3LS5L

Anti-tetrahydrocannabinol fab fragment, free form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
215
structure length
215
Chain Sequence
b'DIVLTQSPTTMAASPGEKITITCSASSSISSNYLHWYQQKPGFSPKLLIYRTSNLASGVPARFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSIPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of antibody Fab fragment
publication title A structural insight into the molecular recognition of a (-)-Delta9-tetrahydrocannabinol and the development of a sensitive, one-step, homogeneous immunocomplex-based assay for its detection
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 53
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5L01
4DGYL 3MRGB 5F1OB 4Q9RH 4R6UA 5EZOL 2BVPB 3MUGB 4P5KB 4YQXH 5C0BE 3PWLB 1I9RH 4JQIH 1YNLH 2DTSA 12E8L 3VFSA 2WBKA 5GGTA 2NXZD 5J9PB 3D87B 3MV9E 3MBXL 4E41E 5F1IB 2WM0A 4ZG1A 3LSOA 5T1MA 4GJTB 5A16B 4H88H 1U6AL 4FQXD 3QHFL 1EHLH 2W91A 4G9DB 4NSKA 3O3EB 3IYLW 4HWBH 3QQ3B 5I1AA 1LO4L 1WTGT 3KNBA 1JN6A 4UDTB 4OKVB 5FGBA 5HYJB 1RVFL 2A38A 4HPYL 4MNQD 5SX4H 5C0DB 4JDZB 3DI2B 5F9OL 3NACL 2QR0A 3UJIL 3GMLB 3MNZA 1I7RB 2BK8A 4MWFB 5B38G 1LDPL 4H26A 4DW2L 4OAWA 3EYOB 3ZKSD 4CMMB 4Y4HD 1SVCP 2LAGB 5HGDA 1XGUA 4N0YL 3A6BH 4P4KD 2HTKC 4H5SA 1HQRB 2HKFH 2DM3A 4XNZB 1CBVL 5LGJA 2CH8A 5EN2A 4JFPB 3JZ7A 4CN1A 2NXZC 5AG8A 1MJ8L 2WP3T 3VXPA 2OTPA 4DGVL 3CMOL 2PTTA 4DAGL 4M43L 1MVUB 4U6HB 3U4AA 5KSAB 1KC5H 1CWVA 1RJLB 5DGRA 3O45B 2V2XA 4BQ9A 4BZ1H 3HS0A 3NIFF 4MAUL 1YEGH 4OCWL 1T20B 3KLAA 25C8H 1RUKL 1X5ZA 1AHWA 2HLAA 4GAGL 3C6LD 1PG7L 3QHZH 4IHOB 1Q72L 4HF5L 2DQGL 1OB1A 3ARBB 3X3GH 4O2EB 4FMKA 5HVGB 1YNKH 1FNGB 2ENYA 2FX8L 1GGCH 4OZGE 5E6ID 4Y4HC 1FNFA 3QI9B 4R9HA 4UQ2B 1LE5A 5DD6A 5F21B 1JZ5A 4P4KC 4UTAH 1U3JA 1NCNA 2JELH 3O6FA 3X14B 3KXFA 2HVKA 4KRLB 4LNRA 3V6FB 3VXSE 2FJHA 5DZOA 1BHGA 3LIZL 1TQCC 4UILL 3DXAD 2EYRB 4NQVB 4EVNA 3QDAA 3WXWH 3BKML 3DUUB 3QO0A 5FOBA 1F58H 3SDXF 2NY5L 5D5MF 2Q6WB 2ED7A 4XPHL 4PB9H 4Y19D 3W39A 2UWEF 1FYTD 2H32H 1S7UB 4FXGA 1D7FA 2VZ1A 4KMLB 1U8JB 3P4MB 3FB5A 2J8UA 3OKNA 4X4ZA 4NUGL 4O2FB 3N1QC 4PJXA 3P4OA 5HY9A 2VDLH 1SEBA 5JHLH 1U8QA 5C6TL 2BMKB 5C1MB 3SDDB 3C6LC 3MV11 4G8IB 3V0WL 3O8XA 3RNKB 5EBWB 2XRAH 3EOBB 3BE1L 5LXGL 4QRRE 1X44A 4KJWD 3KPNB 5E0QA 2DQTH 4EBQL 4NRXB 5J1AB 1T1ZB 4WGVB 3SOBH 4HMEA 1Y0LA 3NH7L 2OL3B 3GSOB 2Y4SA 3PWNB 3RI5F 4Z7WA 4Y89A 4J3TA 3TO4D 3GKZA 2PTUA 4GO6B 3JWDH 3MA9H 4H8WL 4LPXA 2ZZUT 4ODUB 1QSFE 4XNMB 1WCBA 5C09B 5E8NB 4GFTB 4M6OL 5CJ8A 5ALBL 3A6OA 1F2QA 2YOCA 1TJIL 4GBXB 4EQ2A 2MWCA 1A6UH 4TOYH 1F3JB 4L8DB 1DE4A 1QQDA 5KSBA 5TFSH 4M62H 2QQLL 1TQBC 2EEDA 4DVBA 5EFIB 2H6PB 4M5ZH 4EDXB 3U36A 4YGVA 4GAFB 3HE7C 1TCRB 4JFDE 3MXWL 5JR1L 4XH2B 4YZFF 3X17A 3SE4A 1UJ3C 3JVGC 2DBLH 1FCGA 3VFTB 3UPRA 4WY7H 2P45B 4XBEL 3NOIA 4WU7B 3FFCA 4KJWC 1T2QH 4LSVH 2X4QA 1Y18B 4X6CF 4MB5A 3QNYB 3OGCB 4JPVL 2W0LA 1U3YA 1T89C 2A6JA 4RSVA 3FL7A 3I2CL 5T3ZE 5B4MD 1AQDA 1FC1A 2XY2A 4NO0B 1MCQA 2JB5L 5FYKE 4UAOC 1JWSA 2EC9U 2FD6L 1QBLH 3QXVA 3OX8B 3G5YA 4EI5B 5ACZA 2PYED 3W5MA 4Q9QH 4FQQA 4LCYA 4M1GH 5F7DA 5CKAA 4R2GD 4KQ3L 1C1EH 1J1OL 1NAMH 3RDTB 4ZSOB 4R26H 4RAUA 4L3EA 2R0LL 4NNYB 5LJYH 5DTFB 2DI9A 1YPZB 2KBGA 5I8KL 2YKLH 2ZNWA 2B4CH 4OIIL 5C0RL 2CXGA 1FFOA 3TYFB 1A3RH 2ZOLB 3CPLA 2NY1D 2LFGA 1A6ZA 1UB5A 4OF5A 5JOEA 3VMNA 3Q6GL 4MNGE 3RIAK 4PJCF 1XZ0A 4EDWL 5B4MC 3JWNC 4ZO9A 4XP9H 3MYJB 4NWUL 1QR1A 1MCOH 2I5YL 2P8LB 1H3PH 5IFJA 3I84A 1N7MH 3S37L 3QDGD 1XGRA 5D70H 3RZCC 3ZDZE 4GRWB 2J6EL 5E4EC 1LO3L 1B90A 4XCCL 2YPVL 2ZCKL 2NW3B 4BELD 4TUKH 4IRJD 4QNPE 1OSPL 4ZOAA 4LMQE 2D7MA 1XF2B 1HI6A 4QRSB 2VLRD 4J4PD 2AKRB 3D85B 5E8OB 4X4YA 5DK0B 1IKFH 5AD0B 3ROOA 5FEBA 4DWHA 1PG7W 1FP5A 4WFEE 4OI9A 1YEIL 1FORL 2NY1C 2ICES 4ODBD 1OAQL 1BFOB 3H9SD 2AK1H 2EEAA 1DQJB 1P6AB 1YEFH 4MSWA 4ZAKC 2EIZA 3IFNL 5IHLB 3ZKXB 2CGRH 4P3CH 3G5XA 2ZPKL 2EDXA 2V2WB 3QT2A 5FGCE 4PRPA 3SKNB 1QBML 2XN9D 3MLSH 5CBEB 1OAUL 5JUEH 4R3SA 4MVBD 1A6TB 5K59F 2PN5A 2RQ8A 4I18C 5ESVA 1IM9D 1WBXA 3QRGL 3BPCB 3CLEH 4K8RD 2PETA 1LEKB 4IRJC 1KLGA 1CCZA 1EO8H 2XZCL 4Y4KA 5E8PB 2VL5B 3HA0A 4UINL 3KPQA 2A83A 2GT9A 2YBRA 2W59A 4J1UB 1E4WL 3HR6A 5I1HH 1PKQA 2X89D 3ZSSA 1JYWA 2Y6SC 3ULUE 1QVOA 2WBJB 3KPRA 2LQRA 5DUPH 3ULVC 5D1XD 4G6JL 3C5JA 4WUUE 2R1WB 4ISVB 2G5BA 5JW4N 1RIVH 3LB6C 5CJXC 3AB0C 2V7HA 1VPOL 5JPMB 2BNRA 4P46B 3BP4B 4U1MB 3HZMA 3D25A 43CAA 3IFPA 2P24B 5FA3A 4NWTL 2XTLA 1JGLL 1MFEH 2RIKA 3RWFB 2JCCA 4Q6IB 2QQKH 4WV1B 3AM8C 1SBSH 2BNUA 1N0XL 2W92A 5HD8D 2R56H 4OZHB 3W11D 1E6OL 3LAFA 5MERA 1K85A 1R5IB 5J13C 4NQEE 5DQJB 2H1PL 1HINH 3BZDA 2AXJA 1EGJL 3MV9A 2XFXB 3JV6A 4E41A 4CVXB 3WLBA 5HVHC 3AFLA 3RIFK 1EJOH 3WJJA 5HTSA 1T04A 1F4WL 3ZE0E 2JIXB 4UUJA 4RFEB 4I2XB 3GNML 2CRZA 5D6DC 1TVBA 4EUPH 1MJUH 1WIPA 3B2UD 1UB6A 3C5ZA 3DVGB 1S7QA 1S5HA 3T0EB 3TCLA 3A6CH 4M6NH 5C0FB 1ED3A 1F3RB 3LEXB 5EIVA 3TYGL 3UTZA 1FNHA 5DJXB 1DFBL 4F8QA 2CPCA 3DBXA 2VDQH 1ZEAL 4AMKH 2P42B 2B0SL 1NGQH 1BAFH 1GHFL 1J1PH 4APQB 5JXEC 4BH8B 3QFJD 4U1SB 1NBVL 5GGUB 1BD2B 3RWDA 3MOBH 3WD5L 5JLZB 4TRPL 1AP2A 3THML 3Q5TA 2VZOA 3K80A 2DQCL 3I50L 1Z9LA 