3LS5L

Anti-tetrahydrocannabinol fab fragment, free form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPTTMAASPGEKITITCSASSSISSNYLHWYQQKPGFSPKLLIYRTSNLASGVPARFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSIPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural insight into the molecular recognition of a (-)-Delta9-tetrahydrocannabinol and the development of a sensitive, one-step, homogeneous immunocomplex-based assay for its detection
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Light chain of antibody Fab fragment
total genus 53
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L01
1IZKA 3FO9A 1I9IL 4XPHL 1INQA 5I0ZA 1XF4A 1BD2E 4Q9BA 3MV8E 1EFXB 1T2JA 1ZA6A 4WV1B 3LRSB 2VR9A 3OKLB 5DMGD 3PWVA 3C6LB 4GBXA 4NCC1 1EJ6A 2Z31A 1ROWA 2GEEA 2MQCA 3QFDA 4LDLB 3SY0B 4UV4H 3KPSE 4HW6A 4NN7B 4WUUE 4XPBL 3FMGL 1LP9E 4X6EB 5DGRA 3QQ9D 1KXQE 3BQUB 3GSVA 5F9JA 1B0RB 1XCQA 4TN9A 5SWZD 3GI8L 1KJMA 3UTQB 5HGAB 1CG9B 1SEBB 2NY5C 5JXAL 3CAFA 4KK9C 5FYLE 1VESA 1T04A 4X8JB 5I74B 3WJJC 3U7YH 1KN4L 4FS0A 4M93C 1G9MC 2ZSWB 1LNUA 3U30B 1HIMH 4GW4B 32C2A 4KK6D 3LQZA 2MJWA 4PV8B 1RU9L 1QSEA 4XCCL 4HK0B 5IQ7L 4LFHD 5DRZA 5M94B 3P9MA 5DD5L 4HKJA 5GS1A 5HHXH 4UINH 2X4NB 5CJXC 1IEBB 4IJ3B 4KAQH 2IFFH 4HIJB 4JO3H 3HZYB 3QDGD 2HTLC 3QEHB 1OAKL 4KGJA 3RIAF 4XMKH 2NY1C 1JHKH 2VL5A 4PRIA 4F58H 4LF3B 3GSWB 4TUKH 3MUY1 2EH7H 2C3XA 3U36B 5K9JL 5TPWH 2EDKA 5F8RC 2BSTA 2UV3A 4X9HA 4NYLB 4YHMH 1DLHA 5DURD 1WEJH 2UUDK 3O3AB 2XV6B 5C08B 1WEJL 2BMKB 4UUJA 1MLCA 2LU3A 5KG9B 3DETD 1XF4B 3IDIB 3WN5C 4BK5A 1K8DB 4P3WA 2GSIB 4ELMB 4UZGA 3TN0B 3LQZB 4KDWA 4ODHL 4Z0BL 4OZHE 1XF5A 4M1GH 1MPAH 3I6GB 2JIXB 3WEXB 1A6WL 3SDXB 2ZUTA 3BT2H 3C8HA 5IROC 2XY2A 3BGFC 5MHSD 3SKMA 1F3JA 3MV7E 4A6YB 3JV6A 5E8OB 5JIHA 2LTQC 2AXGA 1NC2B 3MV9A 4GOSA 4YDKH 4LLVB 5DF0A 4ZOCA 2NPLX 5FYJH 1A6AB 3BO8B 3PJSA 5FYKD 3R8QA 3T2NL 5IW6A 3WL9A 2D2OA 3MV9E 1LE9A 4KI1A 2I5YL 4ZQKB 4QHNB 1QO3A 5K9JH 5TDPA 4POUB 3SKNB 3MMEB 3IU4H 2AGJH 3QH3A 1HHGA 2ZCKH 4R4FL 5CBEA 1I8MA 3MRIB 1T1WB 1M7IA 4L29B 3ULUF 4MYWB 4PV9B 4E42B 3ISWA 3UPCA 1JGDA 4U1NB 2YWZA 4ONHA 2X4OB 5D5MA 1RZ7H 3FB6B 4MD0B 3GMMB 5DJXA 5IFJA 3MNVA 1BJ1H 1OGAD 4PYHA 4PY8I 5E8OA 2IBGA 2ZUXA 3X13A 1UH2A 2H32A 1MFBL 2YPLD 3F7QA 4KRNA 1II4E 1P2CA 1Y6NR 2YUXA 5E5UB 5FUZL 4X6DE 3QWOA 4MNGB 4AMKH 1IGFH 2H45A 2EZ0C 1QYGH 5D7SH 3SOBH 4OB5H 4OZGE 2DQGL 4HD9A 2BXYA 1U8PB 3UBXG 4U4BA 5GGQL 4OB5L 2X9XA 3T77B 5IBLC 3E1F1 4ONGH 4MWFB 3GKWL 7CGTA 4M6AA 1AGFB 1QSFD 3TH2T 3OJVC 5JMRA 4NC0B 1NMAL 1ORQB 1AGEA 2H9GB 5CBAB 1FAIH 1QKZH 2I60H 5IVXE 2Z31C 3O45B 5KVEL 5H2BB 5DJ0B 2J4WL 2IH3B 3NGBB 4JAMA 4F7PA 5L2KA 5DRNB 1MQKL 1JPFB 1ZVHA 2VDPH 4Y16A 4NQDB 1TETH 4NN6B 4KK9D 5C0JA 5F89B 3DSNA 1BECA 3MREB 3ARDD 5IESH 1LEIB 4HGKC 2O5XH 3QEUA 4OBSA 3IXTB 3D3VA 3DV6B 5CJOL 4NQSB 1ONQA 2P46B 4FZ8L 5HPOA 3HZMB 2DJ4A 4TRPH 1UYWL 1TLKA 3WS3B 1W0VA 3UC0L 3RY5A 2LE9A 5DT1H 5E03A 5H37H 2DQCL 1UYWH 4U1KA 2Q6WA 3G9AB 3CC5A 3RUGA 1JF1B 3N1PC 2H3NA 1G7LB 2NY3D 3SO3C 4JM2F 3FT3A 4WNQA 1JMZA 4N0RA 1CWVA 3MFFA 4ZODA 4PJHF 3MRQB 2XOTA 2AJYH 1FSKB 3O6KH 3QFJA 4L4TA 3SDAA 3GUTA 3RKPA 4WO4D 4ZNEA 3IT8D 1DLHB 1HHKA 5IBUG 1L4IA 2F53E 5KBNC 1QG3A 4G8FA 2BNQE 2M8XA 5L88H 1B90A 1U3HC 2HJKB 3TYGL 3FT3B 1ZTXL 3G08A 4K3DH 1MFEL 4F7EB 4QTHB 5B38A 1ZHNB 2YOCA 1NBYB 4YDIH 3QT2A 4XVTH 1WLHA 4BSVB 1DQTA 1FV1B 2DWEB 4N90E 1RI8A 3RVXD 3TO4C 2FIKB 1HH9A 3P0GB 3HMWH 1RVFL 1IM3B 1G7MB 2FB4H 5KSAD 3WHXA 4HBCH 3O3BA 3RZCC 1KTLA 4QOKD 2OM5A 4C57C 5J12B 2BCKB 5GGVH 3L3KA 5JPNA 3WJLA 5C0EA 4OF6A 5EFIB 1XR9A 5JLZB 2IANA 1I9RH 1HINH 4G9DB 1CXLA 4KJYB 4EIZC 5M95B 5TQ0L 3KPRE 4NQXA 1G1CA 2CMRH 5BQ7A 4NC2B 2PO6C 2AI0H 4MNQD 4JKKA 3VFVB 3EDDA 3M8OL 4CVZB 4BELD 3GFUA 3CC5B 1MI5B 3RUGB 4JJ5B 3W9DB 1OW0C 4HX1A 4GXVH 3AREC 3E6HB 3RWFB 4AY0A 3MACH 4LSTH 5IJKC 3PWPA 2EO1A 4K9EC 3I02A 3KGRA 4NM4L 4Y88A 3GHEL 2ZPKL 5DJ2B 3G6JE 3O8XB 4YH6A 1NAKH 4XNMB 1G0DA 4UQ3A 5BZDB 3QQ3B 4GRLD 3JWOH 1UQSB 5DHYA 2E7HA 4YAQB 1EEQA 1YJDL 2G60L 2GITB 3N06B 4MZ3A 4Y5VB 2QBWA 3WIHL 4PJIE 4TNVF 3TESA 2A1WH 3T8XB 4NO5A 4XVSL 1C08A 4BQBA 1T0MB 4M1CD 3LV3A 3KXFA 3BZFB 1SY6A 3MRCA 1CL7L 2CO7B 4NFBA 5F6HI 1DN0A 1FL5A 3DX8B 3ULUD 1P2CB 2WUCH 3F12B 3UXFA 2BERA 4ETQB 3X11B 2GT9B 4Q7DA 5DRXB 1EMTH 3BKJL 1JE6A 1UM5L 4K9EL 2VDQL 1BQLH 4N8VG 4UTAH 1KEML 4L9LC 4O58L 4GW1A 4WFEE 3RWGA 4AENB 3G6JF 1AXSA 4UQ2B 1U8PA 5IFHH 1BZ9A 1HZHL 2GIYA 4DW2L 5IROA 3SHSA 5IVNA 3KYKL 1FFPB 4OM1H 4LHUG 4YBLC 2DYPB 1X4ZA 1FYTE 2JJVA 2K1MA 5HYJA 3RIFK 3FOMB 3P9WB 1I4FA 4EUPB 3GJEB 2ZPKH 5FF6A 2VLJB 3L95B 1AI1L 4NQUA 1E4XL 1TZGH 2XQBH 1TTGA 3C09B 4X6CB 2X4TA 3SBWA 1E4XH 1TZGL 1UB6B 2WBWB 3IDMB 3OWEA 3W0WE 2VLRB 3BGMA 5BCAA 2WBJA 2DL2A 2V5TA 2EYRA 1K8DA 1CT8A 4WWID 3TCLA 2QHRL 3MRHA 4HS8H 4EI6B 5C0JB 2DJUA 1Q9LA 4ZXBB 5EZJA 2QHLA 1A1MB 1X5GA 2C3GA 4O4YH 4C54A 3CFCL 1BAFH 4X0KA 1J1PH 3CVHL 3O6LH 2FO4A 4PGZA 3CXHJ 4LASH 1CLYH 3A6OA 4JY5H 5EULV 5FYJD 3KNBB 1ED3B 1MHHA 2J6EL 4Y2DD 1MCWM 3GI9L 4MA3A 2PNDA 3EYVA 4GKSB 1JRHH 1A9BA 2WP3O 4P48A 5EZIL 2EKSA 4DKFH 2W9LA 1CDGA 1MJUH 