3LSEA

N-domain of human adhesion/growth-regulatory galectin-9 in complex with lactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
143
Chain Sequence
b'SQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-9
publication title N-domain of human adhesion/growth-regulatory galectin-9: preference for distinct conformers and non-sialylated N-glycans and detection of ligand-induced structural changes in crystal and solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lseA00
2I2SA 2GALA 4K1ZA 1GNHA 2PHXA 2A6WA 4XBLA 4DRRA 1WD4A 4P9YA 4FVVA 4FP2A 4YW5A 2D43A 4FPJA 5KXEA 3MEPA 1ONAA 2GNBA 3R05A 4Q26A 4Y1XA 4Y1ZA 5GZFA 4YZ4A 4XJZA 1W0OA 1I3HA 3USUA 2CWMA 3RMXA 1IKQA 2GN3A 3BODA 1LHVA 4XDQA 1GANA 1GBGA 1LECA 4DPNA 3M1HA 4JCKA 4M3CE 2OVUA 4R9CA 5HCAA 3WDYA 3POWA 1ULFA 2VH9A 2W68A 3VKLA 5JMCA 1N1TA 2GMEA 5GZDA 1GZWA 2ARBA 3POYA 1V6OA 4RA0A 5E89A 3WCRA 3GNEA 2UURA 1LULA 1LOGA 2EXKA 2VU9A 3MW4A 4Y1UA 5DUUA 4BQ1A 2D6LX 2DU0A 2A5ZA 2WJSA 1UPSA 2C5DA 1KDMA 1S0CA 4AYUA 2FHRA 4XJUA 1V00A 4XMIA 3O0WA 5DG2A 1QGLA 4M3CB 5FRAA 2CYFA 4Q1PA 1DGLA 3ILNA 2GNMA 4FPGA 1G9AA 1DLLA 1R1ZA 1N1VA 3DGTA 1AXZA 1JOJA 3ILFA 4XIOA 3WVJA 1LOFC 1H9PA 2R1BA 2ZGPA 1WW6A 3PJQA 3UJOA 1DQ4A 1APNA 3M2MA 3OBTA 2NYYA 3CNAA 3USUB 3AYAA 1MS3A 2DUQA 2CL2A 4SLIA 3OBRA 4D69A 4XMAA 2A6ZA 4YGEA 2GNTA 3ZYPA 3RSJA 4ASMB 1G7YA 5JLVA 1V6IA 5DZGA 4FOQA 2W39A 1UX6A 4AWDA 3FLTA 5EWSA 1BXHA 1GZWB 5KXCA 1ZM1A 3AYEA 4H55A 3N36A 3NV4A 4IQPA 4WV8A 1AXKA 3AYCA 1V6NA 5GLVA 1DBNA 1ULDA 1S0BA 5T5JA 3ATGA 4YFZA 5F9TA 4FQ4A 3AYDA 1CQ9A 1GNZA 4GKYA 3AXEA 4YGBA 5GLUA 3ZYRA 5IK5A 4FPLA 2ZHNA 1NLSA 1RITA 1LJ7A 1C1FA 5HCFA 5FREA 3ZSMA 2P37A 1TEIA 1KDKA 3R4SA 4ATFA 2SLIA 4LBMA 4NOTA 1N3OA 1G86A 1WLDA 1UZZA 5T5PA 2JECA 3RRDA 3FBYA 1SLIA 2DV9A 2NZ9A 1SLTA 3LCPA 1LGCA 2ZAAA 3O0VA 3MPPG 4YZ3A 1AZDA 1V6JA 2XG3A 1V6MA 2ZGSA 1WD3A 4XOGA 5GLTA 2YMZA 1N3QA 2VUAA 3ZXJA 2WT2A 4Q27A 3AJYA 3C2UA 1LU2A 2VW0A 1QOTA 2ZKNA 2WNEA 1UAIA 3OGGA 5GALA 3SISA 3SITA 1UL9A 4K1YA 1IS4A 1DFQA 1KITA 3AZVA 4U2AA 4YM0A 3SH3A 2P2KA 2D6NA 4TYSA 5GLZA 1AX1A 1BZWA 1SCSA 2AENA 2LALA 4R9BA 3M3CA 3D5OA 4UW4A 2YROA 1QKQA 1A78A 4AGGA 2ZGTA 3AP9A 5CAZA 1KQRA 4FPKA 4LBQA 5IT6A 1W6MA 3WZ1A 1N3PA 1VLNA 3ZXLA 1LHWA 2HYKA 4YM3A 1FAYA 4YW3A 1N1SA 2RHPA 1AVBA 3QLQA 4LBNA 2R0FA 2ZGUA 4YLZA 3UK9A 3WNXA 2Q5TA 1LEMA 2LTNA 2GMPA 4WVVA 3U4XA 1QDOA 1N47A 3NV1A 1SACA 3WUCA 2V5YA 4YZ2A 1VALA 3B01A 2AUYA 3OPZA 5EYXA 5H9SA 4YG3A 1AXYA 1QDCA 4GALA 3ZXFA 2ZGMA 4XILA 4DRVA 3NWKA 3WV6A 5JOZA 3PVEA 4R9DA 3Q9OA 1ENQA 4FPCA 2DUOA 2EXIA 1S0FA 3VKOA 2ZMLA 1SLBA 3TAYA 3N3HA 1MS5A 3WG3A 1Z78A 4XYXA 2AH2A 5DUVA 3RQ0A 2D3RA 4ATEA 2D44A 5KXDA 1FATA 1HLCA 4JRAA 1RIRA 5L73A 4GKXA 5LK5A 1DIWA 4OZXA 2SBAA 1H9WA 2KM2A 4LBQB 1ZA4A 1W6MB 2BQPA 2EIGA 3WDVA 2D3PA 5SV8A 5EXOA 3VKMA 1D0HA 1MVEA 4YGCA 1S0DA 1YI7A 2UWCA 4P9XA 3VKNA 2A3WA 3I4IA 4AVSA 3ASIA 4C1WA 3AP4A 4YZ5A 2VXRA 3HR9A 3L2YA 1BJQA 1BQPA 2NMNA 2A6YA 2JKBA 4WVWA 2UU8A 3V65A 4TZDA 1Q8SA 3LSEA 1WLWA 3V0BA 2UWBA 1LHNA 3IN9A 1BYHA 1ENRA 1LTEA 4P9WA 3ILRA 3NV3A 1JYIA 4PCRA 1LCLA 3AX4A 4XHBA 1IS3A 2TEPA 4JC1A 1CPNA 1SBFA 1W6NA 2JD4A 3N7JA 2P3IA 3KQRA 4BPZA 1IS5A 1KRIA 3WOGA 4RL7A 2R49A 5JOYA 2VY0A 1MVQA 1GSLA 1AJKA 4K21A 3W58A 4FPFA 4GXLA 3WHUA 2E7QA 1WUVA 2AYHA 5GM0A 3V0AA 3IPVA 4NO4A 4UW6A 3WUDA 1CJPA 3GALA 1GZCA 3R4UA 4Y1YA 5T54A 3FLRA 3A0NA 1W0PA 1HKDA 4ISRA 1JYCA 4FPOB 1VIWB 4YM1A 1F9KA 1ULEA 4Q8LA 1CIWA 1UZYA 4FOWA 3T1LA 1JHNA 1HQWA 1Q8VA 3BIWE 4PBPA 4Y20A 3VKFC 3WHTA 3WDWA 3AK0A 1DQ1A 1WCSA 2DVAA 4LBOA 1H30A 4ZXKA 1W6PA 1LU1A 3O0XA 4ITCA 1G9DA 1SLCA 3D6EA 1ENSA 1GYKA 3V0BB 3H0OA 1F5FA 4XTMA 4L8QA 1C4RA 4U36A 2XB6C 4XE9A 2NMOA 1OQ1A 1S0GA 2ZMNA 1S0EA 4YG6A 1SCRA 2G4IA 5H9PA 1GV9A 2PHRA 1YO8A 1AJOA 1FYUA 4XBNA 4XIKA 3ZSJA 5DZEA 3WG2A 1DQ0A 4BOWA 1G9CA 1MS4A 1S0IA 1X50A 2WKKA 2E51A 4XJ8A 4DFSA 1AF9A 1RINA 3OY8A 1QMJA 5JVVA 4CZSA 1WW5A 3AZWA 4AGVA 2E6VA 2WSVA 3V0AB 1PZ9A 3PVOA 1DZQA 2D6MA 1XQNA 3B9CA 1CR7A 1O4YA 5AVAA 1LOCA 3ZVXA 1G9FA 2ZA9A 4Y22A 5CB7A 1JW6A 3MW3A 5CBLA 1LHUA 1WW7A 1G8WA 3FLPA 1FNYA 2E53A 2EXJA 2OW4A 2W08A 2ERFA 4Y20B 2ZGOA 1LENA 2EF6A 3IM0A 4M01A 4YFWA 1JBCA 4KBBA 5CNAA 1WBFA 1W6PB 2PHFA 2JE7A 1GKBA 3QCWA 3RMYA 4Q2FA 3M3QA 1A8DA 3AZZA 3JUUA 3IKWA 1DHKB 5GLWA 2GMMA 2AR6A 3ZSLA 4LBJA 2R0HA 5T55A 3TB0A 1F31A 1AX2A 2A6VA 2CWSA 4XJAA 4AVVA 1VAVA 4XXAA 2ZHKA 5GZGA 4UW5A 1JN2P 3WG1A 1YYNA 1LGNA 1HDKA 2R16A 1WBLA 1W6OA 3B69A 2A6XA 1VAMA 1Z0HA 3OY8B 4FOYA 4GWNA 3ZXKA 2VW1A 2A75A 1O4ZA 4Y1VA 1GICA 2UWAA 4M00A 4UW3A 4BLJA 2E7TA 1OFSA 1PZ7A 2DYCA 3SNMA 2A70A 3B3QE 1UKGA 1FNZA 2P3KA 1Q8PA 1DQ6A 4Y22B 4XTPA 5E8AA 1A3KA 2PHUA 4XJWA 5GJ6A 1KJRA 1SBEA 1W6QA 3A4UA 5KXBA 3LSDA 4PF5A 3AFKA 4Q8KA 3VUOA 2Z42A 2A3XA 2ZGQA 1DYPA 4YGDA 1ULGA 1MZ6A 4BMBA 1PZ8A 3PVNA 2ZBJA 5DXDA 2H0BA 2EALA 2D6KA 4W65A 3PMEA 1QU0A 3M3OA 1EPWA 5BYNA 2C9AA 3WG4A 3RG0A 1WLCA 1Q8OA 2DWRA 1YIFA 4FP3A 1LOBA 1Y7BA 4DQAA 3IMNA 4LBLA 5IK7A 2B7YA 4CRQA 2JJ6A 4P14A 3V64A 4WZFA 1S0JA 1LOFA 1UMZA 1JUIA 4PBOA 4BMEA 1V6KA 2ZGNA 2YV8A 1WW4A 4XHXA 5DG1A 3T1MA 