4AM0B 2AVGA 4U1KA 3ARRA 5DURB 1DBKL 1JZ8A 4FXKA 4HH9B 1LHZA 1Q1JL 3PP3K 4K7FB 4Q74A 4I77L 5FYJE 5EULV 5A3ID 4L8SA 5GZND 2VXSH 3V4VH 3S98A 3DNKA 1YUHB 1I3RB 1IJ9A 1QFWI 1RHFA 4PRNA 3EDDA 5F6HI 1WZMA 4OZGA 4U6XA 2Q8BH 5JHDD 5FO8A 1HHIA 3MRBB 2XWTA 3GRWL 4PV9A 2VKXA 2NLJB 3D3VB 3MA7A 5GS3A 5ISZB 3BX7C 2YK1L 3ZDXE 4YDIL 4U7KA 3U4EB 2IANE 5IIEB 4MD0A 3ZYOA 4R96B 5J1SC 5I1KH 2JJTA 5EO1B 4KU1A 5IVZB 3RWCB 2NX5E 4JPWH 1UZ6F 1MWAL 3KDMB 4PJ7E 4YPGA 5IW6A 1AR1D 3O3AB 4OD3L 2OX5A 2DQEL 4YHOH 3O6ML 3OB0K 5CJOL 3VWKC 4UV4H 1HQ4B 1CICD 5EBGA 4FZEL 4NPYB 1U0QA 2YWYA 3RAJH 4GQPH 4HIHA 4PJDA 4AENB 1KJVA 2KL6A 5L2KB 1NGPL 1JPTL 3UBXG 3V5DA 1JF1B 1E4XL 1S9YA 1TXKA 1XGQA 4HUMB 2DOCA 3ULVL 5E08H 5F6IB 3D5OF 1V7NH 4ZS6D 3EOAB 1QKZH 2E9IA 4P99A 1F6LL 1DLFH 5E8EA 1AC6A 3MX0A 4LVNB 3QCTH 1QSFA 1VFAA 5HHOB 3QUZA 1WEJH 2VMFA 5EU6B 5FCUL 4NM8L 4GH7B 3U9UA 3DVNA 3PGCB 3O9WA 2DLHA 3MRJB 4BYHA 3S37X 1K8IA 4NBXB 4FP8L 1HOCA 2VZTA 2EIDA 4X6BB 1AR1C 3BD4A 1BQLL 5C7XH 3WIHA 2FBOJ 1BX2A 4JFDA 4Y7MA 4M7JH 5TF0A 4O5LH 5DVMA 4RX4A 4XVSH 1DZBA 3VXUB 4QLRA 5GGRY 3UTSE 1HH6A 3M45A 5KAQF 3GKWH 2RCSH 2DMKA 3DVIA 3LHPL 4MDIB 3SDYL 3WO4C 3O2DL 4JZNB 4IRSB 4PGBA 5IBUB 2AEPL 1MSPA 3HNTH 3OV6A 4JM4L 5D2LE 3IGAA 5IMOA 5C0AB 4A6YL 4ZODA 1ZVSB 2AEQL 5DUBA 1OGAB 3T0VA 4HWZA 4HG4K 4NNXB 2FJFA 2UVFA 2FO1A 2G2RA 1JVKA 4GOSA 1A1NA 3C9NA 1TTFA 3Q1SH 4FQ1H 4PJHF 3VFNB 3MR9A 5HDQL 1FO0A 4WEMB 1P4BL 4X80H 4KZDL 2HJKA 1Q0XL 4QXUL 3OAZH 1EXUA 1NLBL 3O6FD 2VDRH 4FHBD 3KXFD 3RUGF 4G6ML 3DMMA 5C08B 1XCTA 3O4LE 4ZUVA 4F58L 1UENA 3VW3H 1L0QA 3NFNA 4Z6AT 1QTYT 1WSST 2BVUA 3VXQB 2IGFH 2ITCA 4G8GE 4HZLA 1X5XA 3U46A 4Q9BA 4N8CH 1KPVA 2ZUXA 2AJXH 1RK0B 3T0DA 1DSFH 1KENH 3SE9L 1CD8A 1LVEA 2IPUK 2J6EA 2XZQL 2XZZA 2V5YA 4I8DA 3GSUA 3V95A 1QZ1A 4ZYKB 5DF0A 1UVQB 2XTJD 2A6IA 4I0CC 3WJLC 5KN5B 4YLQT 4YDVB 2BERA 3K4DA 1UKTA 2FRGP 3LCYA 3O8XD 4FZ8H 1C16A 5KOVC 1I4FB 4U0RC 3V6OA 1DEDA 5E2WL 1FRGH 5EU3B 1G7MB 5BVPH 3PXHA 1V3JA 3C09B 4XCYA 5AYUH 4HS8H 4GG6B 3L9RA 3GJFK 4LKXA 1FG2B 1WT5C 1Y6NR 2IFGA 5DLML 2VXVH 4ZS7L 3VFOA 4PJFB 2H32B 2L4OA 2VLJB 4NO3B 4N90E 4G6KL 1F8TH 1UEMA 3L5XH 3RY6C 4JANA 5TQ0L 5GISH 1GJIA 2PW1A 1LP9B 1YDPA 5D6CA 3WHXA 1B88A 2ZG3A 3AU1A 3MROA 4D9QD 3QXDB 3QCVH 1F3DJ 1HHGB 1OM3H 1RZIB 3WFZA 3CSYB 2BHUA 5HYSG 1QSZA 5EOCH 4PJIF 2B39A 4HGWB 1QNZL 1S7VA 2XTJC 1AJ7L 4ZTPL 3UCRA 3DRTB 3MLXH 4OFIA 1CLYH 3O8XC 5D2NB 1NJ9A 3IXTB 2FIKA 2V5TA 2IG2H 3INUH 4KC3B 4U1HB 3TV3L 5D9SB 2UUDH 4LOUD 3MV8D 2YSSB 3SKOB 1FL6B 1GGTA 4EN3B 5DDHB 3FO0L 3MACH 2GFBB 1VEPA 1KTLA 3VG9C 4JY5L 4WUUA 1JGUL 2YEZA 1R3JB 5BOPA 1IAIH 1R3HB 3LPWA 1GGIH 2EDNA 3JTSB 3BP6B 3W2DL 3T77A 3QNXA 3MRRB 4JHAL 3O4OB 3ZTNH 5JW3L 1F45A 5ID0A 5FO7A 3N85L 2WWMC 4LEOA 1U8HB 2AQ1A 2VZUA 4P57B 1J0HA 3F58L 1JHLH 1J0YA 4CGTA 3EO9H 3UTPE 3O2WH 2DDQL 2D0GA 3IDJB 1NAKH 2AGJL 4HHAB 3ZL4H 5F89B 4L3ED 3SE4C 4TQEH 1U8KA 1Z3GL 5J6HB 4YNYB 4NQEA 1CZ8H 4FQCH 1EGJA 2X4UB 2CDEB 4ZPVB 4KMTL 4RGMC 1GZQB 5ANME 2VQ1A 4UMGA 4JFQB 2OTUB 3BVNA 3DV4A 3WNOA 5KANG 1NAMB 3DX6B 4CDGC 5L6YH 1RHHB 1WFUA 3P30H 4NZRL 3K7UA 5BVJA 3FMGH 5D1QA 4F9LA 1MPAL 3DRQA 5CIPA 2VL4A 3B3IA 1H0DB 4IOSD 8FABA 4O51A 3ARFA 3BGFC 3LQAC 3G9AB 4BFIB 2ORBL 4GS7B 4XNYH 5HI4C 1NBZB 1FZKA 5HYJE 4OB5L 2Z8WC 5CCKH 4NYLA 2HWZH 1B0RA 2VWEE 4UT7H 4O9HH 4JFEB 4BSVA 3N06B 4U2ZA 3UAJD 4I48B 3VJ6A 4FQJH 3KG5A 2FLRT 1I7ZA 3EO1B 2C26A 3H9HB 3PDGA 4MLIA 1A1MB 3CDGB 4NRZA 1KCRL 4KKNA 1UWGH 2C4XA 1D5MB 4PRPD 2IQAB 2PXYB 3ARPA 5FUOH 1AXSA 1G7JB 1KIPA 1TZGH 3FHQA 1QFPA 3CFBB 1BZQK 1K5NB 2Y07L 4Z7OF 4PJAB 5GS0L 2AEIT 2OJEA 4XHQA 3BZFB 3LQZB 2XKSA 1JUFB 2BSRA 4KY1L 2YPLA 2Y25A 4Y4KD 3GRWA 1K2DA 5T5FH 3FO9B 3QQNA 3QA3A 2OR9H 2XG5A 3OPZH 3QB7C 5BV7C 3FO1B 2X9XA 4X7SH 1ZHNB 3STZA 4U6VH 4WFFD 1QFWH 2IANA 1LD9A 4RBPH 1TIUA 1K4DA 1ZLWH 1H15A 1MJJA 3KPRD 4FQHB 3EO0B 3M17A 1D9KB 5FYKU 1MWAA 1WAAE 4ZPTA 3UAJC 6FABL 5DRXB 1EUTA 3G5ZA 1RZ8B 2APTA 2FX9H 1TMCB 3L3JA 3NZ8B 1UA6L 3WFEL 5E6YA 3WNMA 1KB9K 2I07B 4WW2B 3HNVL 7CGTA 1HN1A 1RULL 1X5FA 3PHSA 3GK8H 1R24A 3P77A 5TH2A 3HPJB 3QXUA 4R0LC 1S7XB 2W9DL 1F4AA 5I1DA 2YPKA 2VISA 2J8UF 5LAXB 1RSFA 4PYHA 5C0BD 1KF9B 3Q3GB 4PJXF 3GBNH 3RL2B 2BOCA 3STLA 2C3XA 2CK0H 4WHYH 1KACB 4X6DB 3GDBA 4QHUA 4KK9D 3MV9D 4FQPA 4E41D 3S36L 3D2UB 4L4TB 3QXWA 5BQ7B 1S9XA 3WLWC 2C3WA 4HZAA 5I18H 1WBYA 2G75B 4HKBB 1ODAA 1FJ1B 4GRLB 1U8OB 3QIBC 4YHNB 3LS4L 3ZZ1A 3MRQB 4L4VA 3C5ZD 4Z7WF 2FECI 3JSSA 4K8RH 2H3NA 1HZHL 1REIA 5I17B 3MRIB 1H8OA 3U6RA 1C12B 3RX5A 2OL3L 1YEJH 3ARSA 5F7HA 3C08L 5I1EL 5SWZB 2GSIB 5IHUL 1BJ1H 2R29H 3UTSA 5KSBF 5J6GA 5C09E 1DEEB 1QO3B 3CFKA 3I6GA 1J88A 1C5BH 4IIQA 1WC7B 1U92A 1P84J 4EUPB 4ONGL 4WHTB 1NPUA 1FFPB 3ALWA 4F7EB 2P44B 3T1FA 2EC9T 1VGEH 3NABL 1EEZA 5D2LA 1ZHLA 4YX2L 3GI8H 4DQOL 2C9AA 5IBTH 1DQLH 3SEPA 1G9MC 2IAMC 1A6VH 4LPYA 1DQDL 4U1NB 2X4SB 3VDBA 1CYGA 4GKSA 3IU3A 4NUJB 1E6JH 2XZAH 4ZFFA 4G9FB 2F8VA 3IF1B 5T1DH 3CFIC 1ORQB 3FCTB 3HE6C 1YMHA 3DURA 1ZSDB 1A3QA 1IGFL 2VSCA 1BVLA 3ARZA 3B8SA 4XBPB 4HC1L 3P9MA 3WFCL 5F72S 1N6VA 1RI8A 1U2HA 5FDWB 3TPKA 5ITFB 1VGKB 1NFDB 4MMZC 1HHHA 3GBLA 2AV1A 