3LSQA

Trypanosoma brucei seryl-trna synthetase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
467
structure length
431
Chain Sequence
MMVLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEAVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEALGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRGTAAQNVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPYMMGIEMIRFEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seryl-tRNA synthetase
publication title X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Ligase
total genus 149
structure length 431
sequence length 467
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3lsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3lsqA02
11ASA 4CH6A 3L4GB 3V7SA 3IKLA 1KMNA 2IY5A 1NJ6A 2Q7HA 2QHUA 2ZR3A 1B7YB 3V7RA 4XTVA 2EAYA 1SETA 4YRLA 2E65A 1NYQA 5K1XA 1EQRA 4YRJA 3NENA 3P8YA 1E1TA 4UPAA 1NJ5A 4H2WA 1SRYA 2ZZFA 2QHVA 4KQEA 4XEOA 3A32A 1QE0A 4OP0A 3HXWA 1NJ8A 4WJ3M 2EJFA 2EWNA 5K1PA 3P8VA 1NYRA 1N9WA 2DXTA 5C51B 4K88A 3MF1A 4NCXA 4UP9A 4OLFA 3IG2A 1H4VB 1BIAA 1E22A 4YYEA 3P8TA 4XTYA 3HTZA 2DU7A 4YRQA 12ASA 1EIYB 3LSQA 3PCOA 1G51A 4WI1A 1EFWA 2E64A 3CMQA 2DTOA 4P73C 1YGBA 2ZT8A 3A7UA 5ELNA 2C8MA 2DU5A 2EL9A 2DZCA 4UP7A 1ASZA 3L1AA 1YB3A 4P72A 1YFTA 3RKXA 4CH4A 1WQWA 2ZTGA 1X01A 1G5IA 2ZGWA 4TVAA 4EX5A 3V8KA 1E1OA 1EOVA 3RGLA 1GGMA 2EJGA 2G4CA 4H2SA 3UGTA 4H2UA 4PHCA 1NNHA 2Q5IA 4P71C 1EVKA 3REUA 3IKMB 3QO5A 4G85A 3HXVA 1X2HA 3E9HA 5C52B 1PYSB 1LYLA 3NELA 4YRNA 1USYA 3EFSA 4BWAA 3V8JA 2Q7GA 3HY1A 3V8LA 3QO7A 2ZIOA 4P3NA 2ZT7A 4DPGA 1ATIA 4HWPA 1BBWA 4XTUA 4Q6GA 1B7YA 4RDXA 3HXXA 4P75C 1H4TA 3NETA 4CS4A 2ODRD 4CH5A 4TVWA 3RIRA 3LSSA 4K87A 4P74C 2DZ9A 4XU2A 3A7AA 5C53B 3QTCA 3REXA 1KOGA 4TVYA 3TEGA 3VQVA 4YDQA 2DQ3A 4YREA 4CS2A 1ADJA 2DEQA 4TWAA 1YFRA 3A5YA 4DQ2A 5ELOA 2DKGA 3RKYA 3IALA 4XTWA 2DXUA 4XU3A 2CGHA 2AMCA 1BBUA 1EIYA 3HXYA 2ZNJA 1X55A 3RKWA 4HWOA 1VQZA 3HRIA 2CJBA 3VBBA 4CH3A 2E10A 2ZXFA 3TEHB 1J5WA 2ARTA 1HXDA 2J3LA 3UFGA 1QF6A 4H02A 2AMCB 2DTIA 4Q15A 1B70B 3RL6A 2E5AA 1EVLA 1NJ2A 4YRIA 4YRCA 1Z7MA 2Q7EA 4HWRA 2Q5HA 4RMFA 3M4QA 3EFRA 2ZINA 1WLEA 1PYSA 1B76A 4RQEA 4RQFA 5KNNA 4UP8A 2E41A 2ARSA 3A7RA 2EJ9A 2DDZA 3RF1A 2XTIA 4BW9A 3L2ZA 3A31A 4YRTA 4YRPA 2ARUA 1WPYA 2RHQB 4XU1A 2CJAA 3NEMA 4EO4A 4PG3A 4P72C 2AKWB 4YRKA 2QHTA 2ALYB 4LNSA 1ADYA 1C0AA 1G5HA 3VQXA 3R07A 4ZTZB 1BIBA 5F5WA 4E51A 1JJCB 4O2DA 4H2XB 4AH6A 4L87A 2QHSA 3VQWA 3HXUA 2FYKA 3E9IA 1NJ1A 4YP0A 4HWTA 4HWSA 2DQ0A 4J15A 3UH0A 1IL2A 2RHSB 3G1ZA 4YCUA 2ZNIA 5HGQA 4ZTUB 3MF2A 3BFMA 4K86A 4TQFA 2I4LA 4WJ4A 3DSQA 1W66A 1ASYA 3TEHA 4HA8A 2IY5B 1YFSA 3TUPA 1HC7A 3RUXA 4TTVA 4HVCA 2P5IA 2CIMA 1B70A 1FYFA 4P73A 4YRGA 4P3OA 4P3PA 4X5OA 2ZT5A 1WNLA 3HY0A 2C7IA 3W3SA 3A5ZA 3HFVA 2DJZA 2CJ9A 1RIQA 4YRSA 3PZCA 4XEMA 4YRRA 2PMEA 4KR2A 4H2VA 4H2YA 3V7CA 4KR3A 4YPFA 2ZIMA 1WYDA 1SERA 3OD1A 4P71A 3WQZA 1WQ7A 2E3CA 2PMFA 4XU0A 2DTHA 4XTXA 2I4MA 5E3IA 3LC0A 2HNIA 3QO8A 3ICAA 3KFUA 3HXZA 1H4QA 2I4NA 1E24A 3MEYA 1L0WA 2ZR2A 4CS3A 1Z7NA 2I4OA 2ZT6A 3HRKA 3BJUA 2RHQA 3I7FA 3ERRA 1X2GA 4YROA 3HFZA 3PCOB 2XGTA 4P75A 2P0LA 2AKWA 2ZZGA 2ALYA 2ZCEA 1H4SA 4H2TA 4XTZA 3HFZB 3RACA 3UGQA 4YRMA 4P74A 3QNEA 2DVEA 1JJCA 4ZIBA 4TVAB 4H2XA 3VQYA 1X56A 4WF2A 4YCVA 1HTTA 1KMMA 2ODRC 3M4PA 1SESA 2J3MA 2E1HA 4G84A 4YRFA 3L4GA 4YCWA 1WU7A 2RHSA 1X54A 3FJPA 2ZZEA 3A74A 1B8AA 1USYC 4TQDA
chains in the Genus database with same CATH superfamily
4NXNO 2QM7A 1P7BA 1IBKB 2Z5UA 3L4GB 4EB6B 1SS3A 3WB0A 2F23A 2ZR3A 1B7YB 3CXCU 1FXKB 3CC7V 2CGOA 3OUFA 2HP8A 5CA0A 1OCOB 4LR3A 4YRLA 3CRRA 2XASA 5CBFA 1CP9A 3MHSC 4LVIA 3WG7C 2UUCB 1HNZO 4YJ2B 4LF7B 1K34A 5LOVB 2OCCB 4QE9A 1US6A 4W4KA 1QVFU 1QE0A 4OP0A 2WPDG 4WJ3M 2X6AA 1VQMV 3F5TA 1E1RG 3F5WC 2W6JG 2HVKC 1GK9A 4I0XB 2JEXA 1L0NH 1NYRA 4B3SB 3FFQA 4YJ3A 3CJHB 2HR3A 5J2UB 5L3BA 2E5LO 5EZYA 5JJJB 2VQEB 3K0GA 3L72H 1DK1A 5LYJA 5KHIA 4X1YB 2IH1C 5B1BC 2IJJA 4JTCB 1GMGA 4HBNA 3BHPA 1WPBA 1EIYB 3ZJZA 3OGCC 5IJ9B 1I94O 1VQ6V 3H9VA 1G51A 4F6EA 1EFWA 4GX5A 1AR5A 5ELNA 2EL9A 4DR7B 4FLXA 5GTHZ 3B09A 1DLBA 2DZCA 5IWAO 2Z0AA 4CC5A 1IDSA 4UP7A 4U7OA 5IDJA 1YTFD 1THZA 3OEEG 3RKXA 4GKJB 4I7ZB 3DC5A 3E86A 2CAZC 1EOVA 1GGMA 2G4CA 4H2SA 4H2UA 4PHCA 1BSMA 4W4LA 4I50B 5BZBA 2VWKA 3IKMB 1I08A 3ZMUA 4FFBA 1BGYH 4X65O 1N32O 5C52B 4PDRA 1AR1B 1SQPH 5AG2A 3HR0A 4QIWF 4UCUA 1X4TA 2AZ2A 4GYCB 1H2LA 3QO7A 4NXNB 3RYIB 1MABG 4EB6A 4MVMA 3JARA 1L1FA 3J81N 1B7YA 1TGOA 1FXKA 3T1HO 2QWRB 4QNHB 5BR8O 3X2QC 2EZPA 2ETNA 4TV9B 2V4DA 4TSFG 3ZRSA 2YDEA 1Q82W 2BOCC 4O4LA 3LSSA 4YJ2A 4QPJA 1HNZB 4LCUC 5LOVA 3O65A 3ZS8C 4XU2A 3A7AA 4K8XA 1N4CA 1AJPA 4EFBA 4MTGA 1KOGA 1VARA 2F1MA 1KQSU 5CA3A 4YHHO 3KG2A 1B04A 4I0XA 4DV5O 4B3RO 4CS2A 3CJHA 1XEQA 5J2UA 1ADJA 1YFRA 1I5YA 1Q43A 3CPWU 2E5LB 5JJNB 2PTMA 5ELOA 4X1YA 1NTZH 3RKYA 5B3SC 3IALA 2RCVA 4J7JA 2ZXWC 4ZI7B 4H0LB 1JA8A 2ODMA 1EIYA 5IJ9A 1M56C 3C90A 3HXYA 4CZZA 1I94B 4TOIA 3SYQA 4CH3A 3K79A 2Q0AA 4ASUG 4B3MO 3ABLB 2ZE7A 1K73W 1RM1B 3KCYA 1Y67A 4FZ0A 1HWYA 5IWAB 2YUAA 5LA6A 3I55V 2DYRC 1RP3B 4NTXA 1H2SB 2WWWA 2E5AA 5IYDO 3THOA 4U7NA 2VRZA 4DXWA 5KHHA 4Q20A 2DYSB 3B77A 4YRIA 4P2ZA 2UU9B 4WBNB 1Z7MA 1AI6A 4J9ZB 4HWRA 4JAAA 4RMFA 4A5UB 4UUJC 2ZINA 4X65B 5EK0A 3RFRA 1N32B 2F66C 4GX1A 1QBZA 1OCZC 3BRCA 4RQEA 1IBMO 5KNNA 1N36B 2BSKB 5BXZA 4AQYO 3RYIA 1OCCC 1JX9A 2EJ9A 4G28B 3U10A 3ZBHA 4B3TB 2GTSA 4LNUB 3T1HB 4YRPA 4LVMA 3H1JH 4P9PA 4D7TA 4TV9A 2R9AA 2L6LA 3MHHC 2BOBC 3JSNA 3SYOA 5CMUA 4FJCC 4UFZA 4I55B 3JD4A 4X8AA 4DV6O 2Q73A 4LVKA 2ALYB 1ORQC 5KAIZ 3R07A 4YHHB 3UCSC 3OUSA 1JOYA 2P67A 5E1AC 1KU9A 2YIBA 4DV5B 4O2DA 2QJ1A 3N2KB 4B3RB 4IYIA 5KHGA 4AH6A 4GLXA 5KX5B 1CPYA 2LW1A 2B1IA 4UCRA 3E2EA 3BCCH 2Q9LA 4HWSA 4I4TB 1U96A 1NVPB 1IL2A 4JYCA 2ZKOA 4ZI7A 1SC5B 1PNMA 4FPPA 4U3FH 3SJAC 2LGWA 4YCUA 3B8MA 5FLXN 3OTOO 1O9HA 3BFMA 3GB7C 1KKCA 4WJ4A 4JASA 3JASB 2QM4A 1ASYA 3ETGA 3FKSG 3OFNG 2YI8A 4B3MB 4JI5B 2HJDA 2W0FC 4DK0A 2KB1A 4PDVA 1FYFA 4YRGA 1MA1A 1YDXA 4F4LA 2N74A 2XHBA 4P3OA 3BA8A 1OV9A 1WP7A 2XTAA 3SPCA 3W3SA 3TK1A 1YJNV 2DWEC 2CTPA 2CJ9A 4WBNA 4JV5O 4YRSA 1VF6A 3KCXA 4XEMA 4H2VA 2CTWA 5JCOA 1WP8A 4HT4A 2CGNA 4F6RB 2BCCH 1DGSA 2KG7B 3ASOC 2DWDC 2BSKA 3H1LH 4XU0A 4AQYB 2A0LA 1PV0A 3LC0A 1QU7A 3CXHF 3QO8A 4JTAB 4C7UA 2I4NA 1L0WA 4LNUA 3O9OA 3S3WA 1K8AW 5H6QA 4K0KO 3BJUA 2OWOA 1P7GA 4YROA 3HFZA 1AP5A 4P9OA 4XBFA 4P75A 4I55A 2B1GA 1HNXO 3FD9A 5DM6V 1P84F 2GTAA 2ZZGA 2FKXA 2ALYA 2ZCEA 3EHBB 3JD0A 2MK3A 4FLZA 2E75B 1H4SA 4UB6Z 1VQOV 4H2TA 3JCZA 1CEZA 1XMOO 4KL1A 1M1KW 2VWJA 4NTYA 3K5OA 5EC2C 1A32A 4MVOA 1GH6A 3J7AU 3CEIA 2QWOB 4TVAB 1EN6A 3N2KA 3VQYA 3JAWB 4UV8A 1R3IC 5KX5A 4LF4O 5IYCO 2ODRC 2OYQA 3W7UA 3M4PA 5EBWC 5DEDA 1V54B 2P5OA 2J3MA 4I4TA 4JI3B 5EC1C 1NTKH 1RPRA 2LW7A 5EBLC 3DC6A 2IU0A 1B8AA 1K4CC 4YYEA 2XAHA 3ABKB 3D36C 3ZIAG 3OTOB 3JASA 4CH6A 2AGAA 2NS6A 3IKLA 5E79Z 1GM7A 1NJ6A 3V7RA 3ZMSA 2ADQB 1M90W 1WB8A 1SETA 1FPOA 1ZL8B 4OGQB 4BIOA 2E65A 2WLLB 1NYQA 5K1XA 1ZLZA 4PJ0Z 2IBZH 4Z2WA 4G27B 2CTRA 2UXNA 1ENVA 4LFBO 2EIMB 4FLUA 3CSXA 1E1TA 2L35A 4UPAA 4WCEV 2XAFA 4JV5B 1SRYA 2ZZFA 4XEOA 2QTOA 3ETEA 3AG2C 1YI2V 3C3SA 4LVLA 4QPKA 3U0ZA 1NJ8A 1Q6UA 2PYJA 4F6RA 2WLNA 2KG7A 3TXQA 1F51A 3TGUH 3W7WA 1YHQV 3P8VA 1FS0G 2DXTA 1JR9A 1S5JA 1M57B 1FXHA 1AB3A 4K88A 2GV9A 1EN4A 5KHJA 1E22A 1AI4A 3CWBH 2WA4A 4B3SO 4XTYA 4MVZA 4JYYA 3G6EV 5DN6G 2VQEO 1NH2B 3LSQA 1YVWA 1BQ0A 4OX9O 4NR1A 1XL4A 3T1CA 2P4VA 1HDJA 2E64A 3CMQA 1VF7A 5LYJB 4P73C 2P6JA 1AROP 1HNXB 4R50A 2RDCA 2G38A 3PN1A 3IGAC 3F7VC 3OM3B 4JAVA 4J7ZA 4FLYA 5LP6C 1O9GA 2CE4A 1QLNA 1N0JA 4P72A 1YFTA 4X20B 3SPIA 2BE3A 1K4DC 4B08A 1GM9A 