3LSQA

Trypanosoma brucei seryl-trna synthetase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
467
structure length
431
Chain Sequence
MMVLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEAVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEALGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRGTAAQNVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPYMMGIEMIRFEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Ligase
molecule keywords Seryl-tRNA synthetase
total genus 149
structure length 431
sequence length 467
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3lsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3lsqA02
4K87A 3RKXA 5C51B 4EO4A 4J15A 2IY5B 4CH5A 2ZZGA 2ODRC 2ZIMA 5HGQA 3RL6A 4UP8A 1SESA 4TVWA 2G4CA 5C53B 3V7CA 1NJ2A 3V8KA 3RKYA 3HTZA 4HVCA 4KQEA 4G84A 3RF1A 1PYSB 2E1HA 2RHSB 3RGLA 4HWSA 2RHQB 2PMEA 3RKWA 4YRTA 4RQFA 1B7YA 4H2YA 3L4GB 4P72A 2QHSA 1ADJA 4Q6GA 1NJ8A 3LSSA 3TUPA 3WQZA 1WLEA 2DZ9A 3IKMB 3L1AA 1B8AA 4HWOA 4H02A 4HWPA 1YGBA 4RMFA 1NYRA 5E3IA 2DZCA 1X2HA 3PZCA 4TQDA 2Q7EA 2ZZEA 4UP7A 1HTTA 5ELOA 4H2XA 2ZCEA 4P3NA 4P71C 1ATIA 3P8YA 4P71A 4TVAA 3QO7A 1PYSA 2EL9A 2ARUA 1C0AA 4XU3A 4KR2A 3IG2A 4ZTZB 3RACA 4CS3A 1NJ6A 2DU7A 3V8LA 2Q5IA 2AKWB 1NNHA 4G85A 5F5WA 1X2GA 4CH6A 3LC0A 4CH3A 3CMQA 1IL2A 4P75C 2ODRD 2CJBA 1JJCA 2Q5HA 2DKGA 4YRNA 2ZXFA 2I4OA 1B70A 3V7SA 1YFSA 2E41A 2DTIA 2E5AA 1ADYA 2EJGA 1B70B 12ASA 3A31A 1WU7A 3FJPA 2ALYA 1SERA 4UPAA 3E9HA 1J5WA 2DVEA 1G5HA 3REXA 2I4NA 4H2UA 3IALA 2QHVA 3MF1A 2ZNJA 3NEMA 2ALYB 2EJ9A 2E64A 1NJ5A 3MF2A 1Z7NA 3TEGA 4HWRA 4XU2A 1ASZA 1EFWA 1W66A 4XTYA 4XU1A 4DQ2A 2I4LA 1QE0A 2ZTGA 1SETA 1H4TA 3BJUA 2ZT6A 4XEOA 4YYEA 3P8TA 3V8JA 3UGTA 2ZR3A 4BWAA 3V7RA 4XTWA 3HY0A 3TEHB 4HA8A 1WQ7A 4TQFA 1NYQA 4KR3A 1EIYA 3A7AA 3EFSA 4YRLA 5K1PA 3HFZA 1E24A 2DQ0A 4LNSA 3UGQA 3M4PA 1EIYB 5ELNA 2E10A 2ZZFA 2RHQA 2DU5A 3NELA 5KNNA 1G51A 2ZNIA 4OLFA 4P73C 1NJ1A 1X01A 4P72C 4Q15A 1BIAA 1N9WA 1EOVA 2CJ9A 4YREA 3HXYA 5K1XA 2IY5A 2C8MA 1H4QA 3ERRA 4WF2A 1KMMA 3A5ZA 1HXDA 2E65A 3DSQA 3PCOB 2XGTA 1YB3A 4YRMA 2DXUA 4CS4A 1WQWA 2QHUA 5C52B 3TEHA 2C7IA 3LSQA 1X56A 3QO8A 4ZIBA 3HY1A 4P74C 2RHSA 3HFZB 4TVAB 3UH0A 4YCUA 1YFTA 2P5IA 4YCVA 3A7UA 4X5OA 2J3MA 1EQRA 3VQVA 3M4QA 4EX5A 1EVLA 3REUA 2ZIOA 4P75A 3RUXA 1L0WA 3E9IA 1VQZA 1BBWA 3VQWA 3MEYA 1E1OA 1BBUA 3L4GA 1KMNA 2CIMA 3NENA 3HXUA 4DPGA 3HXWA 4TWAA 3UFGA 1X54A 3RIRA 4K88A 2EWNA 2CGHA 1QF6A 4BW9A 3R07A 2DQ3A 2EAYA 4ZTUB 4YRGA 2QHTA 4XTXA 4H2XB 1EVKA 2DEQA 4YRSA 2DTOA 4YRQA 4H2VA 1Z7MA 4YROA 1X55A 4YRFA 2Q7GA 3HFVA 4RQEA 1H4VB 2AKWA 1KOGA 4YRKA 4XTUA 3A32A 3KFUA 3HXZA 3A5YA 1GGMA 4CS2A 3I7FA 2DJZA 3VBBA 4H2WA 4XEMA 4PG3A 2AMCA 1RIQA 4XTVA 2EJFA 3L2ZA 2PMFA 3QO5A 4P73A 3IKLA 2ZT8A 2FYKA 2ZGWA 3HRKA 1FYFA 3HRIA 3HXVA 4YRCA 1B76A 4YRPA 2E3CA 4L87A 3QTCA 1USYA 1WYDA 4RDXA 3G1ZA 1JJCB 1SRYA 2ZT5A 4NCXA 11ASA 3EFRA 3P8VA 4YPFA 3A74A 3ICAA 2ARSA 1E1TA 2ZT7A 4WJ3M 2ARTA 2DDZA 4CH4A 4TVYA 3VQXA 2CJAA 4YP0A 4YRRA 2XTIA 3BFMA 4AH6A 4YDQA 2P0LA 3W3SA 2DTHA 4HWTA 4XTZA 1H4SA 3NETA 4P3PA 4PHCA 3PCOA 4K86A 2AMCB 1E22A 4XU0A 4P3OA 2DXTA 4TTVA 1YFRA 4WJ4A 2J3LA 1G5IA 4YCWA 3VQYA 1ASYA 3OD1A 4P74A 2HNIA 1WNLA 4WI1A 1LYLA 3HXXA 1HC7A 4OP0A 2ZR2A 3QNEA 1WPYA 4O2DA 1B7YB 1BIBA 2I4MA 3A7RA 2Q7HA 2ZINA 4E51A 4YRIA 4H2SA 4H2TA 1USYC 4UP9A 4YRJA
chains in the Genus database with same CATH superfamily
2EJ7A 1DF5A 1F23A 2N05A 1X59A 2Y48A 3LNMB 4PDMA 4WFHA 4OPHA 2A9HA 4ASUG 3T2MA 1FAFA 1RSOB 1Y4MA 3WG7B 2CTPA 2CE4A 2W0XA 5KA6A 5JVDB 2Y69B 3OUSA 4TVWA 3DXRB 2Q69A 1VQ9V 5C53B 5CB4B 3SJCC 3QVNA 4IHJA 1EZVH 3TETA 3K08A 2E1HA 3IFXA 1YTFD 1OCOC 3LUTB 4HWSA 2Q0AA 4I55A 2BSKB 2YIDA 1B7YA 4BW5A 4P72A 4O2BA 1DTOA 2QHSA 5C8YB 1O9HA 4WFFA 1IX9A 4MTOA 4YY3B 5IYCO 3SYPA 1Y74B 4X66B 3TGUH 4ZHQA 3H1KH 3PN1A 1E1RG 3IKMB 2QWNB 1XI1A 3QG5A 4HBNA 5IDJA 5E3IA 4IT5A 1QCEA 5BZBA 4DR3B 4LVKA 4J7JA 2DZCA 1JR9A 1BCCH 3PZCA 5EC1C 2OTLV 4OGQB 4FMTA 2XT9A 1OCZC 4LF8O 2ZZEA 1F4MA 2A7WA 4U3JA 2OWOA 2X6CA 3EVKA 2BTQB 4DR2O 4P3NA 3FFQA 3HPLC 2H94A 2JVDA 1UFIA 1WN7A 5TISZ 3CXCU 4P71A 4TVAA 5J2TB 3DTUB 4GZRB 2ARHA 4BIOA 1SQPH 4XU3A 1MZEA 3JATB 4KR2A 3CJHB 1HNWO 3BFRA 3ZHQA 1WAZA 1VQPV 2WLLB 1WA8B 1KB9F 1EFRG 1HNXB 2UU9B 3CRQA 3U0ZA 1EN5A 3JD1A 3V8LA 2ADQB 5F5WA 1V54C 4DUYB 2OIEA 4YHHB 1X2GA 2ITCC 4O4JA 2WSSG 3OTOB 3WG7C 2P7TC 5J9PC 5FNVA 2N04A 4DO2A 1KU9A 1R1BA 2RDCA 3E86A 1BHBA 5JQGA 4JI8B 5EBMC 1BS3A 2ILMA 5LBQA 5FNVB 4Z2WA 4JV5O 2DWEC 2EIJB 3MQZA 1TA8A 1IXBA 4HYOA 1B70B 4JI7B 3A31A 3BVOA 1SERA 5KHIA 2UUCO 2K9PA 3REXA 1SZXA 4J42A 3U10A 2QHVA 3MF1A 2ZNJA 1K34A 3ZS8C 3MHSC 2VQEO 3K04A 1WP7A 5EYPB 2E64A 1M90W 3TEGA 3K5NA 1NR1A 1ZX3A 2I4LA 3CB2A 1Z5VA 1SETA 1H4TA 3ZCCA 2ZT6A 1AVMA 1QHTA 4AILC 3ABMC 5FPOA 3V8JA 2NS6A 2ZR3A 1D5NA 3HKDA 4BWAA 3CX5F 2W6IG 1FXKB 4TWKA 2JJ1G 5LOVB 2XOKG 4TQFA 3JCUZ 1VQMV 3IC7A 3D3IA 1P7BA 3SYQA 1K9MW 1E24A 1DK1A 1Y67A 1SKVA 3HKCB 3JD3A 5E79Z 1IURA 5ELNA 4DYLA 1G1XB 2E10A 2ZKOA 2EIJC 2DU5A 3NELA 1OJHA 2CK3G 2Q73A 4OLFA 5LYJA 1X01A 1K73W 2E76B 5IJ0B 2WA3A 5KHKA 1QLNA 1XMQB 1EOVA 4LH7A 1LUVA 1L8DA 2JGDA 3F5WC 5L3BA 5K1XA 2Q68A 2IY5A 3MDSA 2C8MA 1H4QA 1PV0A 2OCHA 1GN6A 2LO1A 4WF2A 4JI3B 3DSQA 2E65A 2CGOA 5HFLA 4TSFG 2VWJA 3CWBH 1G8MA 4QPJA 4N23A 2WLJA 1QU7A 2DXUA 3OEHG 3E8FA 4XDLA 1ZSPA 1URFA 3TEHA 4FLVA 2DWDC 3F5TA 4DR6B 1PKXA 1U96A 1X56A 3QO8A 4J11A 4ZIBA 4UFZA 3BA8A 1GH6A 1AJQA 4JI3O 3UM7A 3JAKB 1GM8A 4CZZA 3UH0A 5B1NA 1YFTA 4DV0O 3AG4B 3A7UA 4YCVA 3VQVA 3OMNB 4LFCB 3REUA 5CBGA 4LVJA 2MW2B 2YC0A 1N0JA 2JRIA 1IBLB 2N74A 4DV6B 1BBWA 1NS1A 1FXVA 1PM9A 3VQWA 3ZN0A 3CSXA 3ZMSA 4DPGA 3O65A 1HP8A 2ZDIA 1YEWA 3T1YO 3APQA 2HG5C 1AR5A 1Y6XA 4PDLA 1XHZA 3K79A 4QIWF 2Q8VA 3IJ4A 1IBLO 3ZJZA 2DQ3A 4J9YB 4X9QA 4GT1A 3B09A 1F7YA 4YRGA 1EVKA 4GX2A 3BY6A 4ICGA 2V7QG 1N32O 4JAVA 3T1YB 4YRQA 3MAQA 1XDCA 4EFBA 3RT3C 3RYFB 1Z7MA 1GAXA 2HJFC 1AP5A 4YRFA 2QJ1A 3JSNA 1EBOA 2IU3A 5H5NA 1H4VB 2QSAA 2V4DA 3M7MX 2AKWA 4JI1B 1HNZB 1KOGA 3AK2A 4GCZA 4XTUA 1JVMA 4H44B 3KFUA 2HVJC 4YJ2A 4NXNB 1GGMA 2HP8A 4L8JA 5KA5A 3UKMA 4H2WA 4XEMA 2Y4TA 5H6QA 1M4UA 1RIQA 4YJ2B 1VIBA 4R7CA 4LC1A 3L2ZA 2HKOA 3QO5A 5IYZB 4JI5O 2DE0X 1VARA 3K3WA 4NTXA 1KQSU 1H2SB 5LMUO 3JAMN 2FMLA 3EFFK 2Y69C 3BPZA 2B1GA 5GTHZ 2ZT5A 4NCXA 11ASA 2XNDG 5CA1A 1VMGA 4YPFA 3AG1B 3FB6C 2JIZG 1AROP 1VQLV 3BAAA 1E1TA 2ZT7A 4MTGA 4WJ3M 1CP9A 2VWKA 3VQXA 3GB7C 1F51A 2LP7A 2YICA 3BHPA 5IY5B 3K03A 3GWKC 5B1BB 1T5EA 1F4NA 4JI8O 1RP3B 2RCVA 1ZWIC 4TV9A 4JZGA 4DV4O 1QVFU 4R6ZA 3W3SA 4DV0B 1H2KA 2LGWA 2DTHA 4J7KA 4HWTA 3K9AA 4FPPA 4QNHB 1TUBB 4MVZA 4K86A 4EB6B 4JI2B 2RQ6A 2AMCB 1E22A 4ZI7A 2QM8A 1V9PA 1US6A 4WJ4A 3KCXA 4UB8Z 1PNLA 2YI9A 4EB6A 4MVQA 2J3LA 4DV6O 4PA9A 1IBMB 1BT8A 1H2MA 1G5IA 3HKBA 3VQYA 1ASYA 3JALB 4CC6A 4DV1B 1WNLA 4ZOLA 4WI1A 1WPXA 1VQ7V 2CH7A 1WPYA 3AK1A 3A7RA 1NH2B 2LW7A 2P5OA 5IYDO 3LNNA 4J41A 4FVMA 3ZHSA 3SPHA 2FTKA 1Y76B 3ZRXA 2YSUB 4LF9B 4FK5C 1USYC 1I5YA 4EO4A 4LH6A 4K8ZA 2DYSC 3KCYA 4P9OA 1Y76A 2VQFB 4J15A 4CH5A 2ZZGA 4XDJA 1S3JA 3OD4A 5BR8B 4KUMA 5CB4A 1SQVH 1CXZB 3RYIA 2UXBO 2EBOA 1FXKA 3RL6A 1K92A 1RPOA 4W4KA 4JI1O 1HNZO 1UPGA 4IIJB 1SESA 3ABMB 3C90A 2YXYA 3SJQC 4JZ2A 1YSCA 3V7CA 3AG3C 2IW5A 1IXMA 3ZRVA 2FYUH 5EZYA 4B08A 3HKCA 1PYSB 2GDSA 4G2KA 4O2BB 2NN4A 4DR1B 3RGLA 3OT7A 3OUFA 3SPGA 3RKWA 4E2LA 4H2YA 3L4GB 1OHHG 3TXQA 4LVMA 1G6UA 4DUZO 2E74B 3ASOB 1VQOV 2MK3A 4G28B 3UCSC 3W7TA 4K35A 1FPOA 1QNMA 3TUPA 5DECA 3CCVV 3F7VC 4WFEA 4X20B 4NYKA 4GX0A 3ZRWB 2VRZA 3K0DA 1SQBH 4H02A 4X20A 5KUKA 3B8NA 3CRRA 3ZRWA 1ZTEA 3AK3A 4O4LA 3ZHUA 1K97A 2IM9A 1I0HA 4UCVA 2O57A 3J81N 1Q82W 3AG4C 4HNAA 