1QNYA 2WQZC 3WLUA 5F5QA 3JU9A 1B09A 3BOPA 3BTAA 3AZXA 3N7LA 1W6OB 3WCSA 5IK4A 2D6OX 5JDBA 3AP7A 4DS0A 3FFZA 2CNAA 1LHOA 1C1LA 1FV2A 2ZZJA 4LBKA 3AXDA 5T50A 3SH4A 1C57A 4AVTA 3WDUA 5HCBA 2ES3A 3FUOA 4LBQD 4XJ9A 5DUXA 1SLLA 3ZPYA 3ENRA 2ZHLA 5JOWA 5EYYA 4Y24A 2D3SA 2FMDA 4FOVA 2ZABA 4XXPA 2EAKA 3I8TA 1W6QB 3RS6A 3INAA 1SFYA 4YG0A 2DVDA 1IS6A 1MACA 1G9BA 2GNDA 4YW1A 5T5OA 2AREA 3A0KA 3T2TA 2R1DA 1DQ5A 3AJZA 5CA6A 4C1XA 1HQLA 1GZ9A 4CTEA 2DVGA 2CY6A 2WT1A 3N35A 4YW2A 1Q56A 4GA9A 4ISQA 3APBA 3MW2A 2NM1A 2YZ4A 4ZKTB 4XZPA 4YM2A 2ZGKA 3N7KA 3POSA 1MR5A 1CPMA 2JDZA 3WDXA 3N7MA 3WDTA 2GDFA 3UJQA 5GZCA 1MS1A 3ZXEA 4GWMA 1FV3A 1SLAA 4FQZA 5IK8A 1NXD1 2W52A 1W6NB 5T5LA 1BKZA 2PHTA 2WSUA 3B00A 1CN1A 3OYWA 3ZSKA 1S1AA 1GLHA 1DYKA 5H9QA 1V6LA 2VW2A 3HMYA 4HL0A 1IKPA 3AP5A 4F83A 1LEDA 3AP6A 3VV1A 2DU1A 1N1YA 2DVBA 2GN7A 2OUHA 4FPHA 1FX5A 1U0AA 5JOXA 2D6PA 1MZ5A 3IPVB 4FPEA 2NP0A 3M3EA 2DURA 1CVNA 3W59A 3O12A 3O5SA 4BLIA 2DUPA 4YZ1A 1LGBA 2V73A 4XBQA 4Y26A 5E88A 1D2SA 2A71A 2DTWA 1LODA 2ENRA 4R9AA 2YXSA 2ZHMA 1JXNA 4I30A 2DTYA 4MYEA 3NV2A 1LESA 3SLIA 2ZACA 2YY1A 3UL2A 5DUWA 5H9RA 1LOAA 1LOEA 3OJBA 4PQ9A 1QNWA 4BM8A 1QF3A 2DVFA 3D4KA 1J1TA 1YXWA 2WT0A 3HN1A 2AGSA 2NN8A 2OUJA 1QOOA 1CESA 2PELA 4Q1RA 1IOAA 4AGRA 5DZFA 2A7AA 3AZYA 3SH5A 1OKQA 2WLQA 5T52A 3OYWB 2A3YA 1Q8QA 5GZEA 2P3JA 1I1EA 2ZGRA 1CONA 4HANA 2JE9A 1DQ2A 4YW4A 1MS9A 2P34A 2ZMKA 2ZGLA 2PHWA 1AX0A 2ARXA 1MS8A 1QOSA 4FPYA 3KM5A 2CTVA 1URXA 1ULCA 1KJLA 1YRZA 4K20A 4Z8BA 4M3CA 5IUQA 3FUQA 1UN1A 1SBDA 2D7FA 1MS0A 4M3CF 3DUIA 2EXHA
chains in the Genus database with same CATH superfamily
4K1ZA 4WM7A 1QH6A 2D98A 2A6WA 5CYYA 1GP5A 4P9YA 4V1PA 1FPN2 3DF0A 3K4AA 3QOPA 1Y9MA 3DYOA 4Y1XA 5GZFA 5C7GA 1W0OA 1I3HA 4HETA 2CWMA 3IAQA 3N4MA 2FDHA 3RMXA 2QQNA 2GN3A 3BODA 3GBWA 4PQQA 3VBFB 4GMP3 3WNKA 3M1HA 4JCKA 2XUEA 4NJ4A 4XW3A 2OVUA 4R9CA 4B4QA 5HCAA 3I2HA 4LHSA 1QXPA 3POWA 4OLLA 5HCHA 2VH9A 3LIHA 3WT3A 1BMV1 4MLOA 1N1TA 5FYSA 4AFBA 1IPKA 3D0SA 2IFRA 2HH9A 5DAXA 3GNEA 3WCRA 1LULA 2EXKA 3ES1A 3MW4A 4C91A 4DXTA 4KG8A 2O1QA 3ZFGC 5FXWA 4O9EA 5C8WA 1QJY2 1T6BX 4P9LA 3NKTA 2C5DA 2CV6A 3ZIXA 5A6YA 2GZWA 4AYUA 2D5FA 1QXRA 1W2TA 3CIHA 4MGQA 4YVSA 2VJXA 5FRAA 1GQGA 1XYNA 2XVGA 4URAA 4GWIA 4RR3C 3ILNA 3BALA 3ZFEC 4IEWA 1GOHA 1G9AA 3VZMA 4XETA 1W8FA 5K7PA 3DGTA 2FQPA 4WM8A 3ILFA 3PJQA 2WABA 3LKJA 4KU7A 5KC6A 4UAPA 3WF4A 2BOJA 1AYN1 1APNA 3M2MA 3UESA 2NYYA 3CNAA 3USUB 2VTFA 3DECA 2XUMA 1HN0A 2CL2A 4SLIA 3O1MA 4D69A 4HN1A 5FP8A 1GP6A 4J1WA 2Q4SA 2GNTA 4ZPIA 3ZYPA 3RSJA 4ASMB 4DXZA 3K4ZA 1D4M1 2C4XA 5DZGA 4QX5A 4FOQA 1W8OA 4LR4A 2Y8KA 3NNFA 5EWSA 2VUCA 1ZZ8A 1OC1A 1ZM1A 3AYEA 3M4FA 5KXCA 1NQDA 2RDSA 4OHWA 4P02B 1AYN3 4WV8A 3AYCA 3T2PA 5F5AA 1W9YA 1JZ6A 3PUAA 5IFTA 3WQBA 4IEOA 5T5JA 2JG9C 3ATGA 4FQ4A 4LQRA 1RUF3 5IVJA 1CQ9A 1GNZA 3O1VA 1DCSA 5C5UA 2QNKA 5F7UA 3AXEA 1QJX2 4YGBA 1NCRB 3HQXA 1D4M3 1PIV2 3AVSA 2I45A 5LA0A 4L0PA 5A3TA 2CU5A 1HW5A 3ZSMA 2R061 4L97A 1HQNA 1Y4WA 3R4SA 5FOBB 3L9JT 1N3OA 1OXCA 1WLDA 3RRDA 3VBRC 2JECA 3IBMA 3LCPA 1LGCA 1GOFA 5C6CA 2AC1A 2RJKA 1RUI1 2ZGSA 1V6MA 5LATA 5SV5A 3O1UA 4KWJA 3EHKA 2RDRA 3BGAA 2WZR1 5G05L 1R082 1SG3A 5E1RA 3RNSA 4D7YA 2WT2A 2X5IA 2DCJA 3C2UA 2R063 4I0BA 4XF4A 3MF6A 1VBD2 2WNEA 1UL9A 3SH3A 3AZVA 4H7MA 2WWUA 1EP0A 2D6NA 5GLZA 1WMEA 1CAXB 4CXYA 3OUIA 3D5OA 2YBSA 3VDBA 5E16A 5DABA 4JHZA 1A6CA 4JVAA 3KV9A 2ZOEB 2WZR3 4FPKA 5IVFA 5FZOB 1OD3A 5FZDA 2JIJA 2OZJA 3MUY1 1QXJA 3AMMA 4AEDA 4E2SA 1OPMA 2NQYA 1FAYA 1RJ7A 4AI0A 5EJ3A 4HVRA 1EAH2 2R0FA 4YLZA 3UK9A 3HIFA 5I93A 4H2AA 1LEMA 1CAUA 4WVVA 1N47A 1SACA 3MLJA 4RGGA 4QT6A 3WUCA 2V5YA 3B01A 2VO5A 3U07A 1O3RA 1OF4A 2ZZQA 5H9SA 1RUE2 2JDMA 5A1FA 4GALA 2GAUA 4QQHA 4XILA 5FYYA 1Z7S1 1BK0A 1BCXA 1C5IA 1JYWA 4LA2A 2FZ2A 1S0FA 3MFCA 3RYKA 4AG4A 3WNLA 3N3HA 2VQUA 5CEHA 1H1IA 4MADA 2D3RA 3PU3A 3LEIA 3UKNA 3KCCA 1FATA 2LRPA 1RIRA 1RVF1 5LBFA 4CCEA 5LK5A 2ZJCA 4CUAA 4COUA 3OGVA 4OZXA 1Z7S3 3DYPA 4LBQB 2XBO1 1XE8A 3OTFA 3I59A 5SV8A 4QPWA 1PVC2 2Q0AA 2FDKA 4YGCA 3IDCB 4P9XA 2YPJA 3T0BA 3I4IA 3O7OA 5C8CB 1NCQB 3KLSA 2PMWB 3HR9A 5AVPA 1UXZA 1F5JA 1RVF3 3L2YA 1BQPA 2Y60A 2A6YA 1YQ2A 5FP9A 5JPMB 5IAVA 4TZDA 1Q8SA 2MPFA 3BYWA 4HKWA 4P9WA 3W9AA 1UU5A 2VZ3A 1GQPA 2PTMA 4XABA 1LCLA 3AX4A 3WEZA 2WZEA 4JC1A 5LB6A 3LB9A 3FC0A 4QPYA 4I02A 1WWYA 5CIRA 1STMA 3VBOB 5LA1A 1KEXA 3CJIC 1IS5A 1VMHA 4RL7A 2N7GA 2W2IA 1US3A 1LRHA 5K0UA 5I0DA 2B5HA 4HK9A 1AJKA 4KNCA 2E7QA 3DPRC 2Z4FA 1REFA 2O8OA 4CU7A 5CFCA 4FTEA 1CJPA 1U5ZA 2RV9A 3LGRA 3H8OA 3FHAA 2VNGA 4FTBA 1X9PA 3ZOIA 3MIDA 1HKDA 5CADA 2P6CA 4QB2A 1X9TA 4OMDA 2XOMA 1OUXA 1ULEA 5DDJ2 3T1LA 3V56A 1JHNA 4E2GA 4G9SB 3EXUA 1O8SA 3MYXA 4P9JA 5BNNB 1VB2A 2C24A 2OPWA 1NG0A 3HOBA 3LDKA 4XVHA 4AI9A 3OPTA 1W6PA 1ASJ3 1YJLA 4Q4W1 3BU0A 1SLCA 4N9IA 5C3RA 3Q8AA 4OQ8A 1ZRFA 2DCTA 1F5FA 2WO3A 2CAVA 4XTMA 4IW3A 4AVBA 1K42A 3GHNA 2XB6C 1HB1A 5TSWA 4BA6A 1ST8A 4BQ5A 3TEXA 2ZMNA 3F2ZA 3NJVA 4IETA 4OI4A 3WW3A 1GV9A 4WVMB 1UMHA 2JB4A 3EBRA 4COZA 2PHDA 5FJKA 4XBNA 3SQOA 1AJOA 3LEGA 3VD7A 5LEJA 3ZSJA 1NAEA 2IXKA 1OMIA 1PO21 3AMNA 4Q4W3 