3LSQA

Trypanosoma brucei seryl-trna synthetase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
467
structure length
431
Chain Sequence
MMVLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEAVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEALGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRGTAAQNVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPYMMGIEMIRFEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Ligase
molecule keywords Seryl-tRNA synthetase
total genus 149
structure length 431
sequence length 467
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3lsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3lsqA02
4PG3A 2QHSA 2Q5HA 2E5AA 3W3SA 2Q5IA 2ARSA 3UGTA 11ASA 3A7RA 2DTOA 3IKLA 1HTTA 2XGTA 3PCOA 2DXTA 4YRSA 1NJ1A 4YRJA 3I7FA 1NYRA 3VQWA 1NNHA 4LNSA 4XEOA 1PYSB 2I4LA 3P8VA 4BWAA 3HXZA 4YRKA 2I4OA 1BBWA 3RUXA 2QHVA 1G5HA 1LYLA 4UPAA 4P73A 4YRGA 4J15A 2DVEA 3NENA 3TEHB 4YROA 1SESA 4AH6A 1J5WA 3UGQA 4H2SA 4P71A 2E41A 4YYEA 3HY0A 1USYA 1ADYA 3UFGA 2RHQB 2QHTA 3KFUA 4CH3A 4YRIA 4YRFA 3HXVA 4HVCA 3QO5A 3NEMA 2ZIMA 4CH6A 3QO8A 3M4QA 1H4TA 3IKMB 3NELA 4XU3A 4OLFA 4YPFA 4CH5A 4YCVA 1PYSA 2CIMA 3OD1A 2CGHA 3HFZA 2ARTA 1B7YB 3L4GA 4H2XA 4YRQA 2ZIOA 5K1PA 4YCUA 3V7RA 4WI1A 5E3IA 5ELNA 3REUA 3V8KA 1YB3A 3HXWA 4RDXA 1JJCB 4KQEA 4K86A 5C52B 4HWTA 3ERRA 4HWPA 2I4MA 3RIRA 4DQ2A 3MEYA 4YRTA 1FYFA 1VQZA 3HXUA 3PCOB 4RMFA 3NETA 4H2VA 4BW9A 1BIBA 3LSQA 3RF1A 1GGMA 2EJ9A 2ALYB 3R07A 3TEHA 3L2ZA 5HGQA 1YFSA 4HWSA 5F5WA 4Q6GA 4XTXA 1WYDA 2E1HA 1YGBA 2DXUA 4P3NA 4YRLA 4K87A 4TQFA 2E3CA 3RGLA 4PHCA 2IY5A 2E64A 3FJPA 1ASZA 1KMNA 3CMQA 3L1AA 4YRRA 2DU7A 3EFSA 4XEMA 4KR2A 3P8YA 2C7IA 4H2WA 2QHUA 4P75A 4L87A 4RQEA 4H2UA 4CS2A 