4BIUA 1G5IA 4TVAA 3A0HZ 3OMAB 4DK1A 1E1OA 3JAWA 2N04A 1Z5WA 1FFTB 1MSDA 2QSAA 2Q5IA 4GKJO 4X88A 1W59A 2EINB 1NS1A 3SPJA 1KC8W 1X2HA 2FB5A 3NELA 4YRNA 3EFSA 4JI8B 2Q6AA 2LQTA 1KP2A 1V55B 3B40A 2ZIOA 4P3NA 2VS0A 3IC7A 4LF9B 2HHHB 5IYBO 2NN4A 1ATIA 4HWPA 1H2GA 1MG1A 2QDOA 3AG1C 1H2NA 4FK5C 5EIBD 1F7YA 3ABMC 4O4HB 3HXXA 4D6TH 2IJIA 3ZRWB 2WLLA 4UVAA 2XOKG 1S72V 3NETA 4CS4A 5IJ0A 3SYPA 3E89A 3JARB 1HR0O 5B66Z 2Y69C 1SQXH 2PY5A 2A7WA 3WU2Z 4LFBB 3RW0A 3ASNC 3OT7A 1RFYA 2E74B 3ZMVA 2Q0OC 3WG7B 1W0KG 4TVYA 4O4LB 4RO2A 1GAXA 1FYJA 1MZFA 2FL4A 1EFRG 5IYZB 5HFLA 5HFMA 1M9NA 2DEQA 2YIAA 2DW4A 3JD3A 4LVJA 1IXMA 4DQ2A 2P4KA 5GW7A 3FAVB 4O4IB 4XTWA 2Z3YA 2DXUA 4IT5A 4PDLA 2AMCA 1BBUA 3TCUA 3B8NA 1RSOB 1NT2B 4HWOA 4OX9B 2V1DA 3HRIA 4JPRA 3VBBA 5B1BB 4X1IA 3AG4C 1LUVA 1H8EG 5LP6A 1XMQB 2EILC 2ARTA 1HXDA 3UFGA 3L75H 5GONB 3C3TA 2ARHA 2QTSA 4TV8B 2CDYA 5F2VO 3AG7A 4Q15A 4X20A 3JYCA 4CBCA 3MQZA 1NJIW 4LFAO 2AHZA 3RL6A 2ATKC 1VQ4V 2ZM6O 3SYAA 2CUGA 3H1KH 4DUZO 1R6NA 2YXLA 5CB4A 1QQCA 2ZDIC 4PA7A 2Q7EA 5LA6B 2Q5HA 1D5NA 4X62O 1WB7A 3EFRA 1WPXA 3HPLC 4J7KA 2UU9O 1B76A 4I9WA 2Y4TA 2XUMA 3OTFA 1NQTA 3K57A 2JIZG 3BABA 4JZGA 1R73A 3CCQV 4DR3O 1Y6XA 2GBOA 2ARSA 3A7RA 1M93A 2JK5C 1AP6A 2C2AA 1GO3F 2Q8VA 3JCUZ 2F4VO 4O4HA 3L2ZA 1DF4A 1N36O 3ZRWA 4OPAA 4MVQA 1WPYA 1TAEA 2WLKA 3CRQA 4XU1A 4B3TO 1XDCA 3N2GB 5L3GA 2QA4V 3NEMA 4EO4A 1HR0B 3X2QB 4MSWC 1ZWIC 3L73H 4H13B 4ZHQB 1G5HA 3BEHA 4YXWG 3VQXA 3LUTB 5F5WA 4E51A 1SZTA 1JJCB 4Z1VA 4GZRB 2Q5ZA 5IYZA 4IHJB 4JI0O 1N33O 2Y0IA 2UXCO 3T4ZA 3JATB 1WA8B 4EKWA 3HXUA 4QGPA 3E9IA 4YP0A 2XAGA 3FAVA 1B3QA 4J10A 2EJ7A 1PL4A 4J15A 4O4IA 2NR5A 1V9PA 1S5LZ 4JI6O 2RHSB 2AW9A 4JGSA 2RNBA 1RSOA 1K5SA 5HGQA 3BAAA 3AK1A 1N34B 4TQFA 5B3SB 5JQGB 3DSQA 1W66A 2ZXWB 4R6ZA 4X1KB 3HKBB 1W0JG 4HA8A 3ZHSA 1M56B 2IY5B 5GONA 1NVPD 3T2MA 4KHPO 1Q5OA 4TV8A 3CC2V 2HEPA 1PP9H 2ADPA 2D2CB 5H9CA 4P3PA 4X5OA 4MS2A 1Q6IA 2ZT5A 4LFAB 1WNLA 1BCCH 2ZM6B 5FNVB 3UO3A 1HNWO 4DUZB 1XREA 4JI5O 2DYRB 2K1EA 2RN9A 1RIQA 1JPXA 4J80A 5LHIA 3K58A 4YRRA 1P49A 1IVSA 2PMEA 4QE7A 4X62B 2LJ2A 3E22B 5LMUO 2CTQA 3K3WA 4DRXB 1WYDA 5CA1B 5FL7G 1SERA 2DN9A 4H33A 1JJOA 4I5SA 1AI5A 1WQ7A 4XTXA 2I4MA 5CN0A 5B1AC 4DR3B 3BY6A 2B9ZA 2JJ2G 2F4VB 3ICAA 1Y76B 3SPGA 3KFUA 1OCZB 2QKAA 3A0RA 3U11A 3MEYA 4CS3A 1H4QA 2ZR2A 3ZHQA 1EN5A 2Y48A 2Q4PA 2I4OA 4IYHA 5LHHA 1OCCB 2UXDO 2P06A 3FYIB 4WFBV 3I7FA 2YSUB 3ERRA 2EIKC 1X2GA 1I0HA 3PCOB 3N2GA 4E2LA 1VQ9V 3L71H 1XUQA 4LH7A 4DV3O 1CXZB 1S77D 2P0LA 1SQFA 1R6TA 4GT1A 2AZ0A 5DECA 1W2BU 4NKGB 4DYLA 3M8AA 2M6YA 2WAMA 5KA5A 3SPHA 4GX0A 4O4JB 2UXBO 4ZHQA 4EFEA 1KP3A 4LBEC 4XTZA 1NZ6A 2KQXA 3KKYA 3HFZB 1J95A 5L3EA 2XAQA 3RACA 3IAYA 3UGQA 4YRMA 4HAMA 3SDLA 3M7MX 4X89A 2X7RB 1JJCA 5FPOA 3OMNB 2M7WA 4P30A 4IHJA 3SGIA 4FM2A 4JI0B 2JDIG 3DTUB 1N33B 5IY5C 3JATA 4JTDB 1WA8A 4FM0A 1FJGO 2UXCB 4ICGA 5KMGB 1QNMA 3QVNA 4K35A 2IH3C 4G84A 4YRFA 5A9GA 2HKOA 3STLC 4GKKO 1WU7A 2RHSA 4JI6B 2UUAO 2ZZEA 3ZRXA 1TUEB 1USYC 1XQ8A 3CCEV 4IL6Z 4WFFA 4JI3O 5JQGA 2EIJC 4X1KA 3HKBA 3SJCC 1KMNA 2IY5A 4LC1A 4J42A 3FX7A 4U3JB 4KHPB 4PA3A 1K33A 3B4SA 1SQVH 1DTOA 1K97A 4YRJA 1XI1A 5FNVA 3L74H 5LL6Y 1WJZA 2XAJA 4NTWA 5LGUA 4DV7O 3P8YA 1HNWB 3ZMZA 4JI7O 1PNKA 4H2WA 4L8JA 2QHVA 2LGQA 1J5EO 1R3JC 1UPGA 5KUKA 1ZAUA 3E22A 1XHXA 2DJVA 2QWPB 4DRXA 5CA1A 5LMUB 2DE0X 1XNQO 4GCZA 2X0LA 1AJQA 5K1PA 1TVKA 3JD1A 1VEWA 1QLEC 4KUMA 1XL6A 3UQ8A 4NXMO 3K5LA 4JYBA 1OCRC 4NCXA 2HVJC 4J41A 3IG2A 3ASOB 1R3LC 3B2EE 1Y76A 2D3OW 1VQPV 1R6KA 2JVDA 3P8TA 4N21A 1KB9F 2DU7A 2R72A 1JVMA 4YRQA 2UXDB 1VQLV 3GWKC 3RYHB 3AK2A 3PCOA 3RYCB 3G80A 2WSSG 1VQKV 4PA9A 4DV3B 1YGBA 2ZT8A 2C8MA 1R3KC 2DU5A 2ZQMA 4X66B 2F95B 4O4JA 3A2FA 3P30A 1NI8A 2O57A 2UXBB 3E8HA 2FYUH 4FLTA 1ASZA 1KD1W 4CH4A 1WQWA 2A9HA 4K8ZA 1X01A 1BZKA 5A2QN 4EX5A 3ZHUA 3ZHVA 2EJGA 4MVRA 3TXSA 3UGTA 1NR1A 1BHAA 3FB6C 1PKXA 1NNHA 2W0XA 5KMGA 1FJGB 4P71C 4LP8A 3REUA 3CMEV 4JI1O 1X59A 2P7TC 3HXVA 3H1HH 4LF5O 1LYLA 1QCEA 1USYA 4GKKB 3V8JA 2KSDA 1XHZA 2UUAB 3V8LA 4WFHA 1D2DA 4ZOLB 2ZT7A 2AXTZ 1EM1A 4E4EA 1KUQA 1ZX3A 4Q6GA 4JI8O 1PM9A 1G1XB 4U3JA 3AEIA 3A0BZ 3JSLA 4EEQA 4MW8A 4DV0O 4LF9O 5B1NA 2HHHO 2IM9A 2N05A 2UUBO 3G67A 3K08A 3LDCA 4AILC 2QKSA 4UVBA 4DV7B 4P74C 3LNNA 4JI7B 2DZ9A 1F23A 1GN2A 5LMNB 5C53B 2JRIA 1B6QA 3QTCA 3REXA 4J11A 3E8GA 5IJ0B 3K06A 1J5EB 5KLVH 4WFGA 4GUNA 4HNAB 4UXNA 1EBOA 2PI4A 1IBLO 1XNQB 2Y4UA 2DQ3A 1UFIA 3AG2B 3A8TA 1K9MW 4NXMB 1SQGA 4DV2O 5JH7B 3E8FA 4R7CA 3MAQA 3RGBA 2EX3A 3A5YA 1ZSPA 3WFVA 2DKGA 2RMKB 2HJFC 4DV1O 3JAMN 4UCOA 3DGEA 5JWPA 4XU3A 4PA6A 4PI0A 3TJTA 4OXSA 3RYHA 4FLWA 2ZNJA 3RYCA 1X55A 3RKWA 5IT9N 4FM1A 4DR4O 3K04A 4N23A 1K5QA 2E10A 2BTQB 2ZXFA 5CBGA 4BAYA 1S3JA 2X6CA 1XOUA 3EVKA 3CCLV 2V7QG 2AMCB 2ILMA 2DTIA 2IU3A 1QVGU 3I56V 1AJNA 2JS3A 2WLHA 1EVLA 1U97A 3STZC 4X1IB 1XMQO 1VMGA 1NJ2A 5LP6B 5KHKA 1Y74B 2BTOA 4PA4A 4YRCA 2NLJC 2Y0PA 1PPJH 1Y4MA 3NXSA 1SQQH 2RJZA 4JI1B 3W7TA 1ZTEA 4BR6A 1G8MA 3P3NA 1WLEA 4LF5B 3IJ4A 5CB4B 3HKCB 3CS5A 4RQFA 2WA3A 4ZOLA 2E41A 4DV4O 4XDLA 1WAZA 3D3QA 1AR4A 2DDZA 2XTIA 2HLDG 1SKVA 3A31A 1LUWA 3D36A 4MVUA 1YIJV 3Q4HB 1Q90D 4MW3A 4DV0B 4O2AB 4LH6A 3ZN1A 3AG1B 1SF9A 2UUBB 4LF8O 4PDMA 2CJAA 1NTMH 1WN7A 2IJHA 3CHXA 3EFFK 1H2MA 4PG3A 2JGDB 5IE9A 1FAFA 2QHTA 2QEXV 4JYAO 3SR2C 4LNSA 2OT5A 3ZRVA 1N0NA 3ZCCA 3AG3C 4UCVA 1IURA 2VQFO 2Y69B 3L70H 4FVMA 4ZTZB 2YICA 4HNAA 1BIBA 1K3EA 4PHZA 3ASNB 1VQ8V 1JFFB 1JCHA 2GHYA 2PI5A 3BFRA 1IBLB 5L3DA 4PV1B 1L8DA 1XBLA 4H2XB 3PJSK 4L87A 4JZ2A 5JH7A 2QHSA 4FFKA 4DV2B 2JEUA 1FFXB 2FYKA 3FYEB 2EZOA 5LGTA 3UH0A 1OJHA 3BA9A 4DV1B 3OR6C 2QKCA 5C93A 5H2FZ 1FXKC 1AI7A 4G2KA 4ZTUB 3MF2A 1OCOC 1Q3EA 2I4LA 4DR4B 1VP7A 2BTQA 3ABTA 4H37A 1BHBA 3JD2A 3CCVV 1YFSA 2QE7G 1HC7A 4TTVA 1LR1A 2YIBD 2CIMA 4P73A 2H3OA 3SYCA 3AG4B 1N34O 2OCCC 1GTOA 3OW2U 3JAKA 4AI8A 2EILB 1S76D 3HY0A 1Y74A 1D5AA 3CCUV 1Q81W 3A5ZA 1YXBA 3HFVA 1BQZA 1T5EA 5LGNA 4WF9V 3UM7A 2UXXA 3SJBC 4NB5A 4J9YB 5J9PC 3M99B 5GTIZ 3OAAG 4H2YA 2LFRA 3T1YB 4KR3A 1Q7YW 1BMFG 2OIEA 3IFXA 2KKWA 3CRAA 3HKCA 1QR8A 4UVCA 3LDEA 1WNSA 2PMFA 4H44B 2DTHA 4DV4B 5E3IA 3UO2A 4KFMA 5B5EZ 2F43G 4R8CA 2YS8A 1E24A 2H8PC 5JVDB 3RVYA 1NU1H 1Z7NA 3Q4HA 2YXHA 4LWSB 1OZ0A 4O2AA 3GWOA 1H2KA 2XGTA 1QHTA 1R1BA 4LF8B 1YF2A 2JGDA 3CP1A 3QF7A 3RVZA 4IIJA 4JYAB 4PD4F 1KECA 4OPHA 2GUZB 2FMLA 1MOFA 1I7FA 3RN4A 2VQFB 3QNEA 1XNRB 2DVEA 1F4MA 4B7KA 4ZIBA 1JFFA 3VOUA 5EIBC 4H2XA 3K5NA 1URFA 2PGGA 1X56A 4WF2A 1HTTA 1KMMA 1FFXA 2DOSA 3D8CA 1H8HG 3GVMA 1SESA 3ABUA 2E1HA 1YCIA 1LNQA 3L4GA 2ZT9B 2EJRA 1M5IA 4FZ1A 1MMMA 4DUYO 4JI2O 4YCWA 2QWNB 2GSMB 3A74A 3WQZA 3ZX6A 11ASA 2PF4E 1YITV 5FPRA 2R9IA 1GKFA 2R70A 3V7SA 3LDDA 2YI9A 2Q7HA 2QHUA 4MTXA 4IGGA 4JI4O 4XTVA 2EAYA 5H6RA 4TUYB 4NYKA 2DMXA 3FB5C 1EQRA 1VQ5V 4GX2A 4XDKA 2YEVB 3NENA 3OMIB 2LP7A 5EBMC 4DO2A 2PYLA 1NJ5A 2GDSA 2R9RB 3K5MA 4KQEA 1YEWA 3A32A 1BS3A 3HXWA 2ZDIA 4UV9A 2EJFA 2ZD9A 2EWNA 4X64O 1GM8A 1N9WA 1OHHG 5TISZ 2HFEC 3S3XA 5C51B 3MF1A 4UP9A 4PI2A 3OGIB 3W7XA 4ZBMA 1JJ2U 4OLFA 1H4VB 2CH7B 4UB8Z 1BIAA 3APQA 4DW1A 5JVDA 2OCHA 1YTFB 3HTZA 1TVKB 2WLIB 1E79G 4LWSA 5B1AB 12ASA 3ABLC 4YY3O 3OE7G 1RM1C 3ETDA 4WI1A 3UKMA 5B1OA 1UJWB 2YXYA 1VQNV 4RWUA 2DTOA 2E76B 1GN6A 3A7UA 1H38A 4DR5O 2LO1A 2EIKB 2DYSC 5EYPB 2GUZA 3L1AA 4I50A 1YB3A 3ZHTA 5D5QA 1KYOF 1VF6C 1FXVA 2ZTGA 4MTFA 3G71V 4B7EA 2ZGWA 4X66O 3V8KA 5JCOC 3RGLA 3QG5A 4DW0A 2QWQB 1JQ0A 3LNMB 3I5DA 4LFCO 3K9AA 1EVKA 1E1QG 1YZBA 5D5PA 2W6IG 1NR7A 3TETA 3QO5A 4G85A 4WFEA 1SA0B 3E9HA 1YSCA 2WLJA 5IY5B 1PYSB 4DUYB 4JI2B 4BWAA 1YJWV 1JMKC 2QM8A 5BR8B 2Q7GA 3HY1A 5BMVB 4DPGA 3CB2A 4K3AA 1BBWA 4XTUA 2EULA 3AK3A 2ITDC 4RDXA 3K9SA 5L3CA 4P75C 