5FYKU 4NQDE 5J6HA 3HS0A 4JM4L 3DHJA 2XNAB 1U93B 3BP4B 2F53D 4P2QA 3CXHK 1SJVA 4LCYB 1DL7L 1KN4H 4XGZA 4N1CA 5FM5O 4LAQH 1A6UL 2EDJA 4MXWL 4YGVA 1KCSH 1MFAH 2A9ML 2QQKL 4LAQL 3CCHB 1JPSH 1R3HB 5I17B 3PHOB 5T1KA 4MCYA 1URLA 3QIWC 1CDUA 3L3KB 1FNSH 2CRZA 1GC1L 1WCQA 1EAPB 2X4SB 5CCKH 1YN7B 3KPLB 1NCUA 2H26B 5DMKA 1SQ2N 1FVCA 2JK5B 4MD4A 5EU3A 4WI3A 4XX1G 4KAQL 4U6XB 4KROD 5ICZB 1HK6A 3KYNA 2HKFL 5IEKA 2BMKA 4YHYC 1NEZA 4FN0A 4Z76B 1GHFH 1OSPL 2XKSA 5BOZG 1BFSA 5ICYA 3QISA 1OSPH 1F4YL 4HKBB 1E4KC 3U36A 1JGLL 5D71L 1AR2A 4NZJA 1R5VB 1A7NL 3CFJB 3RTQB 3KYMB 3L9RB 3VFOA 1N5AB 3QNZB 1JPTH 1AP2A 5D93C 4J4PA 1KJ3H 4LLDB 4NN5B 4DKFL 3HRZA 4KK6C 4JPIA 3MBXH 1WCBB 4KMLB 3MQIA 4CRPA 2Y23A 1EX0A 4OFYD 1RZ7L 3IDNA 2J8HA 4AL8L 4MB4A 1U3HD 4OLZL 5AD0B 3Q3GA 4WFGD 5FV1L 4XGZB 3SGDH 3L3JB 3DI3B 4BH7B 5IB1A 3LRHA 1JNNL 1DSFH 2F53A 3AGVA 3HKFA 1MWAB 3E8UH 2EH8H 1DSFL 1ND0A 1TIUA 1XR8B 3VFSB 5ERWB 5GXBB 5JXAH 4P46C 2DB8A 5CCKL 1CYGA 3GM0A 2Z9TA 4HQQL 1KPRB 3WIFA 3RGVD 4KXZI 3A67H 1X6LA 4Y2DA 1MCBA 1KLUA 1HIML 5CUSL 5DLMH 5L6YL 4OF3A 1ADQL 3RUGE 3SE4C 4S1SL 1SJEB 1X5FA 4F37K 4P99A 4D0DB 4D0CA 1IFHL 1RJYA 3TYFA 5SV3A 1P53A 3UJIH 4CL7A 1RULL 3TIEB 2FD6H 2X44D 3TO4A 1TQCB 5BV7L 1HCFX 3WFHB 2IFFL 3MCKB 4DVRL 1S5HB 3HC0B 3O9WB 4EN3B 2IJ0C 4ZTPL 3D2UB 3VXSB 3DLQR 3BUYB 1OAKH 3KLSA 5E2UH 4HUUB 2MCPH 4FQCL 4FMFA 4D0BA 1YECH 4LARL 2Z93B 3IFOA 1N64L 4RSVA 1U8LA 4LEOA 4FTVD 3ARPA 1VPOH 4ONFL 1CXHA 5ADOL 2R9HD 1N6VA 3HNSH 3LPFA 1PG7W 3KYOB 3MLWL 3DVGA 3QWOB 4MNGA 5IBUB 4JFHE 1QTYT 2A6JB 3SQOH 1D9KB 3GSOB 4MMZC 1MCOL 4D94A 5LGJA 1U8LB 1XF3A 3VJ6A 4IHOB 5HI5C 4UV7H 3LKNA 3MV11 3NACL 4GKOA 1CLZL 1T22A 2VLME 4LBEA 4X98B 1OD9A 4X6CF 3OJ2C 5F44A 2I26N 4RAVA 3O9WA 4EN3A 5ISZE 1MJJA 2VLMD 4JANA 5FO7B 1IGYA 2GI7A 4NP4H 2MSPA 1XIWD 3F5WB 1MCFA 3GMQA 4G9FA 2WBJB 1XH3A 3AY4C 3MLXL 1RZKH 2F8VA 3GRWL 4TPRH 2YHGA 3PQYA 3UYPA 1SY6L 5DQ9A 2VXTH 2O93L 4UIMA 1NL0L 1T89A 1ZWIB 1U8QA 4D0CB 2BY2A 3TZVC 1JGUL 5CWSB 5BMFH 1ORSA 5DZLA 4P5MA 2IF7A 2OTWA 1QSEE 3OJMB 1D5ZA 2EE3A 2YPLB 2XZCL 4KVCH 5FDWA 3MV7A 1JZ4A 1QFPA 3ZT7A 2AK4A 2XZCH 1X5LA 5FKPB 5GS0H 1VGKB 3LRSA 1UADC 4HZAA 4R2GD 2WAHA 5BS0D 1PD6A 3MZGB 4YLQT 5TFSL 1DBMH 1I3GL 5DZNA 1SHMA 3VFRA 5D1ZA 5JHDD 3AVEA 4IMLA 1YY8A 3R06A 3ZL4L 4P4KB 1EEZA 5SWSA 1OP3H 4DZBA 5AYUH 5KAQG 4YWGH 2ZKHL 5F7EH 1YNLH 5CGYC 4ETQA 1NSNL 1NGPH 4JKMA 5ALCH 3MV8B 2A83A 5CD3A 1QFHA 2R0KL 3QXVA 5BRZE 1XEDA 4Z7OE 4WWKD 3QWRA 4JRYB 2MQ3A 3D39E 4NP4L 5T33H 2XWBA 4XB7A 3OR6B 4MA8H 5F3BA 2Z8RA 1NC2D 3WFDL 2AABL 3TO2B 3TN0C 4YFLF 3CH1A 4JM2A 4OD2A 2AABH 5HDBF 1I1FA 3RWDA 2P5EA 4UDUA 4DUVA 1K4DA 3O3BB 1MFEH 2I9LB 4S1QL 5C0FB 3M1BB 4WTZG 3QRGH 3WHE1 4P59H 4BSWB 3D0LB 3A6BH 1T21B 3QXUA 1J1OH 5E95B 2ARJA 2F5BH 5FHBL 5IB1B 2GTWB 1HXMB 2EDWA 2M1KA 4KKAC 1FZOA 2VZUA 1JN6B 4NM8L 4HH9B 4Q9RH 2VIRA 4YHPA 3MXVH 1A7BA 4K7FA 2AJZB 2X4NA 4M61A 3MXVL 1P4LB 3X12A 3FQNA 3ARRA 4OCRH 5BZWB 2FDBP 2MPAH 5EWIH 4WO4A 4N0CD 3NIGF 4P4KA 5DURB 1JZ6A 2GTWA 3PDOB 1WV7T 3K1DA 3DARA 1I7ZB 4NZDA 3BKJH 1YDPB 5BRZA 2R1XB 2NXYC 2AXHA 4KI5E 4M6MH 3OG6B 2YPKA 4P5KB 2UYLB 3D85D 1KB9J 4RFNB 4FFYL 3ZDXE 3UPRB 3EYFB 1OAUH 2BCKA 4ISVB 2DD8L 3TLRA 4BUGA 3QDGB 1DBAL 5ADPH 2A6IB 1PYWA 5EC2B 5BVJB 6CGTA 2YBRA 3FFCD 2E9BA 2ADFL 3VXRD 2GK2A 5I1HL 1I1AC 4GKZB 2XWBB 4HUKB 5DJZA 1RZKC 1EGJA 3M45A 3MJ8A 3LKRA 3VDAA 5TJWK 4JGUA 4JRYA 2X4UA 1A0QH 1KELL 5FDYA 1S7TA 5FOJA 3MRFA 3UTTA 1FNGA 3BRGC 3EFFB 1AO7D 3IDUA 1T7ZA 1YN6B 3C9NB 3E0GA 2Y1VA 1AFVH 3DMMA 2HLFD 4UNTA 4OZIF 3CJJA 1JP5A 1LK2A 1JFQL 1LO2H 2MKLC 1F3DJ 3QIUA 3QZWB 5C09D 3IDGA 5IT2H 1JFQH 5JHDA 3BUTA 4KVNL 1D6VH 4F37F 5IF0B 4HS8L 1T7XA 3OB0K 4UTBL 4LSRH 4JDTL 4HDIA 3SDXE 2X05A 2W91A 4AJ0A 4JDTH 2MPAL 4O2EA 2R1YB 5EU7E 5FYKH 3WLWD 5HVWA 3I3BA 2E7LC 5DI8B 2E7MA 1IGYB 3QDJB 1JHLH 5J9PA 1YEJL 4OZHA 1ZT1B 4FTVB 5GHWL 1NCDL 3PHQB 4DZ8A 4HF5L 5HYQB 1RIHL 1S5IL 4H25A 1IE5A 1X6NA 3L3DB 4YHOH 4ENED 2YEZB 3VH8B 3VXOB 2B39A 1HHIB 4ODSH 1VERA 3U4AA 3S36X 1YY9D 3V6BR 1DL7H 5C3TA 1F00I 1YMMD 1EO8L 3O9WD 4EN3D 4HUMB 4XPFH 1A7QH 4I4WB 2OQJB 2QADC 4HWUA 4NWUL 5IB4B 2ICWI 1MFAL 2A9MH 5D7JB 3EOBA 3TCXA 5F96H 2D0HA 2YUWA 3DX9A 3KXFB 4LLQA 4N0YH 4ODWB 2YPVH 1YYLL 3V0WL 2WWMC 3WUWB 3V9FA 5ILTL 3ZHDA 4Q0XH 3S5LA 4I13B 3BGAA 2H2SC 2NQCA 5HI5D 4TUOA 4OZGF 2ZSVA 1WBXB 5J1SC 2ORBH 1R24A 1QR4A 1EBAA 3MR9B 3DMMB 2VXSH 4NM4H 1A2YB 4LSRL 3I9GL 3R8BB 4Q97A 2H8PA 4U7SA 4DVBB 3HMXH 3GSNB 3PXJA 4MLIA 4JKWA 5C6PB 3H9SA 2D3VA 5GGTL 3QEGH 4RIRA 5JORB 2DIBA 4YR6B 1JWUB 1U42A 2VXUH 3GI9H 1HYRC 4QWWC 1F42A 1AKJB 4KTEL 3TO4D 1QNZL 3BSZH 4QRPE 3SDAC 4NNXB 3HAEH 1AHWB 4NQVA 1BMGA 4PJ8C 3GIVB 1HQRB 4KK5D 4LLDA 3WFEH 1ND0B 1MHPL 2VDMH 5B3NA 1NANI 4F7CB 2I9TA 2E7LA 5C09E 4FFZL 1U3HA 1P84J 4LHJB 3GBNH 2EDTA 3ARDC 4I9WD 2DQUH 4K3JL 4WFFE 4XI5C 5F7NC 4TNVK 2FZ3B 5E6IA 1IKNC 1T1WA 1I1RA 4JHWL 4LSDA 3EYOB 1YEEL 4MXVE 3VA6A 5D9SB 4WI4A 1H8OA 5IB5A 4ODBD 5SX5H 4NNYA 3MLTB 4QRUB 3FO2B 1DDHB 5DMGC 1HH9B 4KROB 3AY4A 3TO4B 3IAPA 4NFCA 1M05A 3GHBL 4NBXB 1N5AA 3S3JA 3NIDE 1ZAGA 1EZVX 1XIWA 3NMEA 4OLXH 1OTSD 2J12B 3B43A 3ZE2F 