4YRPA 4TTVA 2ZTGA 2ZNIA 3PZCA 4HWRA 3HRIA 2CJ9A 3UH0A 3HTZA 3A5ZA 4G85A 3A32A 2ZGWA 4XTUA 1BIAA 3ICAA 1E24A 3V8JA 2ALYA 4CS4A 3VQXA 1RIQA 1B70A 3HXXA 2AMCB 1YFTA 2EAYA 2ZINA 2IY5B 2ZCEA 1E1TA 4E51A 2EJFA 3A7AA 3IG2A 4CS3A 4OP0A 2ZT5A 2ZT8A 4P72A 4P71C 4YRCA 1H4QA 2P0LA 2ZT6A 1NYQA 1X56A 1USYC 1EQRA 1WQ7A 4HWOA 1EIYB 1H4VB 1X2GA 4G84A 1Z7NA 2ZR2A 1EOVA 1EFWA 4XTZA 2Q7HA 1N9WA 4YRMA 3HFVA 4K88A 4XU2A 4Q15A 3A7UA 1X54A 3HRKA 4H2YA 1WU7A 1NJ6A 3MF1A 3LC0A 3L4GB 2DTIA 1E22A 3VQVA 3QO7A 2ZXFA 3E9HA 1X01A 3QNEA 2RHSA 2XTIA 1W66A 1WLEA 4TVWA 3V7SA 4UP9A 4WF2A 1BBUA 4H2TA 1QF6A 2DQ3A 1E1OA 4O2DA 2J3MA 3TEGA 3M4PA 1ADJA 2ZT7A 2RHQA 3VBBA 3LSSA 1G5IA 1EVLA 1ATIA 4YDQA 3HXYA 2DKGA 4EX5A 4TWAA 3A31A 4YRNA 4UP8A 4EO4A 1WQWA 4X5OA 2ZZFA 1B7YA 3E9IA 2AKWA 1X2HA 1NJ5A 1WNLA 2ODRD 3G1ZA 1SETA 4NCXA 3VQYA 2CJBA 5ELOA 4WJ4A 3BFMA 2DDZA 4XU0A 4P3OA 3QTCA 3REXA 4P74C 4KR3A 1IL2A 1Z7MA 2Q7GA 1G51A 2DZ9A 4H2XB 2DQ0A 2HNIA 1X55A 2CJAA 5K1XA 1H4SA 12ASA 2E10A 3RKXA 2I4NA 2E65A 4WJ3M 2Q7EA 4TVAB 1KMMA 3RKWA 4H02A 2ZR3A 5C53B 1HC7A 1B70B 2ODRC 2AMCA 4TVYA 3BJUA 2J3LA 1ASYA 2RHSB 3RKYA 2EJGA 1EIYA 1KOGA 4CH4A 1QE0A 1SRYA 2ZNJA 2PMEA 4RQFA 1EVKA 3DSQA 2FYKA 4ZTZB 1B76A 4ZTUB 2DJZA 1HXDA 1JJCA 3RACA 1B8AA 4P74A 2DU5A 3EFRA 4XTWA 1YFRA 2G4CA 3HFZB 1C0AA 3P8TA 1WPYA 3IALA 2DTHA 3V7CA 2C8MA 4TVAA 2ARUA 4DPGA 2DEQA 3WQZA 2PMFA 1NJ2A 5C51B 2ZZGA 1SERA 4P73C 4TQDA 4P72C 2AKWB 2EWNA 4P3PA 3TUPA 4HA8A 3HY1A 3A5YA 3RL6A 4XTVA 3A74A 5KNNA 2P5IA 4XU1A 4YCWA 1NJ8A 4XTYA 4YP0A 4UP7A 1L0WA 3MF2A 3V8LA 2EL9A 4P75C 2ZZEA 2DZCA 4YREA 4ZIBA
chains in the Genus database with same CATH superfamily