1HTTA 2Y0PA 2LQTA 3APOA 2ZCEA 2WLMA 1NBMG 4IGGA 1RM1C 1TVKB 4UCSA 4HNAB 1XHXA 2AHZA 1C0AA 5CN0A 2R9AA 1GRJA 1PNMA 4I50A 1VP7A 5J2UA 1M93A 1JPXA 1M5IA 2YXHA 5LMNO 4JYYA 4GKJB 3IG2A 4ZTZB 5B1AC 5H6RA 4DV1O 4JI0O 1HR0B 2X0LA 4CS3A 1JOYA 2QKCA 4DR2B 2DU7A 4H37A 4G85A 2YIBA 4GYCB 3J80N 4ZI7B 4CH3A 4JI5B 3SDLA 1HNWB 3OGIB 3CMQA 3AG2C 2QEXV 2Q4PA 2P6JA 4JI6O 3ABKB 1EN6A 2QKAA 1K7DA 4LF9O 1B70A 2WLKA 3V7SA 3CS5A 4DV4B 2A0LA 4FFBA 4ZOLB 1XMOB 1SQFA 1XREA 5L3CA 4WFAV 12ASA 4AQYO 3FJPA 4JF3A 4JI2O 4UPAA 1N4CA 2IJIA 2QTOA 2I4NA 1M9NA 3OM3B 4JI6B 3FX7A 3C3TA 4UUJC 3K5LA 2ZXWB 2EJ9A 2BE3A 1Z7NA 4XU2A 3ABLB 1EFWA 4X66O 4OXSA 4QGPA 4NVPA 5B1BC 2UUBO 1I7FA 5D5PA 5KMGB 4DQ2A 2ZTGA 2YI8A 5AG2A 4UXNA 3P8TA 3X2QC 2GSMB 3U11A 3MD0A 5E1AC 1P4RA 4MTFA 4X65B 4PDRA 1FKAO 4HA8A 2ZXWC 2YS8A 3WB1A 4H13B 4YJ3B 5EBWC 1Q86W 2XAQA 2DJVA 1YDXA 4JI7O 3A7AA 3HFZA 4LNSA 1SF9A 3K5OA 5LYJB 4JV5B 3SPCA 3OMAB 1AJPA 2ZZFA 2RHQA 2A3QA 3E8BA 1G51A 1B6QA 1FFXA 3GWOA 3D36A 2YIAA 4UCUA 2CH7B 4JI4B 4JYCA 4H33A 3AG1C 1B06A 1YJNV 2NLJC 5LA6A 3ZEDA 3G71V 1Q8IA 5LMUB 3CCMV 3ERRA 3A5ZA 4X64O 4B3RO 1JCHA 2XGTA 4JI4O 4YRMA 2CTRA 4FLXA 3RWRD 2QHUA 4WBNA 3K9SA 5C52B 2EIKB 3W7XA 1JFFB 1Z5WA 3VOUA 5LOVA 2C7IA 1TUEB 1SQXH 1Q6IA 2RHSA 1Q3EA 3E8HA 2OIGA 5B66Z 2HJDA 5JJNB 4IIJA 1SS3A 5CMUA 3K58A 4X5OA 1BHAA 1EVLA 5EZYB 3Q4HA 3B77A 4P75A 3RUXA 1Q7YW 3N2GA 2F23A 4DV5B 5C93A 1E1OA 1BBUA 4JTDB 2RMKB 3L4GA 2CIMA 3NENA 1BMFG 2JS5A 4AQYB 2KSDA 4TWAA 3UFGA 1XNQB 3FAVB 2D2CB 3A2FA 2EWNA 5KLVH 1R6KA 3B8MA 3FKSG 1R6TA 3JD2A 4JYAB 2CGHA 1NZ6A 4LWSB 2HR3A 5LP6C 4H2XB 4I4TB 4LF8B 4LF5O 4MTXA 4YRSA 4DR6O 2VS0A 1NTMH 1M56B 4DK0A 4NXMB 2JS3A 4FLTA 1YJWV 1AI7A 1DF4A 3HFVA 4RQEA 1GN3A 5DM6V 4UVAA 1NR7A 3R65A 5KMGA 3A32A 4I50B 3SPIA 3HXZA 4NR1A 4RUFA 3CC2V 4Z1VA 1N36O 5L3FA 1I94B 4D7SA 2D3OW 3I56V 2OTJV 2EJFA 3H9VA 4P73A 2Z0AA 3IKLA 2ZT8A 1EZJA 3CC7V 3HRKA 3HXVA 4YRCA 1P7GA 3AEIA 2CGNA 1B76A 4B7EA 2NNUA 5ITZA 2AZ0A 3BA9A 4YRPA 2E3CA 1N36B 4L87A 1WYDA 4RDXA 3BABA 3G1ZA 3ZHVA 4MSWC 4X64B 4B3RB 1H2GA 4NB5A 3A74A 2HEPA 1MABG 3PJSK 4KHPO 3CE2A 2ARSA 4LVLA 2WLHA 4LFCO 4TVYA 2IH3C 4X1IB 3FYIB 2IBZH 1J5EB 2CJAA 2EZPA 4YP0A 1GN2A 4J10A 1WB7A 1D5AA 2QE7G 1OCCB 1MSWD 1YZBA 3DC5A 3R66A 3NETA 1R6NA 4DV2O 3ETGA 3T1HB 5HFMA 5FLXN 1GM7A 3FYEB 3HKBB 2C2AA 4TTVA 1JFFA 3JALA 5JVDA 2HVKC 1GK9A 3IC9A 2ZQMA 1FD9A 3J7AU 2DN9A 4TV8A 1KP2A 1WP8A 4PJ0Z 2JEXA 3LDEA 2PI5A 3SJAC 4FFBB 2GV9A 1HW7A 1S5JA 4Z1MG 4TV8B 2X7RB 2OT5A 1Q43A 3KKYA 2YEVB 4O2DA 4K8XA 1BIBA 2I4MA 4ABMA 1XNRB 5LHIA 2ZINA 4E51A 1N34B 1D2DA 4YRIA 1QLEC 4B3MO 3JD0A 4MVSA 4K87A 1YJ9V 3O9OA 2A06H 4B3SB 4JTCB 4TV9B 3RKXA 5C51B 1N0NA 3CRAA 1SA0A 3CRCA 5LA6B 2IY5B 1I5XA 3OTOO 4H0LB 2ODRC 2B5UA 4RWUA 1XBLA 5HGQA 4P30A 2DYRC 2XTAA 4NTWA 4UP8A 2QWRB 3CEIA 1WB8A 3TK1A 1IBMO 1TGOA 2BTQA 4D6TH 3RKYA 3HTZA 4HVCA 4KQEA 4G84A 4GX5A 3EHBB 2RHSB 2GTAA 4X1KA 5LGNA 2RHQB 2PMEA 3JAKA 1W0KG 4EEQA 4YRTA 4RQFA 3W7UA 4JGSA 1WA8A 1H2LA 5FPRA 4X1KB 2CTQA 1PL0A 2WAMA 4RO2A 4U3FH 3SYCA 3RYHB 5A2QN 3S3WA 2DZ9A 3I5DA 1KC8W 2E5LO 1B8AA 4MVUA 3JSLA 1LR1A 3RYHA 4HWPA 4RMFA 1XUQA 2EIMC 4JYAO 1Q6UA 4LF4B 3M99B 1N33O 3FAVA 2H3OA 4LBEC 4FM1A 2Z3YA 4TQDA 3SPJA 1H8HG 1K8AW 4UP7A 1V54B 2RNBA 5H2FZ 2GTSA 1S72V 3SR2C 5FL7G 2W0FC 5J2UB 3QO7A 2UXXA 1ZLZA 2Q0OC 2ARUA 3P3NA 3FB8C 1L0NH 2G38A 1OCCC 1PPJH 3BRCA 4I55B 3AG7A 3ZIAG 2QWPB 2PYJA 1KMIZ 1AP6A 1RM1B 1YTFB 4BIUA 4YY3O 4R8CA 1THZA 2AKWB 5IE9A 1NNHA 1LNQA 3IAYA 2F66C 2L35A 4PHZA 1MG1A 4ZBMA 4LF7O 4LFBB 2OYQA 5CA3A 5LMNB 5LHGA 4GKKO 1IL2A 5EIBC 2ODRD 3T4DA 2CJBA 1JJCA 2KQXA 2DKGA 2ZXFA 2AGAA 1K3EA 4PELA 2I4OA 1XOUA 2UXDB 5GTIZ 1JJ2U 3HKEB 1EM1A 4KXRA 1COWG 4TUYA 2EJGA 5ITZB 3OR7C 3CCSV 1WU7A 4LFBO 2GUZB 3CPWU 3JAWA 3T1HO 4LF6B 3CXHF 4DR1O 3E9HA 3RFRA 2BOCC 1BSMA 2DOSA 2P67A 5J2TA 3IALA 4P9PA 3SJBC 3NEMA 2K1EA 2UU9O 1NJ5A 3ZBHA 3MF2A 2QWQB 4HWRA 1ASZA 1AJNA 2QKSA 1W66A 2JJ2G 3E8GA 2IU0A 2Q67A 1SA0B 4FM0A 3AG3B 2A8EA 4UV9A 4YYEA 4DR7B 5L3GA 4TOIA 1Q5OA 1XL6A 3V7RA 4PA3A 3HY0A 4XTWA 1YIJV 1TUBA 2EJRA 4DUZB 3OMIB 4FLUA 1W0JG 2NR5A 1NYQA 5JQGB 4FLZA 2BOBC 2LFSA 3D8CA 4YRLA 1KKCA 3OEEG 2DQ0A 3E83A 3M4PA 4DR5O 1FFXB 1EIYB 1A32A 4LF4O 2B9ZA 1M57C 2BCCH 4UCOA 3UT5B 3JCZA 3ETDA 1MZFA 5IWAB 5KNNA 1W2BU 5EK0A 2P06A 4P73C 4LNUB 1FFTB 3FD9A 3ABKC 1S77D 4RUEA 4N21A 4KL1A 1BIAA 2Z5UA 1N9WA 1BQZA 2CJ9A 2IH1C 1P49A 3STZC 2QM7A 3MHHC 4A5UB 4I5SA 1S76D 1ENVA 1VQ5V 3E35A 4FJCC 5D5QA 3NXSA 5L3DA 3CMEV 4F4LA 5L3EA 1YB3A 1HWYA 3DXRA 3CCRV 5EIBD 2UXBB 2DYSB 4X89A 4JI0B 1NTKH 3RGBA 3HY1A 4P74C 3HFZB 3L75H 4YCUA 4O2AA 5C8YA 1EQRA 2ATKC 3L70H 1QQCA 3M4QA 1U97A 3L9DA 4DV2B 2ZIOA 2YEVA 1XMQO 4XBFA 3B4SA 4HT4A 1L0WA 1V55B 1FYJA 4DRXA 3MEYA 3A8TA 5JCOC 4DV7O 5JCOA 5KHHA 1AI4A 1XEQA 2UXCB 3HXUA 3HXWA 3OR6C 1E1QG 3S3XA 3E22B 1NKDA 1X54A 3RIRA 4NXNO 1NJIW 1VEWA 4MT8A 1JQ0A 2IJHA 2M7WA 3JASB 2HLDG 1YI2V 4PDVA 3ZN1A 4X8AA 1ORQC 3R07A 1AR4A 2EAYA 4FLWA 3L71H 2QHTA 5GONA 2WA4A 4XTXA 5BMVB 3W7SA 1N34O 4I7ZB 3B2EE 3GVMA 3SYAA 2DTOA 4O4IA 2ADPA 4B3SO 3CD6V 2XUMA 4YIPA 3THOA 2XAJA 2Q7GA 4O4HB 1YXBA 1KECA 1IDSA 2ZD9A 4FZ1A 4QJFB 1G4YB 3CCUV 4JAAA 2P90A 4O4HA 4TT3G 4B3TO 3ZMUA 4YRKA 1HR0O 4GLXA 2ZM6O 2JEUA 4OX9O 4P2ZA 2ZE8A 3A5YA 2OCCB 4CS2A 1M56C 2KG7B 2VQFO 2JDIG 1PNKA 3VBBA 1TAEA 4R50A 4PG3A 1VF7A 1BGYH 3HB3B 2PMFA 4DV3O 3WU2Z 2FYKA 1WPBA 1QLEB 2ZGWA 5BR8O 3HRIA 3CCLV 3P30A 2XAHA 2L6LA 5LP6A 4JASA 3QTCA 3LSUA 3AG2B 2FB5A 1MSDA 1JJCB 2F4VO 4DK1A 3EFRA 3P8VA 2XAFA 4I0XA 2LJ2A 4WCEV 3ABUA 3CRMA 3ICAA 4UCTA 3RW0A 2H8PC 4CH4A 3RVYA 4DR4B 5CA0A 3JD4A 3DC6A 4YIOA 4GKKB 5CBHA 5F2VO 2VQEB 1N33B 4YRRA 3ZRSA 3BFMA 1VQ8V 4AH6A 4YDQA 4DXWA 1X4TA 2JGUA 1YITV 3FB7C 1R3JC 2P0LA 1JX9A 3TXSA 2GBOA 1GM9A 1KD1W 1L0LH 5LL6Y 5DEDA 4KP4A 3HKDB 4MS2A 1H4SA 4PHCA 1I94O 3PCOA 2FL4A 5BXZA 3ASNB 2RN9A 5LGUA 3UO3A 4XU0A 4DW1A 4P3OA 3RYIB 1OCZB 3D36C 1YFRA 1UJWB 1OCRC 4HZ3A 5IY5C 4LF5B 2EINC 2QGNA 3OD1A 2EINB 4P74A 3L74H 4J7ZA 3G6BA 2EULA 3HXXA 4DUYO 4O2AB 1HC7A 4OP0A 4PA7A 3HR0A 1MOFA 3ICXA 2GUZA 4MVOA 1B7YB 1H2NA 4EFEA 3I55V 1ZL8A 2KB1A 5GW7A 5JH7B 3ETQA 4H2SA 1OV9A 1N8RW 4G27B 1YF2A 3ZMTA 1R3LC 3CHXA 5LXTA 1VQNV 3L73H 4PA4A 2AHYA 3E22A 3P32A 4MW3A 2AXTZ 4DR5B 2QR4A 3A0BZ 4BIZA 2QM4A 2PTMA 3D3QA 3K06A 3H01A 2PGGA 2R9RB 4WFGA 2XAGA 2ZIMA 5KAIZ 4OPAA 4UCRA 3ABTA 3A0HZ 2M6YA 3G67A 4CBCA 2ZM6B 4OX9B 2G4CA 2CUGA 4LFAO 1RSOA 1NJ2A 3V8KA 2Y4UA 1CPYA 1GN4A 2E75B 1KBHA 1QR9A 3RF1A 4DV3B 4K3AA 1M57B 1PL4A 3UT5A 2ITDC 4DW0A 2LFRA 2RJZA 1ADJA 2ODMA 4DR3O 4Q6GA 4LFAB 3Q4HB 1LUWA 4DV7B 1NJ8A 3LSSA 3WQZA 1WLEA 3N2GB 1SC5B 2UUAB 2KG7A 4Q20A 1PD3A 3CC4V 3OGCC 4GKJO 3B40A 1AI6A 3G80A 1BQ0A 1VF5B 3L1AA 4IYHA 3STLC 4HWOA 1NU1H 1YGBA 3X2QB 1NYRA 4LVIA 4B7KA 4FLYA 4IL6Z 4I9WA 2EILC 4YXWG 5B3SB 2AZ2A 4IYIA 4XDKA 5LGTA 1XILA 2YUAA 1HDJA 3TCUA 4MW8A 1X2HA 2UUAO 3L72H 1XMOO 1I08A 4UV8A 1Q81W 1NQTA 2DYRB 1NVPD 4U7NA 2EX3A 4JAUA 3ABLC 3LDCA 2Y0IA 2Q7EA 5IJ9B 2QWOB 5ELOA 3OTFA 4X62O 1YHQV 4H2XA 5BMVA 3BCCH 1O9GA 5B1OA 4P71C 2DMXA 1ATIA 4AI8A 4WF9V 3P8YA 1RPRA 1PYSA 2EL9A 1FXHA 2F1MA 4YHHO 1FS0G 3ZHRA 2A79B 3F7YC 3SYOA 4QE9A 1MA1A 3K0GA 4JYBA 1Q90D 5KAFZ 5KX5A 2CAZC 3RACA 3K57A 1NJ6A 1VQ4V 3LDDA 2P4VA 2QTSA 2Q5IA 4QPKA 2LW1A 4GUNA 2UUBB 3CP1A 1KYOF 3OFNG 4CH6A 2ZE7A 3T4ZA 4FFKA 3LC0A 1JA8A 3JASA 2UXNA 2WWWA 4F6EA 1XNRO 4P75C 1DLBA 2BTOA 2Q5HA 4O4LB 1R73A 3HKEA 4YRNA 4LP8A 5CA1B 1Y66A 3ZHTA 2AW9A 1YFSA 3ML0A 2E41A 2DTIA 2XHBA 1MMMA 4LR3A 2E5AA 1ADYA 4J80A 5LP6B 4AHCA 4EKWA 3CMAV 1S5HC 1IBKO 4O4IB 5KUMA 2P4KA 4ZKIA 2ALYA 3CCQV 1J5WA 2DVEA 4QE7A 4DR4O 1G5HA 3RN4A 5IJ0A 4H2UA 1Q6HA 3KZIZ 2EZOA 3H1JH 2HHHB 2ALYB 4DV5O 1FXKC 4UVCA 