1MS4A 4TWTA 4EN9B 1W8ZA 5FYMA 4DFSA 1AF9A 2HLEA 3NKGA 3OY8A 1U12A 4AGVA 2HWD1 3V0AB 1HJGA 4N43B 1FMD2 1YWKA 3C7OA 1AR92 1CR7A 3T4VA 1LOCA 3GBGA 5FMDA 1YCIA 1UX7A 2ZA9A 2ZS6B 1TZOA 3C7EA 4LOSA 5CBLA 3O1PA 5FYCA 3ZR6A 3FLPA 1R1A2 2EXJA 1PO23 1RUC2 2YBPA 4GH4B 5CFDA 5LY1A 3LDRA 3RI8A 2LW8A 4D6QA 4NIIA 1JBCA 2PAKA 2HWD3 4KBBA 5FO8B 2B9UA 2PHFA 4NVPA 1GKBA 2JG8B 1NA1A 2Z69A 4XAAA 3RMYA 1NLRA 4Q2FA 5JZGA 2C1FA 3NVCA 2GMMA 5EHDA 2WC2A 1QJU2 4LBJA 3ZXAC 1P8JA 4OCTA 3J7MA 5KBFA 3U0ZA 2XJVA 4CCCA 3ZM8A 1AX2A 1REDA 1JI6A 3H8XA 1COV1 1VAVA 2W1WA 2RS52 2EIDA 4UW5A 1JN2P 3I2DA 3R6SA 1YYNA 3AKTA 3ORJA 3CKHA 2R16A 1NOVA 3R0RA 1WBLA 1W6OA 4LO6B 1H8TB 2XHKA 4NPMA 1SFPA 3UGHA 4S2DA 4JKMA 3ZXKA 1PO11 4LTAA 2VW1A 3I3QA 5F8PA 2VCAA 4INDA 4CCOA 4M00A 1O6UA 3SNMA 3CZUA 2A70A 3C8XA 1Q8PA 4XF9A 5A6QA 4JHTA 3PUQA 3A4UA 2OZ6A 4PF5A 3AFKA 1FPN1 2J1RA 4DO0A 1RYYA 4BIOA 5HBAA 2JDNA 4YGDA 1PO13 1NCQC 2VQTA 3HD8B 5C8CC 1PZ8A 1SFNA 2WNOA 3PVNA 4Z2WA 3PTYA 1S55A 5DXDA 2EALA 1F4AA 1UU6A 2GP5A 4UWDA 5A7WB 3VBUB 1W3XA 2CDOA 4GULA 5BYNA 2VBDA 2ZAHA 1ZREA 2VVFA 3N9LA 5HXVA 2DWRA 1HB4A 3N9NA 5JUVA 1BVVA 2G9ZA 3T2OA 1Y7BA 4DQAA 2J1AA 5IK7A 3RZMA 4FSJA 4P14A 3V64A 1S0JA 1FPN3 3ELNA 4PBOA 3VBOC 3J7LA 4NE9A 5FMBA 4OHVA 3MHZA 5DG1A 1QIQA 3GDBA 4YRDA 5C70A 2Q8OA 3WLUA 5FJHA 3BTAA 2CDPA 3NNLA 4B29A 2D6OX 2JEMA 3AP7A 1EY2A 4NIDA 1J3QA 1LHOA 5C4WA 3ZN5A 2WNUC 3AXDA 4OUSA 2FCUA 3MDPA 3RDIA 1C57A 2EIBA 5HCBA 5C9AA 2JX9A 4LBQD 3E6BA 5FZFA 3OUJA 4PJYA 1J3RA 1JODA 3MIGA 2ETEA 2VBPA 2FMDA 4OULA 3RYRA 2ZABA 5FIXA 2EAKA 4N53B 3RS6A 4A42A 5FYIA 1SHWB 3HQUA 5FYVA 4QX7A 4RHV2 5A3UA 1IS6A 1G9BA 2GNDA 4YW1A 3WW1A 1W99A 3A0KA 3IWZA 3OEBA 1F15A 2R1DA 1XB9A 3DEMA 4EQVA 1QY4A 2DBIA 5JSOA 3H7YA 4BISA 2HEWF 2CY6A 1OQEA 4QD2A 1RGSA 2QQWA 4LIUA 4E8DA 4LA3A 4GA9A 4LE4A 4LIVA 4JDOA 5FY5A 4A6OA 4I0WB 1VBA2 2VL4A 3E6DA 3POSA 3MV01 1PGW1 3WQ0A 1MR5A 4Y4YA 1CPMA 5BV6A 4X6QB 1UYZA 2FMYA 3FHIB 2HBTA 3PURA 2NLRA 5JXJA 2BJSA 4NWVA 3W20A 4HVOA 4PIXA 2WSUA 2K9ZA 3B00A 2PYTA 2XL9A 3C7GA 5ABJB 1CAWA 3KS7A 5H9QA 1NZCA 3B02A 3RFRA 3HMYA 1MQTB 2C9KA 4HL0A 2CGNA 5A3WA 3I3EA 1HRI2 3SKJE 4CDWA 3GJAA 5EP9A 4F83A 1LEDA 4UF0B 1N1YA 5IW0A 5JAXA 3LFIA 4AEJA 5JOXA 1JYNA 1H6XA 2VNRA 4BHPA 4GH4C 2BGOA 1CVNA 3LQCA 3W59A 3ALQA 1L7LA 5E6HA 5L9BA 5A6XA 3SXWA 4XQ4A 4L92A 5FZ6A 1Q5OA 2VCCA 5FV3A 1LGBA 4GB32 1UY1A 4IEUA 3K51A 4LK6A 4CSWA 2JG8C 1QJX3 4R9AA 1CAVB 3URFA 4RQPB 2ADDA 3VN4A 1PIV3 2ZPXA 4MGSA 4Y33A 4XZUG 3SLIA 3VZOA 3NNGA 1VBB2 2VQ0A 1DZTA 3UKTA 4LNVA 4B3NA 1W3VA 5F3GA 3K46A 1O3QA 3PMSA 2WT0A 1QOOA 4GIQA 5LEKA 5LK7B 1ND2A 1IOAA 2Q30A 2Y0OA 2J7MA 4QPIA 2MNGA 1H8TC 4V2WA 1OKQA 2BV4A 2L9LA 1CGPA 2WLQA 4LITA 3BCWA 5T52A 3I3BA 1TNRA 4R8HA 4FFHA 2FBEA 1ZX5A 2A3YA 1R083 4QAWA 1PGL2 1Q8QA 3MICA 2VZVA 3K3NA 5FXZA 3J8F2 1ZBA2 2XJSA 5JSPA 1VBD3 1I1EA 2VECA 4CP9B 1PNFA 2Q8EA 5JXIA 2RE9A 4YW4A 5M0TA 2PQSA 3K3OA 4FCAA 4OYUA 4DB5A 3W5NA 2XJQA 4ZU7A 1MS8A 4FPYA 1X36A 3KM5A 3U75A 1URXA 2OKXA 4CVUA 1KJLA 3FL7A 3FUQA 4FFGA 1UN1A 1V70A 2NPIA 5BNPA 2AZ5A 2D7FA 2RS32 4M3CF 4XBLA 4CCMA 2PHXA 3OPWA 3UGGA 1W2UA 2VOTA 2GSYA 1EAH3 1UYXA 4IEZA 4YW7A 3VBSB 3MEPA 3U11A 1ONAA 1W8UA 2E33A 2GNBA 4IV1B 1W8HA 4Y1ZA 2VOXA 4YZ4A 5FLHA 2WZPP 4NIHA 2R7EB 2OS2A 2KR2A 5A32B 1K3IA 3HWJA 1RUE3 5C71A 3PHMA 1LHVA 1FOD1 3NNMA 3VZLA 4JX0A 4DINB 1LECA 4QKFA 4DPNA 5FQ0B 1S2KA 4AVCA 1RL3A 2WO2A 2W1QA 4IXLA 4MZUA 1I5PA 1ULFA 3RI9A 2RDQA 1PVC1 4LOTA 3FWEA 2W68A 4R52A 1PX4A 3LEKA 4AQ2A 2GMEA 2XH6A 1GZWA 3HEIA 2VCMA 2VZTA 5E89A 2ORXA 2UURA 2VU9A 1TNFA 3DL3A 5ACA2 3M3IA 4N53C 4MGKE 4ZS3A 3JCIA 1FOD3 1F35A 1TME2 4K6BA 2Z79A 2XLFA 4Q4Y2 1UOJA 2HBUA 3OGSA 1V00A 4XMIA 2XKPA 5DG2A 1QGLA 4BIFA 2CYFA 1WLTA 1PVC3 5BNQA 3S57A 3DN7A 1AL0G 2GNMA 4WM7B 1FXZA 2WN3A 4LORA 1OT5A 4D0QA 4QB1A 1N1VA 5AC92 2VOVA 1LOFC 1H9PA 2VC9A 3LPGA 1WW6A 4CP1A 2QQUA 1E57A 2QZ2A 5GKAC 4KGGA 4K40A 4BCUA 2P17A 2DDUA 4D6SA 2A6ZA 1HRV2 1AYM1 5A7QA 3OEAA 3NL1A 3GGLA 2VTXA 5JLVA 3RJ2X 3POJA 2W94A 3P6BA 3ZIWA 1UX6A 4AWDA 1R091 5A70A 2VZPA 1S2EA 4YW6A 4E27A 5J3UA 1MZFA 1AR71 1LKNA 3N36A 4IQPA 4NAOA 3TWIA 4CDQC 1AXKA 1WA6X 2WA3A 4KMQA 1XOYA 1DZRA 2W1UA 1YQ5A 2TUNA 2F17A 4GKYA 3AM2A 4YVSB 1W9WA 3ZYRA 4QM8A 2ARCA 2HWF2 3WNPA 4FPLA 5DDJ3 3UNPA 3ZXDA 1HN1A 1LJ7A 1C1FA 3H3LA 5EQUA 1C5HA 1W28A 4I09A 4UFIA 1QWRA 4EZ4A 3B9IA 4UFHA 2SLIA 4LBMA 1XE0A 3NJXA 1K5MC 5D8AA 4WM8B 4AI2A 2NZ9A 4RSUA 1SLTA 2YG0A 5JSRA 1SEFA 2V4AA 3O0VA 1KXGA 3MPPG 3OCPA 4R4ZA 1AZDA 1W03A 3H3ZA 1O7FA 2C0ZA 1WD3A 4XOGA 3ZPOA 1YFWA 2YMZA 1N3QA 2VUAA 3ZXJA 1AR91 4LKFA 4Q27A 2BVBA 3AJYA 3OD0A 1EYBA 3ZR5A 1LU2A 1QOTA 2BEOA 4A3ZA 1UAIA 3OGGA 4COWA 1UIJA 3SITA 4YM0A 1RUC1 4AHWA 4NHKA 2BWCA 3GM8A 4TYSA 1AX1A 4FO9A 4A7ZA 4JDNA 2EICA 2QCSB 2YROA 1ZBE1 3MV11 2IXLA 3FHQA 3P3PA 4NRMA 3RZLA 2WRAA 1H4GA 1RMU1 3WZ1A 1AR93 1PMIA 2JDAA 2IVIB 2IUWA 2Z2SB 3FN9A 4AQ6A 4YW3A 3AKQA 1H1MA 4UOJA 1RUC3 3MPBA 4LBNA 2ZGUA 3SCHA 1JYTA 3WX5A 4AFMA 3U4XA 2JENA 2V09A 3ES4A 3U78A 4MGYE 1GWMA 2FCTA 1VALA 3E1F1 2AUYA 1ODMA 2FZ1A 3CJXA 3OPZA 3F95A 4IV1C 1AXYA 4FFIA 3IAPA 3ZXFA 3WV6A 3O1OA 