4PS4H 4XCFH 2AXHA 3O4LA 4QRUA 4RGOH 4W68A 3C60A 1JNJA 5CP7B 4HUVA 3QEQB 5FYLE 4QRQB 1BGXH 4NBZB 1LEIB 1U3ZA 5I8CA 4ZSOE 5IQ7L 1YJDC 4Z8FL 1U8LB 2OQJB 1CGUA 1T0MB 3SDXB 5J7CC 5DXWA 3LN4B 4HJ0D 2VAAA 4FFVD 1ZANH 4J7RA 2FJGB 4O00A 4C56A 5BV7L 1NEUA 3RTQC 5I75C 3I75B 1NC2A 2I9LB 2F58L 3H3PH 5BRZB 4HUKB 3HRZB 4QRRD 1PSKH 3DIFA 5DRNA 4XI5D 4XP5L 3RX7A 5CBAA 3SE8L 1RJZB 3SE3C 2BRQA 2VKWA 5DJYA 4S1RL 5GSVB 6CGTA 5D8JH 3UZEA 4KROC 4GRWE 1QSFD 3QUZD 1I1FA 4OV5B 5D72H 1D5BA 2P5WB 1X5GA 3E6HA 3O9WD 2BJMH 3TH3T 3FT3B 3GB7B 4XCEA 5E03A 4TUJA 4NOBA 3GSNL 1NH6A 1YQVH 3CFJA 4X6EB 3I3BA 3TNNA 1QSEA 2DJSA 1UM6H 3K2UH 5HHMB 4HJ0C 2YD1A 3K4AA 3BAEH 3BYYA 4JFDD 5EBMB 4YO0B 4ZFOA 4IRZH 4KJYA 2IPTL 4I5BA 1NMBH 2R2HB 3MRDB 4RX4D 4PR5A 4WW1A 3H9ZA 4OIBA 2ZWLT 2X41A 3CCHB 5IHBA 3PIQB 5IHZB 5JOFA 5IFHL 3L5JA 3LEYH 4YWGL 5CILH 4XI5C 1KTDB 3BO8B 2VR4A 5L8JB 2COQA 4MQTB 3O6KH 4JO2H 2CUHA 4R4FL 5I30L 4E5XA 5IT2H 4JG1H 5IF0B 3KLHD 35C8L 1IM3A 4JRXB 5MENA 3IU4H 3EFDH 5C9KA 1HDMA 2Y1VA 1KG0A 3QUXB 1G9NC 3CXHJ 5FYJU 3V7MA 5C2UB 5FYKD 3VH8G 2GTWB 3FN3A 2HVJB 5HI3D 5HJ3B 3EIFA 4ELKB 3MPCA 4FTVB 4WTZG 4OSUL 2CKBL 1KFAL 1P6FA 2BNQA 3V52L 5AWNL 3IETA 1ACYH 3VXNA 3S6CA 4LLMB 1ORSB 3V79C 3T2OA 1TJHL 1NCBL 4PJ8D 1FVCA 4TTGA 4QTIL 4I3SH 1IGJB 4M7LL 1JPFB 3RL1B 1E4KC 1YECH 3VFUA 4OUUA 5GGTH 2AEWA 4MXVF 2CJUL 5IV2B 4BSWB 5IMLB 2BVTA 3EYQC 4GW1B 4HIIB 5BW7A 4LARL 2JCCF 4P2QB 3DMMD 4XXDA 3GO1H 4NN5C 1BIIB 1P7KA 3KLHC 4WJ5A 3KPOB 5DHYA 4MAYB 1F6AB 4PJCB 4Y4FA 2BRRH 5IR1B 1YN6A 4N0FB 1IGTB 5HI3C 4P5KA 4OZHE 3PWLA 2VABB 2V2TB 5J9PA 4X8JB 2VDKL 4JN1L 4BH7A 1T21B 5ICXA 1CGSH 5JOPD 3PE9A 5F1IA 4IMKA 4PJ8C 5TE7L 2N7BA 5MI0C 1OF2B 5DC4B 2XA3A 3SHSA 3I85A 3LN5B 1P9MA 2OZ4L 4G9DA 4TVPL 3O3EA 4I2XE 4A2LA 2P7TB 4KTEH 4OKVA 1OP3K 3I6LE 5HYJA 4ORGA 2P8PA 1A7PL 1KYOJ 5L9DL 5F9AC 3S36X 1J11A 5C0DA 4E42B 4OF8A 3T0EE 4JDZA 4DK6A 5IEHB 3GMLA 3GSVA 1X5IA 3FONA 1IFHL 1I7RA 3O41B 5HHQB 3U0TB 1PY4A 2H2SD 5CEYB 4KHTL 2R0ZH 4DVRH 3EYOA 1A14L 2G5RA 2X05A 4CMMA 3NCMA 1YEEH 5C0EB 2GAZB 4NO5B 3UTTA 4K3DL 4Q0XH 4S0TD 2FHBA 4ZQKB 4AQ1B 1NMAL 3SDCB 3WN5C 1LO2H 1BD2E 4PB0H 3QO1B 4FQ2L 1XFPA 2DQHL 5DQDH 1KT2B 4JFPA 3ARDB 4DTGL 3AY4A 3KS0H 4POZD 3RWJA 4LPTA 5HGAB 4U6HA 1RJLA 4I3RL 8CGTA 1QD0A 3O45A 3PP3H 5DJAB 1EBAA 3MJ8B 2Q87A 3TT3H 3LPGA 3ULUD 1CFSB 5CEZE 1QFWM 1T20A 4UZGA 4G5ZH 3NCCB 5JPNA 2D03L 3OAUL 4WUUD 2NY2C 4ERSL 4LF3B 4IHOA 1QYGL 1MFBL 1YEHH 2Z92B 3NA9L 3UJJL 2A9ML 4KK8D 4O2EA 1EX0A 4XVJH 5E6IB 1Y6MR 3C87A 4ODTH 3HG1A 1U8PA 5A40E 1T7XA 3GI9L 3T4AB 4RFOH 3IDYB 3D3VE 3BWAB 3V6FA 5TE6H 4Y5YB 5IFAL 2WIIB 4LSTH 5ISZE 4HS6B 4LSRH 2EYRA 3DUUA 5DJ8A 2ZUQB 3QXTA 2E7CA 5F7WC 3S9DB 3NFSL 4NQED 1G9NL 4PJDF 1U8JA 3ULUC 3BDBA 3B2VL 3EZ8A 5HVFB 1WVZA 2HT3D 2VXQL 4NQDB 2PW2B 2BMKA 3SDDA 1AGBB 1RD6A 4OF6A 4G8IA 3IJYB 4Y5XA 5C8JB 3RNKA 4LIQE 4P9ML 2Q7YB 3DYPA 5EBWA 3EOBA 1IQWH 5DMYA 3DETD 4JCLA 3PHQB 4NRXA 1T1ZA 5LWYL 4QF1B 3HCVA 2OL3A 3GSOA 5I9QC 3PWNA 5HSFA 5D1QD 2IFFH 5JIHA 3TFKD 1EO7A 3L3IB 3ZHKA 2WINB 3FQXB 2DQUL 2BSED 4XNMA 4ODUA 5HHOE 5C09A 4ODVL 4HWUA 5E99L 5EU6E 1HH9B 1NUGA 3UZQA 4GBXA 3ARFD 2GJJA 1F3JA 4L8DA 2CMRH 5I1JL 4N8VG 43C9B 4PLKD 2H6PA 4EDXA 3TBTA 3UTOA 4FFYL 1ONQA 1M7XA 2HJFB 3F6LA 3FQNB 1XF1A 4P2YA 4RZCB 1TCRA 3QJFB 2HT3C 5E2VH 1MFAH 4FQLL 5CWSB 4XH2A 2P8MB 4LQFH 4DKEL 1FV1B 3VFTA 4CL7A 3VXUE 3H2WA 1KELL 5CMAA 3DX7B 4WU7A 3QIUC 1C5DB 1EK3A 5EO9B 1Y18A 1JHTB 3LRSB 3QNYA 1A7RH 4Z95H 3OGCA 1HYSD 1LE9A 5IWLC 2R0KH 1VHPA 5DHVH 2B2XL 4FMFA 3K81A 2YPLD 3AAZB 2VE6B 1BVZA 4J6RL 4WCYL 3MJ7A 1NEZB 4P23A 1IGIH 5C0AE 5EOQL 4JKPL 2IAND 4NM4L 3OX8A 2PYEB 1FGVH 1OGAE 5DD3H 5EOTB 3FQRB 3MRLA 4LMQI 4R2GB 2DAVA 3RDTA 4QHLB 4ZSOA 4M93B 4NNYA 4J3UA 1YPZA 2ADIB 4G7YH 3V6ZB 3C8HA 4IEFB 1VFBB 3TYFA 1WWAX 3QEUB 2ZOLA 1TNMA 3D39A 2DM2A 1OT2A 2DJ4A 2V6HA 4GW5B 5C08E 5EIQA 1A9EB 4EIZC 5JDSA 1O0VA 1H9VA 2ICWJ 2VRAA 3NAAL 4P4RB 5DRZB 3MYJA 1RZ7L 4UU9B 1ITCA 3N1MC 4LRNL 5DUMH 3MCG1 2AERT 3SGKC 3KJ4C 2VZ3A 1W0WA 5DWUH 3X3GL 3TLRA 5E56A 4JZJC 4K71B 2NYYC 4KVNH 2NW3A 5F96L 1EIBA 1NUNB 3C6SB 1XF2A 3HUJA 4QRSA 1E27B 4LHQB 3DI3B 2AKRA 3OKKB 5E8OA 2JELL 3GSNA 5DK0A 4E0RB 4L4VD 1DCLA 2R39A 1OTSD 4CMHB 3GJFH 1HIMH 4LP5A 3H9SB 1QLRB 3D6GA 2NTFB 4GAYB 3SN6N 1BFOA 4GG6E 3U0PB 1B4RA 1X3DA 2D7TL 1DQJA 1UKQA 4PJFE 3UTSD 2VLJE 4DFIA 4DN3L 1J5OL 2J1KA 3AS3A 2HP4A 4P9HC 1LP9E 2O61B 4B7IA 2V2WA 3SKNA 3HC4H 5J56B 4D9RD 1A6TA 2YC1A 2E5EA 3WUWB 3REWA 1OW0A 4OCYL 3BPCA 5CAYB 3TA3C 1LEKA 3MLWL 5ITBL 3BIKA 5BXFB 2FX7H 1T1XA 4YXHH 5IGXH 2VL5A 1Q94B 4G42A 5D2NE 2UV3A 1W0YT 1UWXK 4U1JB 4UB0H 4J1UA 3BH9B 1DTUA 4JAMB 5DO2D 4GKZB 1AFVL 4DGYH 5KSVB 1DJSA 1DQTA 1OTSC 5KJRL 1BWWA 5EZOH 5IBLD 2WBJA 1J87A 1T7YA 3ZT7A 4QGYA 4NCC2 12E8H 3KPMA 4ISVA 4C4KO 1IEBB 3MBXH 4HUXB 3DV6A 4G43B 4JM2C 3MBEB 4QOKB 3ZKMD 1U6AH 3QHFH 4PJHB 5JPMA 5JA9A 2ID5A 3CSPA 1IRAY 3TC9A 3TN0B 1LO4H 4LRIA 1IC7L 4HCRL 4P46A 4U1MA 4IIQC 1N26A 3O4LD 5E00B 3C60D 4HPYH 3F7RA 4NZJA 4CW1B 4YC2B 4X0KB 5F9OH 3NACH 4WTZA 3UJIH 3RWFA 4KH2A 1JL8A 1W0VB 4WV1A 1M4KA 1V05A 1LDPH 2BXZA 4DW2H 4HD9A 1R5IA 4EOWL 1IBGL 5DQJA 