4JI4B 3BVOA 4TUYA 1H4TA 2EIJB 2ODRD 4CH5A 4TVWA 1TUBB 4JAUA 3RIRA 2QGNA 4AHCA 3ICXA 3MDSA 2YEVA 1S0VA 4K87A 1RPOA 4WFAV 3OD4A 4PELA 4LF6O 1KKDA 3TEGA 1N8RW 5C8YB 4DR1O 1Q8IA 4DR6O 3VQVA 5LMNO 4YDQA 4X64B 4YREA 3CCSV 4TWKA 1EZJA 3RBZA 1PL0A 4TWAA 3K59A 3H01A 1BE3H 2CH7A 3CC4V 2A8EA 2HG5C 4XDJA 1QLEB 4I9QA 2MW2B 3JALB 1K7DA 2WLIA 1OCRB 2K9PA 3OEHG 2ZE5A 3H1IH 2CGHA 4MVSA 4Z1MG 4YY3B 1GRJA 1S5HC 3CX5F 1VQZA 2CJBA 1EZVH 3EXAA 5LXTB 3TEHB 1ZUQA 1J5WA 4DR5B 5BY1A 2J3LA 1QF6A 4H02A 1BL8A 5EYPA 2P22C 4JF3A 1QR9A 3CE2A 3SJQC 1B70B 1VF5B 1NBMG 4QJFB 2Q67A 5L3FA 3G4SV 2B5UA 5J2TB 1YJ9V 5ITZB 3ML0A 3ETQA 1SZXA 1Z5VA 4ZKIA 2ZE8A 3HKEB 1IBMB 4LFCB 3T4DA 2A79B 5JJEB 1G4YB 3M4QA 3FB7C 2XNDG 2Q69A 3N27A 1NH2D 1F4NA 1SA0A 4YIPA 1PYSA 4MTOA 3NR7A 3KZIZ 2NNUA 1PNLA 2FTKA 2LFSA 4UP8A 2JGUA 5BMVA 3UT5B 4DR2O 1VQ7V 2X6BA 1GN4A 3P32A 1NKDA 3RF1A 2P90A 1COWG 4BW9A 5H5NA 4RUEA 4DV6B 4YRTA 1PD3A 2ARUA 3CRCA 2WLMA 3HKDB 3DXRB 2RHQB 3IC9A 4X9QA 3E8BA 1TUBA 5KAFZ 4YIOA 2IW5A 4P72C 3R66A 2QR4A 2AKWB 4YRKA 1MNGA 4FIPC 4KXRA 3RYFB 1L0LH 3L9DA 1ADYA 1IX9A 1C0AA 4RUFA 1VIBA 5C8YA 4LF6B 1IZ3A 4DR1B 3BPZA 3WB2A 1V54C 1KBHA 4DR6B 4UCTA 1Z2GA 2XT9A 3K03A 1MSWD 4O2BB 3VQWA 1NJ1A 4HWTA 1P4RA 1M4UA 3F7YC 3FB8C 3ABKC 2DQ0A 1KMIZ 3CCJV 3JALA 2JS5A 1Q86W 1I5XA 1GN3A 3G1ZA 3MD0A 2ZNIA 1IBKO 3ZMTA 3K0DA 5LHGA 3CD6V 4K86A 4NVPA 3CMAV 3P3PA 5LXTA 1ROPA 3TEHA 2OIGA 3OR7C 1BT8A 5LBQA 5KA6A 2PZSA 1HP8A 3TUPA 3RUXA 4HVCA 2YIDA 2EIMC 4BW5A 2A3QA 2P5IA 5CA0B 1B70A 1FD9A 1FKAO 3HB3B 4RAIA 3APOA 5J2TA 2UUCO 5ITZA 2C7IA 4LF7O 2DJZA 3PZCA 3D3IA 3HKEA 4KR2A 1M57C 3JAKB 4FMTA 3V7CA 2JJ1G 4YPFA 2ZIMA 1HW7A 2A06H 3OD1A 3R65A 5KUMA 5CBHA 4P71A 1DF5A 4TT3G 3RT3C 2AHYA 2E3CA 1K92A 4HYOA 2OTLV 3UT5A 4K0KB 4YJ3B 1XILA 3T1YO 5EZYB 4DR2B 3CCRV 2HNIA 1MZEA 3ZHRA 2PUSA 3ZN0A 2RQ6A 3G6BA 3HXZA 2CK3G 2ZT6A 3HRKA 3HKDA 2YC0A 3DXRA 2RHQA 2IJKA 2EBOA 2ZE6A 1XMOB 4KP4A 2Q68A 3LSUA 2AKWA 1AILA 4DR7O 1IXBA 1AVMA 3RYFA 4HZ3A 4MT8A 3E83A 2H94A 2OTJV 4LF4B 4UCSA 3ZEDA 1Q6HA 3CCMV 4FLVA 4P74A 1TA8A 3ABMB 1B06A 2F93B 1G6UA 2EINC 4IIJB 4YCVA 3CYOA 3AG3B 4CC6A 4O2BA 3WB1A 4ABMA 4BIZA 3RWRD 1SQBH 1XNRO 2ITCC 3E35A 3J80N 1V55C 3CRMA 4D7SA 4FFBB 3W7SA 1Y66A 1X54A 3FJPA 1ZL8A 4TQDA
chains in the Genus database with same CATH topology
3ABKB 2QM7A 3CCEV 11ASA 1P7BA 3ZIAG 1YITV 2Z5UA 4WFFA 2R9IA 2EIJC 3L4GB 4CH6A 1GKFA 2NS6A 3V7SA 3LDDA 3IKLA 1KMNA 2IY5A 1GM7A 1NJ6A 2Q7HA 2QHUA 2ZR3A 4MTXA 1B7YB 3ZMSA 3CXCU 3V7RA 1FXKB 4LC1A 3CC7V 1M90W 4XTVA 3OUFA 2EAYA 1SETA 4PA3A 1K33A 1OCOB 5H6RA 2E65A 4YRLA 2XASA 2WLLB 1NYQA 5K1XA 5CBFA 1DTOA 3FB5C 1EQRA 1K97A 4YRJA 1CP9A 1VQ5V 3MHSC 4G27B 2UXNA 4GX2A 4LVIA 2XAJA 1ENVA 4XDKA 2YEVB 3WG7C 5LGUA 3NENA 3P8YA 3OMIB 2EIMB 3ZMZA 2LP7A 5EBMC 4DO2A 1E1TA 4UPAA 1K34A 1PNKA 4WCEV 1NJ5A 2OCCB 2XAFA 4H2WA 2R9RB 4QE9A 1SRYA 2ZZFA 2QHVA 4KQEA 2QTOA 4XEOA 3ETEA 3A32A 1R3JC 3AG2C 1QVFU 1YI2V 1QE0A 5KUKA 4OP0A 3HXWA 4LVLA 4QPKA 1NJ8A 2WPDG 2ZDIA 4WJ3M 2X6AA 4UV9A 1VQMV 2EJFA 1E1RG 2WLNA 2W6JG 2ZD9A 2HVKC 3F5WC 1GK9A 1GM8A 2JEXA 2X0LA 1AJQA 4GCZA 1F51A 1YHQV 3W7WA 3P8VA 5K1PA 3JD1A 1N9WA 1OHHG 1QLEC 1FS0G 2HFEC 1XL6A 4KUMA 1NYRA 2DXTA 1M57B 5C51B 1FXHA 4JYBA 4K88A 1OCRC 2HR3A 3MF1A 5L3BA 4NCXA 4UP9A 3K0GA 2HVJC 3W7XA 4ZBMA 1JJ2U 3IG2A 4OLFA 1H4VB 3ASOB 1R3LC 1BIAA 1B8AA 2D3OW 1E22A 1VQPV 2IH1C 1AI4A 1R6KA 5B1BC 1YTFB 4N21A 3HTZA 2IJJA 4MVZA 2WLIB 1E79G 2DU7A 4JTCB 5B1AB 1GMGA 1JVMA 3G6EV 4YRQA 5DN6G 12ASA 3ABLC 1EIYB 3ZJZA 3OGCC 3OE7G 1VQLV 1NH2B 3LSQA 1RM1C 3ETDA 1VQ6V 1G51A 3PCOA 4WI1A 3UKMA 1XL4A 2WSSG 5B1OA 3T1CA 1UJWB 1VQKV 1VQNV 2E64A 2DTOA 3CMQA 1EFWA 4PA9A 2P6JA 4GX5A 4P73C 1AROP 1YGBA 2ZT8A 4R50A 3A7UA 2C8MA 1H38A 1R3KC 2EL9A 5ELNA 2DU5A 3IGAC 2ZQMA 3F7VC 3OM3B 4JAVA 2EIKB 3P30A 1DLBA 2DZCA 4UP7A 2DYSC 3E8HA 4U7OA 1ASZA 5IDJA 1YTFD 1QLNA 3L1AA 1YB3A 4P72A 1YFTA 3SPIA 1THZA 1K4DC 3OEEG 1KD1W 3RKXA 1WQWA 4CH4A 1FXVA 1GM9A 2A9HA 4BIUA 2ZTGA 4MTFA 1X01A 1G5IA 3G71V 3E86A 2ZGWA 4TVAA 4EX5A 3OMAB 3V8KA 1E1OA 1EOVA 3RGLA 1GGMA 2EJGA 4MVRA 2G4CA 1NR1A 4H2SA 3UGTA 1FFTB 4H2UA 4PHCA 1BHAA 3FB6C 1PKXA 1JQ0A 3LNMB 1NNHA 5BZBA 2Q5IA 4P71C 3K9AA 4LP8A 1E1QG 1EVKA 3CMEV 2W6IG 1NR7A 4X88A 3TETA 3IKMB 3QO5A 4G85A 3ZMUA 2EINB 2P7TC 4WFEA 3HXVA 3SPJA 1KC8W 1X2HA 3E9HA 1YSCA 5C52B 2WLJA 4PDRA 5IY5B 1AR1B 1LYLA 1PYSB 1QCEA 3NELA 4YRNA 1USYA 3EFSA 1YJWV 4BWAA 2Q6AA 4QIWF 3V8JA 2QM8A 1KP2A 2Q7GA 4WFHA 1V55B 3HY1A 3REUA 3QO7A 3V8LA 2ZIOA 4P3NA 3IC7A 2ZT7A 5IYBO 4DPGA 1MABG 1ATIA 4HWPA 1H2GA 1MG1A 4MVMA 1BBWA 1L1FA 4XTUA 3AG1C 4Q6GA 2ITDC 1B7YA 4FK5C 4RDXA 1FXKA 3ABMC 4QNHB 3HXXA 5L3CA 4P75C 3AEIA 3X2QC 2EZPA 2IJIA 4MW8A 3ZRWB 2WLLA 4UVAA 2XOKG 5B1NA 1S72V 1H4TA 2EIJB 3NETA 4CS4A 4TSFG 2ODRD 3ZRSA 4CH5A 4TVWA 3SYPA 3K08A 3LDCA 4JAUA 3E89A 1Q82W 3RIRA 2BOCC 2QKSA 2YEVA 3LSSA 4UVBA 1S0VA 2Y69C 4K87A 4QPJA 4P74C 4LCUC 3RW0A 1RPOA 2DZ9A 1F23A 4XU2A 3A7AA 5C53B 4WFAV 3ASNC 1B6QA 3QTCA 3REXA 1AJPA 3E8GA 4MTGA 1KOGA 3K06A 4TQDA 3ZMVA 4PELA 3WG7B 1W0KG 4TVYA 1KQSU 4WFGA 5CA3A 1KKDA 3TEGA 4RO2A 1N8RW 3KG2A 4UXNA 1EBOA 2PI4A 3VQVA 4YDQA 1EFRG 2DQ3A 4YREA 4CS2A 3CCSV 4TWKA 1EZJA 3AG2B 1K9MW 3RBZA 5HFLA 1ADJA 5HFMA 1PL0A 1M9NA 2DEQA 4TWAA 1YFRA 1I5YA 3CPWU 2DW4A 3JD3A 3E8FA 4R7CA 4LVJA 3A5YA 1IXMA 4DQ2A 3H01A 5GW7A 3WFVA 3CC4V 5ELOA 2DKGA 2A8EA 2HG5C 2HJFC 1QLEB 4XDJA 3ZRXA 3RKYA 5B3SC 1K7DA 3IALA 2WLIA 2Z3YA 4XTWA 1OCRB 2ZXWC 3DGEA 3OEHG 2DXUA 4XU3A 4PA6A 4PDLA 2CGHA 2AMCA 1BBUA 4MVSA 1M56C 3TCUA 1EIYA 4OXSA 4Z1MG 3B8NA 3HXYA 4CZZA 2ZNJA 1X55A 1S5HC 3RKWA 4HWOA 3SYQA 1VQZA 2V1DA 2CJBA 3HRIA 4JPRA 3VBBA 5B1BB 3K04A 3K79A 4N23A 4CH3A 3AG4C 1K5QA 4ASUG 2E10A 1H8EG 2ZXFA 5CBGA 3TEHB 4BAYA 2EILC 1J5WA 1S3JA 2ARTA 2X6CA 3ABLB 1HXDA 2J3LA 3UFGA 1K73W 1RM1B 1QF6A 4H02A 1BL8A 3CCLV 2V7QG 2AMCB 1HWYA 4JF3A 2DTIA 2IU3A 1QR9A 3I55V 2DYRC 3SJQC 4Q15A 2WWWA 1QVGU 3JYCA 4CBCA 1AJNA 3I56V 1NJIW 1B70B 2AHZA 3MQZA 2WLHA 2ATKC 2E5AA 3RL6A 1VQ4V 1EVLA 1NBMG 3STZC 4QJFB 5IYDO 3SYAA 4U7NA 2Q67A 5L3FA 3G4SV 1NJ2A 4DXWA 2B5UA 4Q20A 1R6NA 1YJ9V 4PA4A 2DYSB 3B77A 4YRIA 4P2ZA 2ZDIC 4PA7A 3ML0A 4YRCA 2NLJC 1Z7MA 1AI6A 4ZKIA 4J9ZB 2Q7EA 4HWRA 1Y4MA 3T4DA 3NXSA 2A79B 2Q5HA 1G4YB 3M4QA 3FB7C 4RMFA 1H4QA 2XNDG 2Q69A 3W7TA 4UUJC 1NH2D 3EFRA 2ZINA 1F4NA 1WPXA 1G8MA 3HPLC 5EK0A 1WLEA 1PYSA 4MTOA 4GX1A 2NNUA 1B76A 1QBZA 1OCZC 1PNLA 2FTKA 2LFSA 4I9WA 4RQEA 4RQFA 5KNNA 4UP8A 1NQTA 2E41A 2JIZG 1OCCC 3CCQV 1R73A 2X6BA 4XDLA 1JX9A 1VQ7V 4G28B 3P32A 2EJ9A 3A7RA 2DDZA 1NKDA 3RF1A 2JK5C 2P90A 2XTIA 2C2AA 1GO3F 1ASYA 1COWG 2HLDG 4BW9A 3L2ZA 3A31A 4RUEA 4YRTA 1DF4A 1PD3A 3D36A 4YRPA 4LVMA 2ARUA 3ZRWA 1WPYA 4MVQA 4P9PA 2WLMA 4MVUA 1YIJV 2RHQB 2WLKA 4MW3A 3E8BA 3MHHC 4XU1A 3ZN1A 3AG1B 4PDMA 2CJAA 2BOBC 3SYOA 5L3GA 3EFFK 2IJHA 5CMUA 2QA4V 3NEMA 4FJCC 4EO4A 4PG3A 2IW5A 4P72C 3X2QB 2AKWB 4YRKA 3JD4A 4X8AA 4LVKA 4FIPC 4MSWC 2QEXV 2QHTA 1ZWIC 2ALYB 1ORQC 4LNSA 2OT5A 1ADYA 1C0AA 3ZRVA 1G5HA 3ZCCA 3AG3C 3BEHA 2Y69B 4RUFA 4YXWG 3VQXA 3R07A 4ZTZB 1BIBA 3LUTB 5F5WA 3OUSA 4E51A 1JOYA 1SZTA 1K3EA 2P67A 1V54C 3ASNB 5E1AC 1JCHA 2GHYA 1VQ8V 2PI5A 1JJCB 5L3DA 4O2DA 4H2XB 3PJSK 4AH6A 3K03A 1MSWD 4L87A 2QHSA 3T4ZA 3VQWA 1CPYA 2JEUA 4EKWA 2B1IA 2FYKA 3E9IA 3HXUA 3FYEB 1NJ1A 4YP0A 3E2EA 4HWTA 2XAGA 1P4RA 2EZOA 3F7YC 3FB8C 3ABKC 5LGTA 4HWSA 2DQ0A 4J15A 1NVPB 3UH0A 3CCJV 1IL2A 1Q86W 4JYCA 1I5XA 3OR6C 1PNMA 2RHSB 5C93A 3G1ZA 4FPPA 3MD0A 4JGSA 4YCUA 1K5SA 1FXKC 1AI7A 3B8MA 4G2KA 2EWNA 2ZNIA 5HGQA 3ZMTA 3K0DA 4ZTUB 3MF2A 3BFMA 1OCOC 5LHGA 3CD6V 4K86A 4TQFA 5B3SB 3GB7C 3CMAV 2I4LA 4JASA 3DSQA 4WJ4A 3ABTA 1ROPA 2ZXWB 4H37A 4R6ZA 1BHBA 1W66A 3TEHA 1W0JG 3OR7C 3ETGA 3JD2A 