1QJU3 4Q0VA 4A2UA 4AF9A 4R9DA 4PHZA 1ENQA 1OOPC 2DUOA 2EA7A 3ST7A 2X5IB 4UFLA 3J9SA 2RS53 1RUH2 4N7UA 4UFKA 5EJZB 3ZN6A 4DXSA 4XYXA 4XC9A 5DUVA 5J36A 1UY4A 3RQ0A 5LBBA 3UKVA 3FX3A 2B9VA 4C8DA 1HLCA 4MGTA 3O1SA 5C5TA 5L73A 1SQ4A 3P1IA 2QUOA 3AL6A 3I3MA 1IZ3A 2VTXJ 2D5HA 3RVHA 2ID4A 2ZEYA 1NZIA 1ZA4A 4XUOA 4YSFA 3WDVA 2EIGA 3K75B 3CLPA 3TNQA 4AEDB 1MVEA 4Z92B 4UXAA 4IERA 1YI7A 4ES8A 1WMXA 1Y43B 2A3WA 3I2FA 3I2IA 4GZ9A 4RGKA 2AACA 3S30A 4G4FA 2DBNA 4C1WA 4CXWA 3AP4A 1ULPA 4QQPA 1CAUB 2NMNA 2UU8A 1RXFA 1BYHA 1LTEA 2YHJA 3QACA 4K9SA 2BBAA 3KV6A 5DN2A 4PIZA 3NV3A 1JYIA 5FAXA 4PCRA 4XHBA 5KHKA 3VZJA 5FWEA 3EQEA 4H7LA 3KF5A 4NROA 4FBFA 4HSJA 3ZFFC 1W9SA 4IEXA 2R49A 4P9GA 2ET1A 1MVQA 1GSLA 3MIBA 4K21A 3W58A 4FPFA 1HB2A 4AZZA 3WHUA 1ZZBA 5BNOC 1UOBA 1WUVA 1GWKA 2AYHA 2P3YA 5FUIA 5IFPA 2V72A 5GM0A 1RUF1 3IPVA 4NO4A 4KL1A 3KHCA 3FFQA 3A0NA 4BXFA 3KF3A 4ISRA 2IXJA 4BK4A 1JYCA 3VHPA 2VOKA 3CL1A 2K0GA 1F9KA 3I59B 1NUKA 2PLV2 2EAAA 3KHBA 4YVSC 4PBPA 3BIWE 4Y20A 3BU7A 3VKFC 3WHTA 3WDWA 3AK0A 1WCSA 1X82A 4AEMA 2QJVA 4RHV3 2BGPA 2Y6JA 2K46A 1E5RA 3VBRA 4ZS2A 1G9DA 3PIGA 3D6EA 1GYKA 3ZYGA 1PK6C 3AB0A 4N9HA 4QDRA 4Y5Z0 1KFXL 2PA7A 4HMZA 3WP5A 1UY0A 2A73B 4JV4A 4XE9A 3SHRA 2QQVA 1S0EA 2VR4A 3KT7A 4YG6A 5DAVA 1B35C 2G4IA 5FYHA 4BYYA 4CE8A 1UMIA 2PHRA 1ZZ6A 4NRPA 2WO1A 1QJEA 1HRI1 1VBC2 1IPSA 2PN5A 3WG2A 1NXMA 4CP2A 1OI6A 1JOBA 4PDWC 5FK8A 2R6QA 3GJBA 2XQXA 1QMJA 2YC2A 1TVGA 4CZSA 1WW5A 3AZWA 4QX8A 1ZA7A 4MSVA 1PZ9A 1T2XA 4A7KA 5CFCB 4Q0QA 1C3HA 5C33A 5ANQA 3VZKA 2D6MA 1PNGA 2RS12 5F5CA 1RJ8A 1ZZCA 1YQ8A 2J1SA 4GB31 4NHMA 4Y22A 2BWAA 5CB7A 3ZVXA 1YUDA 5DMYA 1LHUA 2VNVA 3QD6A 1HRI3 1W2AX 2QDRA 1IQDC 4JRLA 5JI7A 2XWJB 3AMPA 2W08A 5JPNB 2B39A 1VBB1 2E7AA 2ZGOA 2JDYA 3IM0A 1T6GC 1ZNPA 2WO7A 1JU4A 2BBVA 1JZ8A 4O61A 1W6PB 4COVA 3LE0A 4C0BA 5I8TA 4XUNA 4GB33 3JUUA 4WVZA 3IKWA 3GZEA 3LA7A 5CZKA 2VZRA 5T55A 3TB0A 1F31A 1PGL1 5IJRA 1VBB3 1ENXA 2CWSA 2WL1A 5J1XA 1OQDA 4FT8A 1J84A 3VL9A 1YEWA 1ZBA1 2R042 4XXAA 2ZHKA 3WG1A 1UIKA 1YFUA 1HDKA 3MBWA 1JZ7A 1D2QA 3PLQA 5J98B 2VVEA 4ZHNA 3VBFC 3OY8B 1YHFA 1DGWX 1TQ5A 2A75A 3O14A 3WP4A 4UW3A 2E7TA 2ZEXA 4XEZA 5FY7A 2XHNA 5IHRA 3ZSEA 5A7NA 3B3QE 2GH8A 3VB9A 2P3KA 1FNZA 4CDXA 3J8F3 1DQ6A 5E8AA 3H8RA 3RZJA 1ZBA3 2RS31 4XJWA 1KJRA 3OF1A 1W6QA 5KXBA 3OUHA 5CFDB 2Z42A 2IWGB 2I74A 1H0BA 4NAMA 1ULGA 1JTZX 4KQ7A 1MZ6A 3H8UA 4QX0A 4GD4A 3THPA 2H0BA 2YB7A 5B4NA 3PMEA 4D3WA 1NA1B 1SDDB 2C9AA 2BVVA 2LM3A 2X8KA 4CEWA 5JZGB 2UYAA 5FZGA 5JI9A 3WNOA 5LBCA 2RS33 4HSLA 2GC1A 4I3GA 2J1UA 2B7YA 4CRQA 1PVXA 5FYUA 1W05A 3CJIA 4NWWA 1BEV1 4YVWA 4BMEA 2HWE2 1V6KA 3SEEA 2ZGNA 3OBZA 2WIIB 1SDWA 5CG9A 1WW4A 3T1MA 1UW8A 1XNTA 4IE6A 1RTVA 2LS6A 3JU9A 3VBHB 5ANNA 4O9GA 3RWKX 1W6OB 3DPRA 5IK4A 5JDBA 2ZEZA 2JB8A 1HIXA 3FFZA 3KT1A 5ACA1 3VD9A 1PMHX 4Q4V2 1FV2A 1C1LA 1W8WA 2ZZJA 1TME1 2Q1FA 5C3QA 1K5JA 2GU9A 2P1BA 4LO4B 4Q4Y1 2ES3A 4ARXA 3FUOA 3FE5A 4XJ9A 3ZPYA 4QWNA 1GOGA 3H3UA 1DG6A 1BEV3 4AQSA 5J7MA 5JIUA 2ZHLA 2CGOA 4YNIA 4Y24A 1IPJA 5FZ0A 4XXPA 1ASJ1 1ZRCA 3INAA 1SFYA 5A1AA 2DVDA 1MACA 5ACA3 3KMHA 5AC91 5T5OA 2PXJA 2E9QA 3KZ4C 1TME3 1DQ5A 3D8CA 2VZOA 3A21A 5FKCA 1HQLA 4Q4Y3 5FR3A 1NCRC 4CTEA 4LHKA 4DUVA 3JBG2 3KCXA 4OQ9A 5FLJA 3NAPB 4YW2A 1ZYBA 3HNYM 5FMCA 3MW2A 2NM1A 3POGA 4Q29A 4QXCA 1HRV1 4DEQA 4ZKTB 3JQWA 3N7KA 5CG8A 1LNSA 3H50A 2ZEWA 3MFAA 5AC93 2HYXA 1X8EA 3KGLA 2ZX1A 2ZX4A 4IGPA 4BQ4A 3IZOA 3WDTA 1O3TA 3VZNA 1NE6A 2JDPA 3PUSA 3H1MA 4GWMA 1FV3A 2B4KA 5JR7B 3EMRA 3MLLA 4QB6A 1UZVA 5EPAA 1W6NB 5T5LA 4CUGA 4JGZA 3ZSKA 5FK7A 1CN1A 2R072 2XDVA 1GLHA 5DPNA 3I2OA 4HKLA 5FUPA 4AI1A 1HRV3 2VW2A 5FPAA 5C9AB 3AP5A 3PUIA 5FZOA 4DUXA 5DAWA 2FDJA 2HWF1 4XACA 2GN7A 4FPHA 1FX5A 2YUEA 2D6PA 4FPEA 3M3EA 5CVRA 3K4DA 5LA9A 1NY72 1RUJ2 1WA4A 4BLIA 4L9BA 4DEVA 4UBHA 5FOJB 2QQJA 3NNJA 5JMOA 4OHYA 5A3LA 2V73A 1Q3EA 4JZRA 4Y26A 1UKRA 1D2SA 4RN5A 1RHI2 3U4SA 2WLPA 4YYOA 4PT6A 1UO9A 2HWF3 3NV2A 1LESA 1L7QA 2BW8A 2ZACA 3OOXA 1WMFA 4TN7A 4AHYA 1LOEA 2YGMA 5L36A 3OGRA 1SPPB 1QF3A 2J1VA 4AHXA 1J1TA 3HN1A 3I49A 2NN8A 2Y6FA 2MHFA 5JIAA 4AGRA 3C7FA 4GAZA 4J1XA 5DZFA 3LD8A 4FI9A 3AZYA 2UYBA 4ZZ5A 1JS9A 2X09A 1CAWB 1MZEA 4DY5A 4XF1A 3OBAA 3CBNA 4Z82A 4HANA 1AHSA 4O65A 5F6KA 5F5IA 1PM7A 4QU2A 2ARXA 4BB3A 5FZ8A 1JUHA 1NCQA 5CFDC 5J37A 4MXVA 4IEPA 3TRSB 2OIIA 2H6CA 2XONA 4M3CA 4D8MA 2ZX2A 2ATFA 1NA1C 1MS0A 5C3OA 4GWJA 1XXNA 2BFUL 2I2SA 1V9U2 1GNHA 2VG9A 4IV3A 2XR4A 1WCUA 1WD4A 4DRRA 5JZGC 2VZUA 3J7NA 4FVVA 3RZKA 5T3NA 3CO2A 4NRQA 2H6BA 4I3PA 4FPJA 3VD5A 3B7MA 1H2LA 4CCKA 4Q26A 1RUH1 4TXWA 4XJZA 4ZU5A 1I6XA 3T3YA 1ND2B 4AL9A 1MEC2 1IKQA 1VRBA 3VBHC 1ND3A 4QPIB 3WP6A 1H4HA 2VBBA 1GBGA 4YARA 2WNUA 5K8SA 1RUG2 2RM22 4M3CE 4X8PA 4XUPA 4HPKA 4MH0E 4IESA 1SMVA 2D40A 5LASA 3VKLA 4EN0A 4XFHA 1RUH3 1ZZ7A 3MLKA 3POYA 2VXJA 1QJY1 1BMV2 1RUD2 4L11A 1LOGA 4GJZA 5EZWA 5CKNA 2D6LX 5APAA 4XDPA 2A5ZA 1VMFA 4MVTA 1W0NA 3JB8A 2D93A 1VBE2 4LKEA 3VDAA 3WF1A 4OMCA 2W3JA 4XJUA 4EN7B 5JXGA 2AEYA 2BFUS 5BNPB 1DGLA 4RFT0 1GZTA 4Q4X2 5FY4A 4KU8A 4FPGA 5BNNC 1DLLA 3NAPC 1H1AA 1R1ZA 1QJY3 2WAOA 4LEJA 4WVMA 1KS4A 