2R69L 3QYCA 5SWZA 5D72H 4ELKB 3QDGA 1T66C 1A8JH 2LTQB 2B4CL 3RDTB 3QEQE 3D69B 4HEME 1CLOH 3MRNB 3P4LA 3RHWF 3X14B 4X5XA 3VFGH 4DVRH 2B4CH 2OMBA 4OF5A 2IAMC 5C07A 3OR6A 5D1ZC 1FFOB 5DZOA 4LPUA 5GRUL 2R1XA 3H2WA 3RPIA 2F53B 4Y0GA 3NCYS 5T1KD 4AIOA 4JN1H 3ZKSD 4JFEE 2EIZA 2NXZB 5JTWA 4L8CB 4ONFH 1PX4A 5INCB 5DUML 4N90D 5BVPH 5D7JD 1IAII 1WT5A 3QO0A 1H5BB 5I1DB 1RK0A 1TFHA 1X5ZA 4DEPC 3O41A 4J3WA 1MCOH 4M7ZB 1CQYA 1JK8B 1JZ2A 1QEWA 4Z5RA 4HPOL 4WHYG 5I9QC 5BOPA 3ES6A 3O2WL 4HV8B 3VWKC 3QDGE 3VU2A 2DTMH 4FQLL 2OP4L 3UTOA 4LVHB 4M1CC 3NN8A 4IRSD 1UVQB 2PYED 4PJCA 2BHYA 1CFBA 1EBPA 2R4RL 1SYVA 2FJFA 1X4YA 4JREB 1YEHH 2BHZA 1BZ7A 1FNLA 3MJ9A 4FQQB 5F1NB 4PJ7F 4HMCA 3W5NA 1G0XA 1DFBL 2P45B 3O2DA 1ZS8A 4Z7QE 3FB8A 2E5EA 3DGGB 3RU8H 4QHUB 4R3SA 5GRUH 2AK4B 3S34L 1GGCH 5HPMB 3PP4L 1QBBA 1MI5E 2J8UB 5E2WL 2NTFA 2CXKA 3OHXB 1GGCL 5DEGA 4GW1B 1OSZA 2OR9H 4GAJL 3BEWB 3JWNC 3IDJB 5GQBA 3RX7A 1ORSB 2AJSL 1HILB 3QUYD 5DHVA 1KG0B 2KKQA 1KEGL 3LKNB 3LOWA 1MCSA 3G04B 1YY8B 3R06B 3QQ4B 3UTSD 2AXFA 3CDFA 3HAEB 4KI5F 5IEHB 1K85A 1DBJH 2HT3D 4LKXB 1T5XB 1ZV5A 1NFIA 1KJMB 1U93A 3UTQA 1EO5A 2ZUUA 4PUBL 4U2YA 4Y2OA 3VFUB 1RZIA 2NW2A 4OIBA 1S7QB 4WWKC 4N8VB 1LO0H 5FO8B 3FB7A 3LAFA 2UY6A 4PREA 5H94B 3O4OC 4LEOB 3VI4E 1ED3A 3H7LA 4ZS6C 3G5YB 1NGXA 4XWOC 2ZCHH 3CMOH 2WM0A 2M2DA 3L3IA 3FO0L 3T0ED 1BFTA 5E8EA 5HYJB 3DMMC 1AGEB 4YIQB 3KR3H 4YHLL 1B4JH 3KPTA 3O8XD 5FM4A 3P3YA 3G5YA 2XFXB 3KXFE 1CE6A 2G9HA 3VGDA 1WFTA 4DAGH 5A2IH 3NIDF 3UJJH 4X6CA 3MFGB 4ZSOE 1UXWB 1BZQK 1FJ1A 2MHAB 3VXME 2ZUYA 4RGOL 1IQDB 5I0DA 2HFTA 2H32B 4J1UB 4YHYB 3C5ZB 5IM7A 5FGCE 2VQ1A 1LEKB 4RMQA 3G6AA 5JR1H 2NY5H 4PJ5A 3BW9A 5IV2A 4LSUH 1DP0A 1G7HB 3QG6B 3WXWL 3LV3B 1OSZB 4X7TB 1R3LB 2SEBB 4OCRL 5K93A 2CDFB 3CXDL 4HK3J 3ZTJG 1IVLA 4Z7UB 4C56D 2O5YL 4MB3A 3VW3L 2D7QA 2FBOJ 5L7XH 3KJ4B 3RVVC 3Q3GB 4JFPB 3VXTB 5L7XL 4N0FB 1NDMB 4JRYD 3QUXC 3PWPD 3SE8H 1F3RB 4U1HA 2ICES 1YJDC 4H8WH 5KSAB 4JRWA 5HHOE 3W9EA 2HT3C 2HLAB 3OKOB 4G6JL 4KTDH 1DBAH 3QUZB 4OZIA 1EHXA 2CRYA 4OD1H 4AMKL 1B4JL 3OPZL 2CH8A 1OAYH 5CP7B 1OVZA 4NJ9H 5A16A 3MRBB 4EDWH 5I1GL 5JQ6H 4RRPA 5D2LA 3RHWK 3ARFB 3OGCA 5J3HC 4RFEB 2XA3A 5EB9A 2I24N 2OK0L 3K74B 4JGMA 1J5OH 4OM0H 2NY0B 1IM3A 4XPAL 2VLKD 1IILE 4WV1C 1C12B 5I1DA 5ERWA 4JR9L 5B39A 2EE2A 2IG2L 1YDPA 5F93C 4KK5C 5IT2L 2ITCA 1XGYL 1Y0LB 3EYUH 3HE6D 5BS0E 3THML 2DQFA 2X1OA 3BDXA 3UTZA 5ESAA 4PGDA 3EYFA 4UTBH 4OJFH 4QHUA 1DTUA 2P5WD 1E27A 3FQNB 5AD0A 5L2KE 1T0PB 4JFEA 2FR4B 3UAJD 5IVXF 1RUKL 2VMFA 2C4XA 5KG9A 4RDQG 4LPWA 1B2WH 4G6ML 5GIRB 3TA3D 4LSSH 4ZFOA 2Q8BL 1N2RB 3QXTA 1NFDE 3QDME 2Z35A 4L3EB 2P5ED 5I6XC 4LFHG 1X3DA 5D1XA 1D5XA 1XF2B 4JFEB 2FR4A 2X42A 4XH2A 1Q9WB 5B38B 3EKCA 4MDIA 4ZO8A 1XCTB 1KF9B 4JFXB 1Q72H 3ARGC 1AXIB 4M6OH 1O7SA 4OZGA 5ICXB 4TYUA 2GKIA 3NOIA 3BN9D 3MBED 3P40A 3O6FC 5HSFA 1T4KB 3QEQD 2C3VB 1Q38A 1NJ9A 4Y16D 2DI8A 4KJQD 1A6ZB 1OAXL 1BLNA 5D9SA 2HRPL 2XKUA 3O3EA 5DO2C 3SJVD 3HS0B 3MLSL 5BO1H 4JQIL 4GW5B 2PF6A 3GMOA 3W0WA 5I1JL 4JY6B 4R90L 2HAZA 1JHTB 4FXKA 4CVUA 3OF6A 4R90H 4LL9A 3D2UD 4CADA 1ZGLA 2ITCB 4XBPB 4S0TD 5EBWB 2BVTA 5EUOA 3WNNA 2F54A 1U91A 1SJHA 3STZA 2N56A 1U8IA 1YUHA 3RL1A 5L2JB 3AAZA 3HCVB 4PBVC 1D5MB 1IC4L 4XP1H 5BRZD 4G6MH 5F88B 5K33A 1J1OL 3DXAA 2PXYA 4EI5A 4JFPA 3QPQC 2ZUQB 2XTJB 2R8SH 5C9JB 3T0EC 4PTUB 3GSNA 3VFTB 4PJGF 1QNZH 3BSZL 1RUQH 3WO4B 2CDFA 3QUYC 3GJFH 3QFDB 2Q3ZA 2CGRL 1Y0LA 1EDQA 3HZMA 2R9HC 1E4WL 4HUWA 1MHPH 2VC2L 1NFDA 4OUUB 1MCHA 4OFPA 3L3GB 5LAXA 5IB5B 1RUPL 1WZLA 3FOMA 1QFUL 3GBNL 4M4RA 2DYPA 3PQYB 1T3FA 3TWCL 4YO0B 1FO0A 4MNHB 3H0TA 4U6HA 4K94C 4ERSH 4HFUH 5DK0B 5I1IL 2UZIL 5D5MB 3C60D 4JDZA 3IFLL 3FB5B 5I76A 1KN2L 5ADPL 1I8IB 3F7PC 4CN4A 4Z0XA 2FECI 3JV6B 2R2BA 3DHMA 4U6HB 5C2BH 1B9ZA 5FK9B 1D5IH 4NGHH 1I4FB 5HHPB 3RBGA 1CS6A 1OGTB 3MUZ1 1PZ5B 3HE7D 2EICA 3FOLA 4OZFH 3STBA 5KS9B 3ARFC 3ULUL 3I9GH 5HYSG 4WTXA 1DUZB 4ONHB 1K5NA 3S36H 1U3JA 1FZKB 1A1NA 1OWWA 2EO9A 1HYSC 3IXAB 3WIHH 4RISH 5ISZB 3L5HA 3H0TB 5J06A 4FQJL 2IBZX 1D5BB 1EZVY 1X5YA 4EIGB 4F7TA 1OQOA 2WLZA 1JI1A 3MOAL 3OJDA 1QHOA 5TF0A 4JZNA 3PWLA 3MOBL 1UVQA 4GRMA 4WWKA 3BPNB 2B5IC 1GRWA 5FXCH 1A6TB 3BPOC 3GSNL 1KACB 4UBDC 2ADJA 2HKHL 4JQXA 2DQUL 4K3JH 5GHWH 4IOSD 5GSVB 3TBYB 1LE5A 1RZIB 1BJMA 2YSSB 3PWNA 4XXDB 5DS8A 3C8KA 3EJYC 4C4KT 5IVXB 2XZZA 3QUMH 1HDMB 4NQEE 2WINB 2YEZA 2DM7A 5DVKA 2K9UA 4YQXH 4XCEA 4OI8A 4Z7UF 1IKFL 3HB3D 5JOPE 1G7JA 3I75B 3LKQA 1U3ZA 5IB2B 3TZVA 1GPOH 4Y2DB 1CU4H 2HMID 3G6DL 2RFXA 1CIDA 3MNWB 1X7QB 5I8KH 5L8KB 4Q0XL 3T2QA 3N1GC 3KPRD 1ITCA 1VA9A 4MVBD 5EOCH 4G80B 4ZXBD 2V7NA 1DQDL 3U0WL 4AT6B 1I8KA 1LNUB 3RWCA 2CKBB 4JRYE 4LHUA 5C08A 1HHKB 1DQDH 3QJFA 5HDQH 3MRGB 3D9AL 2XG4A 3NCJL 4J3VA 3MLUL 4KRPC 5H37G 3MLUH 4M8QB 1CFSB 4E9LA 5SWZB 4JKPH 1J0JA 5HXMA 2H3NB 4ELMA 1TTUA 1P4IL 4JG0L 1UM6L 3K81A 1LP9B 1UGNA 4PJFE 3O2VH 3BXNA 3BJ91 1MNUL 3U0TB 4ZOBA 3QG7L 2CO6B 1GVIA 4NKIL 2QV2A 5DJZB 4PLNC 3NIFE 3NZHL 2DQIH 3H42L 3QJHB 3NN8B 1A21A 4NKIH 3OXSA 5CGMA 4H0IA 4QY8B 1CG9A 5D7LD 5LKNA 3KG5A 1DVFC 2DIJA 4OCXL 1CBVL 1BVKA 1U8OB 3NPSB 4ZUVB 5AZ2L 1N59A 2I5YH 