOH 1ZT7B 1RUAL 3REWB 3ISWA 3MLTB 4DZBA 2HJFB 4UDTB 5KJRL 3TYFB 4GKNA 3HS0A 4S2SB 1A5FL 4KXZH 2XKUA 3LQMA 1EEUA 3WFEH 5DRNA 5EBGA 5J56B 1OARL 3FL7A<