3CF6E 2Y0IA 1JOJA 1UWWA 4LHNA 1D7PM 2R1BA 2ZGPA 3AFGA 4UYBA 5LCWL 2LROA 5FPVA 1JU3A 3Q8CA 1I9RA 4CDUB 2YFUA 1DQ4A 1WMDA 2RJ2A 3OBTA 4W6XA 2CSGA 2KD7A 1UZ0A 2R30A 2DUQA 4I2OA 3OBRA 1DU3D 1E5IA 1NX9A 4JTNA 2PAMA 1VMJA 3ON7A 4QKDA 4CPBA 3HQRA 5KWRA 3VL8A 4W6WA 3LOBA 3ZO0B 4ZY9A 4QDQA 5I0TA 1UOGA 1DGRA 1DP0A 2W39A 4IE0A 3D0JA 5K4LA 1BXHA 1GZWB 3NJZA 4H55A 4ZONA 4RFRB 2PAEA 4AFCA 2BNNA 2QZ3A 4E4HA 4DUWA 4N43C 3E97A 1J1LA 3PVBB 1QJX1 2VMHA 1EUUA 1JZ4A 1PIV1 4AXOA 3S5AA 1POV1 3OG2A 3A22A 3KQ4B 5IK5A 3UV9A 1EV12 4Z1VA 4ONUA 2PLV3 2WDBA 1NLSA 5HCFA 2HWC2 3T08A 4LMFA 1KDKA 3BIEA 1YC61 3NW4A 5L19A 5ERLA 1W90A 5EV7A 3WNMA 4ATFA 4K7JA 1VBC1 4NOTA 4QKBA 5T5PA 1UZZA 4OUEA 3CEWA 1SLIA 2DV9A 2VGDA 4META 4P00B 3LF7A 3GBFA 2O14A 5DAQA 5CKQA 1R081 3AMHA 4ASKA 1POV3 3MIEA 1H8TA 2XG3A 3G6JB 1UYPA 5GLTA 1E5SA 1RUI2 1OSGA 4BQ3A 1VBD1 4QXBA 5F2WA 3ZMNA 4AW7A 3T09A 2RS11 1IGOA 3ACFA 3SISA 1L3JA 3SEPA 1IS4A 1VBC3 4V2VA 2P2KA 3HJRA 2LALA 4B7KA 4EJRA 1M06G 3J26N 4AGGA 3AP9A 4OZOA 1KQRA 1XSQA 4QPGA 2V5DA 5IT6A 1W6MA 1XBFA 2TNFA 3HNMA 3L2HA 2RS13 5KHJA 1VLNA 4XPVA 3J4UH 4IE4A 4ARYA 1LHWA 2HYKA 4YM3A 1EAH1 1WKYA 1N1SA 2RHPA 1AVBA 4BDVB 4N8MA 3USSA 3QLQA 2XVKA 5DQ0A 4LE3A 3PTRB 4F3JA 2LTNA 4NIAA 2GMPA 1QDOA 3NV1A 4A7YA 1RUE1 5D8AB 5A33A 3VBUC 5A3OA 4YZ2A 4JGYB 3ZYHA 5A1LA 4J6GA 4YG3A 2JD9A 1NE4A 2ZGMA 1ND2C 3NWKA 4DIQA 1O3SA 3CDZB 4QHOA 3GF6A 3Q9OA 3VGIA 4P08A 4QXHA 2ZMLA 2E32A 4B4PA 1OH3A 4AK3A 4OHXA 2W91A 2R043 1SLBA 2ORZA 5L9VA 1MS5A 4OI2A 5JCTA 2AH2A 4ATEA 3IIIA 4KWKA 2D44A 4RD7A 4QGMA 3O1RA 5FZ3A 4GKXA 5FZ9A 5FZIA 4B8EA 5IVCA 1DIWA 4MHRA 2SBAA 1H9WA 1RUOA 3KVAA 2KM2A 3E5QA 3N9OA 1C28A 1O59A 2BQPA 4IEYA 5F1RA 3VKMA 1D0HA 2XBO2 4NPRA 2UWCA 3BTXA 4ES9A 4HG6B 5L7OA 1ZZ9A 3U37A 2DCKA 3U10A 2VXRA 4YZ5A 2IXCA 1O5LA 2JKBA 4WVWA 2RVAA 3BPSA 3UGFA 3V65A 3LSEA 1WLWA 2XL7A 2UWBA 1LHNA 2JDUA 3HNBM 1ENRA 3V0BA 2Q1ZB 2VZSA 3D3AA 4D7SA 4Z2AA 5AFEA 5IYYA 3ILRA 2YGLA 4Q4V1 4CDUC 4CUCA 1TMF2 2TEPA 3H7JA 1CPNA 4NHLA 2JD4A 3N7JA 4OHZA 3M7AA 1OPOA 3T2QA 2HWE3 2Y38A 4CA9A 3MIHA 2VY0A 1FI2A 1OBNA 4A6SA 1HXS2 5IAXA 5KHGA 3ZN6B 1BBT2 4Z07A 4EZHA 2XQRA 3JD72 2YBKA 4CDQA 1JZ2A 4UW6A 1CZVA 3GALA 1GZCA 1XNKA 3R4UA 4Q4V3 4Y1YA 3FLRA 5T54A 3SCFA 4AOCA 1W0PA 4EV0A 4JQTA 1MQTC 5DDJ1 5FY0A 1UYYA 3THCA 4NHXA 3PIJA 2OQ6A 1XU2A 3AKRA 4FOWA 2C6SA 3WW2A 5FZCA 2OT7A 2BGCA 2DVAA 2W46A 4LBOA 3IDBB 4ZXKA 4JDMA 5I0SA 3O0XA 1K5MA 1W04A 5JXHA 4QGLA 1ENSA 2RMU2 3H0OA 5B2GB 4BJ0A 4U36A 3ZYBA 1VRH2 2ARAA 4TTGA 3IDAA 4RQPC 1CX1A 3ME2A 3JBG3 3TYJA 1YI9A 4CEYA 5H9PA 5FZMA 3HN3A 3GZUC 3KWVA 3ZYIB 4XIKA 5FZ7A 3B94A 4X8NA 3E5UA 5FPXA 1XC6A 1DQ0A 4YPJA 1G9CA 2WKKA 1X50A 4XJ8A 4F7ZA 4DMIA 1XNDA 2BDRA 2WNVA 4DXRA 1RINA 3D82A 3NSTA 1FMD1 5JVVA 3AL5A 1QHDA 2OQ7A 1J59A 1NY71 1RUJ1 2WSVA 1H2NA 1DYOA 1OVPA 4MXWA 3PVOA 4CCDA 2G9GA 1OH4A 1PM4A 1XQNA 2R073 3B9CA 4NUBA 1R1A1 1XU1A 3PNAA 5AVAA 1G9FA 3MW3A 4RS5A 4AHZA 1RHI1 2PHLA 1WW7A 5LA2A 1FNYA 3AKSA 2QQKA 3VDDA 5FWJA 1UY3A 1U5YA 2XXZA 4IE5A 4Y5TA 5J96B 4Y20B 2RDNA 4XFCA 2RG4A 3DKWA 2EF6A 1Q43A 2QTWB 4M01A 1FMD3 1RUJ3 2VQAA 2WFF2 2JE7A 2Y6LA 4MGZE 3QCWA 3C7HA 2VZQA 2GC2A 3KV4A 1QJU1 1R1A3 2DF7A 3NJYA 5D8AC 1A8DA 5A7OA 1DHKB 2VPVA 4JGYC 5GLWA 1RHI3 3ZSLA 2R0HA 2XGXA 1W9FA 5IVBA 2QDNA 2RS51 4AFDA 3KD4A 2A6VA 3FBMA 1OOPA 4D7TA 4XJAA 3VBSC 4AVVA 4EROA 4PF1A 1E5HA 5GZGA 1FT9A 1CWPA 1COV2 1LGNA 2Y26A 2Y64A 1QJZA 2A6XA 3UYJA 4Y4RA 2VD7A 3RZHA 1AL22 2VAUA 1LAJA 1GQHA 1O4ZA 3K2OA 2RR12 1W2OA 2UY8A 2WN2A 4PLNA 1PZ7A 2B42B 1JOPA 4ORFA 3OB8A 2ADEA 5FZ4A 3MO4A 1UKGA 4W4ZA 4Y22B 4GQ7A 2BZDA 4S2HA 1H6YA 1OA3A 4PI2A 1V9U1 3QH6A 4D94A 1SBEA 3ZFGA 3LSDA 3VUOA 4NN0A 3ZN4A 2A3XA 2ZGQA 2W47A 3WINE 4CXXA 4XUQA 1AR82 4A45A 4QHZA 1JMUB 2D6KA 4MGIE 4RR3A 3M3OA 3ZFEA 3WG4A 2E63A 4Q5OA 3DYMA 1C8M2 1OD5A 1MEC1 1W39A 1WLCA 4HBNA 3RG0A 3ZX7A 1ULOA 4XQDA 5HI0A 5I0RA 1LOBA 4WM7C 3T0DA 1V9U3 3IMNA 1RUG1 2RM21 2XWBB 4LBLA 5CKMA 5HXMA 1OHFA 4KGQA 1UMZA 1JUIA 1X7NA 1AUYA 1CX4A 2J1EA 3ZFFA 3LA2A 4E8CA 4W6YA 3RJRA 5I8YA 3M8LA 3ZLIA 2V4VA 5F5QA 3BOPA 1KGYA 3N7LA 5BNOA 5IATA 4AQTA 1RUD1 5FZAA 1QQP2 2BTVC 2CNAA 1MEC3 5A3PA 2QFEA 4LBKA 4UT5A 3BI3A 3QBQA 4LT5A 3SH4A 1AR62 3RWNA 1RUNA 5IVYA 4BH9A 5F2SA 1RUG3 1VBE1 2IVJA 2RM23 3A7QA 3EYPA 2G19A 1SLLA 1VPHA 4BQWA 1CJDA 2HEYF 2FDFA 2WZ8A 4BQ2A 4CDXB 2F6BA 4BWOA 5EYYA 5C3PA 1L7RA 4RHV1 2OYZA 1HX6A 1QJFA 2D3SA 4FOVA 4Q4X1 4GMP0 3T0AA 3I8TA 1W6QB 1O8PA 1WGPA 3LZZA 4Y3OA 5FYBA 1J83A 1MPXA 1DLCA 1OLQA 1RUD3 2JG9A 2VUJA 3POFA 1LB2A 4QDSA 4QQLA 3T2TA 1PK6A 2J1TA 1VBE3 4A4AA 2XJTA 3R4DB 1XSRA 5HV0A 3I54A 4CEWB 1VBA1 1BVP1 3N35A 4ISQA 4PLOA 3APBA 3BTZA 1B35A 2YZ4A 4Q4X3 3RGBA 1DF0A 4YM2A 5A7SA 5A80A 2O8QA 3CJIB 4YVWB 4EN6B 4UI9L 2Y6GA 3GXUA 2Q1MA 2JDZA 4WM8C 1ZRDA 3N7MA 2GDFA 3TOJA 1PGW2 1VB4A 2WQ8A 1MS1A 3JB4C 4PDWA 1NQJA 3UJQA 5LY2A 4B4RA 4JTOA 4FQZA 5IK8A 3DPRB 1OKOA 2BNOA 2W52A 3POBA 2VULA 4XURA 1BKZA 1VBA3 2PHTA 3OYWA 3PL0A 2EVXA 3HT1A 1S1AA 1DYKA 3JXSA 1V6LA 5FYTA 5F3CA 4O7XA 2FCVA 5K0UB 4QHBA 4K3UA 5LWBA 2XLGA 1S4CA 5A3NA 1EV11 5F3EA 3AP6A 3VV1A 2DU1A 2DVBA 2OUHA 1OA4A 