2PYEE 3NFNB 3OQ3B 1TDQA 4Q6IC 4PJIF 1R3LA 2SEBA 4R0LA 1V3JA 2R2EA 3FQXB 4W81A 2X9WA 4H26B 3BKCL 4MDJA 1MCPL 1AD9A 4K3EL 1OLLA 4M7KH 3QUMB 4PJCE 4WRLA 4PYGA 3CX2A 5DJDA 5EORL 2A6KA 4N1EA 2A6DA 5INCA 3BWUC 4M7LL 3B9VA 1IQDA 5ENWB 3OKMA 1FGNL 3B9DA 4PG2A 1X7QA 4OLXL 3H9SB 4RBPK 1UXWA 3MCG1 1DQLH 1VADB 3HC3H 4OKDA 4EEEA 3KNBA 4PJ9B 1P4IH 1KGCE 2YD7A 5DVNA 1OARL 1A4KB 4H1LA 2MWCA 4NKMA 2EXYC 1DN2A 3UZQA 4UB0L 4ODXA 5LWYL 3CDGB 2CD0A 4RMVA 4NNXA 2VQ1B 1SEBA 1SVZA 2OJEA 1T1XA 2FLBT 2FO4B 3WYRA 3LEYH 4GG8A 1LDPH 3FT4B 4GUPB 2P24A 1LO0L 3LKSA 5EO1A 3VD4A 2CK0L 4DJMA 3LEYL 4YDKL 3VRLE 1I3RB 1NKRA 1RFDH 2NR6C 2X4TB 4HXBH 4WGWB 2AS5M 1ACYL 3P77A 4YHNB 3QUZC 3I2CL 2R0LH 1SM3L 4XNZB 1EJOL 2OZ4H 3S88H 3V6FA 1KV3A 4G5ZL 1I8MB 3MR9A 1F58H 5CBAA 4OT1L 4L8DA 1RIVL 5EZOH 3CU7A 2HT2D 1ES0A 4PRDB 1QRND 2IPKA 2EDFA 2PETA 3LEVH 4FFWD 5DK2B 2R15A 3QO1A 3VGFA 3E2HC 4H5SB 1WAAA 2EDQA 4RGND 3SCMD 2D0GA 1OHQA 3INUH 3A67L 4BZ1H 1NGXB 1F2XK 5L6YH 1SVCP 1F5WA 5JW4M 4DVBA 4HC1L 1V05A 2AEPH 5F3HA 1KB5A 2RR3A 4I5BB 5C0BD 3EDKA 3OB8A 2C3HA 2FHCA 4AEHH 2NW2B 1D6EB 1T0NA 1XMWA 2AXGB 3MV9B 3SE3C 5IHUL 4H5SA 2C26A 1DQLL 4PJEE 1LVEA 2W07A 3MROA 1U8KA 3WNOA 2FEEL 4JB9L 2IADA 4J6RH 1Z5LB 2COQA 2WANA 5D8JL 1I1CA 4HUVB 4J6RL 1P4BL 5CWSA 2IBBA 2V17L 4PJAE 4Z0XB 5DSCA 4L3AA 3WKMH 4F15C 4GKNB 2HFGH 4R6UA 1H9VA 2V17H 5E2UL 1U92A 1RIUH 4FQ1L 5B8CC 1C5BL 4V2BA 5B38G 4DOHE 5D5MF 3F12A 2EIDA 3NGBC 4YDLB 4LHUD 5B4MD 1KLFA 2VN4A 4L29A 2VB5A 4ONGL 4XNQA 5KZCB 5SX4H 3VGEA 4PD4K 4W68A 4G43A 3EUUA 3ZKMD 1X5AA 2RGSA 4LU5H 4P4RB 2DLEA 2P24B 4FXGA 4G5ZH 4H1LB 3J7HA 1YNTB 4JG1H 3EO0A 3A6CL 3PNWB 4L8CA 1NCWL 5J9PB 3MA7A 1MVUA 3INUL 1S7VA 4Y19D 3P2TA 1RVFH 3K80A 3HG1A 4KUZH 3BJLA 2X1XR 3N50A 3QB7C 4YNYB 1I7ZA 1YEIH 4WCYL 4AEHL 1HHIA 4P2QE 1OPGL 1N2RA 2VQUA 1A7PH 1GZQB 5CP3A 5KZCD 3P73B 2JIXA 3MLXH 1FLTX 4LSQL 5D2LF 4K71B 3SGKC 1RJZB 3RWEA 1G9EA 1LK2B 5I1CL 1I9RL 4DFIA 2OI9C 2BVQA 3TJEH 1R5WB 1MFDL 3CD4A 1F4AA 3MRKB 1GL4B 3SDCC 1IEAA 5C7XL 5E7BA 5IMOA 3SE3A 1N26A 2FJFB 1BJ8A 2XXMB 1K9TA 5J8OA 4NO0A 3IFNH 5JPNB 2F15A 3LRGA 3ZDZF 2C1OB 4LGRB 4P2RA 4GG6B 3WIIL 3D39D 4M5ZH 3F8UB 5CEZD 1WZKA 3VWKB 4CNIB 2CUIA 5A3ID 4RGNB 5D7IE 3SCMB 2BVYA 3RUGF 5A1AA 3NAAL 3PGDA 4K3DL 1CE1H 1I7UA 4NRZA 5F9OH 2I9TB 4FFVD 3MRFB 3UTTB 2JJSC 5J11B 3QEHA 1KJ2A 5I1KH 4XX1E 2Z35B 4AM0A 1YJDH 2V2XA 4L1DA 4X4MA 4ZAKA 3WNPA 2G5BA 5CEXA 4WW1A 3L7FB 1ZT7A 3GBML 5GRJH 5I18H 5ITBL 2Y5TA 4WUKH 3ET9F 2AJZA 4G6JH 4GQ9H 2A0LC 2A6IA 4KTDL 5EC2A 5BVJA 1T20B 1NLBL 4Z78B 3LKOA 2KDGA 4QYOA 2V2TB 5JOPD 3Q6GH 3VXNB 4FQ2H 3AMKA 4RMSA 5IBTL 3ULVC 1NFKA 4DKAA 1WBYA 3Q6GL 2BSRA 5I1CH 1YMMA 5LQBL 1I8LC 5FV2A 1KTRL 3RIAK 5F7MC 4DQOL 2HTLD 1WWCA 4AIXA 4OM0L 5AUMB 1ZLUK 1R5WA 3S36L 1KCLA 1NAML 2DM3A 4HJ0C 1EFXA 4PJ9D 3Q0HA 3ILPA 3SKOB 2CR3A 3AU1A 4K3HA 1KEMH 1UACH 4NSKA 3U9UA 4U1IA 3THMH 2PXYD 4EI5D 4GSDL 1QSZA 5C0RH 3SKJH 5KN5A 4FQJH 4BYHA 5C0IB 2W9EL 4X0KB 2QQNL 3OX8A 4X6EA 4ALAH 3KYNB 5IEKB 5IHZB 3VI3F 5IMOB 4QHMA 4OQTL 2Z4QB 4JFDB 3ARXA 3VD7A 2ID5A 4KJPC 4U33A 4FZEL 4QCIB 4IRZL 3KPSD 4WUUD 2BVQB 5FGSA 3L5WA 1QFUH 4LSSL 1ZA6B 1UB6A 4P9HL 2X2YA 5C0AA 5I16A 1YY9C 3W81A 3QP3A 1YEGL 2DQDL 3KAAA 1OCWH 1V3MA 5E8NA 4QRQA 2DM4A 3KDMB 3EOTH 3DVGB 3L6FA 1QBLL 3TBVA 5GS0C 3CFCH 5KSBE 1F6AA 3ZDXF 3G6JB 5F6HJ 3OR7A 4APQA 5IM7B 1AGCA 1CU4L 1KPUB 3HNTH 3LPGA 3BE1H 4P5MB 4OGZA 5MI0B 4JN2B 1JWUA 4DZBB 4MD0A 3T08A 1FIEA 3D85A 4O2CB 3V6ZA 3WD5L 2LU4A 3QAZB 5DRXA 3KYAA 2OMNA 4FABH 4PJBE 3VWJB 1S3KL 43C9B 3S35H 1KT2B 1ZHKB 3MBEA 4YFEA 1JNHA 2DWDB 1Z2KA 4TULL 5AZEH 1FSKC 4WJ5A 3UJTH 1QRKA 2XN9A 3FB6A 4LDEB 5HJ3A 1A6UH 2BP3A 3UJTL 5IHZA 1FG9C 3DBXB 4W6YB 3ZZ1A 1P5UA 2LABA 4PJAB 2OTWB 1MCEA 3OKDA 1WK0A 2YD5A 1H0DB 3VXPB 5JW3H 3AREA 1H8NA 4PJIA 2F58H 2DIAA 3BO8A 3V4VH 1RUQL 4ISVA 3D0VA 1M6OA 5DI8A 1OOAA 1PSKL 4CU6A 1XH3B 1RSFA 4Y4HD 1WZ1H 4XBEH 4D9RE 1A7OL 3ZLQC 5CSGA 4H88H 4NFDA 3PWPE 3C2AL 5HVGB 4LLMB 3V2AR 5J89A 1BBDH 3VH8A 3G5XB 3KPOB 1JGLH 5D71H 4POZC 5CFHA 1UM4H 1X9QA 1NC2A 3EJZD 4PS4H 1QSFA 2VLJE 3IJHB 1TCRB 4A6YA 1YYLH 3V0WH 1U9KA 3D25A 4R8WL 4JVUA 2NYYC 3BISA 4KRPB 1ZLVH 4NT6A 4MHHG 3U83A 1AGDA 3VA2C 5I2IB 2XN9E 4E41B 3MRDA 5IW3A 2ARJB 2VO5A 1EFXD 4PJ9A 4U05A 4K8RC 3P77B 3BZFA 4UIKH 4YHNA 5BV7C 3WJJA 3MUHL 4BUHA 5C86A 2DLIA 2HVJA 3UBXA 1A6PA 1MCKA 2DLGA 1OGAA 5E8DH 5EOTA 4GW5A 3P30H 3CFBA 3NFSL 5D1ZD 1YPZE 4HAFA 2IPTH 4FHBD 1MLCB 3WHXB 4XXCA 3L3OA 5F7LB 3FONA 5KVGH 2VR5A 5D2NC 3GNMH 1XGTA 2RCSL 4JZOA 3VMNA 1ZLSH 1FNHA 1NBVL 3M07A 4L3EA 1JK8A 1L0YA 2APXA 5JHLL 3F7RA 2DMBA 1K6QL 3P11H 4G8EA 4HXBL 4M61B 1NLDH 2GUOA 4L1HA 1IFHH 2A6DB 2BFVL 1CGXA 1FNAA 3DURA 3EGSA 3T3ME 1CBVH 4B41A 3J8F7 1PEWA 4Y5XA 4HK0A 3SBWC 3Q2CA 1CFVH 5LJYH 4G6FD 1KCUH 1CFVL 4JO1H 2LVCA 3WUZA 2BNQB 4ZAKD 2RHEA 3CU1A 4DN3H 1A9BB 4UIKL 3O3DB 4GBXC 1P4LA 2D7MA 3MBXL 5DTFA 4PV8A 2Y36H 5F7KC 5CKAA 2R69H 2P7TA 2WZPD 3BQUA 4K8RD 4WW1B 4OLZH 1D3CA 1HXMA 3P30L 1MFBH 2N1KA 3NFSH 4CMMA 1UENA 3DX6B 4QXTB 4PJFA 3WKML 1A2YA 1T83A 2VLKA 3VWKD 2BNUB 3NACH 3D0VB 4X98A 1YEKL 5JZ7D 2J5LC 4MJIA 4JAMB 3T0EE 1IAIL 2GYSA 