4X64B 4N21A 2QHSA 2Q5HA 3ZMVA 2E5AA 4DV1O 3ZN1A 3R66A 3RVZA 4EEQA 5IYZA 1M57C 1N0JA 1Z5WA 3MAQA 4B3SO 1S3JA 2DXTA 4YRSA 4MS2A 4HZ3A 3RYCB 1GMGA 4X66B 1NYRA 3RBZA 4I0XA 2PZSA 3OGIB 1PYSB 4JYYA 4DV2B 2I4LA 3A8TA 3SJAC 4EFBA 5BR8O 2I4OA 3QF7A 2B5UA 1G5HA 4UPAA 2OIGA 4P73A 1U97A 1TVKA 2LFSA 1VQ4V 1WPBA 3SPCA 2DYRC 2W0XA 3JYCA 3TEHB 3ZRWB 3DC6A 4AH6A 2QWRB 2UXDO 4DO2A 3BAAA 1FXKC 3RT3C 1N34O 2QKSA 1H2SB 1HW7A 4P71A 3CSXA 2IH3C 1DK1A 1VF6A 3FB6C 3CCMV 5BXZA 2UXDB 2BCCH 2QHTA 5B1BB 3HXVA 3H1KH 3OMIB 4D7TA 3QO5A 4NR1A 2ZIMA 4DR4B 2KSDA 5B1AC 1VQMV 3NELA 4CZZA 5LOVB 1NVPB 2DYSC 2HVKC 2CIMA 3JARB 2ZM6B 4YCUA 3BABA 4WI1A 5CBFA 2N74A 5ELNA 1J95A 2YIBD 3AG7A 2P4VA 4HNAA 4XBFA 5J2TB 3B40A 4PI0A 5KUKA 2WLIB 3OD4A 5C52B 4HWTA 5JH7A 3CP1A 5IWAB 4DR3O 1B3QA 4WF9V 4TV8B 2C2AA 4LVLA 3D3QA 2BTQB 3MEYA 4RWUA 2A7WA 3CCLV 3K9SA 1P7BA 4LP8A 4B3TB 1NBMG 2ALYB 1YTFD 4QPKA 2PY5A 2Y4TA 5HGQA 1YFSA 2N05A 1AVMA 3CCUV 1VEWA 1YGBA 2DXUA 1OCCB 1BS3A 2W6IG 4P3NA 4MVUA 4UVCA 4YHHO 5LP6C 1YIJV 1G4YB 4B7KA 3E22B 3U0ZA 3UQ8A 5JJJB 1KMNA 3CMQA 4YRRA 2DU7A 2QR4A 2JS3A 1E79G 1YCIA 4PA3A 4FMTA 2NS6A 1I08A 3ZHUA 2KG7A 3ZHVA 2QHUA 1AILA 5C8YB 2QKAA 4P75A 4WCEV 1Q7YW 4W4LA 1NR1A 4ZI7A 4NTXA 4DW0A 4YRPA 3STLC 2UXXA 2ZE7A 2ZTGA 4J7ZA 3LDEA 4DV4B 4OX9O 3DTUB 3KKYA 3CEIA 4GKKB 4NYKA 2ZXWC 3A32A 1PM9A 1W0KG 3ICAA 3ICXA 3HR0A 3JAWB 1XOUA 2PYLA 3VQXA 1RIQA 2ZE6A 3B8MA 5KHKA 1J5EO 2Q69A 4J42A 4LF6O 4X9QA 4FZ0A 1IBKO 2GTSA 1B04A 5E79Z 3J81N 1MMMA 4E51A 1FXHA 3H1JH 4U7NA 5H2FZ 2QWPB 3A7AA 5JH7B 2YIDA 2W6JG 1P84F 2A3QA 4B7EA 3UT5B 2UUAB 4G27B 4UB6Z 4OP0A 3AG2C 2ZT8A 4P72A 5B1OA 1XMOB 3SGIA 1THZA 4A5UB 1WP7A 2WWWA 5D5PA 1EQRA 4HWOA 4X1YA 2DWEC 1BE3H 1SC5B 1TAEA 1H4VB 5FL7G 1X2GA 4DV3B 1XNQB 2JEXA 4G84A 3OE7G 1EOVA 1CEZA 3ZMZA 1XREA 2PYJA 3LNNA 1B6QA 2Q7HA 3HKEB 4UB8Z 2QWOB 4KXRA 