1U0AA 4IGOA 2EIEA 1MZ5A 4IDZA 2HWC1 2NP0A 2DURA 1UNBA 3O5SA 4P5HA 4YZ1A 3MI8A 4M4PA 1W8NA 2JKXA 5E88A 4QX3A 3I7DA 4AR2A 2DTWA 3GZAA 5IWFA 1LODA 3TEWA 4IEVA 2YXSA 1VP6A 4I30A 2DTYA 1EV13 1YJKA 4XF3A 3UL2A 2YY1A 4AI3A 4CCJA 2W92A 2A1XA 2HWC3 2OX0A 5H9RA 4PQ9A 4HVQA 2Y6KA 4IE7A 3D4KA 1YXWA 4KBZA 1ODNA 2AGSA 1RXGA 2Q8CA 1CESA 5FYZA 4Q1RA 3FZ3A 5BY5A 3VBFA 4ZU4A 1WZXA 3J7HA 4P5YA 3SH5A 3TNPB 3J8F1 2TBVA 3KT4A 1RUI3 4FFFA 4JGZB 4NR1A 4XFFA 5KC5A 3WNNA 2X5IC 3KGZA 3C3VA 5GZEA 2P3JA 4HFSA 4XCAA 2HKXA 2ZGRA 2Q8DA 3CZJA 4I01A 2XJRA 3VDCA 1PMJX 5ISLA 1WCKA 1MS9A 2P34A 2ZMKA 2ZGLA 4BZ4A 4AEKA 3LOIA 4CP0A 1QOSA 4EWEA 4ZXEA 2JDHA 1PHMA 1YRZA 2VMEA 2E31A 4AEDC 4XCBA 4TSVA 1LR5A 1GR3A 4MV2A 3DUIA 2EXHA 4Q1PA 2GALA 2X53S 3CHXA 3S0MA 2JDKA 4FP2A 3JQXA 4D6RA 5C3SA 4L99A 4YW5A 2D43A 5KXEA 3WSOA 5FTTC 1C8NA 1YFYA 4YWAA 5F6LB 5F39A 3R05A 3M70A 1V0AA 2ZTNA 1PGSA 2B46X 3USUA 3BVCA 3IIAA 1JH5A 5FDBA 1KFUL 4JKLA 3TBDA 1SZBA 4Q0UA 1GANA 2PQQA 4I0AA 1K45A 4XDQA 5D2AA 5B4XA 1FOD2 3JZVA 4IL7A 1A34A 3WDYA 4LK7A 3ETPA 2MEV2 4QGNA 5L9RA 3GZTB 5JMCA 5GZDA 2ARBA 4CDXC 5I0UA 5AFBA 2BRTA 3LDBA 1V6OA 4RA0A 5FZ1A 1XJAA 4BM8A 1RB8G 5F32A 4Y1UA 5DUUA 4BXSV 3WD5A 4M0NA 2DU0A 2WJSA 1EPZA 4K8RB 5FZKA 1UPSA 2JE8A 3OSDA 3I2GA 1KDMA 1NLQA 1S0CA 2FHRA 3O0WA 5DAPA 1NCRA 4M3CB 4NPLA 2W0XA 4HOOA 3TN92 1TMF1 2XBO3 4CEWC 2VNOA 1YIPA 4IV3B 2WA4A 3KB5A 2GP3A 3ECQA 2W95A 1AXZA 4XIOA 3WVJA 3UJOA 4YVWC 1HXS1 2DCYA 2HJIA 3NMBA 4G3YC 3S6PA 5LZ6A 1BK1A 4KWUA 1BBT1 2W87A 4PLMA 4X6RB 3JD71 2HWB2 2XMLA 3AYAA 4E2QA 1MS3A 1ND3B 1TMF3 2QQOA 2JICA 2WNUB 4XMAA 4YGEA 3K77A 4LO8A 1XNBA 1G7YA 1TG7A 4HPKB 1V6IA 2WS92 4TLFA 1AYM2 5K0UC 4EE2A 1JYVA 1O91A 2WYFA 3FLTA 1HXS3 1CAXA 4CYDA 5C4WB 1BBT3 5EJ1B 3NV4A 1UPIA 3JD73 1CZSA 1R092 5CFCC 4MUVA 1V6NA 3ITQA 5FCCA 5GLVA 5EIYB 1DBNA 1AR72 3H9AA 1ULDA 2IFWA 1S0BA 3IB3A 4Q0SA 4YFZA 5F9TA 2RMU1 3AYDA 1OA2A 3WF0A 4A44A 5J09A 3LAGA 2ZCWA 1VRH1 3X29B 2OPKA 2W1SA 5GLUA 4BU2A 2ILMA 2ZHNA 1RITA 1XPWA 5FREA 2P37A 1TEIA 4QQ2A 4BE3A 5I8SA 2WINB 1F2NA 1G86A 5LW9A 5LRSA 3FBYA 3ZDSA 1ZVFA 2RMU3 4OUMA 1OURA 2ZAAA 2WBKA 4CU9A 3ZYJB 4FTSA 4YZ3A 1V6JA 1VRH3 4XFIA 1Y9QA 2IC1A 3HAGA 3LEMA 4QMAA 4LJHA 2VMIA 1UZWA 2VMGA 3DXUA 4JGZC 2VW0A 2ZKNA 1UD1A 3AVRA 4EWAA 5GALA 1A8MA 4FXGB 5FFOC 1DFQA 1KITA 2VUDA 4HXCA 4U2AA 3E5XA 4MOAA 1W9TA 1H2KA 1XNAA 2AENA 1BZWA 1SCSA 5ABJC 4AAXA 2P6HA 4R9BA 3M3CA 4XFAA 5LBEA 1I5ZA 4NIGA 1UOFA 4UW4A 3RZZA 1QKQA 1A78A 2ZGTA 5CAZA 2WFF1 4LBQA 5IVVA 2DFBA 4LPLA 1ZBE2 1N3PA 4XQWA 4CDWB 3I2JA 5FZLA 3WP3A 3ZXLA 1RMU2 5FZBA 1DGRN 1U5XA 1IQAA 5EFUA 1ZRIA 5C8CA 1NYWA 2QQIA 4AI8A 3WNXA 2DFCA 5JR2A 2Q5TA 1J58A 4C0HA 4EN8B 1U5IA 5F3IA 3KSCA 3SMHA 2WFF3 2XJPA 1GUIA 3HBZA 1HV0A 3HT2A 5EYXA 1QDCA 4C90A 4M4RA 1AL21 1REEA 3VBHA 5A6ZA 1ACCA 2BUKA 3SC7X 4DRVA 3CQOA 2RR11 2YC4A 1UY2A 3VBOA 3PVEA 4XUTA 5JOZA 4OI1A 4FPCA 2EXIA 3VKOA 2VOWA 1XE7A 3EJKA 3TAYA 4ET7A 4DNYA 2XKOA 3WG3A 5JWPA 1Z78A 3TEZA 2BNMA 1COV3 3Q8EA 5FY1A 5HPOA 5KXDA 4JRAA 4N7IA 3FMGA 1AL23 5F37A 1HB3A 2XLAA 3PDQA 4A41A 4QXKA 2RR13 4QKNA 1AR81 1XNCA 4QPGB 1EUTA 1W6MB 1YNAA 3MIFA 4FXKB 5FXVA 4F8AA 2D3PA 1C8M1 5EXOA 2BU9A 2ZXQA 4QX2A 5FO7B 1S0DA 3VKNA 1GWLA 4LO5B 4BQXA 5BNNA 4B1LA 3NAPA 4AVSA 2GH2A 3ASIA 2VZ1A 3EB7A 4KG0A 4CCLA 1GNYA 3O1TA 4IV3C 1BJQA 4BK5A 1US2A 2BPA2 2HEVF 4W8JA 3U1XA 1AR83 1XYPA 3IN9A 5A33B 1UQXA 4E4ZA 1IS3A 1QQP1 1C8M3 1UF2C 4E4DX 4ZZ8A 1AR61 4MG2A 1SBFA 1W6NA 2YU1A 4JKKA 1ND3C 3Q8FA 2WR9A 2P3IA 3KQRA 2VMFA 5FY9A 4BPZA 1W8TA 4E4SA 1YQ6A 1KRIA 3WOGA 4CU6A 5JOYA 5D21A 2FDIA 2DCZA 2WQ4A 3VLBB 3WR0A 4TLGA 3RPQA 2D97A 1RC6A 2F4LA 4GXLA 4LKDA 4MHUA 4PIYA 4R4XA 1AYN2 1KS5A 1W06A 3ETQA 4COYA 2QKDA 5C4WC 2WUHA 3WUDA 3V0AA 1QQP3 4N43A 5HV4A 2WWSA 2WWJA 1AR63 1OVSA 2VM9A 1RUF2 2J22A 5C9AC 3SCGA 1JZ3A 2PLV1 4FPOB 5FZEA 1VIWB 4MO3M 3E6CC 4KWLA 4YM1A 3ROUA 1D4M2 3W5MA 3GYDA 4Q8LA 5FO9B 2ZX0A 3PJYA 4GH4A 1CIWA 1UZYA 4LHLA 4QM9A 1HQWA 1JZ5A 1Q8VA 1DDLA 2ZKLA 4JQRA 1DQ1A 5BXXA 5L7OB 3EO6A 1H30A 1D4VB 3AMQA 3N9QA 4AAPA 1LU1A 1HJFA 2JG8A 3MGUA 4ITCA 4LUMA 1SPPA 3ACGA 3V0BB 3NRUA 1H2MA 4E9KA 4L8QA 1S2BA 1C4RA 3KCYA 3NQHA 4B7EA 2NMOA 1OQ1A 1S0GA 3LIGA 5I91A 3I2KA 4EWDA 1SCRA 1OFNA 3POEA 2AEZA 3QH7A 2R062 2XPJA 2Y6HA 5J48A 3S7IA 3IDEA 1YO8A 1FYUA 1O4TA 5FXXA 4CU8A 5DZEA 3UETA 4BOWA 5KHHA 1S0IA 3RYPA 2E51A 4HN0A 1WCQA 2J42A 2WYSA 3BN6A 4Q0PA 1D0GA 4CDQB 2E6VA 3AKPA 5FLIA 2WZR2 1DZQA 1OLMA 3PU8A 1O4YA 4GJYA 4LLOA 1X33A 2VMDA 4SBVA 1JW6A 1J3PA 4CDWC 1G8WA 1CZTA 2E53A 2UY9A 2YU2A 4MX3A 5CU1A 4A3XA 1OLRA 2OW4A 2ERFA 3ZKYA 4BQYA 1VE0A 1VAKA 1M4WA 1LENA 4JAAA 1BLZA 3VD4A 4LXLA 4OFGA 4YFWA 1QH7A 2QQLA 5CNAA 1WBFA 1K5MB 5FKBA 5A7WA 3VBUA 3HPNA 4RYDA 3M3QA 3AZZA 1VJ2A 2AR6A 4AE2A 1CIYA 1OLME 1VR3A 5D1IA 3WW4A 1WCDJ 5FPBA 2IXIA 2R041 4CEYB 3RZGA 4AVAA 2H0VA 4CPBD 3H42B 5IVEA 1F8VA 3A23A 3BB6A 4S2GA 4H14A 3B69A 3ZDVA 4FAGA 3BUCA 1XYOA 3DKQA 5BUVA 1W2NA 3W21A 2WNVB 1VAMA 1POV0 1Z0HA 4FOYA 2C26A 1H8VA 3HVDA 4GWNA 4QPIC 4URTA 5FBJA 5KR7A 1NT0A 2GC3A 4Y1VA 3ABZA 4AFAA 4IGQA 3GHMA 1Z7S2 1GICA 2UWAA 4MXWB 3VHNA 4BLJA 3H1YA 3H1WA 