4YUEH 3S8WA 2CK0H 4S1SH 1UM6H 4EUPA 4J3UA 4F2MB 3GSOA 1FAIL 4NZUH 4OZFB 5DHXB 1GAFL 4WNQB 3QHFH 4H20L 1YC7A 4G9FB 2OL3A 3DSFH 3WHE0 1PGRB 3JTTA 4DUWA 1KT2A 3MBEB 1OLZA 4MWFA 4JO3L 4Y1AE 1AXSB 4UQ2A 4FNLH 3GZKA 4Q74A 1IGMH 3H9HB 2XT1B 2AKRA 3H9ZA 4FG6C 4KKBC 3QZWG 1ZANL 1GGIL 5LXGH 4HC1H 4TQEL 5EZJB 3FRPG 4OI9A 2HA1A 5LXGL 2W38A 3RVUD 1RZJL 4XXDA 1U8KB 2IALA 1PW3A 4XNQB 4LRNH 1JYVA 1HXYA 1KIRB 5IHUH 4Y19B 1XGQB 2KZ1B 1BZ9B 4K3EH 3VXQA 1IL1A 3FTGB 5IQ9B 1NGQL 1J86A 5D5ME 5FUZH 1Q0XL 1NGQH 2KL6A 4KDVA 4TVSa 1FGNH 4NHCH 1M7IB 4PJAA 5LGJB 4LIQL 3K3QA 1FPTL 2GITA 4YIQA 4C83A 2A77L 5IBLD 1CF8H 4GFTB 4UT6H 5J7CC 5CAYB 5D7JA 2A77H 1S8DA 3WMSA 3RY4A 4RX4A 5T33L 1FGVH 1A22B 3CZJA 1NCNA 1NMAH 3ARUA 3X3GL 1KB5B 2D7NA 5DA4A 5GZNC 3ARGB 3V0VA 1RZ8A 3FFDB 5JXED 4RMTA 3ZDZE 3DXAB 3TV3L 4MCZA 4QKXB 4XPTH 1NFIB 1HNGA 2CUMA 1ZT4B 3T3MF 3F7YB 1Q9OB 2AJUH 2ZUVA 3C6SB 3K4AA 2P8PB 5CHNB 3H6JA 3VXRE 2RBLA 3WKNA 4HKZB 4OZFG 2NY4C 1BWWA 5DJ2A 1YMME 4H26A 1C7TA 2XZQH 2X4OA 3PWPB 3KR3L 4YHLH 1A4JB 2A9NL 3IS0X 1RZJH 4AENA 1J11A 3FHQA 3ZDYE 5I73B 5AWNL 5B3JF 3CVIH 1HSBB 5CJOH 1CTNA 4PRNB 5TDNB 4HX1B 4JY6A 4AQOA 1TQBC 5CINL 4HJ0D 4DAGL 2VDKL 4HUNB 5EOQH 3VXSA 1K4CA 1U3YA 2ZOKA 1QRNB 4OAWB 4U1MA 3S4SB 3TBWB 3TJEL 3E3QC 3JWDH 2Q7NA 4NPYA 1N4XH 3DI2B 1FZOB 4QEGA 4RGMC 4Z95H 4FP8L 3CMGA 1U91B 3U0TA 3K46A 1FPTH 4NC1E 1P7QB 4KRMB 3EDJA 5KW9L 2DD8H 1A7RH 4UNUA 2QQNH 5HDBE 3ARYA 4ALAL 1R5VA 4GXVL 4X4XA 1BVKB 1U8OA 5ENWA 4CNIA 5C0AE 1MPAL 3WFDH 1DQQA 4XPGH 2IAMA 2I25N 1J0YA 3O3DA 1KBGH 1BLNB 1QPPA 3QJFB 3GKWH 5EUOB 1OD7A 1TJHL 4PJGE 2YC1B 4F8QA 3X17A 1E4XI 3A6BL 4KUCD 2BSRB 3CPLB 4X7SL 5AG8A 4KHXL 2V7HA 4IIQB 5A2FA 3H9SD 3KPNB 1W0YT 5DD3L 3VFWA 5JA8B 1J12A 4WDIB 3GIZH 3QXWA 4JG1L 3RPIB 1NLBH 4LCCA 5DEFA 1DJSA 3WDHA 1X5JA 3ZHLA 3KPOA 2FEDD 5MEND 5CINH 5IBTH 4ZFOB 3LMJH 1MIML 3TBSA 2QL1A 4GXUN 4HIXH 4ZYKB 1U6AL 5K9KB 4WHDA 5TQ0H 3HG1B 2VZ1A 1MRCL 4MA1B 3M1BA 1KIQA 3QUYB 4FQXA 4Z77B 3EFDL 4OD3L 3BH9B 4HIIA 3QIWA 5D7LB 1P9MA 2XZAL 3BYTA 1JUFA 1G7JB 2VXQH 3I75A 5DT1L 4XPFL 2Z8WC 7FABH 1TPXB 5F3BB 1T2QL 4HG4K 4UT7L 3B5GA 4KJQC 4F8TA 1Z3GH 5EH1A 2VITA 4NNPH 1I1AD 3MACL 1T2QH 3PIQA 5D1QC 3BP4A 5I15L 1KULA 4EI6A 4HS3B 1CCZA 5EUOF 2JB5L 4PP1C 3CSYA 1AGBA 4P3CL 1MAMH 4JM2C 3T77A 3V4VL 3H9SE 2IAND 3OBAA 4F7CA 4GKNA 1FIGH 5BW7A 3V6ZB 4X80H 2EYTB 2FNBA 5SWSB 4PJXB 1JGVH 1UEMA 1ZTXH 2ICEA 3KWWA 4CVXB 2ZCLL 3C5ZA 4GRWB 3MFFB 5HGAA 4RGMB 3KPRB 4IRJD 4KK8D 1UKSA 5T3XE 3IB4A 3RA7H 5MEPA 4YR6A 3VFMA 5EUKA 4DKEH 4PB0H 5EC1A 4TUOB 3BQUC 1Z9MA 3BOVA 1JHLL 1K5NB 1FORL 3IJSB 3V5KB 1MRCH 1AO7A 4UNVA 1RUMH 3LPWA 4G7VH 4N0UE 5E7FA 4LCCC 3O45A 2FGWH 1GH7A 3RVUC 3HI1A 4FQ2L 5GZOD 2N7BA 4ZYKA 5K9KA 2DBLL 3TGXA 4TSBH 4F7TB 4FZ8H 1HINL 4U31A 5GRZA 3UYRH 1G9NH 1TVHB 2GFBA 3UX9B 2XWTB 4UT7H 2DQCH 1JPFA 5ANMB 1MJJB 4LVHC 2ICWJ 4G3YL 1FZKA 2CLRA 1DLFL 1OTUD 1T22B 1A6TA 1UB5B 2V9TA 4G3YH 4V1DE 4HHAB 3EOBB 4FG6D 4KKBD 1ZEAL 4MJ6A 3TA3A 1VFAA 3NTCH 5TH2A 3U9UB 2FJGB 4BSJA 1I7RB 3OJDB 2HKFH 2RAMA 4CGTA 3DROB 1E4WH 5TDPB 2DTSA 2MHAA 4FZEH 3GHEH 1EVTC 4BFEA 1HILA 2WWKO 1R3JB 4IRZH 4HWEH 4YDLC 5FO9A 1WSST 5F9WC 1UZ6F 2XICA 4NZTH 3RWJB 3ZMRA 5DD6A 5T3XH 4XVTL 4MAYC 3GSXA 2PR4L 4P2OA 1U8HB 5F9AC 3W9DA 4HT1H 1RHHB 2BC4B 3LN5B 1REIA 2XN9D 4UAOB 4O02H 4YO0A 3I84A 3P4OB 3IJYA 3QIUB 3AM8C 3P4MB 4UUJB 1N6QH 3HPJA 3LH2H 1T7YA 4QHNA 3F65A 4PRHE 1CL7H 3HZVB 2V2XB 2BNQD 4ZAKB 2AJVL 4G6KL 1I7TB 4ESKA 5I8CA 2VERN 3W82A 1HKFA 3WFCH 4W70A 3PL6B 4RZCA 4G6FB 1GGYA 5GZND 2PKDA 4G42A 3L3HB 4M7JH 4MDIB 1WAAE 5C71A 5L9DL 1L7IH 1NC4A 2AJ3B 1DLFH 1MOEA 1BVLB 2D7OA 4WHTA 1HEZA 1WBZB 2XQYG 4IS6B 4JLRB 3OXSB 4UQ3B 3BP5B 4CMHB 5C0CE 1SJHB 3STZB 4HQQH 1C5DB 2C3VA 1CGYA 3NTCL 3UAJC 3DMMD 3V7MA 4ZUSB 2EDXA 3IETB 1H3UA 3QCTL 2YBRB 1A5FL 1GOHA 1KYOK 5F21B 3H8NA 1A6AA 4X4YB 1E27B 3AROA 2EDEA 4JFXA 3SQBA 1NLDL 4QXGH 1GAFH 2DI7A 4K07A 1AI1H 5BRZB 5DVMA 4JY4B 4B0MM 4FQQA 4WEBH 4G8FB 3PG2A 4XCNA 3Q5TA 2PR4H 5KSBA 4CKVX 5DJDB 3LVEA 5F1IB 4XP6H 4E0RA 3IU3B 4R26L 1JPTL 2C4FT 4JO1L 3IS1X 5D2LB 4HEPG 2GUOB 4LNRA 4FQXB 4Z77A 1KUMA 3HUJF 3UO1H 3BWAA 4KRPD 5E4EC 1KTDA 3O6LL 3Q5YA 1CDCA 2P44B 1QVOA 5IK3A 5JPMB 3FFCE 4NZRL 2F8OA 5IQ9A 4ZXBC 3QEQB 5MENA 1LO3L 3SDDA 2DDQL 3PGFH 3VXMD 1INDL 4ODVL 3ZSTA 1T04B 2DICA 5F89A 4BQ8A 5DUPH 2EH8L 4PLJD 1ORQA 2UUDH 2D7TH 1XCTA 1JWSB 5T5FL 4LIQH 2BDNH 2RQ8A 4ODUB 1YEKH 4JFED 3IDMA 4P49A 1RZFH 1RURH 4N0CC 1OGAE 2YD4A 5I8CB 3RWHA 5B39B 2QQKH 1OF2A 3C6LA 3REVB 2VABA 5CD3B 2DKUA 1ZGLP 3MRNA 2QQLH 3GNML 3GJEA 2IAMB 4LCYA 3UJJL 4C55A 3EW3B 5GSRA 1R6VA 3ZT6A 1QLFA 3WO4C 3V7AG 4GMTL 3NCMA 4S1RL 4NRYB 4GKSA 4XMKL 2ATPA 3S37X 2OL3H 4TUKL 4C56A 2D9CA 2OL3L 5DFVD 3MLPA 2VLKB 4QRSB 1MRDL 3FOLB 4O4YL 1IC7L 2H41A 2A9NH 4EUPH 3S4SA 1U2CA 2IPKB 5DK2A 1KXVC 4OLEA 4XAWH 4ZQKA 2J1KA 3ESVF 4KJWD 2G75B 3O3UN 4U0QB 3ARGA 3UTPE 5IG7A 3QULA 2D7TL 4YDJA 3QNXA 2HWZH 3QUZD 4XP4H 3N85H 1WAAF 4D3CL 2XIDA 3P0VL 1XF3B 5IB4A 1HCVA 2YD3A 5LCVH 1VFUA 1FO0B 4MNHA 4IDJL 4U1HB 4ODHH 1MHEA 5T1LD 3P4OA 2YXFA 4KK8C 4JN2A 4C56B 4EDWL 4M5YL 1TZHA 1FNSL 1NBZA 1Q94A 3CFKA 1ZLUH 