5LBQA 3FKSG 4HA8A 5KA6A 1M56B 2IY5B 3CCVV 3OFNG 1YFSA 2QE7G 3TUPA 1HC7A 3RUXA 4TTVA 4HVCA 4BW5A 2EIMC 2W0FC 3T2MA 1NVPD 2P5IA 2CIMA 3CC2V 2KB1A 4PDVA 1B70A 1FYFA 4P73A 4F4LA 4YRGA 5H9CA 3AG4B 3SYCA 2OCCC 1GTOA 4P3OA 4P3PA 4MS2A 3OW2U 2ZT5A 4X5OA 1WNLA 2EILB 3HB3B 1S76D 3HY0A 4RAIA 3CCUV 1Q81W 2C7IA 3SPCA 3A5ZA 3HFVA 3W3SA 3TK1A 2DJZA 5LGNA 1YJNV 4WF9V 2DWEC 2CJ9A 2DYRB 2K1EA 1RIQA 3UM7A 2UXXA 1JPXA 4YRSA 3PZCA 5LHIA 4XEMA 4J9YB 3D3IA 5J9PC 4YRRA 3M99B 2PMEA 4KR2A 1M57C 3OAAG 4FMTA 2LFRA 4QE7A 4H2VA 4H2YA 3V7CA 4KR3A 2JJ1G 1Q7YW 4YPFA 1BMFG 3K3WA 2ZIMA 3IFXA 1WYDA 4HT4A 5FL7G 1SERA 4H33A 3OD1A 3ASOC 3R65A 4I5SA 5KUMA 5CBHA 4P71A 3WQZA 1QR8A 1AI5A 2DWDC 1DF5A 4TT3G 4UVCA 3LDEA 2AHYA 4HYOA 1K92A 2OTLV 1WQ7A 2E3CA 2PMFA 4XU0A 2DTHA 4XTXA 2I4MA 5CN0A 5B1AC 2A0LA 5E3IA 3CCRV 3LC0A 2HNIA 4KFMA 3BY6A 3QO8A 4JTAB 3ZN0A 2JJ2G 3ICAA 3SPGA 3KFUA 2F43G 1OCZB 3HXZA 4R8CA 2CK3G 3A0RA 1E24A 2I4NA 2H8PC 2ZR2A 3RVYA 1K8AW 3MEYA 2Y48A 1L0WA 4CS3A 5H6QA 1Z7NA 2I4OA 2ZT6A 5LHHA 1OCCB 3HRKA 3BJUA 2RHQA 4XTYA 1OZ0A 3FYIB 4WFBV 3I7FA 2IJKA 2YSUB 3ERRA 2EIKC 1X2GA 3GWOA 3HFZA 4YROA 4P9OA 3PCOB 2EBOA 4E2LA 1VQ9V 2XGTA 4KP4A 2Q68A 4XBFA 4P75A 1S77D 2P0LA 3CP1A 2B1GA 3RVZA 2AKWA 4GT1A 1W2BU 5DM6V 3P8TA 2WAMA 2ZZGA 5KA5A 3SPHA 2ALYA 3EHBB 3JD0A 2ZCEA 4HZ3A 2MK3A 4GX0A 4MT8A 1H4SA 1VQOV 4H2TA 1KECA 3E83A 3JCZA 1KP3A 4LBEC 1CEZA 4XTZA 2H94A 2OTJV 3HFZB 1J95A 5L3EA 2XAQA 1M1KW 3CCMV 3RACA 1MOFA 3UGQA 4P74A 4YRMA 5EC2C 3QNEA 3ABMB 4HAMA 2DVEA 1F4MA 4MVOA 2X7RB 4X89A 1JJCA 4ZIBA 3VOUA 3OMNB 2M7WA 2EINC 4TVAB 4H2XA 3VQYA 4P30A 1X56A 4WF2A 4YCVA 3CYOA 1HTTA 2JDIG 1R3IC 3AG3B 3DTUB 4UV8A 5IY5C 1KMMA 4JTDB 5IYCO 2ODRC 3W7UA 4BIZA 3M4PA 5EBWC 1H8HG 4YYEA 2ITCC 3E35A 1SESA 3ABUA 1V54B 2J3MA 1V55C 2IH3C 2E1HA 4G84A 4YRFA 3L4GA 1LNQA 2HKOA 2EJRA 3W7SA 2ARSA 5EC1C 4YCWA 1RPRA 3STLC 5EBLC 1WU7A 1Y66A 1X54A 2RHSA 3FJPA 2GSMB 2ZZEA 3A74A 2IU0A 1TUEB 1USYC 1K4CC 2XAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 11AS A;  4CH6 A;  3L4G B;  3V7S A;  3IKL A;  1KMN A;  2IY5 A;  1NJ6 A;  2Q7H A;  2QHU A;  2ZR3 A;  1B7Y B;  3V7R A;  4XTV A;  2EAY A;  1SET A;  4YRL A;  2E65 A;  1NYQ A;  5K1X A;  1EQR A;  4YRJ A;  3NEN A;  3P8Y A;  1E1T A;  4UPA A;  1NJ5 A;  4H2W A;  1SRY A;  2ZZF A;  2QHV A;  4KQE A;  4XEO A;  3A32 A;  1QE0 A;  4OP0 A;  3HXW A;  1NJ8 A;  4WJ3 M;  2EJF A;  2EWN A;  5K1P A;  3P8V A;  1NYR A;  1N9W A;  2DXT A;  5C51 B;  4K88 A;  3MF1 A;  4NCX A;  4UP9 A;  4OLF A;  3IG2 A;  1H4V B;  1BIA A;  1E22 A;  4YYE A;  3P8T A;  4XTY A;  3HTZ A;  2DU7 A;  4YRQ A;  12AS A;  1EIY B;  3LSQ A;  3PCO A;  1G51 A;  4WI1 A;  1EFW A;  2E64 A;  3CMQ A;  2DTO A;  4P73 C;  1YGB A;  2ZT8 A;  3A7U A;  5ELN A;  2C8M A;  2DU5 A;  2EL9 A;  2DZC A;  4UP7 A;  1ASZ A;  3L1A A;  1YB3 A;  4P72 A;  1YFT A;  3RKX A;  4CH4 A;  1WQW A;  2ZTG A;  1X01 A;  1G5I A;  2ZGW A;  4TVA A;  4EX5 A;  3V8K A;  1E1O A;  1EOV A;  3RGL A;  1GGM A;  2EJG A;  2G4C A;  4H2S A;  3UGT A;  4H2U A;  4PHC A;  1NNH A;  2Q5I A;  4P71 C;  1EVK A;  3REU A;  3IKM B;  3QO5 A;  4G85 A;  3HXV A;  1X2H A;  3E9H A;  5C52 B;  1PYS B;  1LYL A;  3NEL A;  4YRN A;  1USY A;  3EFS A;  4BWA A;  3V8J A;  2Q7G A;  3HY1 A;  3V8L A;  3QO7 A;  2ZIO A;  4P3N A;  2ZT7 A;  4DPG A;  1ATI A;  4HWP A;  1BBW A;  4XTU A;  4Q6G A;  1B7Y A;  4RDX A;  3HXX A;  4P75 C;  1H4T A;  3NET A;  4CS4 A;  2ODR D;  4CH5 A;  4TVW A;  3RIR A;  3LSS A;  4K87 A;  4P74 C;  2DZ9 A;  4XU2 A;  3A7A A;  5C53 B;  3QTC A;  3REX A;  1KOG A;  4TVY A;  3TEG A;  3VQV A;  4YDQ A;  2DQ3 A;  4YRE A;  4CS2 A;  1ADJ A;  2DEQ A;  4TWA A;  1YFR A;  3A5Y A;  4DQ2 A;  5ELO A;  2DKG A;  3RKY A;  3IAL A;  4XTW A;  2DXU A;  4XU3 A;  2CGH A;  2AMC A;  1BBU A;  1EIY A;  3HXY A;  2ZNJ A;  1X55 A;  3RKW A;  4HWO A;  1VQZ A;  3HRI A;  2CJB A;  3VBB A;  4CH3 A;  2E10 A;  2ZXF A;  3TEH B;  1J5W A;  2ART A;  1HXD A;  2J3L A;  3UFG A;  1QF6 A;  4H02 A;  2AMC B;  2DTI A;  4Q15 A;  1B70 B;  3RL6 A;  2E5A A;  1EVL A;  1NJ2 A;  4YRI A;  4YRC A;  1Z7M A;  2Q7E A;  4HWR A;  2Q5H A;  4RMF A;  3M4Q A;  3EFR A;  2ZIN A;  1WLE A;  1PYS A;  1B76 A;  4RQE A;  4RQF A;  5KNN A;  4UP8 A;  2E41 A;  2ARS A;  3A7R A;  2EJ9 A;  2DDZ A;  3RF1 A;  2XTI A;  4BW9 A;  3L2Z A;  3A31 A;  4YRT A;  4YRP A;  2ARU A;  1WPY A;  2RHQ B;  4XU1 A;  2CJA A;  3NEM A;  4EO4 A;  4PG3 A;  4P72 C;  2AKW B;  4YRK A;  2QHT A;  2ALY B;  4LNS A;  1ADY A;  1C0A A;  1G5H A;  3VQX A;  3R07 A;  4ZTZ B;  1BIB A;  5F5W A;  4E51 A;  1JJC B;  4O2D A;  4H2X B;  4AH6 A;  4L87 A;  2QHS A;  3VQW A;  3HXU A;  2FYK A;  3E9I A;  1NJ1 A;  4YP0 A;  4HWT A;  4HWS A;  2DQ0 A;  4J15 A;  3UH0 A;  1IL2 A;  2RHS B;  3G1Z A;  4YCU A;  2ZNI A;  5HGQ A;  4ZTU B;  3MF2 A;  3BFM A;  4K86 A;  4TQF A;  2I4L A;  4WJ4 A;  3DSQ A;  1W66 A;  1ASY A;  3TEH A;  4HA8 A;  2IY5 B;  1YFS A;  3TUP A;  1HC7 A;  3RUX A;  4TTV A;  4HVC A;  2P5I A;  2CIM A;  1B70 A;  1FYF A;  4P73 A;  4YRG A;  4P3O A;  4P3P A;  4X5O A;  2ZT5 A;  1WNL A;  3HY0 A;  2C7I A;  3W3S A;  3A5Z A;  3HFV A;  2DJZ A;  2CJ9 A;  1RIQ A;  4YRS A;  3PZC A;  4XEM A;  4YRR A;  2PME A;  4KR2 A;  4H2V A;  4H2Y A;  3V7C A;  4KR3 A;  4YPF A;  2ZIM A;  1WYD A;  1SER A;  3OD1 A;  4P71 A;  3WQZ A;  1WQ7 A;  2E3C A;  2PMF A;  4XU0 A;  2DTH A;  4XTX A;  2I4M A;  5E3I A;  3LC0 A;  2HNI A;  3QO8 A;  3ICA A;  3KFU A;  3HXZ A;  1H4Q A;  2I4N A;  1E24 A;  3MEY A;  1L0W A;  2ZR2 A;  4CS3 A;  1Z7N A;  2I4O A;  2ZT6 A;  3HRK A;  3BJU A;  2RHQ A;  3I7F A;  3ERR A;  1X2G A;  4YRO A;  3HFZ A;  3PCO B;  2XGT A;  4P75 A;  2P0L A;  2AKW A;  2ZZG A;  2ALY A;  2ZCE A;  1H4S A;  4H2T A;  4XTZ A;  3HFZ B;  3RAC A;  3UGQ A;  4YRM A;  4P74 A;  3QNE A;  2DVE A;  1JJC A;  4ZIB A;  4TVA B;  4H2X A;  3VQY A;  1X56 A;  4WF2 A;  4YCV A;  1HTT A;  1KMM A;  2ODR C;  3M4P A;  1SES A;  2J3M A;  2E1H A;  4G84 A;  4YRF A;  3L4G A;  4YCW A;  1WU7 A;  2RHS A;  1X54 A;  3FJP A;  2ZZE A;  3A74 A;  1B8A A;  1USY C;  4TQD A; 
#chains in the Genus database with same CATH topology
 4NXN O;  2QM7 A;  1P7B A;  1IBK B;  2Z5U A;  3L4G B;  4EB6 B;  1SS3 A;  3WB0 A;  2F23 A;  2ZR3 A;  1B7Y B;  3CXC U;  1FXK B;  3CC7 V;  2CGO A;  3OUF A;  2HP8 A;  5CA0 A;  1OCO B;  4LR3 A;  4YRL A;  3CRR A;  2XAS A;  5CBF A;  1CP9 A;  3MHS C;  4LVI A;  3WG7 C;  2UUC B;  1HNZ O;  4YJ2 B;  4LF7 B;  1K34 A;  5LOV B;  2OCC B;  4QE9 A;  1US6 A;  4W4K A;  1QVF U;  1QE0 A;  4OP0 A;  2WPD G;  4WJ3 M;  2X6A A;  1VQM V;  3F5T A;  1E1R G;  3F5W C;  2W6J G;  2HVK C;  1GK9 A;  4I0X B;  2JEX A;  1L0N H;  1NYR A;  4B3S B;  3FFQ A;  4YJ3 A;  3CJH B;  2HR3 A;  5J2U B;  5L3B A;  2E5L O;  5EZY A;  5JJJ B;  2VQE B;  3K0G A;  3L72 H;  1DK1 A;  5LYJ A;  5KHI A;  4X1Y B;  2IH1 C;  5B1B C;  2IJJ A;  4JTC B;  1GMG A;  4HBN A;  3BHP A;  1WPB A;  1EIY B;  3ZJZ A;  3OGC C;  5IJ9 B;  1I94 O;  1VQ6 V;  3H9V A;  1G51 A;  4F6E A;  1EFW A;  4GX5 A;  1AR5 A;  5ELN A;  2EL9 A;  4DR7 B;  4FLX A;  5GTH Z;  3B09 A;  1DLB A;  2DZC A;  5IWA O;  2Z0A A;  4CC5 A;  1IDS A;  4UP7 A;  4U7O A;  5IDJ A;  1YTF D;  1THZ A;  3OEE G;  3RKX A;  4GKJ B;  4I7Z B;  3DC5 A;  3E86 A;  2CAZ C;  1EOV A;  1GGM A;  2G4C A;  4H2S A;  4H2U A;  4PHC A;  1BSM A;  4W4L A;  4I50 B;  5BZB A;  2VWK A;  3IKM B;  1I08 A;  3ZMU A;  4FFB A;  1BGY H;  4X65 O;  1N32 O;  5C52 B;  4PDR A;  1AR1 B;  1SQP H;  5AG2 A;  3HR0 A;  4QIW F;  4UCU A;  1X4T A;  2AZ2 A;  4GYC B;  1H2L A;  3QO7 A;  4NXN B;  3RYI B;  1MAB G;  4EB6 A;  4MVM A;  3JAR A;  1L1F A;  3J81 N;  1B7Y A;  1TGO A;  1FXK A;  3T1H O;  2QWR B;  4QNH B;  5BR8 O;  3X2Q C;  2EZP A;  