1OCRC 3S3XA 1YSCA 1AI5A 3HFVA 4LWSB 5EC2C 5B3SB 2IJKA 3HRKA 3FB8C 1SS3A 4LBEC 5EYPA 4H2YA 1U96A 2PUSA 4JI6B 1ORQC 4CBCA 2AZ2A 3H9VA 5JJNB 2KG7B 3LC0A 4I55B 3O9OA 4ZOLA 1HR0B 1XHZA 1AP6A 3GVMA 1M1KW 3ABKC 5LMUO 1WP8A 2QEXV 4YHHB 1CXZB 3N2GB 2RHSA 1H8EG 4I50B 1WLEA 4TVWA 2QE7G 2VQEO 1HR0O 4H2TA 3L71H 1ENVA 4KP4A 1E1OA 5L3EA 2QTSA 3JCZA 5LHHA 1WA8A 3FKSG 2ZT7A 1N8RW 2Q8VA 3WG7B 4I7ZB 3VBBA 1M4UA 3L9DA 1EVLA 1K4DC 1ATIA 3CC4V 1AJPA 3CYOA 2DKGA 2CAZC 4QIWF 4TWAA 5LOVA 2Q6AA 1FAFA 4NXMO 1YJ9V 1WQWA 3ZRSA 2D2CB 4X5OA 3T4ZA 1H2MA 3JARA 4LF7B 3E9IA 4PV1B 4FLXA 2EIJB 1WNLA 3G1ZA 4PJ0Z 4DV7O 3RYFB 5ELOA 4I4TA 4B3RB 1NJIW 1M57B 3ABLC 3ABMC 5H5NA 5KAIZ 3RYHA 3EXAA 4GYCB 4KR3A 1FXVA 1HNZO 3I55V 3K06A 3K3WA 2Q7GA 2VS0A 1G51A 4MTXA 1Z7MA 4X1YB 2OYQA 1F23A 4GX0A 3ZMTA 3CCEV 1H2NA 5EK0A 5C93A 1LUWA 1PD3A 3K5OA 3MQZA 2JGUA 1GN2A 3U10A 4N23A 3D36C 2HKOA 2JGDB 3MHSC 2LFRA 2JIZG 2E10A 5CN0A 2XOKG 5CBHA 1R1BA 3DXRA 2Q7EA 2XAGA 2RNBA 4X62B 3OR6C 2UUCB 3RKWA 1H38A 3ZRXA 1HC7A 2IW5A 1B70B 4DYLA 3W7XA 2YEVA 3BJUA 2ZKOA 2RHSB 2UUAO 2DW4A 1GN3A 1Y4MA 4LFCB 3ZS8C 4RQFA 4BIZA 2ITDC 5EBLC 1FS0G 1ZUQA 1EVKA 4P9OA 2FYKA 1I5YA 3AG3B 3E83A 2DJZA 2BTOA 3ZN0A 3G6EV 2B1IA 2DWDC 1B8AA 2E75B 4TT3G 5BMVA 1M56C 2GSMB 1S77D 5JQGA 1YFRA 1NTZH 2Q9LA 4X20B 1F4MA 2GHYA 4UVAA 3J7AU 4LF4B 3P8TA 5LBQA 4LF5O 4DR5O 2LJ2A 3D36A 3IALA 4DV5O 2DTHA 3V7CA 1SKVA 2IJIA 4DR6O 4TVAA 2YICA 3K04A 4GKJB 1S5HC 4O2AA 2WLIA 5LMUB 1NJ2A 1N32O 5C51B 1YTFB 3ZBHA 4CC5A 3CMAV 5F2VO 2ZZGA 1OHHG 2RQ6A 4DV5B 4LF7O 2CE4A 4GKJO 1D5AA 4JAVA 2AKWB 4P72C 4HA8A 3A5YA 3RL6A 1BGYH 4PD4F 1Q90D 2E74B 4MT8A 1KP3A 1WAZA 3BPZA 4DV7B 2P5IA 5LMNO 3FX7A 4RO2A 4Z1MG 1QQCA 2WLLA 4J9ZB 4NTWA 1F7YA 2G38A 3E8GA 1IBMB 3V8LA 1NT2B 