2P22C 2XASA 3A0RA 4C7UA 4NTYA 4F6RB 1N32B 1IZ3A 3ZX6A 4XTYA 4XU1A 2ZT9B 1IBKB 1QE0A 3DGEA 4JTAB 2V1DA 4KFMA 1S5LZ 3W7WA 3BJUA 2EILB 4XEOA 4F6RA 1E79G 1RFYA 3ETEA 4PA6A 3UGTA 1K5SA 1QVGU 3BEHA 2IJJA 3TEHB 1VQ6V 4LCUC 1WQ7A 2R70A 3ASNC 2PI4A 1GKFA 4KR3A 1YCIA 1EIYA 4MVMA 3EFSA 3WFVA 3ASOC 5K1PA 4IHJB 3UGQA 2ZDIC 3CCJV 4TUYB 3JYCA 4I0XB 1J95A 2ZNIA 1WJZA 3JAWB 2B1IA 1FJGB 1NJ1A 4JPRA 4P72C 1QR8A 4Q15A 1YVWA 1P84F 1KKDA 1WNSA 4X1YA 1Z2GA 4PD4F 4X88A 4YREA 1V55C 3HXYA 2ZE5A 1KUQA 1R3KC 4X1YB 2Q6AA 5BY1A 1NH2D 1M1KW 1KMMA 1R3IC 1FJGO 1HXDA 1XQ8A 2GHYA 1H8EG 1GO3F 1VQKV 3PCOB 1OCRB 1H38A 4CS4A 4PI2A 3G4SV 1WQWA 3IGAC 2QA4V 3M8AA 3P3PA 3RBZA 3CCEV 1AB3A 4I4TA 4X65O 3EXAA 1SQQH 3LSQA 5JJEB 2UXDO 3C3SA 4YJ3A 3K5MA 3N2KA 4MVRA 3RYFA 4UVBA 2HFEC 4TVAB 1OZ0A 2IJKA 2F43G 3N2KB 2P5IA 1K5QA 2J3MA 4EX5A 4LF7B 3JATA 3RVZA 3RYCB 1MNGA 3E9IA 1NVPB 1VQZA 5JH7A 1K4DC 3RYCA 3E2EA 1BL8A 1KMNA 5CBFA 2E5LB 5LXTB 2X6BA 2JK5C 1NTZH 3N27A 1L1FA 1JJOA 3E89A 5IYZA 4K88A 5JWPA 4LF6O 5KHGA 4UB6Z 1QF6A 5GONB 4BW9A 2R72A 5EC2C 1W59A 1IVSA 2PF4E 2DW4A 3NR7A 4FIPC 2R9IA 4WBNB 4U3JB 4ZTUB 4FZ0A 4BAYA 3OW2U 5IT9N 2EIKC 2Q5ZA 1TVKA 4KHPB 2DEQA 1GMGA 2WPDG 2PY5A 3UO2A 5IYBO 1XL4A 1ROPA 4H2VA 1AI5A 4YROA 4U7OA 3T1CA 3CJHA 5IJ9A 5IWAO 3K59A 1X55A 2WLIA 4RAIA 4BR6A 4DR7O 3ZMVA 2X6AA 3TJTA 2CDYA 3OAAG 5EYPA 3QF7A 5EBLC 1VF6C 3FB5C 2BSKA 2W6JG 2WLIB 5KHJA 5LHHA 2UXCO 2YDEA 4GX1A 4DRXB 1EN4A 1ZAUA 3KG2A 1XNQO 1Y74A 1NI8A 1QBZA 5DN6G 3I7FA 4ZHQB 2DJZA 4X62B 5KX5B 2AMCA 3H1HH 4XTVA 2PZSA 2F95B 1SZTA 1B3QA 1SQGA 4WFBV 3UQ8A 2HHHO 1AILA 2F93B 2OCCC 1FYFA 4NKGB 4LWSA 5B5EZ 1USYA 1BE3H 3OE7G 4NXMO 2Q9LA 1SRYA 3G6EV 1NT2B 5CA0B 1DGSA 1B04A 2YIBD 4W4LA 2FKXA 2ARTA 2DDZA 1K33A 1K4CC 5B3SC 2UUCB 4HAMA 1VF6A 2EIMB 2QDOA 5B1AB 2ZE6A 2LGQA 2XTIA 5H9CA 2ETNA 3WB0A 2WLLA 5JJJB 4B3TB 4B3MB 4E4EA 1PP9H 2CTWA 4XTZA 4P3PA 1AR1B 3JARA 1ZUQA 1JMKC 3WB2A 2KKWA 4O4JB 4FM2A 2DXTA 1OCOB 2PYLA 4D7TA 1CEZA 3JARB 4K0KB 4J9ZB 2F4VB 2PUSA 4YCWA 3CYOA 1HNXO 4CC5A 5A9GA 2HNIA 1LYLA 3ZMZA 1S0VA 4I9QA 2YXLA 1ZL8B 2ZR2A 3QNEA 1GTOA 4PV1B 1BZKA 4K0KO 1KP3A 2JGDB 3SGIA 2Q7HA 4X1IA 3H1IH 1J5EO 4H2TA 2WLNA 3H1LH 4PI0A 4LNUA 4UP9A 4YRJA
chains in the Genus database with same CATH topology
4MVSA 2DYSC 1R3LC 3ZMTA 1YJ9V 1VQNV 1DF5A 1F23A 4PA4A 4P9OA 2AHYA 3P32A 4JTCB 4MW3A 3RKXA 4BIZA 5C51B 4EO4A 2Y48A 3LNMB 4J15A 4PDMA 2IY5B 1I5XA 4WFHA 4CH5A 2ZZGA 2A9HA 4XDJA 3K06A 3H01A 2R9RB 4WFGA 4ASUG 3T2MA 1S3JA 2XAGA 2ODRC 2B5UA 2ZIMA 3ABTA 1Y4MA 4KUMA 3WG7B 5HGQA 4P30A 2EBOA 2DYRC 1FXKA 3RL6A 1K92A 1RPOA 5KA6A 4UP8A 4CBCA 2Y69B 1SESA 3OUSA 4TVWA 3ABMB 3SJQC 2G4CA 2Q69A 1VQ9V 3TK1A 5C53B 1YSCA 3V7CA 3AG3C 2IW5A 1NJ2A 3V8KA 1IXMA 3ZRVA 1CPYA 3RKYA 3HTZA 4HVCA 4KQEA 4G84A 1QR9A 3RF1A 3TETA 1PYSB 3K08A 4G2KA 4GX5A 2E1HA 3IFXA 1YTFD 3EHBB 1OCOC 2RHSB 3RGLA 3LUTB 4HWSA 1M57B 5LGNA 3OUFA 2RHQB 2PMEA 2ITDC 1W0KG 3SPGA 3RKWA 4E2LA 4RQFA 2LFRA 4YRTA 3W7UA 1B7YA 4BW5A 3L4GB 1OHHG 4H2YA 4JGSA 1DTOA 1ADJA 2QHSA 4P72A 4LVMA 4Q6GA 4WFFA 3ASOB 4MTOA 1VQOV 2MK3A 4G28B 1PL0A 5IYCO 3W7TA 1NJ8A 3SYPA 2WAMA 3LSSA 4RO2A 3TUPA 3WQZA 1WLEA 3SYCA 3CCVV 3F7VC 4WFEA 4Q20A 1PD3A 3CC4V 1E1RG 3OGCC 2DZ9A 1KC8W 1AI6A 4GX0A 3ZRWB 3IKMB 3L1AA 3STLC 3K0DA 1B8AA 4HWOA 4MVUA 4H02A 1YGBA 4HWPA 4P71C 3X2QB 4RMFA 3HY0A 1NYRA 5IDJA 5E3IA 4LVIA 5KUKA 2EIMC 1QCEA 3B8NA 5BZBA 3M99B 4I9WA 2EILC 3ZRWA 4YXWG 5B3SB 4LVKA 4XDKA 5LGTA 1K97A 3TCUA 2DZCA 4MW8A 1X2HA 3PZCA 5EC1C 4LBEC 2OTLV 4UV8A 1Q81W 1NQTA 2DYRB 4FMTA 1NVPD 4U7NA 1OCZC 2Z3YA 4TQDA 4JAUA 3ABLC 3SPJA 1H8HG 3TEHB 3LDCA 1Q82W 1K8AW 2ZZEA 4UP7A 1V54B 2Q7EA 3AG4C 1F4MA 1HTTA 5ELOA 1S72V 2X6CA 1YHQV 4H2XA 2ZCEA 4P3NA 2WLMA 5B1OA 3HPLC 1NBMG 2H94A 2W0FC 5FL7G 4WF9V 1RM1C 3CXCU 1ATIA 3P8YA 4P71A 4TVAA 1RPRA 3QO7A 2UXXA 1PYSA 2EL9A 1FXHA 2ARUA 2AHZA 3DTUB 1C0AA 4XU3A 3FB8C 1FS0G 1OCCC 5CN0A 2A79B 3F7YC 4KR2A 1PNMA 3SYOA 4QE9A 3ZIAG 1JPXA 3K0GA 1VQPV 4JYBA 2WLLB 4UP9A 3IG2A 4ZTZB 5B1AC 5H6RA 1EFRG 2X0LA 1RM1B 3RACA 4CS3A 1JOYA 1YTFB 1NJ6A 4BIUA 3JD1A 1VQ4V 4R8CA 3LDDA 2DU7A 3V8LA 2Q5IA 4H37A 1THZA 2AKWB 4QPKA 1NNHA 1LNQA 4G85A 1V54C 5F5WA 3CP1A 1X2GA 3OFNG 1MG1A 2ITCC 2WSSG 4ZBMA 4CH6A 3T4ZA 3WG7C 3LC0A 4CH3A 2P7TC 5J9PC 3CMQA 5CA3A 3AG2C 5LHGA 2UXNA 2WWWA 4DO2A 4P75C 1IL2A 2QEXV 1DLBA 3E86A 3T4DA 2CJBA 1BHBA 1JJCA 2ODRD 2P6JA 2Q5HA 1R73A 2DKGA 3ABKB 4YRNA 4LP8A 5EBMC 1K7DA 2ZXFA 1K3EA 4PELA 5LBQA 1B70A 2I4OA 2WLKA 3V7SA 1Y66A 1YFSA 2A0LA 3ML0A 2E41A 2DTIA 2DWEC 1JJ2U 2E5AA 2EIJB 1ADYA 3MQZA 2EJGA 1COWG 5L3CA 4HYOA 4WFAV 3OR7C 4EKWA 12ASA 3CMAV 1S5HC 3CCSV 1B70B 1WU7A 3A31A 5KUMA 3CPWU 3FJPA 4JF3A 4ZKIA 1SERA 2ALYA 3CCQV 3E9HA 4UPAA 1J5WA 2DVEA 4QE7A 2IJIA 2BOCC 2QTOA 2P67A 1G5HA 1M9NA 3OM3B 2I4NA 4H2UA 3REXA 4UUJC 3IALA 4P9PA 2QHVA 3MF1A 2EZOA 2ZXWB 1K34A 2ZNJA 3NEMA 3MHSC 2ALYB 3K04A 2EJ9A 1FXKC 2E64A 2K1EA 4UVCA 1M90W 1NJ5A 3MF2A 4WJ3M 1Z7NA 3TEGA 4HWRA 4XU2A 2XASA 3ABLB 3A0RA 1ASZA 1EFWA 1AJNA 2QKSA 1W66A 4OXSA 1NR1A 5B1BC 2JJ2G 4XTYA 4XU1A 4DQ2A 2I4LA 3E8GA 3DGEA 1QE0A 2ZTGA 2IU0A 2Q67A 1SETA 2V1DA 4JTAB 4KFMA 3W7WA 3ZCCA 1H4TA 3AG3B 3BJUA 2EILB 4UXNA 2A8EA 2ZT6A 4UV9A 1E79G 4XEOA 4YYEA 3ABMC 3P8TA 3ETEA 4PA6A 3V8JA 2NS6A 3X2QC 5L3GA 3UGTA 2GSMB 2ZR3A 4BWAA 1K5SA 1XL6A 3MD0A 1P4RA 3BEHA 4MTFA 4PA3A 2IJJA 2W6IG 5E1AC 1YIJV 1QVGU 1VQ6V 4PDRA 1FXKB 2EJRA 4LCUC 4TWKA 4HA8A 1WQ7A 2JJ1G 3ASNC 2ZXWC 2PI4A 2XOKG 3OMIB 1GKFA 4TQFA 1W0JG 1NYQA 1VQMV 3IC7A 3D3IA 2BOBC 2XAQA 2LFSA 1P7BA 5EBWC 3SYQA 1Q86W 1EIYA 4MVMA 3A7AA 3EFSA 4YRLA 3OEEG 3ASOC 3WFVA 1K9MW 3HFZA 1E24A 2DQ0A 5K1PA 4LNSA 3E83A 3UGQA 4K87A 3JD3A 3M4PA 1EIYB 5ELNA 2ZDIC 3CCJV 3SPCA 3OMAB 1M57C 3JYCA 2E10A 1AJPA 2ZZFA 2EIJC 2RHQA 3JCZA 3ETDA 3NELA 2DU5A 2CK3G 3E8BA 1G51A 1B6QA 1J95A 1W2BU 5KNNA 2ZNIA 5EK0A 4OLFA 4P73C 2B1IA 3GWOA 1NJ1A 1X01A 1K73W 4JPRA 4P72C 1FFTB 1QR8A 3D36A 3ABKC 4Q15A 1S77D 4RUEA 4N21A 1KKDA 1QLNA 1BIAA 2Z5UA 4JYCA 1N9WA 4X88A 1EOVA 2CJ9A 4H33A 2IH1C 4YREA 3AG1C 1V55C 3F5WC 3HXYA 3STZC 5L3BA 2QM7A 1YJNV 3MHHC 2NLJC 2Q68A 5K1XA 3G71V 2IY5A 2C8MA 1H4QA 1R3KC 4I5SA 2Q6AA 3CCMV 1S76D 1ENVA 3ERRA 1VQ5V 1NH2D 3E35A 4FJCC 4WF2A 1M1KW 1KMMA 3A5ZA 4KR3A 3V7RA 1R3IC 3NXSA 1HXDA 2E65A 3DSQA 5L3DA 2GHYA 5HFLA 1H8EG 1JCHA 4TSFG 4F4LA 1GO3F 3CMEV 1VQKV 2XGTA 3PCOB 1OCRB 1G8MA 4QPJA 5L3EA 1YB3A 1HWYA 4N23A 1H38A 2WLJA 2DXUA 4CS4A 3OEHG 3G4SV 4YRMA 1WQWA 3E8FA 3IGAC 4XDLA 2QA4V 2QHUA 3CCRV 5C52B 2EIKB 3RBZA 3W7XA 3CCEV 3TEHA 2DWDC 2DYSB 3VOUA 2C7IA 3LSQA 1PKXA 1X56A 3QO8A 4X89A 4ZIBA 1TUEB 3HY1A 4P74C 1AJQA 4MVRA 2RHSA 3E8HA 4UVBA 2HFEC 3UM7A 3HFZB 1GM8A 4CZZA 4TVAB 3UH0A 4YCUA 5B1NA 5CMUA 1OZ0A 1YFTA 2IJKA 2F43G 3AG4B 2P5IA 3A7UA 4X5OA 1K5QA 4YCVA 2J3MA 1EQRA 3VQVA 2ATKC 3M4QA 1BHAA 4EX5A 3OMNB 1EVLA 3REUA 2ZIOA 2YEVA 5CBGA 4XBFA 4LVJA 3B77A 3RVZA 4P75A 3RUXA 1Q7YW 4HT4A 1L0WA 1V55B 3E9IA 1NVPB 1VQZA 5C93A 1BBWA 3VQWA 1FXVA 3MEYA 1E1OA 1BBUA 4JTDB 1K4DC 3ZN0A 3E2EA 1AI4A 3L4GA 1BL8A 1KMNA 3ZMSA 2CIMA 5CBFA 1BMFG 3HXUA 3NENA 4DPGA 3HXWA 3OR6C 4TWAA 2X6BA 3UFGA 1E1QG 2JK5C 2ZDIA 1NKDA 1L1FA 1X54A 3RIRA 3E89A 1NJIW 4MT8A 2HG5C 4K88A 2EWNA 4PDLA 1JQ0A 1R6KA 2IJHA 2M7WA 2HLDG 3B8MA 3FKSG 3K79A 4QIWF 3JD2A 4PDVA 3ZN1A 4X8AA 1YI2V 2CGHA 1QF6A 1ORQC 4BW9A 3R07A 5EC2C 3ZJZA 2DQ3A 4J9YB 2EAYA 2DW4A 4GT1A 4FIPC 2R9IA 4ZTUB 4YRGA 2QHTA 4XTXA 2HR3A 4BAYA 1EVKA 4GX2A 3BY6A 3W7SA 2EIKC 3OW2U 4H2XB 2V7QG 4MTXA 2DEQA 4YRSA 4JAVA 1GMGA 2WPDG 3SYAA 2DTOA 4YRQA 5IYBO 1XL4A 1M56B 1ROPA 4H2VA 1AI5A 1Z7MA 4YROA 3CD6V 4U7OA 3T1CA 2HJFC 1YJWV 1X55A 4YRFA 2WLIA 4RAIA 2XAJA 2Q7GA 3ZMVA 1AI7A 1DF4A 2X6AA 3HFVA 3OAAG 4RQEA 1KECA 1EBOA 2IU3A 2ZD9A 