2ETN A;  4TV9 B;  2V4D A;  4TSF G;  3ZRS A;  2YDE A;  1Q82 W;  2BOC C;  4O4L A;  3LSS A;  4YJ2 A;  4QPJ A;  1HNZ B;  4LCU C;  5LOV A;  3O65 A;  3ZS8 C;  4XU2 A;  3A7A A;  4K8X A;  1N4C A;  1AJP A;  4EFB A;  4MTG A;  1KOG A;  1VAR A;  2F1M A;  1KQS U;  5CA3 A;  4YHH O;  3KG2 A;  1B04 A;  4I0X A;  4DV5 O;  4B3R O;  4CS2 A;  3CJH A;  1XEQ A;  5J2U A;  1ADJ A;  1YFR A;  1I5Y A;  1Q43 A;  3CPW U;  2E5L B;  5JJN B;  2PTM A;  5ELO A;  4X1Y A;  1NTZ H;  3RKY A;  5B3S C;  3IAL A;  2RCV A;  4J7J A;  2ZXW C;  4ZI7 B;  4H0L B;  1JA8 A;  2ODM A;  1EIY A;  5IJ9 A;  1M56 C;  3C90 A;  3HXY A;  4CZZ A;  1I94 B;  4TOI A;  3SYQ A;  4CH3 A;  3K79 A;  2Q0A A;  4ASU G;  4B3M O;  3ABL B;  2ZE7 A;  1K73 W;  1RM1 B;  3KCY A;  1Y67 A;  4FZ0 A;  1HWY A;  5IWA B;  2YUA A;  5LA6 A;  3I55 V;  2DYR C;  1RP3 B;  4NTX A;  1H2S B;  2WWW A;  2E5A A;  5IYD O;  3THO A;  4U7N A;  2VRZ A;  4DXW A;  5KHH A;  4Q20 A;  2DYS B;  3B77 A;  4YRI A;  4P2Z A;  2UU9 B;  4WBN B;  1Z7M A;  1AI6 A;  4J9Z B;  4HWR A;  4JAA A;  4RMF A;  4A5U B;  4UUJ C;  2ZIN A;  4X65 B;  5EK0 A;  3RFR A;  1N32 B;  2F66 C;  4GX1 A;  1QBZ A;  1OCZ C;  3BRC A;  4RQE A;  1IBM O;  5KNN A;  1N36 B;  2BSK B;  5BXZ A;  4AQY O;  3RYI A;  1OCC C;  1JX9 A;  2EJ9 A;  4G28 B;  3U10 A;  3ZBH A;  4B3T B;  2GTS A;  4LNU B;  3T1H B;  4YRP A;  4LVM A;  3H1J H;  4P9P A;  4D7T A;  4TV9 A;  2R9A A;  2L6L A;  3MHH C;  2BOB C;  3JSN A;  3SYO A;  5CMU A;  4FJC C;  4UFZ A;  4I55 B;  3JD4 A;  4X8A A;  4DV6 O;  2Q73 A;  4LVK A;  2ALY B;  1ORQ C;  5KAI Z;  3R07 A;  4YHH B;  3UCS C;  3OUS A;  1JOY A;  2P67 A;  5E1A C;  1KU9 A;  2YIB A;  4DV5 B;  4O2D A;  2QJ1 A;  3N2K B;  4B3R B;  4IYI A;  5KHG A;  4AH6 A;  4GLX A;  5KX5 B;  1CPY A;  2LW1 A;  2B1I A;  4UCR A;  3E2E A;  3BCC H;  2Q9L A;  4HWS A;  4I4T B;  1U96 A;  1NVP B;  1IL2 A;  4JYC A;  2ZKO A;  4ZI7 A;  1SC5 B;  1PNM A;  4FPP A;  4U3F H;  3SJA C;  2LGW A;  4YCU A;  3B8M A;  5FLX N;  3OTO O;  1O9H A;  3BFM A;  3GB7 C;  1KKC A;  4WJ4 A;  4JAS A;  3JAS B;  2QM4 A;  1ASY A;  3ETG A;  3FKS G;  3OFN G;  2YI8 A;  4B3M B;  4JI5 B;  2HJD A;  2W0F C;  4DK0 A;  2KB1 A;  4PDV A;  1FYF A;  4YRG A;  1MA1 A;  1YDX A;  4F4L A;  2N74 A;  2XHB A;  4P3O A;  3BA8 A;  1OV9 A;  1WP7 A;  2XTA A;  3SPC A;  3W3S A;  3TK1 A;  1YJN V;  2DWE C;  2CTP A;  2CJ9 A;  4WBN A;  4JV5 O;  4YRS A;  1VF6 A;  3KCX A;  4XEM A;  4H2V A;  2CTW A;  5JCO A;  1WP8 A;  4HT4 A;  2CGN A;  4F6R B;  2BCC H;  1DGS A;  2KG7 B;  3ASO C;  2DWD C;  2BSK A;  3H1L H;  4XU0 A;  4AQY B;  2A0L A;  1PV0 A;  3LC0 A;  1QU7 A;  3CXH F;  3QO8 A;  4JTA B;  4C7U A;  2I4N A;  1L0W A;  4LNU A;  3O9O A;  3S3W A;  1K8A W;  5H6Q A;  4K0K O;  3BJU A;  2OWO A;  1P7G A;  4YRO A;  3HFZ A;  1AP5 A;  4P9O A;  4XBF A;  4P75 A;  4I55 A;  2B1G A;  1HNX O;  3FD9 A;  5DM6 V;  1P84 F;  2GTA A;  2ZZG A;  2FKX A;  2ALY A;  2ZCE A;  3EHB B;  3JD0 A;  2MK3 A;  4FLZ A;  2E75 B;  1H4S A;  4UB6 Z;  1VQO V;  4H2T A;  3JCZ A;  1CEZ A;  1XMO O;  4KL1 A;  1M1K W;  2VWJ A;  4NTY A;  3K5O A;  5EC2 C;  1A32 A;  4MVO A;  1GH6 A;  3J7A U;  3CEI A;  2QWO B;  4TVA B;  1EN6 A;  3N2K A;  3VQY A;  3JAW B;  4UV8 A;  1R3I C;  5KX5 A;  4LF4 O;  5IYC O;  2ODR C;  2OYQ A;  3W7U A;  3M4P A;  5EBW C;  5DED A;  1V54 B;  2P5O A;  2J3M A;  4I4T A;  4JI3 B;  5EC1 C;  1NTK H;  1RPR A;  2LW7 A;  5EBL C;  3DC6 A;  2IU0 A;  1B8A A;  1K4C C;  4YYE A;  2XAH A;  3ABK B;  3D36 C;  3ZIA G;  3OTO B;  3JAS A;  4CH6 A;  2AGA A;  2NS6 A;  3IKL A;  5E79 Z;  1GM7 A;  1NJ6 A;  3V7R A;  3ZMS A;  2ADQ B;  1M90 W;  1WB8 A;  1SET A;  1FPO A;  1ZL8 B;  4OGQ B;  4BIO A;  2E65 A;  2WLL B;  1NYQ A;  5K1X A;  1ZLZ A;  4PJ0 Z;  2IBZ H;  4Z2W A;  4G27 B;  2CTR A;  2UXN A;  1ENV A;  4LFB O;  2EIM B;  4FLU A;  3CSX A;  1E1T A;  2L35 A;  4UPA A;  4WCE V;  2XAF A;  4JV5 B;  1SRY A;  2ZZF A;  4XEO A;  2QTO A;  3ETE A;  3AG2 C;  1YI2 V;  3C3S A;  4LVL A;  4QPK A;  3U0Z A;  1NJ8 A;  1Q6U A;  2PYJ A;  4F6R A;  2WLN A;  2KG7 A;  3TXQ A;  1F51 A;  3TGU H;  3W7W A;  1YHQ V;  3P8V A;  1FS0 G;  2DXT A;  1JR9 A;  1S5J A;  1M57 B;  1FXH A;  1AB3 A;  4K88 A;  2GV9 A;  1EN4 A;  5KHJ A;  1E22 A;  1AI4 A;  3CWB H;  2WA4 A;  4B3S O;  4XTY A;  4MVZ A;  4JYY A;  3G6E V;  5DN6 G;  2VQE O;  1NH2 B;  3LSQ A;  1YVW A;  1BQ0 A;  4OX9 O;  4NR1 A;  1XL4 A;  3T1C A;  2P4V A;  1HDJ A;  2E64 A;  3CMQ A;  1VF7 A;  5LYJ B;  4P73 C;  2P6J A;  1ARO P;  1HNX B;  4R50 A;  2RDC A;  2G38 A;  3PN1 A;  3IGA C;  3F7V C;  3OM3 B;  4JAV A;  4J7Z A;  4FLY A;  5LP6 C;  1O9G A;  2CE4 A;  1QLN A;  1N0J A;  4P72 A;  1YFT A;  4X20 B;  3SPI A;  2BE3 A;  1K4D C;  4B08 A;  1GM9 A;  4BIU A;  1G5I A;  4TVA A;  3A0H Z;  3OMA B;  4DK1 A;  1E1O A;  3JAW A;  2N04 A;  1Z5W A;  1FFT B;  1MSD A;  2QSA A;  2Q5I A;  4GKJ O;  4X88 A;  1W59 A;  2EIN B;  1NS1 A;  3SPJ A;  1KC8 W;  1X2H A;  2FB5 A;  3NEL A;  4YRN A;  3EFS A;  4JI8 B;  2Q6A A;  2LQT A;  1KP2 A;  1V55 B;  3B40 A;  2ZIO A;  4P3N A;  2VS0 A;  3IC7 A;  4LF9 B;  2HHH B;  5IYB O;  2NN4 A;  1ATI A;  4HWP A;  1H2G A;  1MG1 A;  2QDO A;  3AG1 C;  1H2N A;  4FK5 C;  5EIB D;  1F7Y A;  3ABM C;  4O4H B;  3HXX A;  4D6T H;  2IJI A;  3ZRW B;  2WLL A;  4UVA A;  2XOK G;  1S72 V;  3NET A;  4CS4 A;  5IJ0 A;  3SYP A;  3E89 A;  3JAR B;  1HR0 O;  5B66 Z;  2Y69 C;  1SQX H;  2PY5 A;  2A7W A;  3WU2 Z;  4LFB B;  3RW0 A;  3ASN C;  3OT7 A;  1RFY A;  2E74 B;  3ZMV A;  2Q0O C;  3WG7 B;  1W0K G;  4TVY A;  4O4L B;  4RO2 A;  1GAX A;  1FYJ A;  1MZF A;  2FL4 A;  1EFR G;  5IYZ B;  5HFL A;  5HFM A;  1M9N A;  2DEQ A;  2YIA A;  2DW4 A;  3JD3 A;  4LVJ A;  1IXM A;  4DQ2 A;  2P4K A;  5GW7 A;  3FAV B;  4O4I B;  4XTW A;  2Z3Y A;  2DXU A;  4IT5 A;  4PDL A;  2AMC A;  1BBU A;  3TCU A;  3B8N A;  1RSO B;  1NT2 B;  4HWO A;  4OX9 B;  2V1D A;  3HRI A;  4JPR A;  3VBB A;  5B1B B;  4X1I A;  3AG4 C;  1LUV A;  1H8E G;  5LP6 A;  1XMQ B;  2EIL C;  2ART A;  1HXD A;  3UFG A;  3L75 H;  5GON B;  3C3T A;  2ARH A;  2QTS A;  4TV8 B;  2CDY A;  5F2V O;  3AG7 A;  4Q15 A;  4X20 A;  3JYC A;  4CBC A;  3MQZ A;  1NJI W;  4LFA O;  2AHZ A;  3RL6 A;  2ATK C;  1VQ4 V;  2ZM6 O;  3SYA A;  2CUG A;  3H1K H;  4DUZ O;  1R6N A;  2YXL A;  5CB4 A;  1QQC A;  2ZDI C;  4PA7 A;  2Q7E A;  5LA6 B;  2Q5H A;  1D5N A;  4X62 O;  1WB7 A;  3EFR A;  1WPX A;  3HPL C;  4J7K A;  2UU9 O;  1B76 A;  4I9W A;  2Y4T A;  2XUM A;  3OTF A;  1NQT A;  3K57 A;  2JIZ G;  3BAB A;  4JZG A;  1R73 A;  3CCQ V;  4DR3 O;  1Y6X A;  2GBO A;  2ARS A;  3A7R A;  1M93 A;  2JK5 C;  1AP6 A;  2C2A A;  1GO3 F;  2Q8V A;  3JCU Z;  2F4V O;  4O4H A;  3L2Z A;  1DF4 A;  1N36 O;  3ZRW A;  4OPA A;  4MVQ A;  1WPY A;  1TAE A;  2WLK A;  3CRQ A;  4XU1 A;  4B3T O;  1XDC A;  3N2G B;  5L3G A;  2QA4 V;  3NEM A;  4EO4 A;  1HR0 B;  3X2Q B;  4MSW C;  1ZWI C;  3L73 H;  4H13 B;  4ZHQ B;  1G5H A;  3BEH A;  4YXW G;  3VQX A;  3LUT B;  5F5W A;  4E51 A;  1SZT A;  1JJC B;  4Z1V A;  4GZR B;  2Q5Z A;  5IYZ A;  4IHJ B;  4JI0 O;  1N33 O;  2Y0I A;  2UXC O;  3T4Z A;  3JAT B;  1WA8 B;  4EKW A;  3HXU A;  4QGP A;  3E9I A;  4YP0 A;  2XAG A;  3FAV A;  1B3Q A;  4J10 A;  2EJ7 A;  1PL4 A;  4J15 A;  4O4I A;  2NR5 A;  1V9P A;  1S5L Z;  4JI6 O;  2RHS B;  2AW9 A;  4JGS A;  2RNB A;  1RSO A;  1K5S A;  5HGQ A;  3BAA A;  3AK1 A;  1N34 B;  4TQF A;  5B3S B;  5JQG B;  3DSQ A;  1W66 A;  2ZXW B;  4R6Z A;  4X1K B;  3HKB B;  1W0J G;  4HA8 A;  3ZHS A;  1M56 B;  2IY5 B;  5GON A;  1NVP D;  3T2M A;  4KHP O;  1Q5O A;  4TV8 A;  3CC2 V;  2HEP A;  1PP9 H;  2ADP A;  2D2C B;  5H9C A;  4P3P A;  4X5O A;  4MS2 A;  1Q6I A;  2ZT5 A;  4LFA B;  1WNL A;  1BCC H;  2ZM6 B;  5FNV B;  3UO3 A;  