1K8AW 1HNXO 1BHAA 4NKGB 4CS4A 5LXTA 1JMKC 4AHCA 2BSKA 3NR7A 4JASA 1NVPD 1EN4A 3W3SA 3H01A 2UXCO 2E5LO 2A06H 3A7RA 3SYOA 1EFRG 3Q4HB 3UM7A 3IKLA 2UXBB 2XGTA 2UU9B 4PA4A 3OTOB 2QKCA 4YRJA 4DV6B 3B2EE 3OAAG 4F6RA 4BR6A 1KU9A 3IGAC 3OGCC 1IXBA 3KCYA 4MTGA 3O65A 2A79B 3OTOO 3TJTA 3T2MA 5L3FA 1S5JA 1S0VA 5J2UB 4R6ZA 3SR2C 4IYIA 4MTFA 1Y74B 4WFHA 4YIPA 3BVOA 3T1YB 3ZIAG 1L8DA 1J5WA 1Z2GA 3LDDA 4QE7A 2HJDA 1TGOA 2P4KA 1WB7A 4JF3A 4JAAA 4KUMA 4DK0A 3JATA 1I7FA 2P5OA 2A0LA 3ZRVA 1N33O 1XQ8A 2O57A 1USYA 1OCZC 3H1HH 5H6QA 4DR7O 4LC1A 1RPOA 5H6RA 5IYCO 4LFCO 3L73H 1VQKV 3QO8A 3M4QA 5KX5A 1R6NA 4XU3A 4QNHB 4OLFA 4YPFA 2GDSA 3CRQA 1PYSA 2CGHA 3HFZA 1B7YB 4X65B 4YY3O 2ZIOA 4Z1VA 5K1PA 4UFZA 1L1FA 4FK5C 3M7MX 5E3IA 3ZX6A 5B3SC 5ITZB 1IBLO 3LUTB 4JI5B 3V8KA 2GTAA 1K9MW 4MW8A 1YB3A 4YJ3A 3HXWA 2Q67A 2YC0A 4RDXA 4J41A 4LF4O 4KQEA 1F51A 4DXWA 3PJSK 5LMNB 1B06A 2LW1A 4HWPA 4WFAV 1R73A 5JCOA 1FFXB 2VQEB 5TISZ 2GV9A 2XAQA 2RJZA 1D5NA 2X6CA 1XDCA 3AK3A 3RFRA 1VQZA 4PI2A 4JI0O 4I9WA 4WBNB 2KKWA 4H2VA 2RDCA 2YXLA 3VOUA 1Y76A 3RF1A 1GGMA 1XL6A 2EJ9A 1MSWD 1W2BU 4JI2O 1VQ8V 4HWSA 3ZHRA 3CD6V 4JV5B 1E1QG 5IY5C 4TQFA 3DGEA 3F7VC 2EIMC 4PHCA 4R8CA 4O4LA 2IY5A 5JVDB 2UXBO 2ZDIC 2Q73A 4WFBV 3FJPA 1KYOF 3NXSA 1RSOB 4O4HA 3B77A 1HDJA 2LP7A 2N04A 2CTQA 5L3DA 4TUYB 2QJ1A 3AG4B 4UCSA 3ABLB 3TCUA 2E5LB 3PZCA 2ATKC 4UCUA 3HRIA 4D7SA 2UUBB 2WLMA 4PHZA 1M93A 3A5ZA 5AG2A 5JCOC 3N2GA 5EZYB 3V8JA 4PDMA 2ALYA 2ODMA 3K5LA 2BOBC 2AMCB 5KHIA 1YFTA 2FKXA 1QBZA 4JTDB 1IVSA 5B1BC 4LR3A 3CC2V 4IYHA 3U11A 1E1TA 4MVRA 5B1AB 1RM1B 5CA3A 3FYEB 1NQTA 1SZTA 4ABMA 3ETDA 1VP7A 3K03A 4FFKA 1NTMH 3W7UA 4P71C 3APOA 1KC8W 1Y67A 4K0KB 1YJNV 4K8ZA 1X56A 1P7GA 2F95B 1SF9A 1OCOB 1UPGA 2HR3A 2F4VO 2ZR2A 1EFWA 