5EBLC 5DM6V 3FB5C 1H4VB 2W6JG 2WLIB 4QJFB 1G4YB 5LHHA 3CCUV 2P90A 4TT3G 4GX1A 4UVAA 2AKWA 1KOGA 1NR7A 3ZMUA 4YRKA 3R65A 4GCZA 3A32A 2JEUA 1JVMA 4XTUA 3KFUA 3KG2A 4P2ZA 2HVJC 3SPIA 3HXZA 3A5YA 4RUFA 1GGMA 3CC2V 2OCCB 4CS2A 1QBZA 1M56C 5DN6G 3I7FA 5L3FA 2JDIG 2DJZA 1PNKA 3VBBA 2D3OW 5KA5A 3UKMA 4H2WA 4XEMA 5H6QA 4R50A 4PG3A 2AMCA 1RIQA 3I56V 2OTJV 4XTWA 4XTVA 1SZTA 3HB3B 4R7CA 4LC1A 2EJFA 2HKOA 2PMFA 3L2ZA 3QO5A 4P73A 3IKLA 4WFBV 2ZT8A 3K3WA 2FYKA 1EZJA 3CC7V 1QLEB 2ZGWA 3HRKA 1KQSU 2OCCC 1FYFA 3HRIA 3HXVA 4YRCA 3AEIA 3CCLV 1B76A 3P30A 2XAHA 2NNUA 4YRPA 2E3CA 4JASA 4L87A 3QTCA 1USYA 3AG2B 1WYDA 4RDXA 3EFFK 3OE7G 2Y69C 3G1ZA 2B1GA 1JJCB 4MSWC 1SRYA 2ZT5A 4NCXA 3G6EV 11ASA 1H2GA 3EFRA 2XNDG 3P8VA 2XAFA 4YPFA 3A74A 3PJSK 1MABG 4WCEV 3ABUA 3AG1B 3FB6C 2JIZG 1AROP 3ICAA 1VQLV 2ARSA 4LVLA 1E1TA 2WLHA 3RW0A 4MTGA 2H8PC 2ZT7A 1CP9A 2ARTA 2DDZA 1K33A 1K4CC 3RVYA 5B3SC 2IH3C 4TVYA 3VQXA 3JD4A 4CH4A 3GB7C 1F51A 2LP7A 3FYIB 4HAMA 2EIMB 5IY5B 3K03A 2CJAA 5B1AB 5CBHA 5B1BB 2EZPA 4YP0A 1F4NA 4YRRA 3ZRSA 2XTIA 3BFMA 1VQ8V 4AH6A 5H9CA 4YDQA 4DXWA 1ZWIC 1YITV 3FB7C 2WLLA 1R3JC 2QE7G 1JX9A 1OCCB 2P0LA 1QVFU 1MSWD 4R6ZA 1GM9A 1KD1W 3W3SA 2DTHA 4HWTA 3K9AA 4KP4A 4FPPA 4MS2A 4XTZA 4QNHB 1H4SA 3NETA 1R6NA 4P3PA 4MVZA 1AR1B 3ETGA 4PHCA 3PCOA 4K86A 5HFMA 2AMCB 3ASNB 1E22A 5LGUA 1GM7A 4XU0A 3FYEB 2QM8A 4P3OA 2DXTA 2C2AA 4TTVA 1OCZB 1YFRA 1OCOB 4WJ4A 1PNLA 1CEZA 4MVQA 2HVKC 1UJWB 1GK9A 2J3LA 1OCRC 4HZ3A 5IY5C 4J9ZB 2ZQMA 4PA9A 1G5IA 1KP2A 2EINC 4YCWA 3VQYA 3CYOA 1ASYA 3OD1A 2EINB 2JEXA 3LDEA 2PI5A 2HNIA 4P74A 1WNLA 4WI1A 1WPXA 1LYLA 1VQ7V 3ZMZA 3HXXA 4Z1MG 1S0VA 1HC7A 4OP0A 4PA7A 2X7RB 2ZR2A 3QNEA 1GTOA 2OT5A 1MOFA 1WPYA 2YEVB 4O2DA 4MVOA 1B7YB 1BIBA 2I4MA 1NH2B 3A7RA 1KP3A 5IYDO 2Q7HA 3I55V 5LHIA 2ZINA 2KB1A 5GW7A 4E51A 3SPHA 2FTKA 4YRIA 1QLEC 3ZRXA 4H2SA 4H2TA 2YSUB 2WLNA 3JD0A 4FK5C 1USYC 1N8RW 1I5YA 4YRJA 4G27B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K87 A;  3RKX A;  5C51 B;  4EO4 A;  4J15 A;  2IY5 B;  4CH5 A;  2ZZG A;  2ODR C;  2ZIM A;  5HGQ A;  3RL6 A;  4UP8 A;  1SES A;  4TVW A;  2G4C A;  5C53 B;  3V7C A;  1NJ2 A;  3V8K A;  3RKY A;  3HTZ A;  4HVC A;  4KQE A;  4G84 A;  3RF1 A;  1PYS B;  2E1H A;  2RHS B;  3RGL A;  4HWS A;  2RHQ B;  2PME A;  3RKW A;  4YRT A;  4RQF A;  1B7Y A;  4H2Y A;  3L4G B;  4P72 A;  2QHS A;  1ADJ A;  4Q6G A;  1NJ8 A;  3LSS A;  3TUP A;  3WQZ A;  1WLE A;  2DZ9 A;  3IKM B;  3L1A A;  1B8A A;  4HWO A;  4H02 A;  4HWP A;  1YGB A;  4RMF A;  1NYR A;  5E3I A;  2DZC A;  1X2H A;  3PZC A;  4TQD A;  2Q7E A;  2ZZE A;  4UP7 A;  1HTT A;  5ELO A;  4H2X A;  2ZCE A;  4P3N A;  4P71 C;  1ATI A;  3P8Y A;  4P71 A;  4TVA A;  3QO7 A;  1PYS A;  2EL9 A;  2ARU A;  1C0A A;  4XU3 A;  4KR2 A;  3IG2 A;  4ZTZ B;  3RAC A;  4CS3 A;  1NJ6 A;  2DU7 A;  3V8L A;  2Q5I A;  2AKW B;  1NNH A;  4G85 A;  5F5W A;  1X2G A;  4CH6 A;  3LC0 A;  4CH3 A;  3CMQ A;  1IL2 A;  4P75 C;  2ODR D;  2CJB A;  1JJC A;  2Q5H A;  2DKG A;  4YRN A;  2ZXF A;  2I4O A;  1B70 A;  3V7S A;  1YFS A;  2E41 A;  2DTI A;  2E5A A;  1ADY A;  2EJG A;  1B70 B;  12AS A;  3A31 A;  1WU7 A;  3FJP A;  2ALY A;  1SER A;  4UPA A;  3E9H A;  1J5W A;  2DVE A;  1G5H A;  3REX A;  2I4N A;  4H2U A;  3IAL A;  2QHV A;  3MF1 A;  2ZNJ A;  3NEM A;  2ALY B;  2EJ9 A;  2E64 A;  1NJ5 A;  3MF2 A;  1Z7N A;  3TEG A;  4HWR A;  4XU2 A;  1ASZ A;  1EFW A;  1W66 A;  4XTY A;  4XU1 A;  4DQ2 A;  2I4L A;  1QE0 A;  2ZTG A;  1SET A;  1H4T A;  3BJU A;  2ZT6 A;  4XEO A;  4YYE A;  3P8T A;  3V8J A;  3UGT A;  2ZR3 A;  4BWA A;  3V7R A;  4XTW A;  3HY0 A;  3TEH B;  4HA8 A;  1WQ7 A;  4TQF A;  1NYQ A;  4KR3 A;  1EIY A;  3A7A A;  3EFS A;  4YRL A;  5K1P A;  3HFZ A;  1E24 A;  2DQ0 A;  4LNS A;  3UGQ A;  3M4P A;  1EIY B;  5ELN A;  2E10 A;  2ZZF A;  2RHQ A;  2DU5 A;  3NEL A;  5KNN A;  1G51 A;  2ZNI A;  4OLF A;  4P73 C;  1NJ1 A;  1X01 A;  4P72 C;  4Q15 A;  1BIA A;  1N9W A;  1EOV A;  2CJ9 A;  4YRE A;  3HXY A;  5K1X A;  2IY5 A;  2C8M A;  1H4Q A;  3ERR A;  4WF2 A;  1KMM A;  3A5Z A;  1HXD A;  2E65 A;  3DSQ A;  3PCO B;  2XGT A;  1YB3 A;  4YRM A;  2DXU A;  4CS4 A;  1WQW A;  2QHU A;  5C52 B;  3TEH A;  2C7I A;  3LSQ A;  1X56 A;  3QO8 A;  4ZIB A;  3HY1 A;  4P74 C;  2RHS A;  3HFZ B;  4TVA B;  3UH0 A;  4YCU A;  1YFT A;  2P5I A;  4YCV A;  3A7U A;  4X5O A;  2J3M A;  1EQR A;  3VQV A;  3M4Q A;  4EX5 A;  1EVL A;  3REU A;  2ZIO A;  4P75 A;  3RUX A;  1L0W A;  3E9I A;  1VQZ A;  1BBW A;  3VQW A;  3MEY A;  1E1O A;  1BBU A;  3L4G A;  1KMN A;  2CIM A;  3NEN A;  3HXU A;  4DPG A;  3HXW A;  4TWA A;  3UFG A;  1X54 A;  3RIR A;  4K88 A;  2EWN A;  2CGH A;  1QF6 A;  4BW9 A;  3R07 A;  2DQ3 A;  2EAY A;  4ZTU B;  4YRG A;  2QHT A;  4XTX A;  4H2X B;  1EVK A;  2DEQ A;  4YRS A;  2DTO A;  4YRQ A;  4H2V A;  1Z7M A;  4YRO A;  1X55 A;  4YRF A;  2Q7G A;  3HFV A;  4RQE A;  1H4V B;  2AKW A;  1KOG A;  4YRK A;  4XTU A;  3A32 A;  3KFU A;  3HXZ A;  3A5Y A;  1GGM A;  4CS2 A;  3I7F A;  2DJZ A;  3VBB A;  4H2W A;  4XEM A;  4PG3 A;  2AMC A;  1RIQ A;  4XTV A;  2EJF A;  3L2Z A;  2PMF A;  3QO5 A;  4P73 A;  3IKL A;  2ZT8 A;  2FYK A;  2ZGW A;  3HRK A;  1FYF A;  3HRI A;  3HXV A;  4YRC A;  1B76 A;  4YRP A;  2E3C A;  4L87 A;  3QTC A;  1USY A;  1WYD A;  4RDX A;  3G1Z A;  1JJC B;  1SRY A;  2ZT5 A;  4NCX A;  11AS A;  3EFR A;  3P8V A;  4YPF A;  3A74 A;  3ICA A;  2ARS A;  1E1T A;  2ZT7 A;  4WJ3 M;  2ART A;  2DDZ A;  4CH4 A;  4TVY A;  3VQX A;  2CJA A;  4YP0 A;  4YRR A;  2XTI A;  3BFM A;  4AH6 A;  4YDQ A;  2P0L A;  3W3S A;  2DTH A;  4HWT A;  4XTZ A;  1H4S A;  3NET A;  4P3P A;  4PHC A;  3PCO A;  4K86 A;  2AMC B;  1E22 A;  4XU0 A;  4P3O A;  2DXT A;  4TTV A;  1YFR A;  4WJ4 A;  2J3L A;  1G5I A;  4YCW A;  3VQY A;  1ASY A;  3OD1 A;  4P74 A;  2HNI A;  1WNL A;  4WI1 A;  1LYL A;  3HXX A;  1HC7 A;  4OP0 A;  2ZR2 A;  3QNE A;  1WPY A;  4O2D A;  1B7Y B;  1BIB A;  2I4M A;  3A7R A;  2Q7H A;  2ZIN A;  4E51 A;  4YRI A;  4H2S A;  4H2T A;  1USY C;  4UP9 A;  4YRJ A; 
#chains in the Genus database with same CATH topology
 2EJ7 A;  1DF5 A;  1F23 A;  2N05 A;  1X59 A;  2Y48 A;  3LNM B;  4PDM A;  4WFH A;  4OPH A;  2A9H A;  4ASU G;  3T2M A;  1FAF A;  1RSO B;  1Y4M A;  3WG7 B;  2CTP A;  2CE4 A;  2W0X A;  5KA6 A;  5JVD B;  2Y69 B;  3OUS A;  4TVW A;  3DXR B;  2Q69 A;  1VQ9 V;  5C53 B;  5CB4 B;  3SJC C;  3QVN A;  4IHJ A;  1EZV H;  3TET A;  3K08 A;  2E1H A;  3IFX A;  1YTF D;  1OCO C;  3LUT B;  4HWS A;  2Q0A A;  4I55 A;  2BSK B;  2YID A;  1B7Y A;  4BW5 A;  4P72 A;  4O2B A;  1DTO A;  2QHS A;  5C8Y B;  1O9H A;  4WFF A;  1IX9 A;  4MTO A;  4YY3 B;  5IYC O;  3SYP A;  1Y74 B;  4X66 B;  3TGU H;  4ZHQ A;  3H1K H;  3PN1 A;  1E1R G;  3IKM B;  2QWN B;  1XI1 A;  3QG5 A;  4HBN A;  5IDJ A;  5E3I A;  4IT5 A;  1QCE A;  5BZB A;  4DR3 B;  4LVK A;  4J7J A;  2DZC A;  1JR9 A;  1BCC H;  3PZC A;  5EC1 C;  2OTL V;  4OGQ B;  4FMT A;  2XT9 A;  1OCZ C;  4LF8 O;  2ZZE A;  1F4M A;  2A7W A;  4U3J A;  2OWO A;  2X6C A;  3EVK A;  2BTQ B;  4DR2 O;  4P3N A;  3FFQ A;  3HPL C;  2H94 A;  2JVD A;  1UFI A;  1WN7 A;  5TIS Z;  3CXC U;  4P71 A;  4TVA A;  5J2T B;  3DTU B;  4GZR B;  2ARH A;  4BIO A;  1SQP H;  4XU3 A;  1MZE A;  3JAT B;  4KR2 A;  3CJH B;  1HNW O;  3BFR A;  3ZHQ A;  1WAZ A;  1VQP V;  2WLL B;  1WA8 B;  1KB9 F;  1EFR G;  1HNX B;  2UU9 B;  3CRQ A;  3U0Z A;  1EN5 A;  3JD1 A;  3V8L A;  2ADQ B;  5F5W A;  1V54 C;  4DUY B;  2OIE A;  4YHH B;  1X2G A;  2ITC C;  4O4J A;  2WSS G;  3OTO B;  3WG7 C;  2P7T C;  5J9P C;  5FNV A;  2N04 A;  4DO2 A;  1KU9 A;  1R1B A;  2RDC A;  3E86 A;  1BHB A;  5JQG A;  4JI8 B;  5EBM C;  1BS3 A;  2ILM A;  5LBQ A;  5FNV B;  4Z2W A;  