4S1QH 1FZMB 3AXLA 2LV4A 5CS7A 1L0XA 5BMFL 3GMRB 3DYMA 4R0LC 5GSRB 1I3VA 3VFUA 4XHQA 3BIKB 1IAIH 4YUEL 3ZHKA 3RVWC 4PJ5B 4EOWH 4ZNCD 1JZ3A 1OGTA 3ARQA 1VEMA 3OZ9H 2XY1A 3I2CH 1Y18A 1GOGA 1GYAA 5FUOH 2AXFB 5GRWA 2EDNA 2PXYC 1MRDH 4EI5C 1AE6H 3V0AC 35C8H 3R0MA 1KG0A 5JR1L 5M7QA 3JVGC 3T0EA 3V52L 3RP1A 4RMWA 1CXFA 2P43B 4N8VA 5FO8A 5EFIA 3BAEH 2R2CA 4KZDH 3HUJE 3ES6B 4R3SB 4RX4D 4WW2F 5D96B 4MGXA 1DQML 2VN7A 3DPBA 3PUCA 3SKMB 5I71B 3KLAA 3T0AA 2DQJH 4HDIB 3SDXA 4M7ZC 5JW4R 1PFCA 3MJ8B 4NO3A 1OAUL 3RI5F 3UDWA 3CLEL 4QOKE 3N9GL 2YD6A 4EBQL 4Q9QL 4WFGE 1G6RA 3UTSA 1MJ8H 4OZGB 5ICXA 3ILPB 3SKOA 3PJSB 1JNNH 4OD1L 1WITA 1LP9A 5JUEL 2DRUA 4JHBA 5EBLB 1Q0XH 5EUKB 2FECL 5IJVA 4LPTA 1C5BH 3IDXL 5DQDL 2EIBA 2JB5H 5JA9A 2WBJD 3SE9L 2VABB 5I8OL 1NUGA 2VE6A 5F1IA 4YPGB 5HHOB 1ODAA 3MRQA 4XPAH 1FIGL 3T3PE 4NBYB 3LS5H 5FHBH 5E0QA 2I60L 1NANH 3MUGA 3TYGH 2CLZA 1CL7I 3BFOA 1NL0H 3WSQH 3KPPB 3PV6A 3MLZL 4CJ0A 2DQFB 4YE4H 3VFPA 4KKLC 1CXEA 1A6ZA 1O7VA 4ZS7L 3B8SA 4F57H 4RBPH 4GMSH 3K8LA 4XNUL 5FKAA 1PG7H 4IRSB 5L8JB 1WWAX 4S11A 3MO1A 4WCYH 3DWTA 2ZP0T 4GXUM 3BZEA 4J12A 5LGKA 5KVDH 2VDNH 5FHAL 4N68A 3MOQA 1P6FA 1WF5A 3TH3T 5ID0A 5MERB 4WHCA 3SKUD 3EJYD 1BP3B 4AQ1B 4V2CB 4HULB 4P2RE 3VH8G 5D1XB 2V5SA 4PG9B 5IHLB 2VDKH 4KKCC 3MLWH 4R96B 1G9NL 4K2UL 1QEWB 5KVMC 3LEXB 4YHIA 4F9LC 5ESVA 3AS1A 3JWDC 3TWCH 4M43L 3G5VB 2IH3A 1YN7A 3KPLA 4OKVB 5JMOC 3I6LE 5DUBB 3VI4F 4KDTC 3SDAB 1MCWW 3NCYP 1UFUA 3LQAC 1Z9LA 1K3IA 3QIBC 1NAMB 2EXYD 2BOBA 4J23A 5ACZB 1CDIA 1CGUA 3ROOA 3ZE2E 5E8NB 4YGVB 1W72B 3TO2A 1FRGH 2XQYK 2HG5A 2DI9A 5MI0C 1LO5B 3ZTJH 3MCLH 1KGCD 3NCFB 1QLEH 4X80L 5FO9B 2XNAA 2E6PA 5HI4D 2MNUA 1ONQB 3MRLA 1BFVH 5KS9A 3L5WB 2VOTA 3ULVD 3RDTD 1WBZA 3MRMA 3QI9A 3C8KB 2Q76B 3HMWL 4EVNA 1IAOA 3QEGL 1XCQB 1PG7L 1E28B 2RB8A 4X5WA 2YA2A 1ZGLM 3QDHA 3OX8B 2NW3B 3G5XA 5E99H 3R1GH 4Z7VA 1C5CH 1U3HB 3QWQB 4HWNA 2CRIA 2CLRB 3CUPA 1FVDB 4D9RD 4UI2A 3O9WC 4EN3C 5C6WH 5D7JC 2APBA 2PO6B 4TTDC 1DDHA 1JNHB 2DWDA 9CGTA 1A14H 4NPYB 3NIFF 1LGVA 1ZSDB 4JZNB 2Q3AA 4PY7B 1TPXC 5HGHA 2GY7B 3ARBA 3HI5L 4Q6IB 3S35X 4NWUH 4B50A 1L0QA 1U6AH 3HI5H 5D7IA 1NAMH 4OSUH 4LGPB 4KKCD 4M6ML 3T0BA 1YEEH 3RVWD 3EDFA 5ECJE 3DO7B 4MNQA 4OZ4B 2YPVL 5DYOA 1IAIM 3M8OH 5KSBF 5KVFH 3OGOE 3NVQA 1FRGL 1IGIL 1IT9H 1DQJB 4LQFL 2VXQL 5HHOA 3TBVB 2NY6C 1PZ5A 5DD1L 2NY0C 1G7IA 4MJ2A 1IM9B 4PRPB 4LKCA 5CEYA 1Z3GL 2CKBL 4R96A 1NCTA 1V8HA 2Y7QB 4UAOC 4MA7H 5EU4A 4C56E 5B8CB 2HFFB 4U49A 5MHSE 1HWHB 1IGCL 4R7NA 3SGKA 1UEYA 4QHLA 2H8PB 4AH2B 5GGTH 5BW7C 1RY7B 4PV9A 3QDJA 5F71A 3NCBB 1KJ2H 4XVSH 2J88L 3TPUB 4DGYL 1I8LA 3OKNB 4OIIL 1J10A 3NCJH 1BD2D 1CIUA 1S7TB 2QHRH 4U3HA 2R0WL 5EIVA 3BP6A 5TF1H 3L3GA 1CICA 2R39A 4PLKC 1T4KA 4JKPL 5JO5B 2AV1A 2UZYB 2WUCL 5F7FA 4ZD3H 3REWA 1SJEA 4NZRH 4PB0L 4HUUA 3ALWA 4KUCF 4ZD3L 3U46B 3MUGB 3RWFA 5GS2D 3FMGH 3KXFD 1JNLL 3B5HA 3QWRD 5DRWA 3E6HA 2E9WA 1NMBL 5AYQA 4XNMA 5L9DH 3QFJD 4L4TD 4HF5H 1FNEA 4XRCB 1EHLL 3GI8H 4UBDD 5FA4B 2NTSP 3VFSA 3Q48A 4U1GB 1E6JH 3CLFH 1BHGA 1YMMB 3VFVA 1VADA 4ODSL 4KFZC 4AIZA 5AZEL 2IANE 3FRPA 1S9VA 3W2DL 1Z9SA 2N7AA 3FCTB 5DD1H 4N9GA 4QRRB 5GPRA 4LSVH 2R56L 3BUYA 1GZPB 3RKDC 3WBDA 4LSTL 2R56H 4I48B 1DEDA 4LP5A 5HPMA 4P5TB 3L1OL 2Z0BA 3VRLF 3HA0A 1NFDF 2VLJD 4NQXB 1OT1A 2WMPA 2NX5E 1KYOJ 4HAGA 3MX0A 3OTTA 2ZG2A 5D7IF 4F7MB 3PP4H 2C7UB 4NQEB 3RNQA 4ZUUB 3LZFL 2BSTB 2DQEH 3GSUB 4L9LA 5C09B 4JZJA 3LZFH 4NZTL 4PP2A 1T03L 1LP9F 1FQ9C 2X5PA 1CLYL 3RX8A 4PB9L 1OY3B 2GJ6A 2F8XC 4AM0B 2Y07L 4CMMB 1EMTL 4IRJC 4ZFGL 1MHCA 2JKXA 3FKUS 4ETYA 2P1YA 5F7WC 1RK0B 3MRJA 4O58H 4FQXD 3V8CA 1OTTD 4PGEA 1MCDA 3WFCL 2EKJA 1TZHB 4NRYA 2Q6WB 3TPKA 3MRGA 1SM3H 3S88L 1RURL 1KJ2B 2D0FA 2NZ9C 1RK1A 2EECA 3HFMH 1CGWA 1IBGH 3HE6A 4KTYA 4M1GL 4ZO7A 2F54E 4O9HH 2B0SL 5C07B 3QI9C 2B0SH 3RDTC 4D9QD 1MY5A 1P6AB 2A74A 1J9CT 4I48A 3QPXH 5F9DC 1I3RA 3U79A 4B7LA 2HN7A 1NKOA 1A64A 1KOAA 3RZWA 4P4RA 3V0VB 5ISZD 1RD6A 5DMIL 1PVHA 4CAGA 1LEIA 5I19H 4JM2D 1BOGA 1I9JL 4OQ1A 5F6IB 4ZOAA 4XVUC 2Z31B 2AJSH 2OZ4A 1RULH 3PDGA 1T21A 2VWEE 5DJ0A 3FO2A 3HMXL 1JTPA 1ZHLA 2A83B 2H6PA 4JY5L 3D3VD 1P4BH 4OTXH 5ESQA 1TJGL 3U48A 2OR8A 1JZ8A 2QR0B 1F6FB 2O5YH 3MGOA 1JRHL 3VW3H 4OD2B 1MY7A 3VDBA 3VGAB 5DSCB 5IMLA 4GS7C 1XGPA 1M7DA 1CD9B 4DCQB 1JVKA 5ID1A 1F13A 4XC3H 1LDPL 5MEQA 3C60B 3N85L 4RWYL 1G7HA 5MEOA 4GLRI 4M03A 3BIKA 5DUMH 5HY9B 1XGQA 4Y19A 3GGWA 4JJHA 1FL3B 1JF6A 3RJDA 5GS3A 5JW5B 4ZDHB 2GJZB 4LBEB 4RAHA 4MCZB 3I6LD 1RIVH 1I75A 3ZYJA 3MNVB 5D7SL 3SOBL 4JRXB 5FECA 4YK4B 5JQ6L 2A0LD 4ELME 1EK3A 4Y4KD 3BMVA 2FIRT 4N0UB 1F8TH 1FN4A 5CUSH 4KPHH 5DLML 2DF3A 2KUTA 4AEEA 3HPLA 1KPUA 2E7BA 3QIWD 4RFNC 1RZFL 5HHPA 5FB8A 5C3LD 2IH1B 4KQ3H 3SGDI 3G5ZA 3UJIL 2GSGB 3DETC 1NDGB 1XGYH 1I8IA 3EYUL 4ZUTA 1I9JH 3HN3A 2ZSVB 3ESUF 5BV7H 5DDHB 1T6WA 5ALBH 4JQXC 3QRFM 3VXPA 3VXSE 4EUPG 3Q6FA 1DFBH 4TVPE 1T1XB 2LVEA 3MRIA 3L3HA 3ZTNH 1BGXL 1T3FB 4RZCB 4PP2B 3MLVH 4I0PC 4O5LL 1YEFL 1BGXH 3SPVB 3RNKA 3MLVL 4O5LH 1CN4A 1ZHLB 2H6PB 4TQEH 5E1AA 5AAMA 1FBIH 2BY0A 5B22A 4CUCA 5GS0L 1BF2A 5EBMA 5EU6B 2L4OA 1IC7H 3FAXA 4OFKA 1NCCL 1OAZH 4DEPB 4Z7WE 