4J9YB 4XTZA 3CXCU 1VQOV 2D3OW 1N9WA 4O4LB 3JD1A 4PA9A 1H2LA 5IE9A 3JAMN 4XU2A 4Q15A 2FL4A 3BY6A 3HKBB 4DK1A 5HFMA 4OGQB 3CJHA 1WU7A 1TUBA 4LH6A 1NJ6A 3LDCA 3MF1A 4O4JA 3KCXA 4TUYA 2JGDA 2DTIA 2P22C 2CTPA 4UV9A 3K0DA 3VQVA 5JWPA 4YJ2B 1BCCH 4UV8A 1X01A 4J80A 3OMAB 4DR3B 2XTIA 4MSWC 3T1HB 1W66A 1IZ3A 2BOCC 3UT5A 2Y48A 4UP9A 4WF2A 3G71V 1VQ6V 3OEEG 1HNWB 3BA8A 1ADJA 2LW7A 3LSSA 4DW1A 4JI2B 4U3JB 4ZIBA 3HXYA 5CB4B 4RUFA 1IBMO 4ZKIA 3A31A 2A9HA 4EO4A 3N2KB 1K97A 4U3FH 3F7YC 1DTOA 3WB1A 3E35A 1B7YA 1MZEA 2FYUH 2WLLB 1X2HA 4TOIA 4IIJA 3E8BA 1NJ5A 2HHHO 4NCXA 4D6TH 1S76D 3CPWU 4WJ4A 4LCUC 3BFMA 3EFFK 4MVQA 2IJHA 4P3OA 1X4TA 4FJCC 1K4CC 1QLEB 3REXA 3P32A 1IL2A 2YXHA 2DZ9A 1Q43A 2UUBO 3Q4HA 5GTHZ 1Y6XA 5C8YA 4H2XB 2DQ0A 3FD9A 4MW3A 4ZI7B 3CE2A 4WBNA 2CJAA 1IURA 1I0HA 4X1IB 1JCHA 1G1XB 2Y69B 3D8CA 4HBNA 2H8PC 3CCSV 4HAMA 4DV1B 1AJNA 1H4SA 4FM2A 3G4SV 2NLJC 2WLNA 4PA6A 3TXSA 4FLWA 3RYCA 3ASNB 2ZDIA 4NVPA 1EM1A 2GBOA 3LSUA 1KMMA 4H02A 2ZR3A 5C53B 1V55B 4ZBMA 1GH6A 4TVYA 2YUAA 4FVMA 3JAKA 1VIBA 3EVKA 3RKYA 1EIYA 4IHJB 3E2EA 1NR7A 4MVOA 2EIKC 1GN4A 3ZRWA 5B5EZ 2ETNA 2OCCC 2WA3A 4H33A 4EB6B 1B76A 1HXDA 1JJCA 4LVMA 2QTOA 2YDEA 5DECA 3AK2A 1KKCA 3RYIA 3IC7A 3K5MA 3EFRA 3ASOB 2X7RB 4JZGA 1XNRB 2NN4A 2MK3A 3M99B 2G4CA 3OR7C 5B1NA 4P2ZA 4LFBB 3HFZB 2XASA 2EINC 1N0NA 2UXNA 5EC1C 3G67A 4F6EA 5LA6A 1AB3A 3WG7C 3N27A 2C8MA 4DPGA 3CB2A 4BIUA 4DV0O 4LFBO 4L8JA 1R6KA 3K57A 2QWQB 1OV9A 2L6LA 4WFEA 2PTMA 2EWNA 4PDLA 4KL1A 5IDJA 3ZHTA 1XMQO 4XU1A 4G2KA 2OIEA 1NJ8A 2LQTA 4LVIA 1AI6A 4H44B 3HKDA 3MF2A 2QDOA 3L74H 3K08A 2JVDA 4PDRA 4TWKA 1VQNV 4B3SB 5JJEB 2CGNA 4GCZA 1QE0A 4PG3A 2GUZB 1VF7A 3BCCH 2P67A 2ARSA 3ABTA 11ASA 1VQ7V 3KG2A 2DTOA 3FFQA 1KUQA 1FJGO 2ADPA 4JI8O 