1KUMA 1DR9A 3TWCH 4N0YH 3EYVB 3L3OB 4L1DA 2DD8L 5MEPB 2XFXA 4C56D 4CVXA 4LPCA 2R2BB 5IBLC 1CBVH 1NC2D 5FUZL 4U31A 2OTWB 5DJDA 1IEAB 5F9WB 5DMJB 4I2XA 1TETL 1MJ8H 4ORZC 1QBLL 4DGVH 1BQHB 3CMOH 4DAGH 1MH5B 4M43H 4GSDL 2XV6B 3ZHLA 5GGVY 4JHWL 2V5MA 5CSGA 3T0EA 4EJ1C 4WU5B 2YHGA 5AAWA 4MAUH 4OCWH 3CLFL 5F70A 5DHXB 1ND0B 1MY7A 4JFOB 2ADGB 1RUKH 4GAGH 1PG7H 3EUUA 1J8HB 1MEXL 3PGDB 1Q72H 4HF5H 2DQGH 4BH8A 5LBSL 3QFDB 2YA2A 4U1SA 1U95A 2UZXB 5JLZA 2MHAB 2FX8H 1QSED 5GIRB 2E9WA 3VXTB 1Z2KA 5HGBA 4AM0A 3QG6A 3S5LG 4XP9L 5E2TL 1RJYA 1JF5A 4JFEE 4PJIB 2W0PA 1N5AA 1ZLUK 3SKMA 3LIZH 3NCBB 4UILH 4RMWA 4PGCB 4HH9A 3BKMH 3TIEA 3OF6A 3BH8B 3SDAC 4ZOBA 2NY5H 2IMMA 5KS9B 4XPHH 3NGBB 1AXIB 1X5JA 1J86A 4BK4A 2OSLB 3DROB 3EBAA 1KSRA 5MEND 2CLVB 4NUGH 3MLZL 4LBEA 4PJAE 1IKFL 4HUWA 3K8KA 4XC3L 5C6TH 2NY3C 5EIIA 3V0WH 3MRBA 4KJPC 2NLJA 3BE1H 4YFLI 5DA0B 4BZ2L 5LXGH 3ZMRA 4PJ9C 5ISZA 3UTPD 2BNQD 4EBQH 4R96A 3NH7H 2FL5B 3MLYL 3G6JB 2AJZA 1CFQB 1S8DA 5EO1A 4OGZA 1VESA 3BJLA 4Y5VA 3KDMA 4H8WH 3BGMB 4JREB 1R3KB 4M6OH 3O3AA 2MJWA 5ALBH 1TJIH 4PY7A 1EUUA 3EKCA 3HAEA 4HPOL 3OXRB 4QXGL 2ZSVB 1HQ4A 1U8NB 2QQLH 1PEWA 4AENA 3EYFA 3X11A 1ZGLP 5L2KA 5M7QA 2I60L 1MVFA 5DR5L 1JF1A 2NZ9D 3E6FA 3MXWH 4P59L 5JR1H 4LEXH 4YFLF 3S8WA 4Y4FD 1OWWA 1MREL 4XBEH 5B3JF 3VFSB 1GC1C 4BKLB 4P48A 4X6DE 4M5YL 5D1ZB 5HHOA 4F57L 1LEGA 3LSOB 5EU6A 4JPVH 4L4TE 5EC2A 5B21A 5BS0E 1ZT4B 3PGCA 4NSKB 4HQQL 4MXQC 1P5UA 3I2CH 3KLSA 4U1GB 4MNHA 2CDFB 1BJMA 5HYJD 4X6BA 2E27L 1G9EA 2JB5H 3AMLA 3GJEA 3MNZB 2FD6H 4LPWA 4OAWB 5KVGH 3VXUA 4HK3N 4KQ3H 1J1OH 5D93C 2AJYL 1WUNT 4AEIL 2R0LH 4H5SB 3OQ3B 1L6ZA 2X4NB 5I8KH 5LGJB 3DGGB 5DYOB 4MDIA 4OIIH 2EDWA 4HWBA 3DHMA 5C0RH 5A43C 4JZNA 4IRSA 2PTTB 3SKUD 4BQCA 4HV8A 3B8YA 1CFTA 3Q6GH 3MTRA 1AXTL 1J0JA 5C0AA 2C7UB 4RNRB 4EDWH 1ZVSA 4LCCB 1NCAL 1AQKL 4NWUH 5ELIA 2I5YH 3F7YB 3N1PC 1T1WA 1Q9LB 1GGBL 1ZA6B 2VWEC 3S37H 1WCQA 4NNXA 4R7NB 2BSTB 4J12A 2J6EH 3CDCA 1GSMA 1LO3H 1OB1B 4G9FE 2IEPA 4XCCH 2ATKB 2YPVH 5K9OA 2ZCKH 1O7SA 5IB4B 3VFNA 1OSPH 3LD8C 3RFZC 1FZJB 1LE5B 3HG1D 4ONFL 1CS6A 5ESAB 3Q2CA 4DFHA 3LKPB 2Q3ZA 2X4PA 3KXFB 2HVKB 3DYMA 3UC0L 4XNZC 4K55A 5C08A 5I0ZA 2ZG1A 3LKOB 5KVEL 4UI2A 4YHLL 5FM5M 1YEIH 1FORH 3ZTJG 3QEQE 5FOBB 1OAQH 5KSAC 3P40A 3GHEL 1JMZA 3LKSB 3JXAA 3F7PC 3C8KB 3IFNH 1KB5L 1KN4L 4FXGB 3DJ9A 3FB5B 3BD5A 3OKNB 4LHUG 4F37F 4M4RA 5I8OL 4AK1A 2DM7A 4PJXB 3SDXE 2ZPKH 3W5NA 3BN9C 4ZYKA 1UVQA 5HY9B 2MMXA 1QBMH 1U8QB 4JVPA 3STBA 5KN5A 1OAUH 3SDDD 2HAZA 5BRZE 3SQOL 4OI8A 2QADD 2PKDA 3QRGH 3ARBC 1I4FA 4NQSB 2AXFB 1T83C 3OZ9L 5EU3A 5MHSE 1V5JA 2XZCH 1CT8B 1AD9B 1Y0LB 3IJSB 3QI9C 2R69L 4R4ND 1ITBB 3JV5A 4UINH 4Z7WB 4MJIB 3V2AR 4GG6A 1ZWIB 3CH1B 1OY3B 1E4WH 1FG2A 1J10A 4PJFA 2H32A 2F54E 4NO3A 4L9LC 5C09D 2RHEA 3QQ9D 1LP9A 4HLZG 4QO1A 3QUYC 4WFHE 4GBXD 3EJYD 4N0CC 2P5WE 3RWIB 5CD3B 4U33A 1DE4B 4G6JH 1CFNB 2AJSL 5AZ2H 2FSEB 3VD4A 1RZIA 1R3IL 3U36B 1VPOH 4RISL 4HGWA 5KTEL 1OCWL 5HHME 4TYUA 5E08L 2BY2A 3FQTA 4RA0C 4NWTH 5D2NA 3AGVA 3HB3C 1JGLH 3IXTA 3FFCB 4YZFE 2X4QB 3MUY1 1N0XH 4EI6A 5D9SA 3G5VB 3VDCA 5D7JC 1FL6A 1E6OH 3MRNB 4PRIB 5DDHA 2GFBA 2H1PH 2EKSB 4XPTL 4I1NB 5AUMA 1R3JA 1EGJH 2WQRA 1R3HA 4JRXE 5DVOA 1AQDB 2EDBA 3JTSA 3C2SA 1BIHA 4S1QL 3MRRA 1F4WH 3VMOA 1JWSB 4NKIL 1HHKA 3BESR 3GNMH 3KYOA 4HCRA 4P23D 1EPFA 1U8HA 1VACB 3MO1B 1JTOA 5ID1B 4EI5D 4LCYB 4PJ5B 4XX1G 2BOBA 3TVMC 3DUSB 3RDTD 4RGNB 3IDJA 5CINL 1SJHB 5F89A 3VXMB 4P0DA 3O6LL 1ZEAH 2EYTB 5DD5L 2Z93A 2R8SL 3RBSA 2B0SH 5J6HA 4YNYA 4NC1E 5DHVB 1GHFH 1FFOB 3T3MF 1N59B 1I7UA 1XIWB 2CDEA 4X7FC 4ZPVA 3GMOB 1A6ZB 4XXCC 3SCMA 5KANI 1NBVH 2EEBA 3WD5H 4TRPH 2FB4L 4P2QE 1OP5K 3THMH 4JFQA 2D31B 1T2XA 1XZ0B 2W1NA 2DQCH 2ZUSA 3I50H 4KK6D 1I1AB 3JUYA 1CLOL 1JV5B 4XNQB 1NAMA 4TSAL 5I74C 1DBKH 1XGRB 4PJCE 3ZE1F 1AKJB 1U3HB 2R0WL 1Q1JH 4XPFL 5JW4M 4MX7B 4EI5C 4XGZA 4I77H 3BKCL 2C5DC 3B43A 3T2NL 1WWWX 4XTRC 1H0DA 1KCSL 4X4YB 5DMGC 4NKDB 1S9VA 3HI1A 3RY5A 4BFIA 5A2LH 1QEWB 4OLWL 3GRWH 5DZLA 4U4BA 5J57B 3EZJB 4LCUA 2BDNL 2YK1H 3Q0HA 4YDIH 1PW3A 2CO7B 4I48A 2O5XL 5BMFL 3EO1A 1A7OL 3H9HA 3CDGA 3OSKA 1MWAH 1QLEL 1YEKL 4R3SB 3I9GL 2ESVB 2IQAA 2PXYA 1G7QB 4Y2DB 5HHXL 4OD3H 1P1ZB 4OM1L 1K5NA 3CFBA 4JDTL 2DQEH 4TTDD 3O6MH 1BZ9B 4LLAA 5MEQB 5CJOH 2MFNA 3BZFA 4LGPB 3LQZA 4FZEH 1FRGL 3GJFB 2DQDL 4OM0L 4C83A 4GXUN 2P5EA 1NGPH 1JPTH 3KPQB 2YBRB 4PG2A 1E4XH 4OJFL 4JVUA 3FO1A 3CX2A 3ULVH 3VWJB 1TDQA 3KPRB 1G6VK 2WBJD 3BIAX 3CUPB 2NZIA 1CG9B 1KXVC 3EO0A 4FQHA 1D9KA 1NDMB 2HTLC 5JMRA 2WNGA 5SWSB 1CE1L 4KQ4L 2G5BB 5DRXA 3CSBA 2C4FU 1RZ8A 5FCUH 4NM8H 2BNRB 3V5KA 3BIBX 1HCFX 2BSSB 2I07A 3FKUS 3FN9A 4YUEL 2R23B 4FP8H 4P46D 2MPAH 4HK0A 1G84A 2V9RA 3IFPB 4F7MA 3CU7A 1BQLH 3T0AA 4P5MA 2JCCB 3PUCA 4Z7VF 2BNUB 3T0WA 5C2BL 5LAXA 5MERB 3DLQR 2GITB 5M94B 3Q3GA 4L4JA 3ZYJA 3TO2A 3UTQB 2E9BA 4Y19E 1U91A 4MQSB 4X6DA 4HT1L 1I9IL 2DQIL 3OKMB 3WLBB 4L4TA 3LHPH 2NXYC 4NKQB 4E9LA 3SDYH 5BQ7A 4NQDE 2G75A 2J3SA 3O2DH 4HKBA 4TVPD 1TVBB 1IL1A 1FJ1A 1SMOA 1U8OA 2Q20A 1BOYA 3O81A 4GRLA 4YHNA 2AEPH 3I6LD 4MA1C 3MRQA 1UB6B 1RZKC 1GGYA 1OLLA 5K9KB 1PEZA 1S5HB 4JM4H 3EO9L 2A73B 