4JV5 O;  2DWE C;  2EIJ B;  3MQZ A;  1TA8 A;  1IXB A;  4HYO A;  1B70 B;  4JI7 B;  3A31 A;  3BVO A;  1SER A;  5KHI A;  2UUC O;  2K9P A;  3REX A;  1SZX A;  4J42 A;  3U10 A;  2QHV A;  3MF1 A;  2ZNJ A;  1K34 A;  3ZS8 C;  3MHS C;  2VQE O;  3K04 A;  1WP7 A;  5EYP B;  2E64 A;  1M90 W;  3TEG A;  3K5N A;  1NR1 A;  1ZX3 A;  2I4L A;  3CB2 A;  1Z5V A;  1SET A;  1H4T A;  3ZCC A;  2ZT6 A;  1AVM A;  1QHT A;  4AIL C;  3ABM C;  5FPO A;  3V8J A;  2NS6 A;  2ZR3 A;  1D5N A;  3HKD A;  4BWA A;  3CX5 F;  2W6I G;  1FXK B;  4TWK A;  2JJ1 G;  5LOV B;  2XOK G;  4TQF A;  3JCU Z;  1VQM V;  3IC7 A;  3D3I A;  1P7B A;  3SYQ A;  1K9M W;  1E24 A;  1DK1 A;  1Y67 A;  1SKV A;  3HKC B;  3JD3 A;  5E79 Z;  1IUR A;  5ELN A;  4DYL A;  1G1X B;  2E10 A;  2ZKO A;  2EIJ C;  2DU5 A;  3NEL A;  1OJH A;  2CK3 G;  2Q73 A;  4OLF A;  5LYJ A;  1X01 A;  1K73 W;  2E76 B;  5IJ0 B;  2WA3 A;  5KHK A;  1QLN A;  1XMQ B;  1EOV A;  4LH7 A;  1LUV A;  1L8D A;  2JGD A;  3F5W C;  5L3B A;  5K1X A;  2Q68 A;  2IY5 A;  3MDS A;  2C8M A;  1H4Q A;  1PV0 A;  2OCH A;  1GN6 A;  2LO1 A;  4WF2 A;  4JI3 B;  3DSQ A;  2E65 A;  2CGO A;  5HFL A;  4TSF G;  2VWJ A;  3CWB H;  1G8M A;  4QPJ A;  4N23 A;  2WLJ A;  1QU7 A;  2DXU A;  3OEH G;  3E8F A;  4XDL A;  1ZSP A;  1URF A;  3TEH A;  4FLV A;  2DWD C;  3F5T A;  4DR6 B;  1PKX A;  1U96 A;  1X56 A;  3QO8 A;  4J11 A;  4ZIB A;  4UFZ A;  3BA8 A;  1GH6 A;  1AJQ A;  4JI3 O;  3UM7 A;  3JAK B;  1GM8 A;  4CZZ A;  3UH0 A;  5B1N A;  1YFT A;  4DV0 O;  3AG4 B;  3A7U A;  4YCV A;  3VQV A;  3OMN B;  4LFC B;  3REU A;  5CBG A;  4LVJ A;  2MW2 B;  2YC0 A;  1N0J A;  2JRI A;  1IBL B;  2N74 A;  4DV6 B;  1BBW A;  1NS1 A;  1FXV A;  1PM9 A;  3VQW A;  3ZN0 A;  3CSX A;  3ZMS A;  4DPG A;  3O65 A;  1HP8 A;  2ZDI A;  1YEW A;  3T1Y O;  3APQ A;  2HG5 C;  1AR5 A;  1Y6X A;  4PDL A;  1XHZ A;  3K79 A;  4QIW F;  2Q8V A;  3IJ4 A;  1IBL O;  3ZJZ A;  2DQ3 A;  4J9Y B;  4X9Q A;  4GT1 A;  3B09 A;  1F7Y A;  4YRG A;  1EVK A;  4GX2 A;  3BY6 A;  4ICG A;  2V7Q G;  1N32 O;  4JAV A;  3T1Y B;  4YRQ A;  3MAQ A;  1XDC A;  4EFB A;  3RT3 C;  3RYF B;  1Z7M A;  1GAX A;  2HJF C;  1AP5 A;  4YRF A;  2QJ1 A;  3JSN A;  1EBO A;  2IU3 A;  5H5N A;  1H4V B;  2QSA A;  2V4D A;  3M7M X;  2AKW A;  4JI1 B;  1HNZ B;  1KOG A;  3AK2 A;  4GCZ A;  4XTU A;  1JVM A;  4H44 B;  3KFU A;  2HVJ C;  4YJ2 A;  4NXN B;  1GGM A;  2HP8 A;  4L8J A;  5KA5 A;  3UKM A;  4H2W A;  4XEM A;  2Y4T A;  5H6Q A;  1M4U A;  1RIQ A;  4YJ2 B;  1VIB A;  4R7C A;  4LC1 A;  3L2Z A;  2HKO A;  3QO5 A;  5IYZ B;  4JI5 O;  2DE0 X;  1VAR A;  3K3W A;  4NTX A;  1KQS U;  1H2S B;  5LMU O;  3JAM N;  2FML A;  3EFF K;  2Y69 C;  3BPZ A;  2B1G A;  5GTH Z;  2ZT5 A;  4NCX A;  11AS A;  2XND G;  5CA1 A;  1VMG A;  4YPF A;  3AG1 B;  3FB6 C;  2JIZ G;  1ARO P;  1VQL V;  3BAA A;  1E1T A;  2ZT7 A;  4MTG A;  4WJ3 M;  1CP9 A;  2VWK A;  3VQX A;  3GB7 C;  1F51 A;  2LP7 A;  2YIC A;  3BHP A;  5IY5 B;  3K03 A;  3GWK C;  5B1B B;  1T5E A;  1F4N A;  4JI8 O;  1RP3 B;  2RCV A;  1ZWI C;  4TV9 A;  4JZG A;  4DV4 O;  1QVF U;  4R6Z A;  3W3S A;  4DV0 B;  1H2K A;  2LGW A;  2DTH A;  4J7K A;  4HWT A;  3K9A A;  4FPP A;  4QNH B;  1TUB B;  4MVZ A;  4K86 A;  4EB6 B;  4JI2 B;  2RQ6 A;  2AMC B;  1E22 A;  4ZI7 A;  2QM8 A;  1V9P A;  1US6 A;  4WJ4 A;  3KCX A;  4UB8 Z;  1PNL A;  2YI9 A;  4EB6 A;  4MVQ A;  2J3L A;  4DV6 O;  4PA9 A;  1IBM B;  1BT8 A;  1H2M A;  1G5I A;  3HKB A;  3VQY A;  1ASY A;  3JAL B;  4CC6 A;  4DV1 B;  1WNL A;  4ZOL A;  4WI1 A;  1WPX A;  1VQ7 V;  2CH7 A;  1WPY A;  3AK1 A;  3A7R A;  1NH2 B;  2LW7 A;  2P5O A;  5IYD O;  3LNN A;  4J41 A;  4FVM A;  3ZHS A;  3SPH A;  2FTK A;  1Y76 B;  3ZRX A;  2YSU B;  4LF9 B;  4FK5 C;  1USY C;  1I5Y A;  4EO4 A;  4LH6 A;  4K8Z A;  2DYS C;  3KCY A;  4P9O A;  1Y76 A;  2VQF B;  4J15 A;  4CH5 A;  2ZZG A;  4XDJ A;  1S3J A;  3OD4 A;  5BR8 B;  4KUM A;  5CB4 A;  1SQV H;  1CXZ B;  3RYI A;  2UXB O;  2EBO A;  1FXK A;  3RL6 A;  1K92 A;  1RPO A;  4W4K A;  4JI1 O;  1HNZ O;  1UPG A;  4IIJ B;  1SES A;  3ABM B;  3C90 A;  2YXY A;  3SJQ C;  4JZ2 A;  1YSC A;  3V7C A;  3AG3 C;  2IW5 A;  1IXM A;  3ZRV A;  2FYU H;  5EZY A;  4B08 A;  3HKC A;  1PYS B;  2GDS A;  4G2K A;  4O2B B;  2NN4 A;  4DR1 B;  3RGL A;  3OT7 A;  3OUF A;  3SPG A;  3RKW A;  4E2L A;  4H2Y A;  3L4G B;  1OHH G;  3TXQ A;  4LVM A;  1G6U A;  4DUZ O;  2E74 B;  3ASO B;  1VQO V;  2MK3 A;  4G28 B;  3UCS C;  3W7T A;  4K35 A;  1FPO A;  1QNM A;  3TUP A;  5DEC A;  3CCV V;  3F7V C;  4WFE A;  4X20 B;  4NYK A;  4GX0 A;  3ZRW B;  2VRZ A;  3K0D A;  1SQB H;  4H02 A;  4X20 A;  5KUK A;  3B8N A;  3CRR A;  3ZRW A;  1ZTE A;  3AK3 A;  4O4L A;  3ZHU A;  1K97 A;  2IM9 A;  1I0H A;  4UCV A;  2O57 A;  3J81 N;  1Q82 W;  3AG4 C;  4HNA A;  1HTT A;  2Y0P A;  2LQT A;  3APO A;  2ZCE A;  2WLM A;  1NBM G;  4IGG A;  1RM1 C;  1TVK B;  4UCS A;  4HNA B;  1XHX A;  2AHZ A;  1C0A A;  5CN0 A;  2R9A A;  1GRJ A;  1PNM A;  4I50 A;  1VP7 A;  5J2U A;  1M93 A;  1JPX A;  1M5I A;  2YXH A;  5LMN O;  4JYY A;  4GKJ B;  3IG2 A;  4ZTZ B;  5B1A C;  5H6R A;  4DV1 O;  4JI0 O;  1HR0 B;  2X0L A;  4CS3 A;  1JOY A;  2QKC A;  4DR2 B;  2DU7 A;  4H37 A;  4G85 A;  2YIB A;  4GYC B;  3J80 N;  4ZI7 B;  4CH3 A;  4JI5 B;  3SDL A;  1HNW B;  3OGI B;  3CMQ A;  3AG2 C;  2QEX V;  2Q4P A;  2P6J A;  4JI6 O;  3ABK B;  1EN6 A;  2QKA A;  1K7D A;  4LF9 O;  1B70 A;  2WLK A;  3V7S A;  3CS5 A;  4DV4 B;  2A0L A;  4FFB A;  4ZOL B;  1XMO B;  1SQF A;  1XRE A;  5L3C A;  4WFA V;  12AS A;  4AQY O;  3FJP A;  4JF3 A;  4JI2 O;  4UPA A;  1N4C A;  2IJI A;  2QTO A;  2I4N A;  1M9N A;  3OM3 B;  4JI6 B;  3FX7 A;  3C3T A;  4UUJ C;  3K5L A;  2ZXW B;  2EJ9 A;  2BE3 A;  1Z7N A;  4XU2 A;  3ABL B;  1EFW A;  4X66 O;  4OXS A;  4QGP A;  4NVP A;  5B1B C;  2UUB O;  1I7F A;  5D5P A;  5KMG B;  4DQ2 A;  2ZTG A;  2YI8 A;  5AG2 A;  4UXN A;  3P8T A;  3X2Q C;  2GSM B;  3U11 A;  3MD0 A;  5E1A C;  1P4R A;  4MTF A;  4X65 B;  4PDR A;  1FKA O;  4HA8 A;  2ZXW C;  2YS8 A;  3WB1 A;  4H13 B;  4YJ3 B;  5EBW C;  1Q86 W;  2XAQ A;  2DJV A;  1YDX A;  4JI7 O;  3A7A A;  3HFZ A;  4LNS A;  1SF9 A;  3K5O A;  5LYJ B;  4JV5 B;  3SPC A;  3OMA B;  1AJP A;  2ZZF A;  2RHQ A;  2A3Q A;  3E8B A;  1G51 A;  1B6Q A;  1FFX A;  3GWO A;  3D36 A;  2YIA A;  4UCU A;  2CH7 B;  4JI4 B;  4JYC A;  4H33 A;  3AG1 C;  1B06 A;  1YJN V;  2NLJ C;  5LA6 A;  3ZED A;  3G71 V;  1Q8I A;  5LMU B;  3CCM V;  3ERR A;  3A5Z A;  4X64 O;  4B3R O;  1JCH A;  2XGT A;  4JI4 O;  4YRM A;  2CTR A;  4FLX A;  3RWR D;  2QHU A;  4WBN A;  3K9S A;  5C52 B;  2EIK B;  3W7X A;  1JFF B;  1Z5W A;  3VOU A;  5LOV A;  2C7I A;  1TUE B;  1SQX H;  1Q6I A;  2RHS A;  1Q3E A;  3E8H A;  2OIG A;  5B66 Z;  2HJD A;  5JJN B;  4IIJ A;  1SS3 A;  5CMU A;  3K58 A;  4X5O A;  1BHA A;  1EVL A;  5EZY B;  3Q4H A;  3B77 A;  4P75 A;  3RUX A;  1Q7Y W;  3N2G A;  2F23 A;  4DV5 B;  5C93 A;  1E1O A;  1BBU A;  4JTD B;  2RMK B;  3L4G A;  2CIM A;  3NEN A;  1BMF G;  2JS5 A;  4AQY B;  2KSD A;  4TWA A;  3UFG A;  1XNQ B;  3FAV B;  2D2C B;  3A2F A;  2EWN A;  5KLV H;  1R6K A;  3B8M A;  3FKS G;  1R6T A;  3JD2 A;  4JYA B;  2CGH A;  1NZ6 A;  4LWS B;  2HR3 A;  5LP6 C;  4H2X B;  4I4T B;  4LF8 B;  4LF5 O;  4MTX A;  4YRS A;  4DR6 O;  2VS0 A;  1NTM H;  1M56 B;  4DK0 A;  4NXM B;  2JS3 A;  4FLT A;  1YJW V;  1AI7 A;  1DF4 A;  3HFV A;  4RQE A;  1GN3 A;  5DM6 V;  4UVA A;  1NR7 A;  3R65 A;  5KMG A;  3A32 A;  4I50 B;  3SPI A;  3HXZ A;  4NR1 A;  4RUF A;  3CC2 V;  4Z1V A;  1N36 O;  5L3F A;  1I94 B;  4D7S A;  2D3O W;  3I56 V;  2OTJ V;  2EJF A;  3H9V A;  4P73 A;  2Z0A A;  3IKL A;  2ZT8 A;  1EZJ A;  3CC7 V;  3HRK A;  3HXV A;  4YRC A;  1P7G A;  3AEI A;  2CGN A;  1B76 