1XFPA 2ENSA 2X4UB 1T83C 2V2WB 3F58H 1JJUA 3ARVA 4PJFF 4JJ5A 4CBPA 4EBQH 4L4JA 4UILL 2R23B 3PDDA 3PHQA 5DEGB 2Q76A 2W92A 5IWLA 1D9KD 1MQ8A 1N0LA 3BN3B 4UV7L 1K2DB 3BYYA 3SDXF 1GZPA 1U95B 1U8IB 1YUHB 5BQ7B 3HHRB 3O2DL 3HRZB 4KPHL 3GSQB 4NO3B 1PBYA 4GAYB 1FC1A 2IANB 1EHNA 5T3ZE 5DFWH 2GSIA 3VXNA 4A6YL 4JPKL 3TA3B 1RZKL 1OAQL 2PYEA 3GRWH 4TPRL 1SBSL 4M1DL 4MAYB 4Z78A 3VRJB 2OJEB 3VXSD 4M6NL 4Z18A 3ZSSA 2L7JA 4OGYH 3QUMA 1NEZB 4Z76A 3WFHA 3EFFA 4YE4L 1QFWH 4YHIB 4XP5H 1L6XA 4XCYB 1NGYA 5K59E 2QLVB 2DKMA 2XI9A 5DVOA 5T5NG 3LN5A 4GSDH 4XMLL 3VWKA 3HG1D 1KEGH 2VZTA 2DMCA 1PQZA 3ARFD 2BOCB 5GGVL 3RGVB 1UJTA 3RWJA 4TNWF 4UILH 1DUZA 3ETBF 3CK0L 1J05B 3PGCA 4FFVC 4Y4KB 3ZE1E 4P23B 5TE7L 1CDYA 2JLLA 5DJYA 5KJRL 3EIFA 3ORJA 1GIGL 3JWDL 5A3IC 1MRFH 2B7DT 4TSCL 3H9YA 1LMKA 2Z91A 4NQVB 2DQJL 4PR5A 4O00A 1MRFL 1G7IB 4TSCH 5D2LE 1HH6A 4ERSL 5I1KL 1VDGA 4H8WL 1AXTH 1TVBA 3B8YA 4LRIC 2X41A 4ZFZB 3FZUC 1DQJA 4YGAB 4PRAA 1H3GA 3KLHC 4HG4J 1MHHB 3WJLC 1XF1A 1Z6JT 1PG7X 3DUUB 1SBSH 2PCPA 3TNNA 3P73A 4MLSA 5IWLC 3MCLL 1OP5K 1IQWH 3ZKXC 3SY0A 1FVCB 1W8NA 3IDXH 4HIEB 5DS8B 5DQDH 5IFAL 1YQ2A 4BSVA 2C3WA 5DMJB 3CFJA 5EO0B 5TE4H 3SDCB 4JZJC 3ULVE 2G60H 3SJVE 1M71B 2DLHA 4PJHB 4KVCL 4Q9CA 3EYVB 5ITFB 2AW2A 4GS7B 3WS3A 2ATPB 3QUZA 4JM2B 3REWB 3VI3E 1FO0H 4XMLH 1BVZA 3RNQB 4JDVB 4YBHA 3HAEG 2ARJQ 4QHKJ 1P5VA 3BX7C 4XVUD 4Y89A 3SDCA 5I1LB 1WTLA 2NXYB 2W9EH 4P57B 5H8DA 4ZMAT 1Q9LB 1EA9C 4ZXBA 1U0QA 3BP7A 1D7FA 1HQRA 3T0XA 4WJ5B 2VKWA 4OQTH 5CZVL 3B83A 3MYJA 3BDYH 4P3DB 2J8OA 2EYRB 3GSNH 3RGHA 2AAVA 2HKHH 3BPCA 1NGPL 4K7PH 3KVQA 2F58L 3T0EB 3VD3A 4OSUL 4LPCA 2EIEA 1AXTL 2WP3T 1E6JL 3CLFL 2QSVA 4TSAL 2GT9A 1BQUA 1T1YA 1I7RA 1Y18B 4BJLA 3KYKH 3VCLB 4HCRA 1KJVB 2D9QB 2FJHB 3NABL 5C0GB 4Y4KA 5HVHB 5JDJA 3U1SH 1D5IL 4KC3B 3ARGD 1OAXH 4JRXE 4X6BA 5IW1A 1U41A 3PWJA 1G7QA 3L7EB 2P49B 2FL5A 2ZNXA 4N0YL 3TFKD 3NA9H 3HE7C 4F15B 4L3CB 3KLHD 4FQIH 5ILTH 4IIQC 25C8L 4XH2B 1VEOA 3T1FA 4LCWA 1CFNA 1CGTA 3GK8H 2QSQA 2X4PA 3ILQD 2CIIA 1MREL 1M4KA 3EYSL 4HUWB 3MGTB 2VLRD 4OJFL 5E5MB 43C9A 1UZ8B 5CZXC 5J6GA 3TF7C 5CEZE 2H2PC 3WUWG 1OT2A 2ZOKB 3CVHH 2W60A 1MI5A 1ZE3C 2DM2A 3BQUD 3LB6D 3TVMA 1JL8A 2JJTA 2HJLB 5HYQA 1EAJA 1B2WL 4K7PL 2YZ8A 1MNUH 1ZLSL 4OBRA 4RQQB 4O2FB 5HGDB 2NY1D 1BX2B 3C6LD 3G04A 4NKQB 1TVDA 5I8EB 3ZE0F 4QRRD 3GMMA 4JPVH 1C5DA 5EBWA 3KDMA 3JZ7A 3L6FB 1OP9A 3FB5A 4GRLA 1TZIB 4IJ3C 2P8LA 3TEUA 3QUML 4P5TC 2VDML 1CD1A 3DRTB 2J8UA 4FXKB 4L9DA 5C0EB 5T3XD 3C2AH 5IF0A 2EEDA 4ORZC 5F96L 1EV2E 3QCUH 3EBAA 5HI3D 3RVVD 3P4NB 4JFZL 2PTTB 1QOKA 4POZD 4YAQA 1SYVB 3HC0A 1UZ8A 2QSCL 3CDCA 2CUHA 1WCBA 4PRBB 1YN6A 5K9OB 3NIGE 5AAWA 4G9DA 1UJ3A 1CFNB 3GHBH 3D9AH 2FEEI 1C08B 5E9DB 5KTEL 4HWEL 2R1WB 3HC3L 4X5WB 4X6CE 5L8LB 4HWBA 2IMNA 2AK1L 1R5IB 5D72L 5CJBA 4PJ7A 5JW4N 5IVZA 1IMHC 4GRLB 1UKTA 4ZAKC 5BZDA 3UP1A 1TNNA 3BGFB 3L5JA 4WFHD 4L5FH 4I3SL 2F9BT 3BMWA 1LEKA 4ZFGH 5FB8B 1L6ZA 4LPXA 3LKPB 4U7KA 1MCRA 2OJZL 5D6CB 3WXVL 3JSSA 2WK2A 4YHKH 4MQXD 3QIBA 2CLZB 4BH8A 5E00A 4RWYH 3GEWB 4RNRA 3W5MA 2BHUA 4Y5YB 2Y5TB 4OCXH 4NRXB 2F54D 4KY1H 1FYHB 4HIJA 2PYFB 4ZG1A 4AT6A 3BP7B 4JPWH 1I7UB 4NRZB 3FFCA 4Y8DC 1H3XA 1XR9B 4GG6E 4NHUB 1I1YA 3MODH 1F8TL 2ERJC 4XHJC 3W0WD 3PF2A 5MERA 4I0KA 1GC1C 1GGIH 2PN5A 2FX7L 1MLBB 2X1PA 2Q7YB 4DN3L 3TZVB 4MA3B 1I1FB 1LILA 4QY8A 2XTJC 5ACLA 1P7QA 3S7GA 1YNTA 2E8ZA 4QXGL 5I75C 3OKLA 1P7KA 3BESR 4LSPH 3MLYL 5D1QA 1HQ4A 4HWZB 4NOBA 4PJFB 3ULUH 2IALB 5FYJE 2UVFA 4LDOB 1N8ZA 3ARDA 3GSVB 5F9JB 4CW1A 5KSUA 5JZ7C 2HN7B 5H35B 5F70A 1A4JA 2NLJB 2JJWA 4N1HB 1FBIL 1MCCA 1T1ZB 2BRRH 1XT5A 4NKOA 1EUTA 1PZUB 3L95A 3CSYB 2W59A 3IF1B 3G6AB 2OL3B 3TC9A 1WIOA 3GB7A 3HC4L 3VFRB 3STLB 4JHZA 4FFZH 3S3PA 2K7PA 5CSZB 5D2NA 3FQRB 4IRJA 4EJ1C 2OS7A 1INQB 3HLAB 5FKPA 5JNYA 1SYSB 4JDVA 3DSFL 3H42H 1V7NH 5FDWB 1IC1A 4HPOH 5DD6B 1MUJB 3MV7D 2NY7L 3DRQB 3DVIA 4RAUA 5BJTB 4KXZH 1QBAA 3O2DH 4GBXB 3SO5A 4JFDE 2NY2C 3BVNB 3DGCR 4KUZL 2AJUL 3FQWB 1RMFL 1R3IH 4G8EB 3MJ9H 2FX7H 2ZCHL 3CMOL 1QZ1A 5CZXD 1N3NB 3CFIC 3KLAB 5C6TH 3M17A 3HFML 1KCRL 5GRVK 5DJ6B 4HGWA 2HYMA 3QCVH 1FJ1B 5DA0B 1FAKT 5L0QB 2BY3A 1KB5L 2IC2A 3HZKB 4ODTH 4JVWA 4OGYL 2PW1A 3DX7B 4X99A 4Y1AB 4AK1A 3R0NA 4BFIA 1DUYA 2D4FA 2IBZY 3GSUA 2E27H 2E8YA 4GMTH 2ED9A 4GG8B 4KRLB 5C7XH 2E27L 3KPNA 5H2BA 3CDYA 3ROLA 2FBJL 3CSPA 2NZIA 3BKML 1NUNB 4KJWC 5C0BE 3B9KB 2KBGA 3FJTA 1S78D 3U4EA 1FDLH 3GSQA 5JDSA 5DJXB 5IFJB 5CILH 4R4ND 1X5HA 1NCCH 3I3EA 5GGUB 4NRXA 1EO7A 1JGDB 3ZL4H 3WXWH 3K1KC 4N5EC 4XPGL 5J13B 2NXZC 1T89C 3VXUE 1AQDB 5TDOB 1A1OB 1TJHH 1CFQA 1CFTB 3W39A 4OUOA 4D3CH 5C1MB 3AAZB 4HK3N 4YXHL 2R2BB 3RL1B 4OLYL 4JHAH 4NO0D 5GS2H 3O0RL 4BZ2L 4TOYL 1XGUA 5F6IC 1OF2B 2OZ4L 4NO2A 3QNXB 4ONOA 2DKSA 3IDJA 1IGJA 3QNZA 1KCRH 4XNXL 2CJUL 4L9LB 1K3ZA 3OPZH 4M1DH 4LSQH 3S96B 5AEAA 1HYSD 5KOVC 4Z7OF 1AD0A 4JCLA 5E9DA 1YEHL 1T5XA 4HIHB 1KTLB 4QLRA 1PKOA 5TE4L 5EORH 4IRSC 5LAXB 5DK3A 4YBLB 1AQKH 2IPUK 1MSPA 1KENH 3B9KC 3C8DA 3RL2A 2H2SD 1QFWL 1MF2H 4HXAL 1JRHI 4QRRE 3VXUA 4JR9H 4AH2A 1QVOB 4PTUA 3VFTA 2IQAA 5ALBL 2B1AL 4W6XB 3NZ8B 1QLFB 5CILL 5KS9F 1YEDB 1QSEB 