1ED3B 3T0ED 4LLWB 3UTZB 1EHAA 4A6YH 5I17A 4P46C 2AEQH 3T04D 1C12A 5KZCB 2X09A 5SWZA 3KLDA 1FL3A 2ICWA 4Q6IC 3L7FB 2D4DA 1JMXA 3JWOC 1QO3A 1CFVL 1X6NA 5HDQH 1AP2B 3EYUL 4HXBL 1P4BH 1WC7A 4KZDH 3GM8A 4JLRA 1Q0XH 1DUZB 1KTRL 5TF1L 3L5WB 4QXUH 1P5VA 3RQ3A 1NLBH 1UM4L 4W6XB 3WNLA 4F7EA 4G6MH 4KRPB 3PWVA 1JNNL 1NL0L 4F58H 4FXKB 1J1XL 5JW4R 2EDFA 3H0TB 3OF6D 5B38B 5H35A 4U1NA 2X4SA 4L8SB 1F02I 4PRDA 2XZQH 4NUJA 5GS1B 1UWEL 4NGHH 4ODXB 4FA8A 5IB2B 3IF1A 2H41A 1SY6L 3FCTA 4HSQA 4KKCD 4OBSA 3ORJA 1ZSDA 4U6XB 4YDJB 1N6QL 3FO2B 3W9EB 1JGDB 2R2CA 5FO8B 4PV9B 4APQC 2DLFL 5FDWA 1VGKA 1NFDA 2QQQA 1RURH 2LVCA 2RB8A 3ZYZA 5E2WH 5ISZD 4IJ3B 1YPZF 5CP7A 2PYEE 5H2BB 2VAJA 1KN2L 3CFDB 2Z31C 1LEIA 5DLMH 2ADJA 4ZS7H 4L5FL 4G6KH 5IW6B 1QOKA 1Z5LB 1ZVYA 1U8LA 1XGPB 3K3QA 5TQ0H 3UJTL 4AEHL 1MQKL 2J8HA 2OQJA 4OGXL 1T0MA 1MRDL 5T1KB 3LN4A 3OKLB 1RZJC 1EFQA 4PJDB 3I75A 2I9LA 3O2VL 5BRZA 5L2KD 1HNFA 4BFEA 1QNZH 3HRZA 1OOAA 3U9PL 1OQXA 2A74B 2D0HA 1AJ7H 4ZTPH 4WO4C 1JRHL 4C54A 1A7NL 3RWHA 4DGIL 2W9LA 1OTTC 2FWOB 5E8EB 3HUJF 4X7TA 1FHGA 4ZNCD 4XNXL 1VFAB 3QUZB 3TV3H 3ETBF 3U4BL 5HHOD 2VH5L 4XP6L 5EU6D 4P2RA 3FO0H 3U9UB 4LHUA 1FPTL 4P2OB 1RV6X 4JY5H 1KXQE 1JGUH 3FT3A 2MOVA 1BREA 3GB7A 3Q48A 1RJCA 5JIPA 3W2DH 4JHAH 5JW3H 4X6EA 1BX2B 3N85H 3RVVC 3RVWC 3GSWB 1N2RB 4XVUC 5I19L 2E3VA 5EBMA 4ZTOL 1GOHA 3F58H 1SJVA 4X4ME 3H9SE 3ESVF 3VXUD 3CCHA 3PIQA 5IHZA 2DDQH 1N4XL 3OR7B 2AGJH 3BISA 4OZFG 5C6WH 3CZFB 1ZVHA 2X9WA 3WO3B 1KTDA 5F6IC 1RZFL 3QYCA 1Z3GH 1GIGL 3NCYP 4K3JL 1UFUA 4N0UA 5IF0A 4M4PA 2X1QA 5TGBA 2WLYA 4IRSD 4KMTH 4KAQL 1MNUL 5CFHA 4JZOB 3KYAA 1DVFC 4QHKJ 2GTWA 5C0AD 1FBIL 4K7PL 1IAKA 1I8LA 5DUBB 2EE3A 4ELKA 4FTVA 2R15A 2HRPL 2H2PD 1XGTB 1M6OB 3MNVA 3JWOL 2LU3A 2V9TA 2FJFB 3HC3L 3RBGA 1B9ZA 1ORSA 4NZRH 2Z8SA 3C9NB 1GGUA 3FB8B 5L88L 2BHZA 4JGUA 1MPAH 2YA0A 1NANI 1FZMB 3IFOA 4YHML 3KWWA 3CVHL 4JFZL 1WFOA 3QXAB 1CDBA 4BSWA 4GW1A 4QOKE 4HIIA 4PJHE 2ORBH 1XCTB 4P2QA 3U7WH 4V2CB 5C08D 3PF2A 4BQ6A 3ZKND 1BIIA 4OB5H 3KPOA 2E7BA 3U46B 1NLDL 4QYOB 1KPVB 4JEGB 2Z9TA 2NY4C 3ULSB 5CGYD 5T3XL 1MAKA 4MAYA 1ZLSH 3V0VB 1EFXB 3WKML 5IR1A 1PDKA 1IGTA 4N0FA 1KCRH 3VGHA 4X8JA 1XGYL 5F44A 1NBYA 4AH2B 1TQCB 3ESUF 5HI5C 2C1OB 1D6EA 3GEWB 1OF2A 2Y07H 1C16B 5GS0H 4G6AC 2XYCA 3K0WA 5I76B 3LN5A 1L0YA 2KZWA 4KY1H 3IAPA 3MV01 1L9MA 1CDJA 2EDHA 4E42A 1JZ7A 3L9RB 5EUKA 1CDYA 4JANB 3U0TA 3C8DA 5CEYA 2PW1B 1O5DT 5CGMA 2CSPA 3WFBL 1MHPL 5CGYC 3QPXL 6FABH 2GAZA 3AU1B 4NO5A 2B1AL 1DQML 3CZJA 4ZQKA 2N56A 3SDCA 2VERN 1UA6H 5HPOA 3QO1A 1V3KA 3E8UL 4HFWB 1KT2A 4UQ3B 3WFEH 3HNVH 2ATPA 3ARDA 4MHHG 1RULH 3IDMA 4UT6L 5HGAA 2GKIA 4PJIE 4DOHB 4PP2A 5DJAA 3HN3A 2W9DH 1YMMB 3GIVB 5C0IB 1CFSA 1OWRM 4EN3D 3C09C 5HVWA 1KTLB 5FM8A 2BJML 1A7QL 3HE7B 3X13A 3SKJL 4LAQL 3B9KC 3S36H 2VXUL 1UJ3B 3BUTA 3T77B 2Z92A 3QNXB 4HG4J 1IKNC 3WYRA 5ID0B 4U3CA 3EDKA 2HRLA 3LS4H 3BWAA 4WI9A 4Y5YA 2WIIA 2VYRE 3ARYA 1HZHH 4N68A 1FLTX 4GXVL 1MHHB 1YY9D 3SO5A 1H5BC 4F3FB 2OL3H 3G6JE 5I1EH 3JUZA 1NCTA 3C08H 5IROC 5IHUH 3RY4A 4ELMB 1PAMA 1MCCA 1MIEL 3JWDC 3MCLL 3S35L 4S0SD 4RMTA 1EAPA 3PWPB 3E2HB 4UBDC 5E6ZA 5DEZA 2VDPL 3SCMD 2VQ1B 4EN3C 4NQDA 1KCLA 3BQUA 2PW2A 3BVNB 1CLCA 2DQFB 1AGBA 4ONGH 3DV4B 3IJYA 5C8JA 2F8OA 2Q7YA 1H8NA 1WZ1L 1H8SA 1UZ8B 3D69B 3NABH 1JZ3A 3F12B 2ARJB 4YX2H 1ACYL 3PHQA 3QWRA 1OAKL 3VG0L 4DQOH 1ERNA 1LO5B 5D1QB 2AK4B 4ZD3L 3RA7L 1DQDH 3GBML 5DK2B 2APWA 3DRQB 3L3IA 1T66D 1UGNA 2BP3A 2WINA 3FQXA 5SX4I 2R4RL 1RUQL 1IGML 4MA8L 4ZOEA 1YY9C 1G0YR 3ARFB 4HGKC 1HH9A 1WBZB 3HI6L 3NN8A 4C58B 5CZVL 4N5EC 5D7KE 5FKAB 2NMSA 4K94L 1B0GA 4KKBD 1IGFH 4MQ7B 1U58A 4HC1H 1YEDB 3WFCH 5F7MC 43C9A 2R4SL 1ZOXA 1B0RB 3IRPX 5E4EB 1ZMYA 4BSVB 1IT9L 3FQNA 2HG5B 2HJFA 3P0YH 4JFED 4RZCA 3U2SB 2P43B 3CMGA 3QJFA 5EZJB 1F3DH 3VJ6B 4EXKA 3LDBB 3PQYA 1MCSA 4ONOA 4M1DL 4CJ1A 3DX7A 4UIMA 1HXMA 5IQ7H 1VENA 1RUPL 3KVQA 4S1DC 5EO9A 2IBZY 2H26B 3U0WL 4Z8FH 2XXMB 1AXSB 1KIPB 5T1LA 2PXYD 3VXRB 1LWRA 1PKOA 2D9CA 3G6DL 1SY6A 4CBPA 2B4CC 4PREA 3LKRA 5BV7H 5CUSL 5I2IB 4EKXA 2F58H 2P5ED 4HUUA 3QA3B 1GVIA 4Z7OE 2GY7B 1B6DA 1D5XA 2EKJA 1NEZA 3R4DA 5FXCH 4KKBC 1LD9B 4XP5H 3FQWB 3K2MC 3V4UL 1MJJB 3M17B 3FQRA 1OAZL 1T0NB 3QULB 1D9KD 1FQ9C 4S1RH 2X1WL 2P4AB 2H8PB 3G5ZB 4XCNA 2ADIA 3R1GL 2B1HH 5E5UB 3KHQA 2WV3A 1VFBA 1I8MA 2BXYA 3RP1A 5KOMC 1R24B 2PXYC 3GSNH 3KXFE 4PJGA 3UXFA 1LO0L 3P77B 4KPHL 5T33L 4GW5A 3PL6B 1EZVX 1A9EA 4MB3A 1FZOB 5IVXF 2IPTH 4M6AA 4P4RA 5GRUL 3AB0B 4UU9A 2BOCB 5IFHH 4YWGH 3TESA 4M3KB 2F5BL 4UTBL 2ZG2A 1HEZB 5HDOA 4L4TD 3GFUA 1HNGA 5F8QC 2HLFD 4PJXE 3TCXA 4R4FH 5I30H 2DMCA 3C6SA 3U7YL 35C8H 4GRLD 3OKKA 4Z76B 1KEML 4L4VB 4GG6F 1MUJB 4N5UA 1S5IL 4PJFF 3N1GC 5J13B 2AV7A 2ICEA 2FEDC 4WW2C 5ERWB 1LDSA 3J7HA 1LP9F 4OSUH 4Z78A 1QLRA 4Z7WE 3SGJA 2CKBH 3R06B 4GAYA 1KFAH 7FABL 3U0PA 4HDIB 5SWZD 3V52H 5AWNH 3BP7A 4LGRB 5D7LB 1NCBH 3CFKB 4QTIH 1LILA 4M7LH 2O61A 3DGCR 4H1LG 4UIKL 1ZLVK 1U92B 4J2XA 4U2YA 3RNQB 3SJVA 5KSBE 2CJUH 1PYWB 4OFPA 1FAIL 3FN0L 3T1FB 3SPVA 3L1OL 4LARH 1EEZB 3RGVC 2WANA 4A6YB 1N3NB 5BXFA 3VI3E 2XA8L 3RVTD 5I1GL 2J2ZA 3FFCE 4JAMA 5KSVA 1Z0MA 4ZFFB 3F7QA 