4LF8B 4O4IA 1COWG 3AG2B 4YJ2A 5CA0B 1NJ1A 1FFTB 3GWOA 4JI4O 3VQWA 3M8AA 1NNHA 4LNSA 4XEOA 2R70A 3CRCA 3P8VA 5GONA 3HXZA 4YRKA 1NI8A 2OWOA 1RP3B 1LYLA 1DLBA 4JI1B 1J5EB 1Y76B 1N36O 3FYIB 1JJOA 4YIOA 1OCCC 3DC5A 1QHTA 5LYJA 4JI1O 1NKDA 1XL4A 3E86A 2Y4UA 4O2BB 1K5QA 3OW2U 1BSMA 3ETQA 1ADYA 1XNRO 3ABKB 3UFGA 1FXKA 2RHQB 4FPPA 3KFUA 4CH3A 4YRFA 4HVCA 1JQ0A 4NXNO 4C7UA 4CH6A 1T5EA 3FB7C 1G8MA 1R3KC 1DGSA 1H4TA 3IKMB 3T4DA 4DV0B 4G28B 3OD1A 3L4GA 4H2XA 5GTIZ 1TA8A 2OCHA 5KA6A 1Z5VA 4BIOA 3B8NA 4Q20A 3REUA 2WPDG 4TV8A 3JD0A 1YDXA 3PN1A 3OT7A 1S5LZ 2FTKA 1Q86W 4P30A 3ERRA 4K35A 4UCOA 2I4MA 4HYOA 3RIRA 2LGQA 4FFBB 5A2QN 3CX5F 3JATB 2Y0IA 1QCEA 3A0BZ 1QVGU 5CA0A 4BW9A 1N32B 1BIBA 4XDLA 1V9PA 5HFLA 2XNDG 2BTQA 3E22A 4LF9O 4I55A 3R07A 3L2ZA 2IU0A 2Z5UA 5KA5A 3X2QC 1K7DA 1JX9A 1SQXH 2W0FC 4Q6GA 3SPIA 1Q82W 1YI2V 1PL4A 3OM3B 5CA1B 5KX5B 2VQFB 4DR2O 4K87A 3RGLA 2E3CA 4EB6A 5KHJA 1GM7A 1FJGB 3JASB 2E64A 4LF9B 3THOA 1ASZA 3P30A 4FM1A 4JI4B 3EFSA 4DV2O 4I0XB 4XEMA 4KR2A 3P8YA 5LYJB 4H2WA 3JALA 4O2BA 4DV4O 5IJ0A 1MG1A 2VRZA 3L72H 3IJ4A 1N36B 2ZNIA 1QLEC 1GAXA 4HWRA 2XT9A 1FFXA 2M6YA 4BW5A 3ABUA 5KLVH 4JI8B 2CJ9A 1Q8IA 4J11A 3AG1C 3UH0A 1GN6A 1YHQV 1N34B 3IC9A 3ZJZA 3RYFA 1BIAA 4DV6O 2F66C 4LFAB 4OX9B 4TV9A 1NH2D 3HXXA 2QWNB 4DR1B 5FNVB 1M56B 2IY5B 2V4DA 2DN9A 2MW2B 2ZCEA 4GUNA 1URFA 1ZAUA 4X62O 4U3JA 2EJFA 3HKDB 2IH1C 3R65A 4DR1O 1JVMA 2JK5C 4DUYB 2DE0X 1IBKB 2ZT5A 1YEWA 4DV3O 4KHPB 4IL6Z 4YRCA 1H4QA 3DXRB 4EKWA 4IIJB 2P0LA 2ZT6A 2ZT9B 1NYQA 2EIJC 1USYC 3GB7C 1MZFA 5KHHA 2PF4E 1EIYB 5IJ9A 1W0JG 4J10A 4DR4O 1Z7NA 2K9PA 1IXMA 4GX1A 3RVYA 4JI6O 1US6A 3S3WA 3L75H 4YRMA 4EFEA 3JASA 4MTOA 4GZRB 1PNMA 2X0LA 2V7QG 1X54A 1XNQO 3CMEV 2EINB 4I5SA 2XAFA 4H0LB 2CGOA 