1HNW O;  4DUZ B;  1XRE A;  4JI5 O;  2DYR B;  2K1E A;  2RN9 A;  1RIQ A;  1JPX A;  4J80 A;  5LHI A;  3K58 A;  4YRR A;  1P49 A;  1IVS A;  2PME A;  4QE7 A;  4X62 B;  2LJ2 A;  3E22 B;  5LMU O;  2CTQ A;  3K3W A;  4DRX B;  1WYD A;  5CA1 B;  5FL7 G;  1SER A;  2DN9 A;  4H33 A;  1JJO A;  4I5S A;  1AI5 A;  1WQ7 A;  4XTX A;  2I4M A;  5CN0 A;  5B1A C;  4DR3 B;  3BY6 A;  2B9Z A;  2JJ2 G;  2F4V B;  3ICA A;  1Y76 B;  3SPG A;  3KFU A;  1OCZ B;  2QKA A;  3A0R A;  3U11 A;  3MEY A;  4CS3 A;  1H4Q A;  2ZR2 A;  3ZHQ A;  1EN5 A;  2Y48 A;  2Q4P A;  2I4O A;  4IYH A;  5LHH A;  1OCC B;  2UXD O;  2P06 A;  3FYI B;  4WFB V;  3I7F A;  2YSU B;  3ERR A;  2EIK C;  1X2G A;  1I0H A;  3PCO B;  3N2G A;  4E2L A;  1VQ9 V;  3L71 H;  1XUQ A;  4LH7 A;  4DV3 O;  1CXZ B;  1S77 D;  2P0L A;  1SQF A;  1R6T A;  4GT1 A;  2AZ0 A;  5DEC A;  1W2B U;  4NKG B;  4DYL A;  3M8A A;  2M6Y A;  2WAM A;  5KA5 A;  3SPH A;  4GX0 A;  4O4J B;  2UXB O;  4ZHQ A;  4EFE A;  1KP3 A;  4LBE C;  4XTZ A;  1NZ6 A;  2KQX A;  3KKY A;  3HFZ B;  1J95 A;  5L3E A;  2XAQ A;  3RAC A;  3IAY A;  3UGQ A;  4YRM A;  4HAM A;  3SDL A;  3M7M X;  4X89 A;  2X7R B;  1JJC A;  5FPO A;  3OMN B;  2M7W A;  4P30 A;  4IHJ A;  3SGI A;  4FM2 A;  4JI0 B;  2JDI G;  3DTU B;  1N33 B;  5IY5 C;  3JAT A;  4JTD B;  1WA8 A;  4FM0 A;  1FJG O;  2UXC B;  4ICG A;  5KMG B;  1QNM A;  3QVN A;  4K35 A;  2IH3 C;  4G84 A;  4YRF A;  5A9G A;  2HKO A;  3STL C;  4GKK O;  1WU7 A;  2RHS A;  4JI6 B;  2UUA O;  2ZZE A;  3ZRX A;  1TUE B;  1USY C;  1XQ8 A;  3CCE V;  4IL6 Z;  4WFF A;  4JI3 O;  5JQG A;  2EIJ C;  4X1K A;  3HKB A;  3SJC C;  1KMN A;  2IY5 A;  4LC1 A;  4J42 A;  3FX7 A;  4U3J B;  4KHP B;  4PA3 A;  1K33 A;  3B4S A;  1SQV H;  1DTO A;  1K97 A;  4YRJ A;  1XI1 A;  5FNV A;  3L74 H;  5LL6 Y;  1WJZ A;  2XAJ A;  4NTW A;  5LGU A;  4DV7 O;  3P8Y A;  1HNW B;  3ZMZ A;  4JI7 O;  1PNK A;  4H2W A;  4L8J A;  2QHV A;  2LGQ A;  1J5E O;  1R3J C;  1UPG A;  5KUK A;  1ZAU A;  3E22 A;  1XHX A;  2DJV A;  2QWP B;  4DRX A;  5CA1 A;  5LMU B;  2DE0 X;  1XNQ O;  4GCZ A;  2X0L A;  1AJQ A;  5K1P A;  1TVK A;  3JD1 A;  1VEW A;  1QLE C;  4KUM A;  1XL6 A;  3UQ8 A;  4NXM O;  3K5L A;  4JYB A;  1OCR C;  4NCX A;  2HVJ C;  4J41 A;  3IG2 A;  3ASO B;  1R3L C;  3B2E E;  1Y76 A;  2D3O W;  1VQP V;  1R6K A;  2JVD A;  3P8T A;  4N21 A;  1KB9 F;  2DU7 A;  2R72 A;  1JVM A;  4YRQ A;  2UXD B;  1VQL V;  3GWK C;  3RYH B;  3AK2 A;  3PCO A;  3RYC B;  3G80 A;  2WSS G;  1VQK V;  4PA9 A;  4DV3 B;  1YGB A;  2ZT8 A;  2C8M A;  1R3K C;  2DU5 A;  2ZQM A;  4X66 B;  2F95 B;  4O4J A;  3A2F A;  3P30 A;  1NI8 A;  2O57 A;  2UXB B;  3E8H A;  2FYU H;  4FLT A;  1ASZ A;  1KD1 W;  4CH4 A;  1WQW A;  2A9H A;  4K8Z A;  1X01 A;  1BZK A;  5A2Q N;  4EX5 A;  3ZHU A;  3ZHV A;  2EJG A;  4MVR A;  3TXS A;  3UGT A;  1NR1 A;  1BHA A;  3FB6 C;  1PKX A;  1NNH A;  2W0X A;  5KMG A;  1FJG B;  4P71 C;  4LP8 A;  3REU A;  3CME V;  4JI1 O;  1X59 A;  2P7T C;  3HXV A;  3H1H H;  4LF5 O;  1LYL A;  1QCE A;  1USY A;  4GKK B;  3V8J A;  2KSD A;  1XHZ A;  2UUA B;  3V8L A;  4WFH A;  1D2D A;  4ZOL B;  2ZT7 A;  2AXT Z;  1EM1 A;  4E4E A;  1KUQ A;  1ZX3 A;  4Q6G A;  4JI8 O;  1PM9 A;  1G1X B;  4U3J A;  3AEI A;  3A0B Z;  3JSL A;  4EEQ A;  4MW8 A;  4DV0 O;  4LF9 O;  5B1N A;  2HHH O;  2IM9 A;  2N05 A;  2UUB O;  3G67 A;  3K08 A;  3LDC A;  4AIL C;  2QKS A;  4UVB A;  4DV7 B;  4P74 C;  3LNN A;  4JI7 B;  2DZ9 A;  1F23 A;  1GN2 A;  5LMN B;  5C53 B;  2JRI A;  1B6Q A;  3QTC A;  3REX A;  4J11 A;  3E8G A;  5IJ0 B;  3K06 A;  1J5E B;  5KLV H;  4WFG A;  4GUN A;  4HNA B;  4UXN A;  1EBO A;  2PI4 A;  1IBL O;  1XNQ B;  2Y4U A;  2DQ3 A;  1UFI A;  3AG2 B;  3A8T A;  1K9M W;  4NXM B;  1SQG A;  4DV2 O;  5JH7 B;  3E8F A;  4R7C A;  3MAQ A;  3RGB A;  2EX3 A;  3A5Y A;  1ZSP A;  3WFV A;  2DKG A;  2RMK B;  2HJF C;  4DV1 O;  3JAM N;  4UCO A;  3DGE A;  5JWP A;  4XU3 A;  4PA6 A;  4PI0 A;  3TJT A;  4OXS A;  3RYH A;  4FLW A;  2ZNJ A;  3RYC A;  1X55 A;  3RKW A;  5IT9 N;  4FM1 A;  4DR4 O;  3K04 A;  4N23 A;  1K5Q A;  2E10 A;  2BTQ B;  2ZXF A;  5CBG A;  4BAY A;  1S3J A;  2X6C A;  1XOU A;  3EVK A;  3CCL V;  2V7Q G;  2AMC B;  2ILM A;  2DTI A;  2IU3 A;  1QVG U;  3I56 V;  1AJN A;  2JS3 A;  2WLH A;  1EVL A;  1U97 A;  3STZ C;  4X1I B;  1XMQ O;  1VMG A;  1NJ2 A;  5LP6 B;  5KHK A;  1Y74 B;  2BTO A;  4PA4 A;  4YRC A;  2NLJ C;  2Y0P A;  1PPJ H;  1Y4M A;  3NXS A;  1SQQ H;  2RJZ A;  4JI1 B;  3W7T A;  1ZTE A;  4BR6 A;  1G8M A;  3P3N A;  1WLE A;  4LF5 B;  3IJ4 A;  5CB4 B;  3HKC B;  3CS5 A;  4RQF A;  2WA3 A;  4ZOL A;  2E41 A;  4DV4 O;  4XDL A;  1WAZ A;  3D3Q A;  1AR4 A;  2DDZ A;  2XTI A;  2HLD G;  1SKV A;  3A31 A;  1LUW A;  3D36 A;  4MVU A;  1YIJ V;  3Q4H B;  1Q90 D;  4MW3 A;  4DV0 B;  4O2A B;  4LH6 A;  3ZN1 A;  3AG1 B;  1SF9 A;  2UUB B;  4LF8 O;  4PDM A;  2CJA A;  1NTM H;  1WN7 A;  2IJH A;  3CHX A;  3EFF K;  1H2M A;  4PG3 A;  2JGD B;  5IE9 A;  1FAF A;  2QHT A;  2QEX V;  4JYA O;  3SR2 C;  4LNS A;  2OT5 A;  3ZRV A;  1N0N A;  3ZCC A;  3AG3 C;  4UCV A;  1IUR A;  2VQF O;  2Y69 B;  3L70 H;  4FVM A;  4ZTZ B;  2YIC A;  4HNA A;  1BIB A;  1K3E A;  4PHZ A;  3ASN B;  1VQ8 V;  1JFF B;  1JCH A;  2GHY A;  2PI5 A;  3BFR A;  1IBL B;  5L3D A;  4PV1 B;  1L8D A;  1XBL A;  4H2X B;  3PJS K;  4L87 A;  4JZ2 A;  5JH7 A;  2QHS A;  4FFK A;  4DV2 B;  2JEU A;  1FFX B;  2FYK A;  3FYE B;  2EZO A;  5LGT A;  3UH0 A;  1OJH A;  3BA9 A;  4DV1 B;  3OR6 C;  2QKC A;  5C93 A;  5H2F Z;  1FXK C;  1AI7 A;  4G2K A;  4ZTU B;  3MF2 A;  1OCO C;  1Q3E A;  2I4L A;  4DR4 B;  1VP7 A;  2BTQ A;  3ABT A;  4H37 A;  1BHB A;  3JD2 A;  3CCV V;  1YFS A;  2QE7 G;  1HC7 A;  4TTV A;  1LR1 A;  2YIB D;  2CIM A;  4P73 A;  2H3O A;  3SYC A;  3AG4 B;  1N34 O;  2OCC C;  1GTO A;  3OW2 U;  3JAK A;  4AI8 A;  2EIL B;  1S76 D;  3HY0 A;  1Y74 A;  1D5A A;  3CCU V;  1Q81 W;  3A5Z A;  1YXB A;  3HFV A;  1BQZ A;  1T5E A;  5LGN A;  4WF9 V;  3UM7 A;  2UXX A;  3SJB C;  4NB5 A;  4J9Y B;  5J9P C;  3M99 B;  5GTI Z;  3OAA G;  4H2Y A;  2LFR A;  3T1Y B;  4KR3 A;  1Q7Y W;  1BMF G;  2OIE A;  3IFX A;  2KKW A;  3CRA A;  3HKC A;  1QR8 A;  4UVC A;  3LDE A;  1WNS A;  2PMF A;  4H44 B;  2DTH A;  4DV4 B;  5E3I A;  3UO2 A;  4KFM A;  5B5E Z;  2F43 G;  4R8C A;  2YS8 A;  1E24 A;  2H8P C;  5JVD B;  3RVY A;  1NU1 H;  1Z7N A;  3Q4H A;  2YXH A;  4LWS B;  1OZ0 A;  4O2A A;  3GWO A;  1H2K A;  2XGT A;  1QHT A;  1R1B A;  4LF8 B;  1YF2 A;  2JGD A;  3CP1 A;  3QF7 A;  3RVZ A;  4IIJ A;  4JYA B;  4PD4 F;  1KEC A;  4OPH A;  2GUZ B;  2FML A;  1MOF A;  1I7F A;  3RN4 A;  2VQF B;  3QNE A;  1XNR B;  2DVE A;  1F4M A;  4B7K A;  4ZIB A;  1JFF A;  3VOU A;  5EIB C;  4H2X A;  3K5N A;  1URF A;  2PGG A;  1X56 A;  4WF2 A;  1HTT A;  1KMM A;  1FFX A;  2DOS A;  3D8C A;  1H8H G;  3GVM A;  1SES A;  3ABU A;  2E1H A;  1YCI A;  1LNQ A;  3L4G A;  2ZT9 B;  2EJR A;  1M5I A;  4FZ1 A;  1MMM A;  4DUY O;  4JI2 O;  4YCW A;  2QWN B;  2GSM B;  3A74 A;  3WQZ A;  3ZX6 A;  11AS A;  2PF4 E;  1YIT V;  5FPR A;  2R9I A;  1GKF A;  2R70 A;  3V7S A;  3LDD A;  2YI9 A;  2Q7H A;  2QHU A;  4MTX A;  4IGG A;  4JI4 O;  4XTV A;  2EAY A;  5H6R A;  4TUY B;  4NYK A;  2DMX A;  3FB5 C;  1EQR A;  1VQ5 V;  4GX2 A;  4XDK A;  2YEV B;  3NEN A;  3OMI B;  2LP7 A;  5EBM C;  4DO2 A;  2PYL A;  1NJ5 A;  2GDS A;  2R9R B;  3K5M A;  4KQE A;  1YEW A;  3A32 A;  1BS3 A;  3HXW A;  2ZDI A;  4UV9 A;  2EJF A;  2ZD9 A;  2EWN A;  4X64 O;  1GM8 A;  1N9W A;  1OHH G;  5TIS Z;  2HFE C;  3S3X A;  5C51 B;  3MF1 A;  4UP9 A;  4PI2 A;  3OGI B;  3W7X A;  4ZBM A;  1JJ2 U;  4OLF A;  1H4V B;  2CH7 B;  4UB8 Z;  1BIA A;  3APQ A;  4DW1 A;  5JVD A;  2OCH A;  1YTF B;  3HTZ A;  1TVK B;  2WLI B;  