4JKMA 5F7NC 2EE2A 4Z7NF 4ZUWA 1YMHB 3DURB 2VDKH 3PXJA 4JN1H 5IM7B 2PF6A 3LMJL 4WWKA 1IEBA 1JGVL 5TE7H 4G43A 1MRFL 3MBEA 5EBLB 1HHHB 3TBSB 3N1FC 2OZ4H 2E9JA 2BCKA 4KUCD 3TN0A 4ODHL 2YUVA 5L9DH 2DJUA 1A7PH 5E00A 4HUVB 2YN3A 4PJ5E 3QEQD 1DN2A 1KB9J 4X0KA 4CW1A 4NP4L 1IFHH 4RGNE 2ZSWA 1BZ7B 1W0VA 3U30C 1A22B 4OKDA 3VXME 4M3JA 4KHTH 4YAQB 1A14H 1F11B 4ALAL 5E8DL 5ETUB 1FNAA 2XG4A 5C3TA 2VAAB 2DIBA 4OF7A 2Z8VC 4K3DH 4C56B 3EYVA 5MEPA 5DJCA 1S7RB 2RFXA 1NC2B 5J3HC 1NMAH 3OAYH 3SBWA 3BW9B 2OTWA 5BRZD 4FQ2H 2DQHH 1HSBB 1IEAA 4LVEA 1FLRL 3X3FL 1Q9WA 4DTGH 1JNHB 3T2PA 4JDVB 3S35X 2QSQA 1MH5A 1CQKA 4I3RH 15C8L 2AABL 1T7ZA 4WU5A 3BN3B 5I1LA 4YBLC 4GT7A 4MQXD 1I1FB 2E7LA 1ND0A 4R90H 4JFOA 4WFHD 1DBML 2D03H 2P5WD 3OAUH 3MLPA 4ERSH 4XCEB 1J8HA 1DLHB 1QYGH 3QFDA 3NA9H 4MLSA 3UJJH 2A9MH 3CFJB 3TNNB 1QSEB 2MHAA 4JQVC 3BZEB 5HHMD 1NKOA 3L7EA 4KJYB 5GRYA 3GI9H 4I5BB 3D9AL 3W82A 4TVSa 4XPGL 4PR5B 5IFAH 4PJIA 5EZIL 5FF6A 3VRLF 3MOQA 4PGCA 4LFHG 3QIWC 5DSCB 3BH8A 4LCWA 3R8BB 1OTUD 5IK3A 1SJXA 2KPNA 5KS9A 3NFSH 2Y06L 2AS5M 1CDHA 3MOAL 1G9NH 2X5PA 3DO3A 4YHYC 2OSLA 2ESVE 3S88L 4MQXC 4ZDHA 1E28A 2CLVA 3B2VH 3AREC 3P73B 1IAMA 3HAEH 5HYSB 2VXQH 3G9VA 5AZEL 3ALPA 1NBQA 1I75A 2YUWA 2E7HA 4P5TC 4OFVA 4QXWA 4TNWF 5C92A 1N64L 4FTVD 1Q0YL 3VE0B 1PKQE 2Q8AL 1AI1L 2WUCL 1BM3L 1FIGL 5DEGB 2Q86B 3WO4B 5LWYH 4I0PC 2EXWD 4TSCL 3KPRE 4G8EB 3OGOE 3G6JA 1CFQA 4D0CA 3RRQA 5SWSE 3PV7A 2DQUH 3QUML 2F53A 5C3LD 1PZ5A 4ODVH 5E99H 2CR3A 4BUHA 3ARGC 5DVKA 2BNRE 3OXRA 3V5HA 5T3ZH 2QLVB 4P2QD 5GZOC 1DUYB 2OS7A 4MXVE 4WJ5B 2FX7L 5DHYB 5JORB 3ZT5A 3P9LB 1G6RL 2AAVA 5EUOA 4FFYH 4MD4A 4NKOB 2ICWI 2JCCE 3QUXC 4FQLH 4MAYD 1ZKAA 4X6DF 4Y4FB 4BK5A 4DKEH 4D9LL 1YN6B 2IALB 5AAMA 5E9DB 2APVA 3MC0A 4GMTL 1KELH 5TPWL 1U41A 4UDUA 1TCMA 4BH7B 1FN4A 2R1YA 4BKLA 3TJHC 5ICXB 5D1ZA 5CZXD 1KJ3L 1G7PA 1RFDL 5ICYA 1ZT4A 2K7PA 3PNWA 2BC4A 1KGCD 1PFCA 2B2XH 4NC1C 5IB3A 4ORGB 2P8PB 2CDFA 3V7AG 4J6RH 3P0GB 4WCYH 4D8PB 3GSVB 3FONB 1WLHA 4NZUH 5EOQH 4W6YB 1QHPA 4JKPH 4MXWH 4NM4H 4MMXC 2DWEB 4HIEA 3RKDD 1FL5B 5IJKC 3UTTB 3TWCL 1X4XA 3BT2L 1ZTXL 1RAMA 2X4NA 4YFDB 1ZT7B 3DGGA 5DYOA 4RFNC 3SDCD 5LGHL 2DLIA 4R7DB 5ALCH 4KGJA 3TZVA 2GUOB 3ARDD 3RWJB 3P9WB 1CTNA 1F6FB 3ARQA 4FQXC 2X44D 3QNZB 4F7PA 2C7UA 4RNRA 5J89A 4LCCA 4R4BB 4FXLA 3NAAH 4Q6YA 1RZ7H 5JPNB 1HE7A 3F7YA 4YHKL 1ZA6A 1Q9LA 4LRNH 5I6XC 1MHCB 4L1HA 2YRLA 1ADQL 4G6FD 4R7NA 2CK2A 2ARJQ 3BFOA 2BSTA 4ETQB 1BEYL 2BVOA 2ATKA 1X4YA 1NFDF 5IB4A 1H3XA 3FFDA 4KUCF 5F96H 4WI6A 2B7DT 3HG1B 4PGDB 1FZJA 1U8PB 5CD5D 4WTWA 1S9KC 2MNUA 5ESAA 4X98B 3FB7B 3LKPA 2XXCB 2JJSA 5FM5O 3JV0A 2Y7QB 3LKOA 3NPSC 3WDJA 3O0RH 5DJ8B 2OR8A 3TJEL 2P46B 1JZ6A 1UQSA 1CIUA 2D7TH 3LKSA 4X4XA 3C8KA 4OD2B 4Z7VB 4DN3H 1J5OH 5C07B 3TBVA 3IKKA 4HJGA 3GZKA 1T6VN 2V17L 3BEWB 5IG7B 2BY1A 4NQDD 2OR7A 3NTCL 3BQUD 1IARB 1WV7T 3ZO0A 4Y5XB 4PJDE 2HMID 2QADB 4OCYH 1TPXC 1Z9SA 1FG9C 4PJEA 4NQSA 5GRVK 2AXFA 1XF5B 3MLWH 5ITBH 5A2KH 5E6IC 1ZA3B 1CT8A 1AD9A 1HHJB 3QWRD 5CD5C 3NZHL 3HCVB 5HYIA 3IJHB 3IJSA 4M48H 2QTEA 4LSPL 2VB5A 4TNVK 4MJIA 3IDYC 1ZWIA 3CH1A 3V0AC 1HXYA 1AFVH 5ACMA 4Y5YC 4FG6D 5KJRH 2PO6B 1QUNA 3VGDA 4DKFL 5K9JL 2HH0L 2ZUQC 3M07A 2ZUYA 3RWIA 3S4SG 5CD3A 3PV6B 3C5SB 1MCFA 1CFNA 2JJVA 4OZIA 2FSEA 1G7IB 3QUKA 3TBTB 1ONQB 5I71C 4DZBA 1NSNL 1KCUL 2IMNA 5GSRB 4LEXL 3U7AA 1IC7H 4HCRH 2GSGB 5HDBE 3IT8D 3KHOA 3TIDA 5CMAB 3PQYD 3BGFB 4KJQD 5K9QG 1CDUA 2HJLB 2O5YL 1FNEB 4GW4A 3G5VA 5H94A 1UT9A 3LY6A 3GHBL 3L95B 3MRNA 2Y5TB 4PRIA 1LE9B 4EOWH 1BFVL 1IBGH 3TO4C 2LU7A 1WQVT 2EKSA 2BHYA 2DD8H 3CC5A 1I3UA 3LOWA 2AI0L 5FUZH 5IEKA 4JPIB 3MJ7B 1UYWL 5LVEA 1CDCA 3OHXA 2EZ0D 4P23B 5HBBA 4JGMA 1TETH 1EO5A 1A0QL 1VACA 3MO1A 5ID1A 4GSDH 2V7NA 5KVGL 3MRLB 2XQYK 4JHWH 3B83A 4PJ5A 3UPCA 2Q1EA 3DUSA 1IC5L 5F8RC 1SJHA 2RR3A 2Z35B 3CLFH 3VXMA 1DBBL 4LKCB 2M26A 1SEQL 2EYTA 5FV1L 1KULA 5DHVA 5BV7B 1N59A 4HJJL 4JO1L 1MEXH 1XIWA 3D39B 2DLEA 1BF8A 5LBSH 3GMOA 3FTGA 1XMWA 4AT6A 2D31A 1NCCL 5JDSB 1I1AA 5E2TH 1JV5A 4XNQA 1HCVA 1SBBA 4BUGA 4OLXH 2J88L 1HWGB 2GCYB 1W0WB 1AKJA 1U3HA 3A67L 5IQ9B 4MX7A 4HXAL 3L3KB 4WI4A 4R2GC 2J4WH 3HUJB 5JOPE 4R0LB 3D1MC 3CX5K 1CXKA 4HEPG 4M93C 1EEUA 3GSNB 2C3VA 3MLZH 3NIDF 2EICA 5I73B 4NKDA 3EDEA 3V6OE 3BDXA 4G8FA 4KKLD 4XC3H 1QEWA 4K07A 1R5VA 4KDTC 2BY3A 3GSQB 4OLZL 4MDJA 3WL9B 3DWTA 4BZ2H 1ETZB 4PP1D 5BZWA 3MLYH 4RQQB 3QIBB 4O4YL 5E1HB 4X5XB 1NGZA 4BJLA 1R5WA 2FH8A 3SJVD 2YC1B 2ESVA 1G7QA 4Y2DA 4YIQB 3REWB 5CJQL 1P1ZA 3ISWA 1C5CL 1WIOA 4MZ2A 4HPOH 1BZ9A 1P7QA 4PRBB 5MEQA 4QXGH 4O2CB 5EU4B 4IDLA 3GJFA 3BIKB 4J4PC 4UNVA 1T1XB 5DS8B 2I60H 4G42B 2CKBB 3K1KC 5DR5H 4YFEA 1IAII 4J3WA 1BQUA 4DOHE 4P59H 5HPMA 2HT4D 1YMME 1PY9A 4XZUB 3VWJA 5E5RB 1MREH 3CUPA 1CG9A 1NDMA 4Q9CA 2JF1A 3KPMB 3QUMA 5SWSA 3LZFL 3IXAA 3ARXA 4M5YH 5AZ2L 3DV6B 4WWKD 4F57H 3AS0A 5SV3A 4CVZB 1P53A 1I1CA 4QXTB 3DUHA 3MBED 4LLYB 4QOKD 2MCPL 4HQQH 2HFGH 5GRWA 2BSSA 3CXDL 3TN0D 2R23A 3OXSA 4PLJD 2X4TB 4NFDA 1UXSB 4MVBC 3VH8B 1G6RA 3UYPA 1SMAA 1WF5A 5ADPL 2E27H 4F2MB 3FZUD 3QBTB 1FE8L 2EDLA 3ZHDA 2N4IA 1UACL 1MI5A 4K8RC 4X9FA 3EYSL 1S3KL 1JWUA 5GGSB 4GAJL 4JQXC 