2FHBA 4RIRB 3V52H 1OARH 1SBBA 3EZJB 4LIQE 3WIIH 2A38A 4M8QA 3GMNA 5E2VH 1KCVL 3PWJB 2NX5B 3BT2L 2D7PA 2DBJA 2BY1A 5F7DA 2ADIB 2CRMA 1SEQH 3IU3A 3QHZL 1DQMH 4M93B 1KPVB 2JIXD 5E56A 3SEPA 1XF5B 2ZG1A 4GRLC 3SPVA 5B3JE 3C2SA 3GO1H 4P2QB 3TN0D 3L5IA 3RTQA 4WDIA 1T1YB 1YNKL 2W0LA 1T5WA 5E4EB 4FQHA 4PG2C 3F62A 4MX7B 1JCKA 4PRIB 3MV8D 3RVTC 4HWBH 5IMLB 2AQ2A 1G7QB 2V7HB 1F2QA 3L7EA 2NZ9D 4WO4C 2FEDC 4O51A 1OAYL 4XBGB 3ZKNC 1HOCA 2HH0L 2MCG1 4XWGH 3HR5A 1TNMA 2VSDA 4I2XB 2I9LA 4DKEL 2E3VA 2EDDA 5MENE 5GJTL 3BKYL 4M48L 3D39B 4Z9KB 1Z0MA 1AQKL 2ICCA 2AJ3A 1CGVA 3FO9B 4G8IA 2Y06L 1AFVL 3OAUH 3MJ7B 4OLWL 4XNYH 5BS0B 4R2GB 1IAMA 4XNYL 4JRXA 5FECB 1S3KH 2VXVH 2FWOB 4NWTH 3HB3C 3S35L 4RAUB 2JTDA 2CPCA 3AU1B 3SKJL 1FL6B 4KJPD 3OR7B 3OL2A 4APQB 4WW2A 4NT6B 1J8HD 2AEQL 5HY9A 3UTTE 1I8KB 3PP3K 1J1XL 5K9QI 4U1MB 1OP3K 2AEQH 4ZPTB 3K7UA 2WIMA 3GB7B 1NMCC 1FFPA 3IGAA 5JORA 2EKSB 1SMOA 1XIWB 2APTA 1FZJA 5ESAB 2ILLA 1KLGA 1MAML 1T20A 3SE8L 1S5IH 2ZUQC 5T1LA 3MLRL 3TM6A 3CVHA 2B1HL 1C12A 4IMKC 4OLVH 4I18A 3S6CA 2B1HH 15C8L 1JV5A 4DN4L 1A1MA 5SV4A 1VKXA 4F80A 1H3PH 4GBXD 1RUPH 5F9OL 3EOTL 4X7DC 4TVPD 5T3ZL 4NQCB 2FWOA 3S5LB 1YYML 5C0CD 3MRBA 5A16B 1LK3H 3WO3B 4S1DC 2JB6A 4RDQF 1MQKH 4FMKA 5FA3A 4NSKB 4JQIH 1J5OL 1JIBA 5C0NC 4RWHA 5CLTA 2VLKE 2HJFA 4MSWB 4WIQA 1PAMA 2YPKB 4RAVB 2XWJA 1EGJH 5JW4Q 1IQWL 4K7PX 1DCLA 3O6FB 4HCRH 1NUFA 1F4XL 2F5AL 1QO3B 1LO5A 4AYFA 1TMCB 2G2RB 2QKIA 1J1XH 1UXSA 4ORGB 3V4PH 4K94H 3EGSB 1D9KA 4HMDA 1BF8A 1IEHA 3HR6A 4QNPF 5EDXA 4PPTA 4NQTA 1IARB 1JPGB 2E7CA 2HT2C 3QDMD 4YC2B 4JEGB 1J0HA 3KPQA 2P47B 4X7FC 1ZEAH 5C0BB 3O4LA 4QRQB 5HHNA 2NX5A 1Z9OA 3NCEB 3ZDYF 1EEUA 1JZ5A 4OLUL 4OQTA 4YFLI 2VDLH 1VFAB 2VC2H 1YZZA 3QDJE 4XBEL 3D0LA 2IQ9L 4Y5YC 5F1OB 5CZVH 2BZDA 1ZHBB 3D6GA 5IIEB 2OI9B 2AV7A 4XBPA 1N7ML 3IDYC 3P9LB 4M6OL 2DQHH 5GGVY 3H9HA 2NTFB 4L8SC 5DK0A 3TT1L 4KQ4H 3BZDA 4MAYA 3VXUB 4OCYL 2W0PA 4WY7H 1S9XB 3RZCB 3TT1H 4M8VA 3TNMB 4V1DD 3SDDD 4F7MA 4JFZH 3RY6C 3GBMH 5GRJL 4ZOEA 5F1NA 5DFVC 3BP6B 1HOCB 3U9PL 5I1JH 4DWHA 2V5MA 4D0DA 1U8NA 4QF1A 2Y36L 2YMXL 4PJ7E 1ZLWK 1PYWB 1UCBH 3IDGB 3EOYG 4F3FA 4D8PA 1ZT1A 4LSPL 5HDOA 5CJQH 4PGCB 1IAKB 5IJKA 1WTGT 3H3KA 4UV4L 3HNVH 3O6ML 5F7UA 4KI5C 4MB5A 1CR9H 1EEZB 5GGRY 3AFLA 1XR8A 5DGQA 1IKNA 3CSBA 3V6OC 4QGYA 1FNGB 4G8GD 1MCNA 2OTPA 1CD1B 4PIRF 1KJ2L 2NY4D 3N1QC 1BM3L 1N5YH 4GAYA 5DUPL 1WC7B 1RJLB 1JF5A 5D93B 5E6YA 1VGKA 1CDJA 3ULSB 4PJDA 4PRHB 2BDNL 4ZPVA 3CZFA 4OCLC 2EEAA 1PJ9A 4LLWB 1IC5H 1HKLL 3KHQA 4HH9A 2G2RA 5E6ID 1G9MH 3QQNA 4HJJL 5EN2A 5DJ8B 5A2KH 4U2ZA 1N0XH 1J0KA 4KROC 1LO4L 2JJUA 4MMXC 4WEBL 2CQVA 3O3AA 5INDA 5C0FA 1S7WA 4HFUL 4RFOH 5BZWA 2OBGA 4L4VD 3GSRB 3W2DH 4TUJB 3DVNA 2P5EE 2XTLA 1IKFH 1MAKA 3GSWA 2NW3A 2JCCE 3LD8B 3JWOC 3VG0H 1L7TL 2NY1B 1MEXH 4XCFH 4Z8FL 3GRWA 1U8MA 4JFHD 3K2MC 4MJ5A 2JK5A 4MD4B 3MRRB 3W11D 2H1PL 2B20A 1WFUA 3T2OA 3DECA 3U7WH 2MMXA 3FAWA 5EOCL 2VH5H 2WNGA 3GGWB 3E3QE 4ZTOH 2FX9H 1NBQA 1NCAL 1CLCA 1P84K 2DDQH 3PGFL 1BQLL 4MQXC 3VD5A 4E5XA 4HKJB 2W65B 4QO1A 4Y2DC 4WTWA 4WI8A 3BEVB 3HLAA 3MUJA 4D9LL 2J3SA 4AG4L 1MELA 4JO2H 2VISA 4H8WC 3C08L 1IRAY 1ZVSA 3DUHA 4U1SA 3H3PH 3HC4H 4NZUL 4I3SH 2W0KA 4APQC 1LD9B 1EXUA 1S7XA 2Z4QA 4JFDA 1LO4H 4PUBH 1I1AB 3ULVL 1E6OL 5EG6C 3ZE0E 4Z7VB 4Q58C 4P9MH 3BPOB 5FCUH 4X6DF 1UT9A 1MH5A 4H0HB 5F1SA 5C0DA 4XVJH 2GTZB 3W9EB 5D1QD 3O11B 4YDVB 2YN3A 5EIIB 2R29L 3BGMB 2VZVA 4NQCE 2R29H 4X8XA 5JPMA 3G6DH 1AR1D 3AC0A 3L3IB 3OB0H 2FZ3A 5E6IB 5FGRA 1C16A 2VLJA 4XP9L 3QNYB 4PJXE 5GISL 3L5XL 1DVFB 1S7UA 4UU9A 3LKOB 3U0WH 1M7XA 1N4XL 3L5XH 4KV5F 3GSRA 1YPZF 1NCBH 2NXYD 2ATKB 5C09A 3D87B 1CGSH 4K23H 4BQ9A 1KXTB 4RGOH 5C08E 1NCBL 3FO1A 5C8JA 5FO7A 3BKMH 3BHBB 4F33B 3X13B 1D5ZB 2YPLA 1FDLL 3QQ4A 5I66A 3CNKA 5IQ7H 4HUXB 5EN2B 1YMHA 3QIBD 5D8JH 3HUJA 3LIZH 4M00A 4JFQB 2IGFH 5DXWA 3RAJH 3D2UA 1E6OH 2R2HB 4OZHB 5HYSA 3RAJL 1PQZB 3B9AA 4QXUL 1EFQA 1C1EL 5ICYB 3C6LC 3IETA 2D31A 4LP4A 5JHLH 2BVOB 3JTSA 1ZS8B 4NUJA 3HE6C 4C58B 4X7SH 4DUXA 4QNPE 4Y4KC 1IGTA 2O26U 2EEBA 1FG2B 1J0IA 2NR6D 4HWBL 4G6AD 5FUOL 2YSSA 4V1DB 3VJ6B 1CVRA 4JVPA 1KC5H 3PQYD 2VUOA 4FNLL 5DFTA 4B7IA 3QQ3A 1I7TA 5L0QC 3CDGA 5I1GH 2AGJL 3BPLB 4KMTH 4ZS7H 4DFHA 1KJ3L 1A4KA 2AQ1A 1EVUA 1UA6L 3BD5A 5FM5M 2AEPL 1VCAA 4AIZB 2OK0H 2ADIA 4PJ5E 3BI9X 2C9AA 2L7UA 1TETL 3IJYB 4JFFA 5KVDL 3WS6A 1AQDA 3PV7A 5DHVB 2GHWB 5IB3A 2BNRB 1FC2D 5KN5B 4HJGA 2FHFA 1A7RL 3LKPA 1ETZA 4R2GC 3EYQD 3CZFB 3OXRB 2QKIB 3HUJB 5DO2D 1DBKL 4JFFB 5E2VL 4FQ1H 4EDXB 4L4VE 1KBGL 3O8XC 1JGEA 3L9RA 1SEQL 3ARBD 3QHZH 2DQGH 4X6DB 1NUDA 4RRPG 4MAYD 1QACA 3PWNB 3K4DA 4MD5B 2HJLA 3KPQB 4WO4B 4BQCA 4L8SA 5E9DE 4UOJA 4CVWA 4MQSB 2E6JA 1K8IA 5I1EL 2R2HA 3T2NH 4JDZB 5I76B 1OB1A 2X4RB 5JOFB 5E2JA 4M5ZL 5HHVH 1X5IA 2MQ0A 3HZVA 2VDRL 1YMHB 5HHVL 5C0CB 2XACC 4ZNEE 5EZOL 1QRNE 5FF6B 4NQCD 2VAAA 3QFJE 1FH5L 4L4TE 2DWEA 2X40A 5B4MC 2IADB 1ZLWH 2OSLA 1FH5H 3MROB 3N1FC 3O41B 2HTKC 4U6VH 3VGBA 1VKXB 3GJFB 1YECL 2HJKA 1FORH 3CCHA 4G6AC 2X70A 2P5EB 5F3HB 4NQDD 5SWQA 2FGWL 3NBNA 1FZJB 5B39G 1VPOL 1C16B 5DR5H 2QTEA 4I0PA 2V5RA 4NCDA 4LVNC 5B8CA 3MXWL<