A;  4B7E A;  2NNU A;  5ITZ A;  2AZ0 A;  3BA9 A;  4YRP A;  2E3C A;  1N36 B;  4L87 A;  1WYD A;  4RDX A;  3BAB A;  3G1Z A;  3ZHV A;  4MSW C;  4X64 B;  4B3R B;  1H2G A;  4NB5 A;  3A74 A;  2HEP A;  1MAB G;  3PJS K;  4KHP O;  3CE2 A;  2ARS A;  4LVL A;  2WLH A;  4LFC O;  4TVY A;  2IH3 C;  4X1I B;  3FYI B;  2IBZ H;  1J5E B;  2CJA A;  2EZP A;  4YP0 A;  1GN2 A;  4J10 A;  1WB7 A;  1D5A A;  2QE7 G;  1OCC B;  1MSW D;  1YZB A;  3DC5 A;  3R66 A;  3NET A;  1R6N A;  4DV2 O;  3ETG A;  3T1H B;  5HFM A;  5FLX N;  1GM7 A;  3FYE B;  3HKB B;  2C2A A;  4TTV A;  1JFF A;  3JAL A;  5JVD A;  2HVK C;  1GK9 A;  3IC9 A;  2ZQM A;  1FD9 A;  3J7A U;  2DN9 A;  4TV8 A;  1KP2 A;  1WP8 A;  4PJ0 Z;  2JEX A;  3LDE A;  2PI5 A;  3SJA C;  4FFB B;  2GV9 A;  1HW7 A;  1S5J A;  4Z1M G;  4TV8 B;  2X7R B;  2OT5 A;  1Q43 A;  3KKY A;  2YEV B;  4O2D A;  4K8X A;  1BIB A;  2I4M A;  4ABM A;  1XNR B;  5LHI A;  2ZIN A;  4E51 A;  1N34 B;  1D2D A;  4YRI A;  1QLE C;  4B3M O;  3JD0 A;  4MVS A;  4K87 A;  1YJ9 V;  3O9O A;  2A06 H;  4B3S B;  4JTC B;  4TV9 B;  3RKX A;  5C51 B;  1N0N A;  3CRA A;  1SA0 A;  3CRC A;  5LA6 B;  2IY5 B;  1I5X A;  3OTO O;  4H0L B;  2ODR C;  2B5U A;  4RWU A;  1XBL A;  5HGQ A;  4P30 A;  2DYR C;  2XTA A;  4NTW A;  4UP8 A;  2QWR B;  3CEI A;  1WB8 A;  3TK1 A;  1IBM O;  1TGO A;  2BTQ A;  4D6T H;  3RKY A;  3HTZ A;  4HVC A;  4KQE A;  4G84 A;  4GX5 A;  3EHB B;  2RHS B;  2GTA A;  4X1K A;  5LGN A;  2RHQ B;  2PME A;  3JAK A;  1W0K G;  4EEQ A;  4YRT A;  4RQF A;  3W7U A;  4JGS A;  1WA8 A;  1H2L A;  5FPR A;  4X1K B;  2CTQ A;  1PL0 A;  2WAM A;  4RO2 A;  4U3F H;  3SYC A;  3RYH B;  5A2Q N;  3S3W A;  2DZ9 A;  3I5D A;  1KC8 W;  2E5L O;  1B8A A;  4MVU A;  3JSL A;  1LR1 A;  3RYH A;  4HWP A;  4RMF A;  1XUQ A;  2EIM C;  4JYA O;  1Q6U A;  4LF4 B;  3M99 B;  1N33 O;  3FAV A;  2H3O A;  4LBE C;  4FM1 A;  2Z3Y A;  4TQD A;  3SPJ A;  1H8H G;  1K8A W;  4UP7 A;  1V54 B;  2RNB A;  5H2F Z;  2GTS A;  1S72 V;  3SR2 C;  5FL7 G;  2W0F C;  5J2U B;  3QO7 A;  2UXX A;  1ZLZ A;  2Q0O C;  2ARU A;  3P3N A;  3FB8 C;  1L0N H;  2G38 A;  1OCC C;  1PPJ H;  3BRC A;  4I55 B;  3AG7 A;  3ZIA G;  2QWP B;  2PYJ A;  1KMI Z;  1AP6 A;  1RM1 B;  1YTF B;  4BIU A;  4YY3 O;  4R8C A;  1THZ A;  2AKW B;  5IE9 A;  1NNH A;  1LNQ A;  3IAY A;  2F66 C;  2L35 A;  4PHZ A;  1MG1 A;  4ZBM A;  4LF7 O;  4LFB B;  2OYQ A;  5CA3 A;  5LMN B;  5LHG A;  4GKK O;  1IL2 A;  5EIB C;  2ODR D;  3T4D A;  2CJB A;  1JJC A;  2KQX A;  2DKG A;  2ZXF A;  2AGA A;  1K3E A;  4PEL A;  2I4O A;  1XOU A;  2UXD B;  5GTI Z;  1JJ2 U;  3HKE B;  1EM1 A;  4KXR A;  1COW G;  4TUY A;  2EJG A;  5ITZ B;  3OR7 C;  3CCS V;  1WU7 A;  4LFB O;  2GUZ B;  3CPW U;  3JAW A;  3T1H O;  4LF6 B;  3CXH F;  4DR1 O;  3E9H A;  3RFR A;  2BOC C;  1BSM A;  2DOS A;  2P67 A;  5J2T A;  3IAL A;  4P9P A;  3SJB C;  3NEM A;  2K1E A;  2UU9 O;  1NJ5 A;  3ZBH A;  3MF2 A;  2QWQ B;  4HWR A;  1ASZ A;  1AJN A;  2QKS A;  1W66 A;  2JJ2 G;  3E8G A;  2IU0 A;  2Q67 A;  1SA0 B;  4FM0 A;  3AG3 B;  2A8E A;  4UV9 A;  4YYE A;  4DR7 B;  5L3G A;  4TOI A;  1Q5O A;  1XL6 A;  3V7R A;  4PA3 A;  3HY0 A;  4XTW A;  1YIJ V;  1TUB A;  2EJR A;  4DUZ B;  3OMI B;  4FLU A;  1W0J G;  2NR5 A;  1NYQ A;  5JQG B;  4FLZ A;  2BOB C;  2LFS A;  3D8C A;  4YRL A;  1KKC A;  3OEE G;  2DQ0 A;  3E83 A;  3M4P A;  4DR5 O;  1FFX B;  1EIY B;  1A32 A;  4LF4 O;  2B9Z A;  1M57 C;  2BCC H;  4UCO A;  3UT5 B;  3JCZ A;  3ETD A;  1MZF A;  5IWA B;  5KNN A;  1W2B U;  5EK0 A;  2P06 A;  4P73 C;  4LNU B;  1FFT B;  3FD9 A;  3ABK C;  1S77 D;  4RUE A;  4N21 A;  4KL1 A;  1BIA A;  2Z5U A;  1N9W A;  1BQZ A;  2CJ9 A;  2IH1 C;  1P49 A;  3STZ C;  2QM7 A;  3MHH C;  4A5U B;  4I5S A;  1S76 D;  1ENV A;  1VQ5 V;  3E35 A;  4FJC C;  5D5Q A;  3NXS A;  5L3D A;  3CME V;  4F4L A;  5L3E A;  1YB3 A;  1HWY A;  3DXR A;  3CCR V;  5EIB D;  2UXB B;  2DYS B;  4X89 A;  4JI0 B;  1NTK H;  3RGB A;  3HY1 A;  4P74 C;  3HFZ B;  3L75 H;  4YCU A;  4O2A A;  5C8Y A;  1EQR A;  2ATK C;  3L70 H;  1QQC A;  3M4Q A;  1U97 A;  3L9D A;  4DV2 B;  2ZIO A;  2YEV A;  1XMQ O;  4XBF A;  3B4S A;  4HT4 A;  1L0W A;  1V55 B;  1FYJ A;  4DRX A;  3MEY A;  3A8T A;  5JCO C;  4DV7 O;  5JCO A;  5KHH A;  1AI4 A;  1XEQ A;  2UXC B;  3HXU A;  3HXW A;  3OR6 C;  1E1Q G;  3S3X A;  3E22 B;  1NKD A;  1X54 A;  3RIR A;  4NXN O;  1NJI W;  1VEW A;  4MT8 A;  1JQ0 A;  2IJH A;  2M7W A;  3JAS B;  2HLD G;  1YI2 V;  4PDV A;  3ZN1 A;  4X8A A;  1ORQ C;  3R07 A;  1AR4 A;  2EAY A;  4FLW A;  3L71 H;  2QHT A;  5GON A;  2WA4 A;  4XTX A;  5BMV B;  3W7S A;  1N34 O;  4I7Z B;  3B2E E;  3GVM A;  3SYA A;  2DTO A;  4O4I A;  2ADP A;  4B3S O;  3CD6 V;  2XUM A;  4YIP A;  3THO A;  2XAJ A;  2Q7G A;  4O4H B;  1YXB A;  1KEC A;  1IDS A;  2ZD9 A;  4FZ1 A;  4QJF B;  1G4Y B;  3CCU V;  4JAA A;  2P90 A;  4O4H A;  4TT3 G;  4B3T O;  3ZMU A;  4YRK A;  1HR0 O;  4GLX A;  2ZM6 O;  2JEU A;  4OX9 O;  4P2Z A;  2ZE8 A;  3A5Y A;  2OCC B;  4CS2 A;  1M56 C;  2KG7 B;  2VQF O;  2JDI G;  1PNK A;  3VBB A;  1TAE A;  4R50 A;  4PG3 A;  1VF7 A;  1BGY H;  3HB3 B;  2PMF A;  4DV3 O;  3WU2 Z;  2FYK A;  1WPB A;  1QLE B;  2ZGW A;  5BR8 O;  3HRI A;  3CCL V;  3P30 A;  2XAH A;  2L6L A;  5LP6 A;  4JAS A;  3QTC A;  3LSU A;  3AG2 B;  2FB5 A;  1MSD A;  1JJC B;  2F4V O;  4DK1 A;  3EFR A;  3P8V A;  2XAF A;  4I0X A;  2LJ2 A;  4WCE V;  3ABU A;  3CRM A;  3ICA A;  4UCT A;  3RW0 A;  2H8P C;  4CH4 A;  3RVY A;  4DR4 B;  5CA0 A;  3JD4 A;  3DC6 A;  4YIO A;  4GKK B;  5CBH A;  5F2V O;  2VQE B;  1N33 B;  4YRR A;  3ZRS A;  3BFM A;  1VQ8 V;  4AH6 A;  4YDQ A;  4DXW A;  1X4T A;  2JGU A;  1YIT V;  3FB7 C;  1R3J C;  2P0L A;  1JX9 A;  3TXS A;  2GBO A;  1GM9 A;  1KD1 W;  1L0L H;  5LL6 Y;  5DED A;  4KP4 A;  3HKD B;  4MS2 A;  1H4S A;  4PHC A;  1I94 O;  3PCO A;  2FL4 A;  5BXZ A;  3ASN B;  2RN9 A;  5LGU A;  3UO3 A;  4XU0 A;  4DW1 A;  4P3O A;  3RYI B;  1OCZ B;  3D36 C;  1YFR A;  1UJW B;  1OCR C;  4HZ3 A;  5IY5 C;  4LF5 B;  2EIN C;  2QGN A;  3OD1 A;  2EIN B;  4P74 A;  3L74 H;  4J7Z A;  3G6B A;  2EUL A;  3HXX A;  4DUY O;  4O2A B;  1HC7 A;  4OP0 A;  4PA7 A;  3HR0 A;  1MOF A;  3ICX A;  2GUZ A;  4MVO A;  1B7Y B;  1H2N A;  4EFE A;  3I55 V;  1ZL8 A;  2KB1 A;  5GW7 A;  5JH7 B;  3ETQ A;  4H2S A;  1OV9 A;  1N8R W;  4G27 B;  1YF2 A;  3ZMT A;  1R3L C;  3CHX A;  5LXT A;  1VQN V;  3L73 H;  4PA4 A;  2AHY A;  3E22 A;  3P32 A;  4MW3 A;  2AXT Z;  4DR5 B;  2QR4 A;  3A0B Z;  4BIZ A;  2QM4 A;  2PTM A;  3D3Q A;  3K06 A;  3H01 A;  2PGG A;  2R9R B;  4WFG A;  2XAG A;  2ZIM A;  5KAI Z;  4OPA A;  4UCR A;  3ABT A;  3A0H Z;  2M6Y A;  3G67 A;  4CBC A;  2ZM6 B;  4OX9 B;  2G4C A;  2CUG A;  4LFA O;  1RSO A;  1NJ2 A;  3V8K A;  2Y4U A;  1CPY A;  1GN4 A;  2E75 B;  1KBH A;  1QR9 A;  3RF1 A;  4DV3 B;  4K3A A;  1M57 B;  1PL4 A;  3UT5 A;  2ITD C;  4DW0 A;  2LFR A;  2RJZ A;  1ADJ A;  2ODM A;  4DR3 O;  4Q6G A;  4LFA B;  3Q4H B;  1LUW A;  4DV7 B;  1NJ8 A;  3LSS A;  3WQZ A;  1WLE A;  3N2G B;  1SC5 B;  2UUA B;  2KG7 A;  4Q20 A;  1PD3 A;  3CC4 V;  3OGC C;  4GKJ O;  3B40 A;  1AI6 A;  3G80 A;  1BQ0 A;  1VF5 B;  3L1A A;  4IYH A;  3STL C;  4HWO A;  1NU1 H;  1YGB A;  3X2Q B;  1NYR A;  4LVI A;  4B7K A;  4FLY A;  4IL6 Z;  4I9W A;  2EIL C;  4YXW G;  5B3S B;  2AZ2 A;  4IYI A;  4XDK A;  5LGT A;  1XIL A;  2YUA A;  1HDJ A;  3TCU A;  4MW8 A;  1X2H A;  2UUA O;  3L72 H;  1XMO O;  1I08 A;  4UV8 A;  1Q81 W;  1NQT A;  2DYR B;  1NVP D;  4U7N A;  2EX3 A;  4JAU A;  3ABL C;  3LDC A;  2Y0I A;  2Q7E A;  5IJ9 B;  2QWO B;  5ELO A;  3OTF A;  4X62 O;  1YHQ V;  4H2X A;  5BMV A;  3BCC H;  1O9G A;  5B1O A;  4P71 C;  2DMX A;  1ATI A;  4AI8 A;  4WF9 V;  3P8Y A;  1RPR A;  1PYS