5HHVL 5FGSA 3FQUA 3LRGA 1XEDA 2GITA 3PP4L 3UTQA 4ELME 2ZJSL 2AJYH 2VDOL 1X7QB 1A3LH 3LVEA 4AEIH 3OKMA 2HA1A 4LASL 3T4YA 1UADC 3HHRB 5DJDB 5D1XC 1IVLA 4W4NA 3T0XA 4PJBB 5K9KA 3WNKA 5B8CA 2A73A 3OKYA 1AXTH 4LLWA 2VDNL 2DB8A 3KYKH 1WFNA 3N9GL 3ILPA 4WENB 3PWJB 1NCAH 1AQKH 2AK4E 1QPXA 5I75B 3BEVA 1GGBH 1IAOB 3NVQA 3RVUD 1IE5A 3PWUB 1J8HD 3L7FA 4QWWD 2ZUUA 5HD8C 5CKGA 2DLTA 3RWGB 1U95B 3DTXB 1MIML 3W11C 3MRPA 4OCXL 4ONFH 1QFHA 1DUZA 3VXSB 3L5WA 5HGBB 3QG6B 3UC0H 1RJYB 1N5AB 3SKMB 4FNLL 4X83A 3LQMA 2PCPB 5IW1A 5KVEH 4YHLH 2APFA 2GJ6B 4I0KA 3TIEB 3UDWA 3H0TA 2GK2A 5B38A 3B2UC 2IJ0C 4LCWD 4JKKA 3GHEH 5GPRA 1ADQA 2QKIB 1KB5H 1KN4H 2QJDA 5GS1A 3T1WA 5IB2A 4ODXA 3VXRE 5I8OH 4LBEB 4X7EC 4HUWB 2GYSA 4WTXA 1JRHI 4H0GA 4YDJA 2YPLE 5EIIB 2D4FA 3FO2A 1JGDA 3W9EA 4QHMA 1VB9A 3IDGB 4QWWC 3WHE1 3WNNA 3SQOH 4H0IA 3OZ9H 5JO5B 3NIGF 4WHYG 2CLZA 2R69H 5H2BA 2AJZB 2VLLB 1S8DB 3ZTJH 3CFDA 4Y5VB 5E1AA 3EHBD 4GG8B 1U42A 1Z5LA 5KAQG 2NY0D 1XGPA 4XWGH 4PJGF 4AIZB 4PY7B 3HAEB 5DC0A 3WUWG 1C7TA 5T1KA 3OKLA 1XR8B 3BPLB 5A3IC 2AJSH 5GZNC 3VI4F 3EYFB 3X11B 1R3IH 4RISH 3E6FB 1EEQA 2ITDA 5KTEH 1OCWH 3ULVE 2A74A 4EIGB 2WIMA 4YXLL 4LL9A 2FWOA 4DN4L 2M2DA 2ADFL 5TDPB 4NN5B 1LEGB 5D1ZD 5EC2B 2KH2B 4NQUA 5DMIL 4K7PY 2XNAB 5B3JE 4HLZH 4P2OA 5D7KD 4XPTH 1FVDB 4MNHB 2MPAL 1S9WB 2Y23A 5I1CL 4JREC 1INQB 4L4VE 4NDMA 5F1KC 3QDJB 4S1QH 1NFKA 1KEGL 3GJEB 4LP4A 5EO0B 1JGEB 5JXAL 1T80A 4NKIH 4NIKB 3GSWA 1N2RA 1CICC 1K3IA 1UXWB 4F7TA 4XAWL 5E95B 4LLVB 3OKDB 2CR6A 1JP5A 2XICA 5C71A 3QEGL 4Y0GA 1JNLL 3OR7A 1H3TA 2VLKB 5CINH 3CZFA 5D7LE 1ZLVH 4QRTB 4O02L 1CF8L 3P0VL 3O6LH 3QZWG 4HKJB 5DD5H 4ZS6C 2R8SH 1T2JA 1U9KA 4D9RE 1UG9A 1EVUA 3TZVD 1LNUA 1ZT1B 4N8VB 2DWDB 1BQHG 2F5AL 3VRJA 3O11B 4HV8B 1CFTB 2FB4H 4JZOA 5LKNA 3O3BA 2Q3AA 1H3VA 5FGBC 1CLOH 3BUYB 3HC0A 3OR6B 4QTHB 1XGTA 1PZUB 1M6OA 1T1WB 3BMWA 4M03A 3WN5B 4TSAH 2YD7A 1PBYA 1GPOL 5IOPA 2R0WH 3HNSL 3FB8A 4XPFH 5K9OB 3LKNA 2NR6D 2B8OT 1FZMA 3BKCH 3T2NH 5IKCB 1ACZA 3BXNB 3QXAA 2IQ9L 3OL2A 1KCSH 2X4PB 3PABB 5B39G 4F9PA 4OLWH 3AUVA 3ARTA 4KTDL 2NY2B 3WFHB 4F15C 3VGEA 4K2UL 4QYOA 3ULSA 2BDNH 3M8OL 2GJZA 2E8YA 1OPGL 2O5XH 1EFXA 3V0VA 3BDYL 3VFPA 5BMFH 4Y4HA 5IVXB 1XAUA 3DX9B 4NGHL 1A7OH 5EB9A 2LTQB 1FH5L 4OCRL 3BRDA 3ES6B 1XT5A 3Q5YA 4KWUA 4OLYL 1QLEH 1YEKH 1AHWC 4C56E 3I9GH 4AH2A 1B3JA 2DKSA 5HHXH 2C1OA 3FT4A 4OM1H 1GH7A 5I15L 4JDTH 3NBNA 1F00I 5I76A 1RURL 2XIDA 5H37G 1KCKA 2DQDH 4OM0H 5FK9B 3CNKA 2FGWL 5EA0L 1D5ZB 1KPRA 4OJFH 3O6FC 4MJID 1I85A 1MAJA 2YUXA 3C2AL 2JJSC 3X12B 3RIAF 4YHZL 4AIOA 5F1NB 4BQ8A 1CE1H 4U7MA 4KQ4H 3GMPB 1BP3B 3VRIA 1HK6A 4MGXA 1II4E 4JJ5A 1VCAA 4L29A 1QSEE 3IDNB 4HFWA 4UQ3A 3SGEI 4MD5B 4YUEH 4FFWD 5E7BA 3FQTB 1QACA 1TFHA 4Y16B 3VA2C 5KS9F 4KHXL 3FFCD 1YMMA 4OCMC 3GIVA 4EI6B 5C0IA 2AXGB 1QLFA 5C2BH 4M7ZC 5D4QA 5J12C 1VEMA 1A21A 4PRID 1LGVA 3MRHA 5AUMB 4CN4A 4HT1H 3HE7A 1I9IH 2DQIH 2QSVA 4V1DA 4NT6B 5MENE 5KVDL 2UY7A 1UJ3A 1HYRC 2VIRB 3FAXA 4AQOA 3JVGA 3MGOA 2O93L 1YA5A 4S1SL 1HHKB 3KYOB 1F4YL 2P49B 2CO6B 2K9UA 3G6JF 4Z7QF 3QPQD 2BOBB 4PJ5D 4GQ9L 2Y9RT 4YGAB 2BNQE 4KMQA 1T89A 3IS0X 2EDTA 4RGND 1MHHA 3VXMD 4F3FA 2CLRA 4XP1L 1NMCB 2Z93B 4LDLB 1BMGA 1I7TB 4ELMA 4JPKL 1I7UB 1P4LB 1XIWD 4GXUM 3IVKB 3PWPA 4LOUC 5EUOF 3SCMB 5KBNC 1CFVH 1PD6A 4F7CB 3EYUH 4HXBH 3OJDA 4GMSH 4CDHA 3T3ME 1F4XL 2DQFA 5TF1H 2ICCA 4XPBL 4IDJL 3WHE0 5D71L 1I1AD 1UM4H 1UZ8A 4ZO7A 3D69A 1JNNH 4WI3A 1NL0H 1MFNA 3HZKB 4J23A 3F12A 2ARJA 4RIRA 4S2SB 3BRGC 2QEJA 1J1XH 4G80A 1AKJD 1U3HD 3DPBA 1MAML 1LO5A 1KNOA 5E9DE 2AK4A 3P2TA 4RMUA 4XGZB 4D3CL 3QPQC 5DK2A 1T3FB 5C86A 3MUJA 4RGNC 3ZE1E 1UWEH 3HMWL 2RJMA 1WBZA 1S9VB 3HI1B 3N50A 4MYWB 3S3PA 5JZ7D 1SY6H 1T7WA 5FKAA 2CRIA 3U7WL 1KBGL 1N6QH 4MQ7A 1YEDA 1UM5L 4XMPL 4KI5D 3SY0A 3ZSTA 3RZCA 2DLFH 1P4IL 4WI8A 4LCUB 5DQ9B 2OJZL 1X6LA 2HG5A 3RIFF 5J8OA 5IMKA 4WRLA 1ZLSL 3U2SA 4JZJB 5EZJA 5I66B 2NX5B 1I1AC 1KN2H 1F97A 2YR3A 4L5FH 3UTTE 2WWKT 4PY8J 3MLUL 2H26A 3UJTH 4AEHH 2ESVD 1MQKH 4Y2DD 3VXRA 4OGXH 1YN7A 1MRDH 2CUMA 4ESKA 5E24E 3RI5K 1L6XA 3BP5B 5CEXB 2ZP0T 1P7QD 1V7ML 4WNQA 4C83B 4QHKI 2P5EB 4ZAKA 4U1IA 1VFOA 5I2IA 3P11H 3O2VH 3S5LB 3U9PH 4KV5F 5FECA 3H6JA 4X5LA 3FQWA 1JRHH 3VWJD 1JI1A 1A7NH 3QULA 1T0NA 1PGRB 4DGIH 5BOZG 4IOFD 4JKWA 1SHMA 2HKHL 5SWSD 4XNXH 2H8PA 2IH3B 1SYVA 4IRJA 3SQBA 3U4BH 2VH5H 1NGXB 4XP6H 4Z7UA 3G6AB 2ZCLL 3V5KB 1FPTH 3UZVB 4HEME 2BNRD 3HG1E 2QSCL 4HK0B 2VN4A 1FDLL 2ZCHL 5GJTL 4F7MB 5C9JB 5FA4B 4NQXB 4P5MB 1IC4L 3PL6A 2X4OA 5IVNA 5CSZA 5C0CA 5I19H 1FZOA 4ZTOH 1QFUL 3CFCL 4Y4KC 1T4KB 5HYEA 4JRWA 5CJXA 3TO2B 1N4XH 1U91B 4Z7VE 5C07E 1AD0A 4QCIA 1HEZA 1RZFH 3NCJL 3VWJC 4MJ5A 1RPQA 3LN9A 4PJEF 1GIGH 3I02B 1NC4B 1T22A 1MCDA 4K3JH 1IL1B 4YHIA 3WXVL 1MFCL 3AM8A 4Z76A 4KAQH 1IGYA 1MNUH 1MUJA 3UBXA 5BO1L 4X7DC 1QFOA 1FBIH 4K7PH 5ERWA 3BPOC 1B0WA 3OJMB 4TPRL 5KZCD 2HRPH 3R06A 2YD6A 3JWOH 4QRPB 2IBBA 1FL3B 4HDIA 4TSBL 2WBWB 4B7LA 3HC3H 2ICWB 2K1MA 4YDLC 5D7LA 4HIJB 5D6DA 5L88H 4OZIF 4OZFH 5LQBL 5I16B 2APXA 4YHMH 3O2DA 2A6KB 5K93A 4JLRB 3CVHH 2L7UA 4JFZH 3RNQA 1EHNA 4KK9C 3VI3F 1PYWA 5KVFL 1S7TB 2ZUVA 3WEXA 3PWVB 1MJ7L 