4LO7A 1OFSA 2DYCA 4N90A 3WF3A 2W9XA 4CUBA 2X10A 4QPGC 4S2FA 4UFJA 4BQ1A 4RS5B 4XTPA 1A3KA 2PHUA 5GJ6A 2YPDA 1HV1A 3T30A 5KHIA 4WZCA 4H3WA 3VDDB 2B45X 3CU7A 4N53A 4Q8KA 2XJUA 4HZFA 3OD4A 2I07B 5FP3A 1GMMA 1R64A 1DYPA 1RVF2 1JYXA 3S7EA 4IUGA 4IEQA 4BMBA 2QBXA 3I97A 3ZMOA 2ZBJA 5A7PA 4W65A 2XVLA 1QU0A 3P3NA 1EPWA 3VHOA 1G6NA 5BNPC 1Q8OA 4CDUA 1KD7A 1YIFA 4FP3A 2HWE1 2LUWA 4LKSA 3N9MA 2BERA 1OF3A 2JJ6A 3ACHA 4M0HA 4WZFA 2E26A 1LOFA 5LRRA 3MZHA 3I3DA 5FUNA 1OOPB 2Y34A 4QX1A 2YV8A 2VE1A 2MEV1 3UT0A 4XHXA 2X29A 1BEV2 1QNYA 2WQZC 4HONA 1Y9GA 1B09A 3U14A 5A3MA 3AZXA 2RJLA 3ACLA 1BHGA 3WCSA 4HT1T 1UCXA 1K12A 3BOWA 2PFWA 3CMGA 5FZHA 3T4HB 4DS0A 1UU4A 5T50A 5FP7A 5ABJA 1GP4A 2OXBA 4AVTA 1Y3TA 2IZWA 3WDUA 2IXHA 2VCBA 1MQTA 5DUXA 2P5BA 3ENRA 3TEYA 1TE1B 1PX3A 3WY6A 3TN91 4UF0A 2QVSB 5JOWA 2MEV3 1OUSA 3ZFGB 4YG0A 5CISA 3Q8BA 1ASJ2 3G7DA 2AREA 3SKVA 5L7OC 2QE3A 2ZX3A 3DCQA 1GU3A 2F4PA 3JBG1 3AJZA 5CA6A 4C1XA 1GZ9A 2KXLA 2YFZA 1IG3A 4K8FA 4RR3B 4XFBA 3LWCA 2DVGA 2HWB1 3HBKA 4LUKA 1CAVA 3OGJA 3KVBA 2WT1A 3ACIA 4RQPA 3ZFEB 2FDGA 3TN93 1Q56A 3S5QA 3BTYA 4XZPA 2YYOA 4OI0A 4RGAA 5FY8A 2ZGKA 2WFPA 4NHYA 2BP6A 3ZFFB 2WS91 3LA3A 4Q4W2 2JWPA 1UXXX 3DXTA 1JHJA 3POIA 4XFGA 2KA3A 3WDXA 1CD3G 5GZCA 3AC0A 3ZXEA 4XDOA 2OA2A 4QQOA 5BNOB 1SLAA 1ZRRA 2R071 3WQ7A 1NXD1 1QEXA 2GC0A 2HWB3 3FJSA 4HLTA 3BPZA 2W5FA 3B93A 3N9PA 4EYUA 2CGPA 2VVDA 2O0OA 4UBGA 3MUZ1 4L2NA 1IKPA 4CP9A 1PO22 2WS93 3IMMA 1AYM3 4QU1A 5FPZA 3WXPA 2P4EA 1X8MA 3IPVB 2X05A 5FMOL 3NO8A 4LLFA 2HWD2 1R093 2JG9B 3O12A 2DUPA 5K9YA 2QQPA 2JIGA 3LFMA 4FAHA 2G1MA 1AR73 3P5BA 3ZKUA 3ZYFA 4NMIA 4XBQA 1PK6B 2A71A 2CHHA 3ZXGA 2ENRA 3GCWA 4JGYA 4KI5M 3GCXA 2QQMA 2ZHMA 1JXNA 4MYEA 3THTA 4LULA 2Z5WA 5DUWA 1B35B 3VBRB 1LOAA 1IG0A 1YFXA 2CAUA 1QNWA 2BYVE 3OJBA 3PUHA 3VBSA 4HK8A 2DVFA 4IV1A 3B5LB 4CEYC 4XF0A 4Y5SA 1ALYA 3KV5A 3MF9A 2OUJA 3THDA 2PELA 4B1MA 5A32A 4PI0A 5G04L 4PDWB 1F4HA 4XAEA 2A7AA 5FPLA 5BPXA 1DGWA 2WAAA 4DZGA 5FQ0A 2WNVC 1O5UA 3OYWB 2B8MA 2YDEA 5FP4A 1XRUA 4CCNA 4DOUA 1YQCA 3DV8A 4P9IA 5FPUA 1IHMA 4J25A 1CONA 5FMOS 4RS5C 4OVEA 2JE9A 1DQ2A 3IT8A 4HKOA 3BKZA 2YC0A 2BOIA 3VDDC 3VHRA 2PHWA 1PO12 1AX0A 1NKGA 4KH9A 4WBBA 2R32A 2ET7A 1YLLA 2CTVA 3WF2A 1ULCA 2Y33A 5FBZA 3WQ1A 2VMCA 2K2SA 1GFF2 3LPFA 4UFMA 3VD3A 4K20A 4Z8BA 2FD8A 3K48A 2JXAA 1ZBE3 1POQA 5IUQA 4ASLA 1SBDA 2G9FA 4GMP1 4W50A 1RMU3 4DY3A 4K1YA
chains in the Genus database with same CATH topology
4K1ZA 4WM7A 1QH6A 2D98A 2A6WA 4P9YA 4V1PA 1FPN2 3DF0A 3QOPA 4Y1XA 5GZFA 1W0OA 1I3HA 4HETA 2CWMA 3N4MA 3RMXA 2GN3A 3BODA 3GBWA 3VBFB 4GMP3 3M1HA 4JCKA 4XW3A 2OVUA 4R9CA 4B4QA 5HCAA 1QXPA 3POWA 4OLLA 2VH9A 3WT3A 1BMV1 4MLOA 1N1TA 4AFBA 1IPKA 3D0SA 2IFRA 3WCRA 3GNEA 1LULA 2EXKA 3ES1A 3MW4A 4C91A 4KG8A 2O1QA 3ZFGC 5C8WA 4O9EA 1QJY2 4P9LA 3NKTA 2C5DA 2CV6A 3ZIXA 2GZWA 4AYUA 2D5FA 1QXRA 4YVSA 5FRAA 1GQGA 1XYNA 2XVGA 4RR3C 3ILNA 3BALA 3ZFEC 4IEWA 1G9AA 3VZMA 4XETA 5K7PA 3DGTA 2FQPA 4WM8A 3ILFA 3PJQA 3LKJA 4KU7A 5KC6A 1AYN1 1APNA 3M2MA 3USUB 2NYYA 3CNAA 2XUMA 2CL2A 4SLIA 4D69A 4HN1A 4J1WA 2Q4SA 2GNTA 3ZYPA 3RSJA 4ASMB 4DXZA 1D4M1 5DZGA 4QX5A 4FOQA 4LR4A 5EWSA 1ZZ8A 5KXCA 1ZM1A 3AYEA 3M4FA 1NQDA 4OHWA 1AYN3 4WV8A 3AYCA 4IEOA 5T5JA 2JG9C 3ATGA 4FQ4A 1RUF3 1CQ9A 1GNZA 2QNKA 3AXEA 1QJX2 4YGBA 1NCRB 3HQXA 1D4M3 1PIV2 2I45A 1HW5A 3ZSMA 2R061 4L97A 1HQNA 3R4SA 3L9JT 1N3OA 1WLDA 3RRDA 3VBRC 2JECA 3IBMA 3LCPA 1LGCA 5C6CA 2RJKA 1RUI1 2ZGSA 1V6MA 5SV5A 4KWJA 3EHKA 2WZR1 3RNSA 1R082 5E1RA 4D7YA 2WT2A 2X5IA 2DCJA 3C2UA 2R063 4I0BA 4XF4A 3MF6A 1VBD2 2WNEA 1UL9A 3SH3A 3AZVA 4H7MA 1EP0A 2D6NA 5GLZA 1WMEA 1CAXB 3D5OA 5E16A 1A6CA 4JVAA 2ZOEB 2WZR3 4FPKA 2OZJA 1QXJA 3AMMA 4AEDA 4E2SA 1OPMA 2NQYA 1FAYA 1RJ7A 4AI0A 5EJ3A 4HVRA 1EAH2 2R0FA 4YLZA 3UK9A 3HIFA 5I93A 1LEMA 1CAUA 4WVVA 1N47A 1SACA 3MLJA 4RGGA 4QT6A 3WUCA 2V5YA 3B01A 3U07A 1O3RA 2ZZQA 5H9SA 1RUE2 4GALA 2GAUA 4QQHA 4XILA 1Z7S1 1BCXA 1C5IA 4LA2A 2FZ2A 1S0FA 3MFCA 3RYKA 4AG4A 3N3HA 1H1IA 2D3RA 3UKNA 3KCCA 1FATA 1RIRA 1RVF1 5LK5A 2ZJCA 4COUA 4OZXA 1Z7S3 4LBQB 2XBO1 1XE8A 3OTFA 3I59A 5SV8A 1PVC2 2Q0AA 4YGCA 3IDCB 4P9XA 2YPJA 3I4IA 3O7OA 5C8CB 1NCQB 3KLSA 3HR9A 5AVPA 3L2YA 1F5JA 1RVF3 1BQPA 2A6YA 5JPMB 4TZDA 1Q8SA 2MPFA 4HKWA 4P9WA 3W9AA 1UU5A 2PTMA 1LCLA 3AX4A 4JC1A 3LB9A 3FC0A 4QPYA 4I02A 5CIRA 3VBOB 3CJIC 1IS5A 4RL7A 2N7GA 5K0UA 1LRHA 2B5HA 4HK9A 1AJKA 4KNCA 2E7QA 3DPRC 1REFA 2O8OA 5CFCA 4FTEA 1CJPA 1U5ZA 3LGRA 2VNGA 4FTBA 3MIDA 1HKDA 5CADA 1ULEA 5DDJ2 3T1LA 3V56A 1JHNA 4E2GA 4G9SB 3EXUA 3MYXA 4P9JA 5BNNB 1VB2A 1NG0A 1W6PA 1ASJ3 1YJLA 4Q4W1 1SLCA 4N9IA 1ZRFA 2DCTA 1F5FA 4AVBA 2CAVA 4XTMA 3GHNA 2XB6C 5TSWA 4BA6A 2ZMNA 4IETA 4OI4A 3WW3A 1GV9A 4WVMB 4COZA 3EBRA 2PHDA 4XBNA 1AJOA 5LEJA 3ZSJA 2IXKA 1OMIA 1PO21 3AMNA 4Q4W3 1MS4A 4TWTA 4EN9B 4DFSA 1AF9A 3NKGA 3OY8A 1U12A 4AGVA 2HWD1 3V0AB 4N43B 1FMD2 1YWKA 1AR92 1CR7A 1LOCA 3GBGA 1YCIA 2ZA9A 2ZS6B 5CBLA 3FLPA 1R1A2 2EXJA 1PO23 1RUC2 4GH4B 5CFDA 3RI8A 1JBCA 2PAKA 2HWD3 4KBBA 5FO8B 2B9UA 2PHFA 4NVPA 1GKBA 2JG8B 1NA1A 2Z69A 3RMYA 1NLRA 4Q2FA 5JZGA 2C1FA 3NVCA 2GMMA 2WC2A 1QJU2 4LBJA 3ZXAC 