A;  2EL9 A;  1FXH A;  2F1M A;  4YHH O;  1FS0 G;  3ZHR A;  2A79 B;  3F7Y C;  3SYO A;  4QE9 A;  1MA1 A;  3K0G A;  4JYB A;  1Q90 D;  5KAF Z;  5KX5 A;  2CAZ C;  3RAC A;  3K57 A;  1NJ6 A;  1VQ4 V;  3LDD A;  2P4V A;  2QTS A;  2Q5I A;  4QPK A;  2LW1 A;  4GUN A;  2UUB B;  3CP1 A;  1KYO F;  3OFN G;  4CH6 A;  2ZE7 A;  3T4Z A;  4FFK A;  3LC0 A;  1JA8 A;  3JAS A;  2UXN A;  2WWW A;  4F6E A;  1XNR O;  4P75 C;  1DLB A;  2BTO A;  2Q5H A;  4O4L B;  1R73 A;  3HKE A;  4YRN A;  4LP8 A;  5CA1 B;  1Y66 A;  3ZHT A;  2AW9 A;  1YFS A;  3ML0 A;  2E41 A;  2DTI A;  2XHB A;  1MMM A;  4LR3 A;  2E5A A;  1ADY A;  4J80 A;  5LP6 B;  4AHC A;  4EKW A;  3CMA V;  1S5H C;  1IBK O;  4O4I B;  5KUM A;  2P4K A;  4ZKI A;  2ALY A;  3CCQ V;  1J5W A;  2DVE A;  4QE7 A;  4DR4 O;  1G5H A;  3RN4 A;  5IJ0 A;  4H2U A;  1Q6H A;  3KZI Z;  2EZO A;  3H1J H;  2HHH B;  2ALY B;  4DV5 O;  1FXK C;  4UVC A;  2P22 C;  2XAS A;  3A0R A;  4C7U A;  4NTY A;  4F6R B;  1N32 B;  1IZ3 A;  3ZX6 A;  4XTY A;  4XU1 A;  2ZT9 B;  1IBK B;  1QE0 A;  3DGE A;  4JTA B;  2V1D A;  4KFM A;  1S5L Z;  3W7W A;  3BJU A;  2EIL B;  4XEO A;  4F6R A;  1E79 G;  1RFY A;  3ETE A;  4PA6 A;  3UGT A;  1K5S A;  1QVG U;  3BEH A;  2IJJ A;  3TEH B;  1VQ6 V;  4LCU C;  1WQ7 A;  2R70 A;  3ASN C;  2PI4 A;  1GKF A;  4KR3 A;  1YCI A;  1EIY A;  4MVM A;  3EFS A;  3WFV A;  3ASO C;  5K1P A;  4IHJ B;  3UGQ A;  2ZDI C;  3CCJ V;  4TUY B;  3JYC A;  4I0X B;  1J95 A;  2ZNI A;  1WJZ A;  3JAW B;  2B1I A;  1FJG B;  1NJ1 A;  4JPR A;  4P72 C;  1QR8 A;  4Q15 A;  1YVW A;  1P84 F;  1KKD A;  1WNS A;  4X1Y A;  1Z2G A;  4PD4 F;  4X88 A;  4YRE A;  1V55 C;  3HXY A;  2ZE5 A;  1KUQ A;  1R3K C;  4X1Y B;  2Q6A A;  5BY1 A;  1NH2 D;  1M1K W;  1KMM A;  1R3I C;  1FJG O;  1HXD A;  1XQ8 A;  2GHY A;  1H8E G;  1GO3 F;  1VQK V;  3PCO B;  1OCR B;  1H38 A;  4CS4 A;  4PI2 A;  3G4S V;  1WQW A;  3IGA C;  2QA4 V;  3M8A A;  3P3P A;  3RBZ A;  3CCE V;  1AB3 A;  4I4T A;  4X65 O;  3EXA A;  1SQQ H;  3LSQ A;  5JJE B;  2UXD O;  3C3S A;  4YJ3 A;  3K5M A;  3N2K A;  4MVR A;  3RYF A;  4UVB A;  2HFE C;  4TVA B;  1OZ0 A;  2IJK A;  2F43 G;  3N2K B;  2P5I A;  1K5Q A;  2J3M A;  4EX5 A;  4LF7 B;  3JAT A;  3RVZ A;  3RYC B;  1MNG A;  3E9I A;  1NVP B;  1VQZ A;  5JH7 A;  1K4D C;  3RYC A;  3E2E A;  1BL8 A;  1KMN A;  5CBF A;  2E5L B;  5LXT B;  2X6B A;  2JK5 C;  1NTZ H;  3N27 A;  1L1F A;  1JJO A;  3E89 A;  5IYZ A;  4K88 A;  5JWP A;  4LF6 O;  5KHG A;  4UB6 Z;  1QF6 A;  5GON B;  4BW9 A;  2R72 A;  5EC2 C;  1W59 A;  1IVS A;  2PF4 E;  2DW4 A;  3NR7 A;  4FIP C;  2R9I A;  4WBN B;  4U3J B;  4ZTU B;  4FZ0 A;  4BAY A;  3OW2 U;  5IT9 N;  2EIK C;  2Q5Z A;  1TVK A;  4KHP B;  2DEQ A;  1GMG A;  2WPD G;  2PY5 A;  3UO2 A;  5IYB O;  1XL4 A;  1ROP A;  4H2V A;  1AI5 A;  4YRO A;  4U7O A;  3T1C A;  3CJH A;  5IJ9 A;  5IWA O;  3K59 A;  1X55 A;  2WLI A;  4RAI A;  4BR6 A;  4DR7 O;  3ZMV A;  2X6A A;  3TJT A;  2CDY A;  3OAA G;  5EYP A;  3QF7 A;  5EBL C;  1VF6 C;  3FB5 C;  2BSK A;  2W6J G;  2WLI B;  5KHJ A;  5LHH A;  2UXC O;  2YDE A;  4GX1 A;  4DRX B;  1EN4 A;  1ZAU A;  3KG2 A;  1XNQ O;  1Y74 A;  1NI8 A;  1QBZ A;  5DN6 G;  3I7F A;  4ZHQ B;  2DJZ A;  4X62 B;  5KX5 B;  2AMC A;  3H1H H;  4XTV A;  2PZS A;  2F95 B;  1SZT A;  1B3Q A;  1SQG A;  4WFB V;  3UQ8 A;  2HHH O;  1AIL A;  2F93 B;  2OCC C;  1FYF A;  4NKG B;  4LWS A;  5B5E Z;  1USY A;  1BE3 H;  3OE7 G;  4NXM O;  2Q9L A;  1SRY A;  3G6E V;  1NT2 B;  5CA0 B;  1DGS A;  1B04 A;  2YIB D;  4W4L A;  2FKX A;  2ART A;  2DDZ A;  1K33 A;  1K4C C;  5B3S C;  2UUC B;  4HAM A;  1VF6 A;  2EIM B;  2QDO A;  5B1A B;  2ZE6 A;  2LGQ A;  2XTI A;  5H9C A;  2ETN A;  3WB0 A;  2WLL A;  5JJJ B;  4B3T B;  4B3M B;  4E4E A;  1PP9 H;  2CTW A;  4XTZ A;  4P3P A;  1AR1 B;  3JAR A;  1ZUQ A;  1JMK C;  3WB2 A;  2KKW A;  4O4J B;  4FM2 A;  2DXT A;  1OCO B;  2PYL A;  4D7T A;  1CEZ A;  3JAR B;  4K0K B;  4J9Z B;  2F4V B;  2PUS A;  4YCW A;  3CYO A;  1HNX O;  4CC5 A;  5A9G A;  2HNI A;  1LYL A;  3ZMZ A;  1S0V A;  4I9Q A;  2YXL A;  1ZL8 B;  2ZR2 A;  3QNE A;  1GTO A;  4PV1 B;  1BZK A;  4K0K O;  1KP3 A;  2JGD B;  3SGI A;  2Q7H A;  4X1I A;  3H1I H;  1J5E O;  4H2T A;  2WLN A;  3H1L H;  4PI0 A;  4LNU A;  4UP9 A;  4YRJ A; 
#chains in the Genus database with same CATH homology
 4MVS A;  2DYS C;  1R3L C;  3ZMT A;  1YJ9 V;  1VQN V;  1DF5 A;  1F23 A;  4PA4 A;  4P9O A;  2AHY A;  3P32 A;  4JTC B;  4MW3 A;  3RKX A;  4BIZ A;  5C51 B;  4EO4 A;  2Y48 A;  3LNM B;  4J15 A;  4PDM A;  2IY5 B;  1I5X A;  4WFH A;  4CH5 A;  2ZZG A;  2A9H A;  4XDJ A;  3K06 A;  3H01 A;  2R9R B;  4WFG A;  4ASU G;  3T2M A;  1S3J A;  2XAG A;  2ODR C;  2B5U A;  2ZIM A;  3ABT A;  1Y4M A;  4KUM A;  3WG7 B;  5HGQ A;  4P30 A;  2EBO A;  2DYR C;  1FXK A;  3RL6 A;  1K92 A;  1RPO A;  5KA6 A;  4UP8 A;  4CBC A;  2Y69 B;  1SES A;  3OUS A;  4TVW A;  3ABM B;  3SJQ C;  2G4C A;  2Q69 A;  1VQ9 V;  3TK1 A;  5C53 B;  1YSC A;  3V7C A;  3AG3 C;  2IW5 A;  1NJ2 A;  3V8K A;  1IXM A;  3ZRV A;  1CPY A;  3RKY A;  3HTZ A;  4HVC A;  4KQE A;  4G84 A;  1QR9 A;  3RF1 A;  3TET A;  1PYS B;  3K08 A;  4G2K A;  4GX5 A;  2E1H A;  3IFX A;  1YTF D;  3EHB B;  1OCO C;  2RHS B;  3RGL A;  3LUT B;  4HWS A;  1M57 B;  5LGN A;  3OUF A;  2RHQ B;  2PME A;  2ITD C;  1W0K G;  3SPG A;  3RKW A;  4E2L A;  4RQF A;  2LFR A;  4YRT A;  3W7U A;  1B7Y A;  4BW5 A;  3L4G B;  1OHH G;  4H2Y A;  4JGS A;  1DTO A;  1ADJ A;  2QHS A;  4P72 A;  4LVM A;  4Q6G A;  4WFF A;  3ASO B;  4MTO A;  1VQO V;  2MK3 A;  4G28 B;  1PL0 A;  5IYC O;  3W7T A;  1NJ8 A;  3SYP A;  2WAM A;  3LSS A;  4RO2 A;  3TUP A;  3WQZ A;  1WLE A;  3SYC A;  3CCV V;  3F7V C;  4WFE A;  4Q20 A;  1PD3 A;  3CC4 V;  1E1R G;  3OGC C;  2DZ9 A;  1KC8 W;  1AI6 A;  4GX0 A;  3ZRW B;  3IKM B;  3L1A A;  3STL C;  3K0D A;  1B8A A;  4HWO A;  4MVU A;  4H02 A;  1YGB A;  4HWP A;  4P71 C;  3X2Q B;  4RMF A;  3HY0 A;  1NYR A;  5IDJ A;  5E3I A;  4LVI A;  5KUK A;  2EIM C;  1QCE A;  3B8N A;  5BZB A;  3M99 B;  4I9W A;  2EIL C;  3ZRW A;  4YXW G;  5B3S B;  4LVK A;  4XDK A;  5LGT A;  1K97 A;  3TCU A;  2DZC A;  4MW8 A;  1X2H A;  3PZC A;  5EC1 C;  4LBE C;  2OTL V;  4UV8 A;  1Q81 W;  1NQT A;  2DYR B;  4FMT A;  1NVP D;  4U7N A;  1OCZ C;  2Z3Y A;  4TQD A;  4JAU A;  3ABL C;  3SPJ A;  1H8H G;  3TEH B;  3LDC A;  1Q82 W;  1K8A W;  2ZZE A;  4UP7 A;  1V54 B;  2Q7E A;  3AG4 C;  1F4M A;  1HTT A;  5ELO A;  1S72 V;  2X6C A;  1YHQ V;  4H2X A;  2ZCE A;  4P3N A;  2WLM A;  5B1O A;  3HPL C;  1NBM G;  2H94 A;  2W0F C;  5FL7 G;  4WF9 V;  1RM1 C;  3CXC U;  1ATI A;  3P8Y A;  4P71 A;  4TVA A;  1RPR A;  3QO7 A;  2UXX A;  1PYS A;  2EL9 A;  1FXH A;  2ARU A;  2AHZ A;  3DTU B;  1C0A A;  4XU3 A;  3FB8 C;  1FS0 G;  1OCC C;  5CN0 A;  2A79 B;  3F7Y C;  4KR2 A;  1PNM A;  3SYO A;  4QE9 A;  3ZIA G;  1JPX A;  3K0G A;  1VQP V;  4JYB A;  2WLL B;  4UP9 A;  3IG2 A;  4ZTZ B;  5B1A C;  5H6R A;  1EFR G;  2X0L A;  1RM1 B;  3RAC A;  4CS3 A;  1JOY A;  1YTF B;  1NJ6 A;  4BIU A;  3JD1 A;  1VQ4 V;  4R8C A;  3LDD A;  2DU7 A;  3V8L A;  2Q5I A;  4H37 A;  1THZ A;  2AKW B;  4QPK A;  1NNH A;  1LNQ A;  4G85 A;  1V54 C;  5F5W A;  3CP1 A;  1X2G A;  3OFN G;  1MG1 A;  2ITC C;  2WSS G;  4ZBM A;  4CH6 A;  3T4Z A;  3WG7 C;  3LC0 A;  4CH3 A;  2P7T C;  5J9P C;  3CMQ A;  5CA3 A;  3AG2 C;  5LHG A;  2UXN A;  2WWW A;  4DO2 A;  4P75 C;  1IL2 A;  2QEX V;  1DLB A;  3E86 A;  3T4D A;  2CJB A;  1BHB A;  1JJC A;  2ODR D;  2P6J A;  2Q5H A;  1R73 A;  2DKG A;  3ABK B;  4YRN A;  4LP8 A;  5EBM C;  1K7D A;  2ZXF A;  1K3E A;  4PEL A;  5LBQ A;  1B70 A;  2I4O A;  2WLK A;  3V7S A;  1Y66 A;  1YFS A;  2A0L A;  3ML0 A;  2E41 A;  2DTI A;  2DWE C;  1JJ2 U;  2E5A