1MCRA 3WJJC 1JFQL 4KRPD 3F5WA 4A6YA 3PGFL 1N3NA 1QBAA 5DC9B 5JXEA 1NLDH 3C5ZC 2VXTL 5H35B 5T3XH 3ZKQD 3LQAL 4CADB 1FFNB 1T1YB 4PRDB 3WKMH 3VXOA 2OMBA 3DSFL 2Y72A 5H8DA 5IM7A 1XGYH 3TNMA 4P3WA 1KJ2H 5EBLA 3U79A 4GRMB 3P0YL 3SDAB 3TBSA 4M61B 3UMTA 4Z0XB 4HULB 1FNLA 2J5LC 2W0FB 2VR9A 2ADJB 1KB5B 4FQIL 2AJ3B 1BZ7A 5C0ND 1BFTA 4HUNB 2NY3B 1YPZE 3WBDA 4YAQA 4KI1A 3WFBH 1F11A 5ETUA 5T1KD 1MHPH 1MY5A 3QPXH 1AGEA 2EC8A 3WDHA 1U8MA 2B1AH 4PJ9B 1TZHB 4MCZB 3WS6A 5L8LB 4L8SC 1DQMH 1S7RA 2YMXL 3D39E 1NQBA 1RU9L 5GS1C 3BW9A 2YD8A 3E8UH 4FFZH 1HSBA 1Q9OA 1JNHA 4LPUA 4JDVA 3SO3C 4UT6H 4XWOD 3RWHB 3S96A 2Z4QA 2MTPA 4X7TB 4LLDB 3O3DA 3VWKA 2CUIA 3MFFB 4HIXH 2UUDK 2EIEA 1ROWA 4IJ3C 3U1SL 4P2RB 4LHUB 2JJTC 2B1HL 1NKRA 3G04A 3HUJE 3NCFB 4P2OD 1A7QH 1Z0NA 4KI5F 3SKJH 1A1OA 4LAQH 1DLHA 2VXUH 4L3AA 2E6PA 5JHDA 1IILE 1JYXA 4FFVC 3BZEA 4M02A 2XWJB 5TE4L 2IF7A 4Q97A 1DQQB 1CLZL 5K33A 2Q76B 4J3XA 4GXVH 1ZE3C 5DSCA 3SGEH 3A0OA 4JFYA 3MLRL 4N0UB 1G1CA 5ENWA 5TGBB 3WMSA 1MIEH 4H8WC 3MCLH 3S35H 5ANMB 3QUZC 1IAIM 3MLVL 1B4JL 2VDPH 3P73A 1A6WL 1MCPL 1TITA 4MJ2A 5HYSA 4MJ4A 1RQ5A 2DLGA 3O9WC 2DYPB 5D93B 1IAKB 3V4PL 1WZ1H 2E8ZA 2RAMA 2HTKD 3MNVB 3KYMB 3VE0A 5IW3A 4HH8A 5DEGA 2Q86A 1OAKH 3VG0H 4G8EA 2RGSA 4ZD3H 3QQ4B 3RA7H 3GBMH 4HK3J 3IFOB 2SEBB 4HAFA 3KWWB 2R4RH 2EDQA 1RUQH 1IGMH 4MA8H 4D2NA 1DDHB 3HI6H 5CZVH 1G9ML 5DJ0B 4K94H 2KDGA 4GLRI 5L0QB 4WUKL 5D7IA 1DUYA 1M7IA 3KJ6L 2R4SH 5JORA 3P9LA 2VDML 1IT9H 4NKOA 5HGHB 5TDNA 2C1PB 1AY1L 1M71B 3LD8B 1IQDA 1EFXD 2IALA 2LV4A 5E9DA 3VFMA 2Y5EA 4M1DH 4H20L 3OB8A 1RUPH 1NBYB 3U0WH 1L4IA 1D6EB 1SM3L 1K4CA 3IDXL 5L2JB 3G6DH 3WCYA 1CD0A 2PYFA 4JRYA 4N9GB 4TVPE 3W9DA 4Z9KB 1K8DB 1G1YA 1CIDA 4PJBE 5CUSH 1FNSL 3MRKA 5IMMB 1NDGB 1YC7A 1YJDL 1FCCA 4FS0A 4ZO6A 4D8PA 2Z0BA 3TT1L 5EUKB 4CVWA 4F9PC 3DMMC 1A6AB 5E2UL 3WJLA 4OBRA 5F88B 3OWEA 4RBPK 3V4UH 2DWEA 1ZLWK 1OAZH 1FL5A 2YRPA 4N0RA 2FYYB 4WEBL 3R1GH 1ZT7A 3OG6B 4FRWA 1MOEA 4NZDA 4GUPB 1KJMA 4R7DA 1CDGA 5DD1L 2ATPB 1OAYL 3LEVL 1VA9A 1WT5A 2GUOA 3IDMB 4L9LB 4K3HA 2E6JA 5FAAA 3RY6A 4NN6C 4MA3B 1LO0H 3OJVC 4KPHH 5T33H 5FB8B 5J4MA 1I8IA 4PP2B 3P4NA 3QUYB 2WUBL 3QNZA 5IUSA 3V6OC 1INDL 1YMMD 4NBYB 2GJ6E 3MCKA 4R4BA 4LNVA 2E6QA 3LH2L 5GRUH 4R90L 1TNNA 4LDOB 4G6FB 1NUDA 1HSAB 1MHCA 4DEPC 1I85C 1GXEA 3X13B 1B2WL 5BZDA 4NC2B 4ETQA 2F5BH 3HE7D 4PFEA 4UTBH 1JK8B 4V1DD 2H2SC 4LSSL 1UCBL 1J05A 3VFWB 4U1LA 4PGDA 1A8JH 3U7YH 3DSNA 4X98A 1EA9C 1KEMH 3FB7A 1K6QL 4R8WL 4JG0L 3MXVH 5D7JB 1S5IH 2Y7QA 1EMTL 4POZC 4ETYA 5FDYA 3QEHB 4HKXB 7FABH 3AS1A 5TDOA 4NNPL 4OD2A 4Z7VA 3OB0H 4NKMB 3IKCB 5C07A 1EAPB 1TJGL 3IFLL 3PWPD 4YK4B 2NQCA 3QP3A 4UIKH 1F13A 3FOMB 3BZ4B 3BEWA 5IG7A 3BQUB 3MLTB 3TVMB 1FAIH 3WIHL 5L2KE 3FN0H 2HT2D 3L1OH 4KK8C 2ARWA 3WFDL 1XF5A 2YD9A 4WGWB 1D6VL 1EBPA 1ZA3A 1GOGA 1HHJA 3IJHA 2XA8H 5I1GH 1BPVA 2AK4D 3MGAA 3MV8A 1WJ3A 3HRPA 2PO6A 3NN8B 3BPNB 1A7BA 1X5YA 4H1LH 1B0GB 4P49A 5T3ZL 1A4JB 2FGZA 3PV6A 3C5SA 1U58B 3LMJH 5HDBF 3VGAC 4ACPA 3MODL 5I74B 5F3HB 1JGVH 3ALXA 5FYKL 1G7IA 1MRFH 2IC2A 4W6WB 3RZCD 3E2HC 3QDJE 3UYRL 3FOLA 5K9QI 2HN7B 5IVOA 5GSRA 5DMKA 4ODHH 2GSGA 3I6KB 2DQJL 5DFWH 3QJHA 1ZHKB 4H25B 3V6BR 1X5HA 3PQYB 2HT2C 4OFDA 4NP4H 4UIMB 1HXMB 2HJLA 2UZYB 3DETC 4XHJD 2VLKE 5I1IL 1XCQB 5T1LB 1FNEA 3LRHA 1J9CT 1FO0L 1FGNL 4ALAH 3VXRD 3L95A 5E8DH 2Y5TA 5D1QC 4F9LC 5F71A 4PREB 3LKRB 3TFKC 4HC1A 1CGXA 4Z5RB 1TTUA 2AJVL 4HUUB 4ZAKD 4JPIA 3ARFC 1D5XB 1FLRH 3X3FH 2VO5A 4NZUL 3FT2B 4MXWL 1OGTB 2D7QA 5SV4A 4PLKC 3KPSA 4DCQA 4C59B 3H7BA 4Z0BL 3RZWA 15C8H 2AABH 2G9HB 5F9JA 4XCNB 2Z35A 4LKCA 3QR2A 5KG9B 3LDBC 5ALCL 1DBMH 1O7VA 5JIIA 1UEYA 4XHJC 1RUAL 3BGAA 5LCVL 1I8MB 2Y6SD 4PJGB 4JHZA 4M7LT 1PX3A 5GRXG 1HYSC 1V3MA 3PL6D 3HMXL 3ULVD 5C0CD 4DUWA 1MHEB 3D9AH 4XPGH 4CU8A 2W9EL 1W72L 3LB6D 5EZIH 2GCYA 2MKWA 5IVXE 2XWBB 5IQ9A 5IJVA 2P47B 4UT9L 1T03L 3OBAA 3L3KA 2Y06H 3R0NA 2EH8L 3MOAH 5J11B 1ZHBB 4R0LA 1YC8A 3S88H 4JB9L 1U93A 1C08B 4NN7B 5AZEH 3DX8B 1A9BB 2AV7B 2F19L 2ICEB 4LVHC 4YHPB 3GSQA 1L9NA 3O0RL 5HGGS 3WL9A 4Z78B 1N64H 2FR4B 1Q0YH 2NXYB 3ULUL 1ETZA 2Q8AH 1AI1H 2WUCH 5MP6L 3BP7B 1BM3H 1FIGH 3HR5B 3EJJX 3VDAA 3PL6C 4Q7DA 4TSCH 5D7LD 4RQQA 3QIBA 4X5WB 1MRCL 4MA1B 5GGQL 4JY4B 4X5XA 2VC2L 2B5IC 3QUMH 3SJVB 4YIQA 3VD9A 1P7HL 1M7DB 1PG7X 1OARL 3SPVB 1KCVL 3QCUL 4PRBA 4O2CA 5D96B 5EU4A 3MREA 2XACC 5ICZB 1G6RH 1T5XB 4M48L 5DS8A 2CKBA 5JXED 2CRYA 2WQ8A 4ZXBB 2P1YA 2HYMA 2XQBL 4U0QB 4QT5A 5C0BA 4D9LH 1M05A 4XZUA 4OZFB 1CD9B 1ZV5A 3IRZA 4ZUWB 1J0IA 2DKMA 4GMTH 5TPWH 4HFUL 4K23L 3CVHB 4WWKB 1EDQA 4URTB 3PJSA 4CVZA 5FO9A 4Z7NE 1KJ3H 1RFDH 3R8QA 4QXTA 4LLYA 3TGXA 2IAMA 2BCKB 2X4TA 1UXSA 3VH8A 4KUZL 3K8MA 4L3CB 4F2MA 4HLJA 1L7TL 4X9HA 4AZ8A 4ELMF 2ZSWB 3GMQB 3PDOB 3HE6A 5GGSA 1RZGA 4GLRH 3ILQD 1NUFA 1G0XA 4HWNA 2YXMA 2AQ3A 3UEZA 5DO2C 4F8TA 1X7QA 3BT2H 1ZTXH 1KJ2B 2RFXB 5DJCB 4IMLB 3JTTA 5LGHH 2OZ4A 1Q9WB 4MJ6A 2QQNL 2Z31B 3CDFA 3GUTB 4MZ3A 4PJBA 3ZKMC 4LCIL 4AEFA 5TQ2L 3MV7B 5I1LB 1V8HA 3VWKD 3PWJA 3C60C 2FCBA 5GGVL 5FYJL 3RTQA 4HW6A 4YHKH 4U6YA 1ADQH 1IAOA 1BEYH 3PWUA 4WO4B 4PGEB 3RWGA 3HPLA 3ILQC 2GY5A 3DTXA 5HYFA 3GMNB