1E79 G;  4LWS A;  5B1A B;  12AS A;  3ABL C;  4YY3 O;  3OE7 G;  1RM1 C;  3ETD A;  4WI1 A;  3UKM A;  5B1O A;  1UJW B;  2YXY A;  1VQN V;  4RWU A;  2DTO A;  2E76 B;  1GN6 A;  3A7U A;  1H38 A;  4DR5 O;  2LO1 A;  2EIK B;  2DYS C;  5EYP B;  2GUZ A;  3L1A A;  4I50 A;  1YB3 A;  3ZHT A;  5D5Q A;  1KYO F;  1VF6 C;  1FXV A;  2ZTG A;  4MTF A;  3G71 V;  4B7E A;  2ZGW A;  4X66 O;  3V8K A;  5JCO C;  3RGL A;  3QG5 A;  4DW0 A;  2QWQ B;  1JQ0 A;  3LNM B;  3I5D A;  4LFC O;  3K9A A;  1EVK A;  1E1Q G;  1YZB A;  5D5P A;  2W6I G;  1NR7 A;  3TET A;  3QO5 A;  4G85 A;  4WFE A;  1SA0 B;  3E9H A;  1YSC A;  2WLJ A;  5IY5 B;  1PYS B;  4DUY B;  4JI2 B;  4BWA A;  1YJW V;  1JMK C;  2QM8 A;  5BR8 B;  2Q7G A;  3HY1 A;  5BMV B;  4DPG A;  3CB2 A;  4K3A A;  1BBW A;  4XTU A;  2EUL A;  3AK3 A;  2ITD C;  4RDX A;  3K9S A;  5L3C A;  4P75 C;  4JI4 B;  3BVO A;  4TUY A;  1H4T A;  2EIJ B;  2ODR D;  4CH5 A;  4TVW A;  1TUB B;  4JAU A;  3RIR A;  2QGN A;  4AHC A;  3ICX A;  3MDS A;  2YEV A;  1S0V A;  4K87 A;  1RPO A;  4WFA V;  3OD4 A;  4PEL A;  4LF6 O;  1KKD A;  3TEG A;  1N8R W;  5C8Y B;  4DR1 O;  1Q8I A;  4DR6 O;  3VQV A;  5LMN O;  4YDQ A;  4X64 B;  4YRE A;  3CCS V;  4TWK A;  1EZJ A;  3RBZ A;  1PL0 A;  4TWA A;  3K59 A;  3H01 A;  1BE3 H;  2CH7 A;  3CC4 V;  2A8E A;  2HG5 C;  4XDJ A;  1QLE B;  4I9Q A;  2MW2 B;  3JAL B;  1K7D A;  2WLI A;  1OCR B;  2K9P A;  3OEH G;  2ZE5 A;  3H1I H;  2CGH A;  4MVS A;  4Z1M G;  4YY3 B;  1GRJ A;  1S5H C;  3CX5 F;  1VQZ A;  2CJB A;  1EZV H;  3EXA A;  5LXT B;  3TEH B;  1ZUQ A;  1J5W A;  4DR5 B;  5BY1 A;  2J3L A;  1QF6 A;  4H02 A;  1BL8 A;  5EYP A;  2P22 C;  4JF3 A;  1QR9 A;  3CE2 A;  3SJQ C;  1B70 B;  1VF5 B;  1NBM G;  4QJF B;  2Q67 A;  5L3F A;  3G4S V;  2B5U A;  5J2T B;  1YJ9 V;  5ITZ B;  3ML0 A;  3ETQ A;  1SZX A;  1Z5V A;  4ZKI A;  2ZE8 A;  3HKE B;  1IBM B;  4LFC B;  3T4D A;  2A79 B;  5JJE B;  1G4Y B;  3M4Q A;  3FB7 C;  2XND G;  2Q69 A;  3N27 A;  1NH2 D;  1F4N A;  1SA0 A;  4YIP A;  1PYS A;  4MTO A;  3NR7 A;  3KZI Z;  2NNU A;  1PNL A;  2FTK A;  2LFS A;  4UP8 A;  2JGU A;  5BMV A;  3UT5 B;  4DR2 O;  1VQ7 V;  2X6B A;  1GN4 A;  3P32 A;  1NKD A;  3RF1 A;  2P90 A;  1COW G;  4BW9 A;  5H5N A;  4RUE A;  4DV6 B;  4YRT A;  1PD3 A;  2ARU A;  3CRC A;  2WLM A;  3HKD B;  3DXR B;  2RHQ B;  3IC9 A;  4X9Q A;  3E8B A;  1TUB A;  5KAF Z;  4YIO A;  2IW5 A;  4P72 C;  3R66 A;  2QR4 A;  2AKW B;  4YRK A;  1MNG A;  4FIP C;  4KXR A;  3RYF B;  1L0L H;  3L9D A;  1ADY A;  1IX9 A;  1C0A A;  4RUF A;  1VIB A;  5C8Y A;  4LF6 B;  1IZ3 A;  4DR1 B;  3BPZ A;  3WB2 A;  1V54 C;  1KBH A;  4DR6 B;  4UCT A;  1Z2G A;  2XT9 A;  3K03 A;  1MSW D;  4O2B B;  3VQW A;  1NJ1 A;  4HWT A;  1P4R A;  1M4U A;  3F7Y C;  3FB8 C;  3ABK C;  2DQ0 A;  1KMI Z;  3CCJ V;  3JAL A;  2JS5 A;  1Q86 W;  1I5X A;  1GN3 A;  3G1Z A;  3MD0 A;  2ZNI A;  1IBK O;  3ZMT A;  3K0D A;  5LHG A;  3CD6 V;  4K86 A;  4NVP A;  3CMA V;  3P3P A;  5LXT A;  1ROP A;  3TEH A;  2OIG A;  3OR7 C;  1BT8 A;  5LBQ A;  5KA6 A;  2PZS A;  1HP8 A;  3TUP A;  3RUX A;  4HVC A;  2YID A;  2EIM C;  4BW5 A;  2A3Q A;  2P5I A;  5CA0 B;  1B70 A;  1FD9 A;  1FKA O;  3HB3 B;  4RAI A;  3APO A;  5J2T A;  2UUC O;  5ITZ A;  2C7I A;  4LF7 O;  2DJZ A;  3PZC A;  3D3I A;  3HKE A;  4KR2 A;  1M57 C;  3JAK B;  4FMT A;  3V7C A;  2JJ1 G;  4YPF A;  2ZIM A;  1HW7 A;  2A06 H;  3OD1 A;  3R65 A;  5KUM A;  5CBH A;  4P71 A;  1DF5 A;  4TT3 G;  3RT3 C;  2AHY A;  2E3C A;  1K92 A;  4HYO A;  2OTL V;  3UT5 A;  4K0K B;  4YJ3 B;  1XIL A;  3T1Y O;  5EZY B;  4DR2 B;  3CCR V;  2HNI A;  1MZE A;  3ZHR A;  2PUS A;  3ZN0 A;  2RQ6 A;  3G6B A;  3HXZ A;  2CK3 G;  2ZT6 A;  3HRK A;  3HKD A;  2YC0 A;  3DXR A;  2RHQ A;  2IJK A;  2EBO A;  2ZE6 A;  1XMO B;  4KP4 A;  2Q68 A;  3LSU A;  2AKW A;  1AIL A;  4DR7 O;  1IXB A;  1AVM A;  3RYF A;  4HZ3 A;  4MT8 A;  3E83 A;  2H94 A;  2OTJ V;  4LF4 B;  4UCS A;  3ZED A;  1Q6H A;  3CCM V;  4FLV A;  4P74 A;  1TA8 A;  3ABM B;  1B06 A;  2F93 B;  1G6U A;  2EIN C;  4IIJ B;  4YCV A;  3CYO A;  3AG3 B;  4CC6 A;  4O2B A;  3WB1 A;  4ABM A;  4BIZ A;  3RWR D;  1SQB H;  1XNR O;  2ITC C;  3E35 A;  3J80 N;  1V55 C;  3CRM A;  4D7S A;  4FFB B;  3W7S A;  1Y66 A;  1X54 A;  3FJP A;  1ZL8 A;  4TQD A; 
#chains in the Genus database with same CATH homology
 3ABK B;  2QM7 A;  3CCE V;  11AS A;  1P7B A;  3ZIA G;  1YIT V;  2Z5U A;  4WFF A;  2R9I A;  2EIJ C;  3L4G B;  4CH6 A;  1GKF A;  2NS6 A;  3V7S A;  3LDD A;  3IKL A;  1KMN A;  2IY5 A;  1GM7 A;  1NJ6 A;  2Q7H A;  2QHU A;  2ZR3 A;  4MTX A;  1B7Y B;  3ZMS A;  3CXC U;  3V7R A;  1FXK B;  4LC1 A;  3CC7 V;  1M90 W;  4XTV A;  3OUF A;  2EAY A;  1SET A;  4PA3 A;  1K33 A;  1OCO B;  5H6R A;  2E65 A;  4YRL A;  2XAS A;  2WLL B;  1NYQ A;  5K1X A;  5CBF A;  1DTO A;  3FB5 C;  1EQR A;  1K97 A;  4YRJ A;  1CP9 A;  1VQ5 V;  3MHS C;  4G27 B;  2UXN A;  4GX2 A;  4LVI A;  2XAJ A;  1ENV A;  4XDK A;  2YEV B;  3WG7 C;  5LGU A;  3NEN A;  3P8Y A;  3OMI B;  2EIM B;  3ZMZ A;  2LP7 A;  5EBM C;  4DO2 A;  1E1T A;  4UPA A;  1K34 A;  1PNK A;  4WCE V;  1NJ5 A;  2OCC B;  2XAF A;  4H2W A;  2R9R B;  4QE9 A;  1SRY A;  2ZZF A;  2QHV A;  4KQE A;  2QTO A;  4XEO A;  3ETE A;  3A32 A;  1R3J C;  3AG2 C;  1QVF U;  1YI2 V;  1QE0 A;  5KUK A;  4OP0 A;  3HXW A;  4LVL A;  4QPK A;  1NJ8 A;  2WPD G;  2ZDI A;  4WJ3 M;  2X6A A;  4UV9 A;  1VQM V;  2EJF A;  1E1R G;  2WLN A;  2W6J G;  2ZD9 A;  2HVK C;  3F5W C;  1GK9 A;  1GM8 A;  2JEX A;  2X0L A;  1AJQ A;  4GCZ A;  1F51 A;  1YHQ V;  3W7W A;  3P8V A;  5K1P A;  3JD1 A;  1N9W A;  1OHH G;  1QLE C;  1FS0 G;  2HFE C;  1XL6 A;  4KUM A;  1NYR A;  2DXT A;  1M57 B;  5C51 B;  1FXH A;  4JYB A;  4K88 A;  1OCR C;  2HR3 A;  3MF1 A;  5L3B A;  4NCX A;  4UP9 A;  3K0G A;  2HVJ C;  3W7X A;  4ZBM A;  1JJ2 U;  3IG2 A;  4OLF A;  1H4V B;  3ASO B;  1R3L C;  1BIA A;  1B8A A;  2D3O W;  1E22 A;  1VQP V;  2IH1 C;  1AI4 A;  1R6K A;  5B1B C;  1YTF B;  4N21 A;  3HTZ A;  2IJJ A;  4MVZ A;  2WLI B;  1E79 G;  2DU7 A;  4JTC B;  5B1A B;  1GMG A;  1JVM A;  3G6E V;  4YRQ A;  5DN6 G;  12AS A;  3ABL C;  1EIY B;  3ZJZ A;  3OGC C;  3OE7 G;  1VQL V;  1NH2 B;  3LSQ A;  1RM1 C;  3ETD A;  1VQ6 V;  1G51 A;  3PCO A;  4WI1 A;  3UKM A;  1XL4 A;  2WSS G;  5B1O A;  3T1C A;  1UJW B;  1VQK V;  1VQN V;  2E64 A;  2DTO A;  3CMQ A;  1EFW A;  4PA9 A;  2P6J A;  4GX5 A;  4P73 C;  1ARO P;  1YGB A;  2ZT8 A;  4R50 A;  3A7U A;  2C8M A;  1H38 A;  1R3K C;  2EL9 A;  5ELN A;  2DU5 A;  3IGA C;  2ZQM A;  3F7V C;  3OM3 B;  4JAV A;  2EIK B;  3P30 A;  1DLB A;  2DZC A;  4UP7 A;  2DYS C;  3E8H A;  4U7O A;  1ASZ A;  5IDJ A;  1YTF D;  1QLN A;  3L1A A;  1YB3 A;  4P72 A;  1YFT A;  3SPI A;  1THZ A;  1K4D C;  3OEE G;  1KD1 W;  3RKX A;  1WQW A;  4CH4 A;  1FXV A;  1GM9 A;  2A9H A;  4BIU A;  2ZTG A;  4MTF A;  1X01 A;  1G5I A;  3G71 V;  3E86 A;  2ZGW A;  4TVA A;  4EX5 A;  3OMA B;  3V8K A;  1E1O A;  1EOV A;  3RGL A;  1GGM A;  2EJG A;  4MVR A;  2G4C A;  1NR1 A;  4H2S A;  3UGT A;  1FFT B;  4H2U A;  4PHC A;  1BHA A;  3FB6 C;  1PKX A;  1JQ0 A;  3LNM B;  1NNH A;  5BZB A;  2Q5I A;  4P71 C;  3K9A A;  4LP8 A;  1E1Q G;  1EVK A;  3CME V;  2W6I G;  1NR7 A;  4X88 A;  3TET A;  3IKM B;  3QO5 A;  4G85 A;  3ZMU A;  2EIN B;  2P7T C;  4WFE A;  3HXV A;  3SPJ A;  1KC8 W;  1X2H A;  3E9H A;  1YSC A;  5C52 B;  2WLJ A;  4PDR A;  5IY5 B;  1AR1 B;  1LYL A;  1PYS B;  1QCE A;  3NEL A;  4YRN A;  1USY A;  3EFS A;  1YJW V;  4BWA A;  2Q6A A;  4QIW F;  3V8J A;  2QM8 A;  1KP2 A;  2Q7G A;  4WFH A;  1V55 B;  3HY1 A;  3REU A;  3QO7 A;  3V8L A;  2ZIO A;  4P3N A;  3IC7 A;  2ZT7 A;  5IYB O;  4DPG A;  1MAB G;  1ATI A;  4HWP A;  1H2G A;  1MG1 A;  4MVM A;  1BBW