A;  2EIJ B;  1ADY A;  3MQZ A;  2EJG A;  1COW G;  5L3C A;  4HYO A;  4WFA V;  3OR7 C;  4EKW A;  12AS A;  3CMA V;  1S5H C;  3CCS V;  1B70 B;  1WU7 A;  3A31 A;  5KUM A;  3CPW U;  3FJP A;  4JF3 A;  4ZKI A;  1SER A;  2ALY A;  3CCQ V;  3E9H A;  4UPA A;  1J5W A;  2DVE A;  4QE7 A;  2IJI A;  2BOC C;  2QTO A;  2P67 A;  1G5H A;  1M9N A;  3OM3 B;  2I4N A;  4H2U A;  3REX A;  4UUJ C;  3IAL A;  4P9P A;  2QHV A;  3MF1 A;  2EZO A;  2ZXW B;  1K34 A;  2ZNJ A;  3NEM A;  3MHS C;  2ALY B;  3K04 A;  2EJ9 A;  1FXK C;  2E64 A;  2K1E A;  4UVC A;  1M90 W;  1NJ5 A;  3MF2 A;  4WJ3 M;  1Z7N A;  3TEG A;  4HWR A;  4XU2 A;  2XAS A;  3ABL B;  3A0R A;  1ASZ A;  1EFW A;  1AJN A;  2QKS A;  1W66 A;  4OXS A;  1NR1 A;  5B1B C;  2JJ2 G;  4XTY A;  4XU1 A;  4DQ2 A;  2I4L A;  3E8G A;  3DGE A;  1QE0 A;  2ZTG A;  2IU0 A;  2Q67 A;  1SET A;  2V1D A;  4JTA B;  4KFM A;  3W7W A;  3ZCC A;  1H4T A;  3AG3 B;  3BJU A;  2EIL B;  4UXN A;  2A8E A;  2ZT6 A;  4UV9 A;  1E79 G;  4XEO A;  4YYE A;  3ABM C;  3P8T A;  3ETE A;  4PA6 A;  3V8J A;  2NS6 A;  3X2Q C;  5L3G A;  3UGT A;  2GSM B;  2ZR3 A;  4BWA A;  1K5S A;  1XL6 A;  3MD0 A;  1P4R A;  3BEH A;  4MTF A;  4PA3 A;  2IJJ A;  2W6I G;  5E1A C;  1YIJ V;  1QVG U;  1VQ6 V;  4PDR A;  1FXK B;  2EJR A;  4LCU C;  4TWK A;  4HA8 A;  1WQ7 A;  2JJ1 G;  3ASN C;  2ZXW C;  2PI4 A;  2XOK G;  3OMI B;  1GKF A;  4TQF A;  1W0J G;  1NYQ A;  1VQM V;  3IC7 A;  3D3I A;  2BOB C;  2XAQ A;  2LFS A;  1P7B A;  5EBW C;  3SYQ A;  1Q86 W;  1EIY A;  4MVM A;  3A7A A;  3EFS A;  4YRL A;  3OEE G;  3ASO C;  3WFV A;  1K9M W;  3HFZ A;  1E24 A;  2DQ0 A;  5K1P A;  4LNS A;  3E83 A;  3UGQ A;  4K87 A;  3JD3 A;  3M4P A;  1EIY B;  5ELN A;  2ZDI C;  3CCJ V;  3SPC A;  3OMA B;  1M57 C;  3JYC A;  2E10 A;  1AJP A;  2ZZF A;  2EIJ C;  2RHQ A;  3JCZ A;  3ETD A;  3NEL A;  2DU5 A;  2CK3 G;  3E8B A;  1G51 A;  1B6Q A;  1J95 A;  1W2B U;  5KNN A;  2ZNI A;  5EK0 A;  4OLF A;  4P73 C;  2B1I A;  3GWO A;  1NJ1 A;  1X01 A;  1K73 W;  4JPR A;  4P72 C;  1FFT B;  1QR8 A;  3D36 A;  3ABK C;  4Q15 A;  1S77 D;  4RUE A;  4N21 A;  1KKD A;  1QLN A;  1BIA A;  2Z5U A;  4JYC A;  1N9W A;  4X88 A;  1EOV A;  2CJ9 A;  4H33 A;  2IH1 C;  4YRE A;  3AG1 C;  1V55 C;  3F5W C;  3HXY A;  3STZ C;  5L3B A;  2QM7 A;  1YJN V;  3MHH C;  2NLJ C;  2Q68 A;  5K1X A;  3G71 V;  2IY5 A;  2C8M A;  1H4Q A;  1R3K C;  4I5S A;  2Q6A A;  3CCM V;  1S76 D;  1ENV A;  3ERR A;  1VQ5 V;  1NH2 D;  3E35 A;  4FJC C;  4WF2 A;  1M1K W;  1KMM A;  3A5Z A;  4KR3 A;  3V7R A;  1R3I C;  3NXS A;  1HXD A;  2E65 A;  3DSQ A;  5L3D A;  2GHY A;  5HFL A;  1H8E G;  1JCH A;  4TSF G;  4F4L A;  1GO3 F;  3CME V;  1VQK V;  2XGT A;  3PCO B;  1OCR B;  1G8M A;  4QPJ A;  5L3E A;  1YB3 A;  1HWY A;  4N23 A;  1H38 A;  2WLJ A;  2DXU A;  4CS4 A;  3OEH G;  3G4S V;  4YRM A;  1WQW A;  3E8F A;  3IGA C;  4XDL A;  2QA4 V;  2QHU A;  3CCR V;  5C52 B;  2EIK B;  3RBZ A;  3W7X A;  3CCE V;  3TEH A;  2DWD C;  2DYS B;  3VOU A;  2C7I A;  3LSQ A;  1PKX A;  1X56 A;  3QO8 A;  4X89 A;  4ZIB A;  1TUE B;  3HY1 A;  4P74 C;  1AJQ A;  4MVR A;  2RHS A;  3E8H A;  4UVB A;  2HFE C;  3UM7 A;  3HFZ B;  1GM8 A;  4CZZ A;  4TVA B;  3UH0 A;  4YCU A;  5B1N A;  5CMU A;  1OZ0 A;  1YFT A;  2IJK A;  2F43 G;  3AG4 B;  2P5I A;  3A7U A;  4X5O A;  1K5Q A;  4YCV A;  2J3M A;  1EQR A;  3VQV A;  2ATK C;  3M4Q A;  1BHA A;  4EX5 A;  3OMN B;  1EVL A;  3REU A;  2ZIO A;  2YEV A;  5CBG A;  4XBF A;  4LVJ A;  3B77 A;  3RVZ A;  4P75 A;  3RUX A;  1Q7Y W;  4HT4 A;  1L0W A;  1V55 B;  3E9I A;  1NVP B;  1VQZ A;  5C93 A;  1BBW A;  3VQW A;  1FXV A;  3MEY A;  1E1O A;  1BBU A;  4JTD B;  1K4D C;  3ZN0 A;  3E2E A;  1AI4 A;  3L4G A;  1BL8 A;  1KMN A;  3ZMS A;  2CIM A;  5CBF A;  1BMF G;  3HXU A;  3NEN A;  4DPG A;  3HXW A;  3OR6 C;  4TWA A;  2X6B A;  3UFG A;  1E1Q G;  2JK5 C;  2ZDI A;  1NKD A;  1L1F A;  1X54 A;  3RIR A;  3E89 A;  1NJI W;  4MT8 A;  2HG5 C;  4K88 A;  2EWN A;  4PDL A;  1JQ0 A;  1R6K A;  2IJH A;  2M7W A;  2HLD G;  3B8M A;  3FKS G;  3K79 A;  4QIW F;  3JD2 A;  4PDV A;  3ZN1 A;  4X8A A;  1YI2 V;  2CGH A;  1QF6 A;  1ORQ C;  4BW9 A;  3R07 A;  5EC2 C;  3ZJZ A;  2DQ3 A;  4J9Y B;  2EAY A;  2DW4 A;  4GT1 A;  4FIP C;  2R9I A;  4ZTU B;  4YRG A;  2QHT A;  4XTX A;  2HR3 A;  4BAY A;  1EVK A;  4GX2 A;  3BY6 A;  3W7S A;  2EIK C;  3OW2 U;  4H2X B;  2V7Q G;  4MTX A;  2DEQ A;  4YRS A;  4JAV A;  1GMG A;  2WPD G;  3SYA A;  2DTO A;  4YRQ A;  5IYB O;  1XL4 A;  1M56 B;  1ROP A;  4H2V A;  1AI5 A;  1Z7M A;  4YRO A;  3CD6 V;  4U7O A;  3T1C A;  2HJF C;  1YJW V;  1X55 A;  4YRF A;  2WLI A;  4RAI A;  2XAJ A;  2Q7G A;  3ZMV A;  1AI7 A;  1DF4 A;  2X6A A;  3HFV A;  3OAA G;  4RQE A;  1KEC A;  1EBO A;  2IU3 A;  2ZD9 A;  5EBL C;  5DM6 V;  3FB5 C;  1H4V B;  2W6J G;  2WLI B;  4QJF B;  1G4Y B;  5LHH A;  3CCU V;  2P90 A;  4TT3 G;  4GX1 A;  4UVA A;  2AKW A;  1KOG A;  1NR7 A;  3ZMU A;  4YRK A;  3R65 A;  4GCZ A;  3A32 A;  2JEU A;  1JVM A;  4XTU A;  3KFU A;  3KG2 A;  4P2Z A;  2HVJ C;  3SPI A;  3HXZ A;  3A5Y A;  4RUF A;  1GGM A;  3CC2 V;  2OCC B;  4CS2 A;  1QBZ A;  1M56 C;  5DN6 G;  3I7F A;  5L3F A;  2JDI G;  2DJZ A;  1PNK A;  3VBB A;  2D3O W;  5KA5 A;  3UKM A;  4H2W A;  4XEM A;  5H6Q A;  4R50 A;  4PG3 A;  2AMC A;  1RIQ A;  3I56 V;  2OTJ V;  4XTW A;  4XTV A;  1SZT A;  3HB3 B;  4R7C A;  4LC1 A;  2EJF A;  2HKO A;  2PMF A;  3L2Z A;  3QO5 A;  4P73 A;  3IKL A;  4WFB V;  2ZT8 A;  3K3W A;  2FYK A;  1EZJ A;  3CC7 V;  1QLE B;  2ZGW A;  3HRK A;  1KQS U;  2OCC C;  1FYF A;  3HRI A;  3HXV A;  4YRC A;  3AEI A;  3CCL V;  1B76 A;  3P30 A;  2XAH A;  2NNU A;  4YRP A;  2E3C A;  4JAS A;  4L87 A;  3QTC A;  1USY A;  3AG2 B;  1WYD A;  4RDX A;  3EFF K;  3OE7 G;  2Y69 C;  3G1Z A;  2B1G A;  1JJC B;  4MSW C;  1SRY A;  2ZT5 A;  4NCX A;  3G6E V;  11AS A;  1H2G A;  3EFR A;  2XND G;  3P8V A;  2XAF A;  4YPF A;  3A74 A;  3PJS K;  1MAB G;  4WCE V;  3ABU A;  3AG1 B;  3FB6 C;  2JIZ G;  1ARO P;  3ICA A;  1VQL V;  2ARS A;  4LVL A;  1E1T A;  2WLH A;  3RW0 A;  4MTG A;  2H8P C;  2ZT7 A;  1CP9 A;  2ART A;  2DDZ A;  1K33 A;  1K4C C;  3RVY A;  5B3S C;  2IH3 C;  4TVY A;  3VQX A;  3JD4 A;  4CH4 A;  3GB7 C;  1F51 A;  2LP7 A;  3FYI B;  4HAM A;  2EIM B;  5IY5 B;  3K03 A;  2CJA A;  5B1A B;  5CBH A;  5B1B B;  2EZP A;  4YP0 A;  1F4N A;  4YRR A;  3ZRS A;  2XTI A;  3BFM A;  1VQ8 V;  4AH6 A;  5H9C A;  4YDQ A;  4DXW A;  1ZWI C;  1YIT V;  3FB7 C;  2WLL A;  1R3J C;  2QE7 G;  1JX9 A;  1OCC B;  2P0L A;  1QVF U;  1MSW D;  4R6Z A;  1GM9 A;  1KD1 W;  3W3S A;  2DTH A;  4HWT A;  3K9A A;  4KP4 A;  4FPP A;  4MS2 A;  4XTZ A;  4QNH B;  1H4S A;  3NET A;  1R6N A;  4P3P A;  4MVZ A;  1AR1 B;  3ETG A;  4PHC A;  3PCO A;  4K86 A;  5HFM A;  2AMC B;  3ASN B;  1E22 A;  5LGU A;  1GM7 A;  4XU0 A;  3FYE B;  2QM8 A;  4P3O A;  2DXT A;  2C2A A;  4TTV A;  1OCZ B;  1YFR A;  1OCO B;  4WJ4 A;  1PNL A;  1CEZ A;  4MVQ A;  2HVK C;  1UJW B;  1GK9 A;  2J3L A;  1OCR C;  4HZ3 A;  5IY5 C;  4J9Z B;  2ZQM A;  4PA9 A;  1G5I A;  1KP2 A;  2EIN C;  4YCW A;  3VQY A;  3CYO A;  1ASY A;  3OD1 A;  2EIN B;  2JEX A;  3LDE A;  2PI5 A;  2HNI A;  4P74 A;  1WNL A;  4WI1 A;  1WPX A;  1LYL A;  1VQ7 V;  3ZMZ A;  3HXX A;  4Z1M G;  1S0V A;  1HC7 A;  4OP0 A;  4PA7 A;  2X7R B;  2ZR2 A;  3QNE A;  1GTO A;  2OT5 A;  1MOF A;  1WPY A;  2YEV B;  4O2D A;  4MVO A;  1B7Y B;  1BIB A;  2I4M A;  1NH2 B;  3A7R A;  1KP3 A;  5IYD O;  2Q7H A;  3I55 V;  5LHI A;  2ZIN A;  2KB1 A;  5GW7 A;  4E51 A;  3SPH A;  2FTK A;  4YRI A;  1QLE C;  3ZRX A;  4H2S A;  4H2T A;  2YSU B;  2WLN A;  3JD0 A;  4FK5 C;  1USY C;  1N8R W;  1I5Y A;  4YRJ A;  4G27 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...