3U0ZA 2XJVA 1AX2A 1REDA 1COV1 1VAVA 2RS52 4UW5A 1JN2P 3I2DA 3R6SA 1YYNA 3AKTA 3WD5A 3R0RA 2R16A 1NOVA 4LO6B 1WBLA 1W6OA 1H8TB 2XHKA 4S2DA 3ZXKA 1PO11 4LTAA 2VW1A 4INDA 4M00A 3SNMA 2A70A 1Q8PA 4XF9A 3A4UA 2OZ6A 4PF5A 3AFKA 1FPN1 4BIOA 5HBAA 4YGDA 1PO13 1NCQC 5C8CC 3HD8B 1PZ8A 1SFNA 3PVNA 4Z2WA 3PTYA 1S55A 5DXDA 2EALA 1UU6A 3VBUB 1ZREA 4GULA 5BYNA 2ZAHA 2VVFA 5HXVA 2DWRA 1BVVA 1Y7BA 4DQAA 5IK7A 4FSJA 4P14A 3V64A 1S0JA 1FPN3 3ELNA 4PBOA 3VBOC 4OHVA 5DG1A 4YRDA 2Q8OA 3WLUA 3BTAA 4B29A 2D6OX 2JEMA 3AP7A 1EY2A 1J3QA 1LHOA 5C4WA 3ZN5A 2WNUC 3AXDA 4OUSA 3MDPA 3RDIA 1C57A 5HCBA 5C9AA 2JX9A 4LBQD 3E6BA 4PJYA 1J3RA 3MIGA 2ETEA 2FMDA 4OULA 3RYRA 2ZABA 2EAKA 4N53B 3RS6A 4RHV2 1IS6A 1G9BA 2GNDA 4YW1A 3WW1A 3A0KA 3IWZA 2R1DA 5JSOA 1QY4A 3H7YA 2HEWF 2CY6A 1OQEA 4QD2A 1RGSA 4LA3A 4GA9A 4LE4A 4JDOA 4I0WB 1VBA2 3E6DA 3POSA 1PGW1 3WQ0A 1MR5A 4Y4YA 1CPMA 5BV6A 4X6QB 2FMYA 3FHIB 2NLRA 4NWVA 4HVOA 4PIXA 2WSUA 2K9ZA 3B00A 2PYTA 2XL9A 5ABJB 1CAWA 3KS7A 5H9QA 1NZCA 3B02A 3HMYA 1MQTB 4HL0A 2CGNA 1HRI2 4F83A 4CDWA 1LEDA 1N1YA 5JAXA 5JOXA 4AEJA 4BHPA 2VNRA 4GH4C 1CVNA 3W59A 3ALQA 3SXWA 4XQ4A 4L92A 1Q5OA 1LGBA 4GB32 4IEUA 3K51A 2JG8C 1QJX3 4R9AA 1CAVB 3URFA 4RQPB 3VN4A 1PIV3 2ZPXA 3VZOA 3SLIA 1VBB2 2VQ0A 1DZTA 3UKTA 4LNVA 4B3NA 1O3QA 3PMSA 2WT0A 1QOOA 4GIQA 5LEKA 5LK7B 1ND2A 1IOAA 2Q30A 2Y0OA 4QPIA 2MNGA 1H8TC 1OKQA 1CGPA 2WLQA 5T52A 3BCWA 1TNRA 4R8HA 2FBEA 1ZX5A 2A3YA 1R083 1PGL2 1Q8QA 3MICA 3J8F2 1ZBA2 2XJSA 5JSPA 1VBD3 1I1EA 2VECA 1PNFA 2RE9A 4YW4A 4FCAA 2XJQA 4ZU7A 1MS8A 4FPYA 1X36A 3KM5A 1URXA 1KJLA 3FUQA 1UN1A 1V70A 2NPIA 5BNPA 2AZ5A 2D7FA 2RS32 4M3CF 4XBLA 2PHXA 1W2UA 2GSYA 1EAH3 4IEZA 3VBSB 3MEPA 3U11A 1ONAA 2GNBA 4IV1B 4Y1ZA 2VOXA 4YZ4A 5FLHA 2WZPP 5A32B 3HWJA 1RUE3 3PHMA 1LHVA 1FOD1 4DINB 3VZLA 1LECA 4DPNA 5FQ0B 1S2KA 4AVCA 1RL3A 4IXLA 4MZUA 1ULFA 3RI9A 4AQ2A 1PVC1 3FWEA 2W68A 4R52A 2GMEA 2XH6A 1GZWA 5E89A 2UURA 2VU9A 1TNFA 3DL3A 5ACA2 3M3IA 4N53C 4MGKE 3JCIA 1FOD3 4K6BA 1TME2 2Z79A 2XLFA 4Q4Y2 4BIFA 4XMIA 1V00A 5DG2A 2XKPA 1QGLA 2CYFA 1WLTA 1PVC3 5BNQA 3DN7A 1AL0G 2GNMA 4WM7B 1FXZA 1N1VA 5AC92 2VOVA 1LOFC 1H9PA 1WW6A 4CP1A 1E57A 2QZ2A 5GKAC 4KGGA 4K40A 4BCUA 2P17A 2A6ZA 1HRV2 1AYM1 3NL1A 5JLVA 3RJ2X 3ZIWA 1UX6A 4AWDA 1R091 4E27A 5J3UA 1MZFA 1AR71 1LKNA 3N36A 4IQPA 3TWIA 4CDQC 1AXKA 2WA3A 1DZRA 2TUNA 4GKYA 3AM2A 4YVSB 3ZYRA 4QM8A 2HWF2 4FPLA 5DDJ3 3ZXDA 1LJ7A 1C1FA 1C5HA 4I09A 1QWRA 3B9IA 2SLIA 4LBMA 5D8AA 1K5MC 4WM8B 4AI2A 2NZ9A 4RSUA 1SLTA 5JSRA 1SEFA 3O0VA 1KXGA 3MPPG 3OCPA 4R4ZA 1AZDA 4XOGA 3H3ZA 1O7FA 2C0ZA 1WD3A 2YMZA 1YFWA 1N3QA 2VUAA 3ZXJA 1AR91 4Q27A 2BVBA 3AJYA 3OD0A 1EYBA 1LU2A 1QOTA 2BEOA 1UAIA 3OGGA 4COWA 1UIJA 3SITA 4YM0A 1RUC1 4AHWA 4NHKA 2BWCA 4TYSA 1AX1A 4FO9A 4A7ZA 4JDNA 2QCSB 2YROA 1ZBE1 2IXLA 3P3PA 1H4GA 1RMU1 3WZ1A 1AR93 1PMIA 2Z2SB 4AQ6A 4YW3A 3AKQA 1H1MA 1RUC3 3MPBA 4LBNA 2ZGUA 3SCHA 3WX5A 4AFMA 3U4XA 2JENA 2V09A 3ES4A 4MGYE 1VALA 2AUYA 2FZ1A 3CJXA 3OPZA 4IV1C 1AXYA 3ZXFA 3WV6A 1QJU3 4Q0VA 4A2UA 4AF9A 4R9DA 1ENQA 1OOPC 2DUOA 2EA7A 3ST7A 2X5IB 3J9SA 2RS53 1RUH2 4N7UA 3ZN6A 4XYXA 5J36A 5DUVA 3RQ0A 3UKVA 3FX3A 1HLCA 5L73A 1SQ4A 2QUOA 1IZ3A 2D5HA 1ZA4A 4YSFA 3WDVA 2EIGA 3TNQA 3CLPA 4AEDB 1MVEA 4Z92B 4UXAA 4IERA 1YI7A 4ES8A 1Y43B 4FTSA 2A3WA 3S30A 4G4FA 4C1WA 3AP4A 4QQPA 1CAUB 2NMNA 2UU8A 1BYHA 1LTEA 2YHJA 3QACA 4K9SA 4PIZA 3NV3A 1JYIA 5FAXA 4PCRA 4XHBA 5KHKA 3VZJA 3EQEA 4H7LA 4FBFA 4HSJA 3ZFFC 4IEXA 2R49A 4P9GA 2ET1A 1MVQA 1GSLA 3MIBA 4K21A 3W58A 4FPFA 5BNOC 3WHUA 1ZZBA 1WUVA 2AYHA 5GM0A 1RUF1 3IPVA 4NO4A 4KL1A 3FFQA 3A0NA 4ISRA 2IXJA 1JYCA 3VHPA 2VOKA 3CL1A 2K0GA 1F9KA 3I59B 2PLV2 2EAAA 4YVSC 4PBPA 3BIWE 4Y20A 3BU7A 3VKFC 3WHTA 3WDWA 3AK0A 1WCSA 1X82A 4AEMA 2QJVA 4RHV3 3VBRA 1G9DA 3D6EA 1GYKA 3ZYGA 1PK6C 3AB0A 4N9HA 4Y5Z0 1KFXL 2PA7A 4HMZA 3WP5A 2A73B 4JV4A 4XE9A 3SHRA 1S0EA 3KT7A 4YG6A 1B35C 2G4IA 4BYYA 2PHRA 1ZZ6A 1HRI1 1VBC2 2PN5A 3WG2A 1NXMA 4CP2A 1OI6A 4PDWC 2R6QA 1QMJA 4CZSA 1WW5A 3AZWA 4MSVA 1PZ9A 5CFCB 4A7KA 4Q0QA 1C3HA 5C33A 3VZKA 2D6MA 1PNGA 2RS12 1RJ8A 1ZZCA 4GB31 3ZVXA 4NHMA 4Y22A 2BWAA 5CB7A 1YUDA 1LHUA 3QD6A 1HRI3 2QDRA 4JRLA 5JI7A 2XWJB 3AMPA 2W08A 5JPNB 2B39A 1VBB1 2E7AA 2ZGOA 3IM0A 1T6GC 1ZNPA 2BBVA 4COVA 1W6PB 4C0BA 5I8TA 4GB33 3JUUA 4WVZA 3IKWA 3LA7A 5T55A 3TB0A 1F31A 1PGL1 1VBB3 1ENXA 2CWSA 2WL1A 1OQDA 4FT8A 3VL9A 2R042 1ZBA1 4XXAA 2ZHKA 3WG1A 1UIKA 1YFUA 1HDKA 1D2QA 3PLQA 5J98B 2VVEA 3VBFC 3OY8B 1YHFA 1DGWX 1TQ5A 2A75A 3O14A 3WP4A 4UW3A 2E7TA 4XEZA 3ZSEA 3B3QE 2GH8A 4CDXA 2P3KA 1FNZA 3J8F3 1DQ6A 5E8AA 1ZBA3 2RS31 4XJWA 1KJRA 3OF1A 1W6QA 5KXBA 5CFDB 2Z42A 2IWGB 2I74A 1H0BA 1ULGA 1JTZX 4KQ7A 1MZ6A 3H8UA 3THPA 2H0BA 3PMEA 4D3WA 1NA1B 2C9AA 2BVVA 2LM3A 2X8KA 4CEWA 5JZGB 2UYAA 5JI9A 2RS33 4HSLA 2GC1A 4I3GA 2B7YA 4CRQA 1PVXA 3CJIA 4NWWA 1BEV1 4YVWA 4BMEA 2HWE2 1V6KA 2ZGNA 2WIIB 1SDWA 5CG9A 1WW4A 3T1MA 1UW8A 1RTVA 3JU9A 3VBHB 4O9GA 5IK4A 1W6OB 3DPRA 5JDBA 1HIXA 3FFZA 3KT1A 5ACA1 4Q4V2 1FV2A 1C1LA 2ZZJA 1TME1 4LO4B 2GU9A 4Q4Y1 2ES3A 3FUOA 3FE5A 4XJ9A 3ZPYA 3H3UA 1DG6A 1BEV3 4AQSA 5J7MA 5JIUA 2ZHLA 2CGOA 4YNIA 4Y24A