A;  1L1F A;  4XTU A;  3AG1 C;  4Q6G A;  2ITD C;  1B7Y A;  4FK5 C;  4RDX A;  1FXK A;  3ABM C;  4QNH B;  3HXX A;  5L3C A;  4P75 C;  3AEI A;  3X2Q C;  2EZP A;  2IJI A;  4MW8 A;  3ZRW B;  2WLL A;  4UVA A;  2XOK G;  5B1N A;  1S72 V;  1H4T A;  2EIJ B;  3NET A;  4CS4 A;  4TSF G;  2ODR D;  3ZRS A;  4CH5 A;  4TVW A;  3SYP A;  3K08 A;  3LDC A;  4JAU A;  3E89 A;  1Q82 W;  3RIR A;  2BOC C;  2QKS A;  2YEV A;  3LSS A;  4UVB A;  1S0V A;  2Y69 C;  4K87 A;  4QPJ A;  4P74 C;  4LCU C;  3RW0 A;  1RPO A;  2DZ9 A;  1F23 A;  4XU2 A;  3A7A A;  5C53 B;  4WFA V;  3ASN C;  1B6Q A;  3QTC A;  3REX A;  1AJP A;  3E8G A;  4MTG A;  1KOG A;  3K06 A;  4TQD A;  3ZMV A;  4PEL A;  3WG7 B;  1W0K G;  4TVY A;  1KQS U;  4WFG A;  5CA3 A;  1KKD A;  3TEG A;  4RO2 A;  1N8R W;  3KG2 A;  4UXN A;  1EBO A;  2PI4 A;  3VQV A;  4YDQ A;  1EFR G;  2DQ3 A;  4YRE A;  4CS2 A;  3CCS V;  4TWK A;  1EZJ A;  3AG2 B;  1K9M W;  3RBZ A;  5HFL A;  1ADJ A;  5HFM A;  1PL0 A;  1M9N A;  2DEQ A;  4TWA A;  1YFR A;  1I5Y A;  3CPW U;  2DW4 A;  3JD3 A;  3E8F A;  4R7C A;  4LVJ A;  3A5Y A;  1IXM A;  4DQ2 A;  3H01 A;  5GW7 A;  3WFV A;  3CC4 V;  5ELO A;  2DKG A;  2A8E A;  2HG5 C;  2HJF C;  1QLE B;  4XDJ A;  3ZRX A;  3RKY A;  5B3S C;  1K7D A;  3IAL A;  2WLI A;  2Z3Y A;  4XTW A;  1OCR B;  2ZXW C;  3DGE A;  3OEH G;  2DXU A;  4XU3 A;  4PA6 A;  4PDL A;  2CGH A;  2AMC A;  1BBU A;  4MVS A;  1M56 C;  3TCU A;  1EIY A;  4OXS A;  4Z1M G;  3B8N A;  3HXY A;  4CZZ A;  2ZNJ A;  1X55 A;  1S5H C;  3RKW A;  4HWO A;  3SYQ A;  1VQZ A;  2V1D A;  2CJB A;  3HRI A;  4JPR A;  3VBB A;  5B1B B;  3K04 A;  3K79 A;  4N23 A;  4CH3 A;  3AG4 C;  1K5Q A;  4ASU G;  2E10 A;  1H8E G;  2ZXF A;  5CBG A;  3TEH B;  4BAY A;  2EIL C;  1J5W A;  1S3J A;  2ART A;  2X6C A;  3ABL B;  1HXD A;  2J3L A;  3UFG A;  1K73 W;  1RM1 B;  1QF6 A;  4H02 A;  1BL8 A;  3CCL V;  2V7Q G;  2AMC B;  1HWY A;  4JF3 A;  2DTI A;  2IU3 A;  1QR9 A;  3I55 V;  2DYR C;  3SJQ C;  4Q15 A;  2WWW A;  1QVG U;  3JYC A;  4CBC A;  1AJN A;  3I56 V;  1NJI W;  1B70 B;  2AHZ A;  3MQZ A;  2WLH A;  2ATK C;  2E5A A;  3RL6 A;  1VQ4 V;  1EVL A;  1NBM G;  3STZ C;  4QJF B;  5IYD O;  3SYA A;  4U7N A;  2Q67 A;  5L3F A;  3G4S V;  1NJ2 A;  4DXW A;  2B5U A;  4Q20 A;  1R6N A;  1YJ9 V;  4PA4 A;  2DYS B;  3B77 A;  4YRI A;  4P2Z A;  2ZDI C;  4PA7 A;  3ML0 A;  4YRC A;  2NLJ C;  1Z7M A;  1AI6 A;  4ZKI A;  4J9Z B;  2Q7E A;  4HWR A;  1Y4M A;  3T4D A;  3NXS A;  2A79 B;  2Q5H A;  1G4Y B;  3M4Q A;  3FB7 C;  4RMF A;  1H4Q A;  2XND G;  2Q69 A;  3W7T A;  4UUJ C;  1NH2 D;  3EFR A;  2ZIN A;  1F4N A;  1WPX A;  1G8M A;  3HPL C;  5EK0 A;  1WLE A;  1PYS A;  4MTO A;  4GX1 A;  2NNU A;  1B76 A;  1QBZ A;  1OCZ C;  1PNL A;  2FTK A;  2LFS A;  4I9W A;  4RQE A;  4RQF A;  5KNN A;  4UP8 A;  1NQT A;  2E41 A;  2JIZ G;  1OCC C;  3CCQ V;  1R73 A;  2X6B A;  4XDL A;  1JX9 A;  1VQ7 V;  4G28 B;  3P32 A;  2EJ9 A;  3A7R A;  2DDZ A;  1NKD A;  3RF1 A;  2JK5 C;  2P90 A;  2XTI A;  2C2A A;  1GO3 F;  1ASY A;  1COW G;  2HLD G;  4BW9 A;  3L2Z A;  3A31 A;  4RUE A;  4YRT A;  1DF4 A;  1PD3 A;  3D36 A;  4YRP A;  4LVM A;  2ARU A;  3ZRW A;  1WPY A;  4MVQ A;  4P9P A;  2WLM A;  4MVU A;  1YIJ V;  2RHQ B;  2WLK A;  4MW3 A;  3E8B A;  3MHH C;  4XU1 A;  3ZN1 A;  3AG1 B;  4PDM A;  2CJA A;  2BOB C;  3SYO A;  5L3G A;  3EFF K;  2IJH A;  5CMU A;  2QA4 V;  3NEM A;  4FJC C;  4EO4 A;  4PG3 A;  2IW5 A;  4P72 C;  3X2Q B;  2AKW B;  4YRK A;  3JD4 A;  4X8A A;  4LVK A;  4FIP C;  4MSW C;  2QEX V;  2QHT A;  1ZWI C;  2ALY B;  1ORQ C;  4LNS A;  2OT5 A;  1ADY A;  1C0A A;  3ZRV A;  1G5H A;  3ZCC A;  3AG3 C;  3BEH A;  2Y69 B;  4RUF A;  4YXW G;  3VQX A;  3R07 A;  4ZTZ B;  1BIB A;  3LUT B;  5F5W A;  3OUS A;  4E51 A;  1JOY A;  1SZT A;  1K3E A;  2P67 A;  1V54 C;  3ASN B;  5E1A C;  1JCH A;  2GHY A;  1VQ8 V;  2PI5 A;  1JJC B;  5L3D A;  4O2D A;  4H2X B;  3PJS K;  4AH6 A;  3K03 A;  1MSW D;  4L87 A;  2QHS A;  3T4Z A;  3VQW A;  1CPY A;  2JEU A;  4EKW A;  2B1I A;  2FYK A;  3E9I A;  3HXU A;  3FYE B;  1NJ1 A;  4YP0 A;  3E2E A;  4HWT A;  2XAG A;  1P4R A;  2EZO A;  3F7Y C;  3FB8 C;  3ABK C;  5LGT A;  4HWS A;  2DQ0 A;  4J15 A;  1NVP B;  3UH0 A;  3CCJ V;  1IL2 A;  1Q86 W;  4JYC A;  1I5X A;  3OR6 C;  1PNM A;  2RHS B;  5C93 A;  3G1Z A;  4FPP A;  3MD0 A;  4JGS A;  4YCU A;  1K5S A;  1FXK C;  1AI7 A;  3B8M A;  4G2K A;  2EWN A;  2ZNI A;  5HGQ A;  3ZMT A;  3K0D A;  4ZTU B;  3MF2 A;  3BFM A;  1OCO C;  5LHG A;  3CD6 V;  4K86 A;  4TQF A;  5B3S B;  3GB7 C;  3CMA V;  2I4L A;  4JAS A;  3DSQ A;  4WJ4 A;  3ABT A;  1ROP A;  2ZXW B;  4H37 A;  4R6Z A;  1BHB A;  1W66 A;  3TEH A;  1W0J G;  3OR7 C;  3ETG A;  3JD2 A;  5LBQ A;  3FKS G;  4HA8 A;  5KA6 A;  1M56 B;  2IY5 B;  3CCV V;  3OFN G;  1YFS A;  2QE7 G;  3TUP A;  1HC7 A;  3RUX A;  4TTV A;  4HVC A;  4BW5 A;  2EIM C;  2W0F C;  3T2M A;  1NVP D;  2P5I A;  2CIM A;  3CC2 V;  2KB1 A;  4PDV A;  1B70 A;  1FYF A;  4P73 A;  4F4L A;  4YRG A;  5H9C A;  3AG4 B;  3SYC A;  2OCC C;  1GTO A;  4P3O A;  4P3P A;  4MS2 A;  3OW2 U;  2ZT5 A;  4X5O A;  1WNL A;  2EIL B;  3HB3 B;  1S76 D;  3HY0 A;  4RAI A;  3CCU V;  1Q81 W;  2C7I A;  3SPC A;  3A5Z A;  3HFV A;  3W3S A;  3TK1 A;  2DJZ A;  5LGN A;  1YJN V;  4WF9 V;  2DWE C;  2CJ9 A;  2DYR B;  2K1E A;  1RIQ A;  3UM7 A;  2UXX A;  1JPX A;  4YRS A;  3PZC A;  5LHI A;  4XEM A;  4J9Y B;  3D3I A;  5J9P C;  4YRR A;  3M99 B;  2PME A;  4KR2 A;  1M57 C;  3OAA G;  4FMT A;  2LFR A;  4QE7 A;  4H2V A;  4H2Y A;  3V7C A;  4KR3 A;  2JJ1 G;  1Q7Y W;  4YPF A;  1BMF G;  3K3W A;  2ZIM A;  3IFX A;  1WYD A;  4HT4 A;  5FL7 G;  1SER A;  4H33 A;  3OD1 A;  3ASO C;  3R65 A;  4I5S A;  5KUM A;  5CBH A;  4P71 A;  3WQZ A;  1QR8 A;  1AI5 A;  2DWD C;  1DF5 A;  4TT3 G;  4UVC A;  3LDE A;  2AHY A;  4HYO A;  1K92 A;  2OTL V;  1WQ7 A;  2E3C A;  2PMF A;  4XU0 A;  2DTH A;  4XTX A;  2I4M A;  5CN0 A;  5B1A C;  2A0L A;  5E3I A;  3CCR V;  3LC0 A;  2HNI A;  4KFM A;  3BY6 A;  3QO8 A;  4JTA B;  3ZN0 A;  2JJ2 G;  3ICA A;  3SPG A;  3KFU A;  2F43 G;  1OCZ B;  3HXZ A;  4R8C A;  2CK3 G;  3A0R A;  1E24 A;  2I4N A;  2H8P C;  2ZR2 A;  3RVY A;  1K8A W;  3MEY A;  2Y48 A;  1L0W A;  4CS3 A;  5H6Q A;  1Z7N A;  2I4O A;  2ZT6 A;  5LHH A;  1OCC B;  3HRK A;  3BJU A;  2RHQ A;  4XTY A;  1OZ0 A;  3FYI B;  4WFB V;  3I7F A;  2IJK A;  2YSU B;  3ERR A;  2EIK C;  1X2G A;  3GWO A;  3HFZ A;  4YRO A;  4P9O A;  3PCO B;  2EBO A;  4E2L A;  1VQ9 V;  2XGT A;  4KP4 A;  2Q68 A;  4XBF A;  4P75 A;  1S77 D;  2P0L A;  3CP1 A;  2B1G A;  3RVZ A;  2AKW A;  4GT1 A;  1W2B U;  5DM6 V;  3P8T A;  2WAM A;  2ZZG A;  5KA5 A;  3SPH A;  2ALY A;  3EHB B;  3JD0 A;  2ZCE A;  4HZ3 A;  2MK3 A;  4GX0 A;  4MT8 A;  1H4S A;  1VQO V;  4H2T A;  1KEC A;  3E83 A;  3JCZ A;  1KP3 A;  4LBE C;  1CEZ A;  4XTZ A;  2H94 A;  2OTJ V;  3HFZ B;  1J95 A;  5L3E A;  2XAQ A;  1M1K W;  3CCM V;  3RAC A;  1MOF A;  3UGQ A;  4P74 A;  4YRM A;  5EC2 C;  3QNE A;  3ABM B;  4HAM A;  2DVE A;  1F4M A;  4MVO A;  2X7R B;  4X89 A;  1JJC A;  4ZIB A;  3VOU A;  3OMN B;  2M7W A;  2EIN C;  4TVA B;  4H2X A;  3VQY A;  4P30 A;  1X56 A;  4WF2 A;  4YCV A;  3CYO A;  1HTT A;  2JDI G;  1R3I C;  3AG3 B;  3DTU B;  4UV8 A;  5IY5 C;  1KMM A;  4JTD B;  5IYC O;  2ODR C;  3W7U A;  4BIZ A;  3M4P A;  5EBW C;  1H8H G;  4YYE A;  2ITC C;  3E35 A;  1SES A;  3ABU A;  1V54 B;  2J3M A;  1V55 C;  2IH3 C;  2E1H A;  4G84 A;  4YRF A;  3L4G A;  1LNQ A;  2HKO A;  2EJR A;  3W7S A;  2ARS A;  5EC1 C;  4YCW A;  1RPR A;  3STL C;  5EBL C;  1WU7 A;  1Y66 A;  1X54 A;  2RHS A;  3FJP A;  2GSM B;  2ZZE A;  3A74 A;  2IU0 A;  1TUE B;  1USY C;  1K4C C;  2XAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...