5LGTA 1NTKH 3UO2A 4I50A 2PI5A 4QE9A 3CWBH 2NR5A 4LNUA 5LA6B 2ZXWB 1R3LC 4J7JA 2ZE8A 1Q5OA 2EZOA 3E9HA 2DMXA 2Q0OC 2Q68A 5KHGA 3V7SA 1FPOA 1GRJA 4ZOLB 2OTLV 4O2DA 2J3MA 3TEGA 3JSNA 4JI0B 1K34A 2QM7A 2DYSB 2RHQA 4LF5B 4JTCB 3J80N 4DR6B 4O2AB 1NU1H 2ZE5A 2WLJA 3K5NA 5LHGA 5FPRA 4EX5A 3ZMSA 4YRNA 2VQFO 2QGNA 1GK9A 2CTRA 4AQYO 2P06A 5LGNA 5EIBC 2CUGA 3SJQC 3OFNG 2AKWA 5CBGA 3WB2A 1V54C 4GKKO 5BY1A 3SYPA 2X6BA 3STZC 3CJHB 1HNZB 3SDLA 4AQYB 2JRIA 1XILA 4UUJC 2Q0AA 2VWKA 3FB5C 1SETA 2ODRD 5JVDA 2CJBA 4O4JB 4ZHQB 3B09A 1XEQA 4XU0A 2B1GA 1KBHA 3T1CA 2YIAA 4AI8A 3QTCA 4P74C 3KZIZ 5BR8B 5IJ9B 4R50A 1RM1C 4O4IB 4B3RO 2RCVA 3HKCB 1X55A 4X8AA 1KECA 3RYHB 2XTAA 5LP6B 5K1XA 1FYJA 2L35A 2EBOA 1BT8A 4RAIA 4ASUG 2B9ZA 1ZTEA 2M7WA 4LFAO 3AEIA 2CH7B 5CA1A 1AJQA 5KUMA 1MABG 1OCOC 4GX5A 4KFMA 1OJHA 2HLDG 4FM0A 1BZKA 4LNUB 1N33B 2IU3A 1VQLV 2ODRC 2AMCA 1XUQA 2J3LA 2HFEC 3P3PA 1ASYA 4NXNB 3JD2A 3JALB 2R9IA 3CCQV 1XMOO 1Y74A 2ZNJA 5EYPB 5JQGB 1YF2A 1FXKB 1G6UA 2RMKB 1F4NA 3MHHC 1RFYA 4QGPA 2IBZH 2WAMA 4P74A 1EBOA 2WSSG 4OPHA 1PKXA 2EIMB 1K5SA 1SQBH 3ABMB 4TV9B 4GLXA 4UCTA 1UFIA 1GKFA 1WPYA 1DF5A 1AI7A 1CP9A 4K3AA 3UCSC 4B3MB 3CRAA 3K0GA 3ZHQA 2DEQA 2JS5A 3EHBB 1EN6A 4B3TO 3UKMA 3AG4C 1TUBB 1JFFA 1VQ9V 3W7TA 3TXQA 1K73W 2LGWA 4P3PA 5DEDA 1PP9H 1ZL8B 2PGGA 3HY1A 3T1HO 3HKCA 3UO3A 3X2QB 1BQ0A 5EIBD 4UCVA 4JI3B 3A74A 1OCRB 5LP6A 1NS1A 1TVKB 1HNWO 1OCZB 4YCWA 3JCUZ 3QVNA 3RN4A 1QR8A 1GM9A 4XTYA 2IM9A 3OTFA 5LXTB 4YP0A 1BQZA 4UP7A 2BSKB 1L0WA 1S72V 5GW7A 1YZBA 3W7WA 3A0RA 4XDKA 3P3NA 3OEHG 2KQXA 4P75C 2ZZEA 1JR9A 1VMGA 3RWRD 3SYCA 1KQSU 1SA0B 2HJFC 4DUZO 1A32A 1ZSPA 4FLYA 2Q5IA 4F6RB 3UGTA 1R3JC 1HTTA 5IJ0B 2OT5A 4DRXA 3PCOA 2AHYA 5LGUA 4X88A 3ASNC 4O4HB 1RPRA 3I7FA 4DUZB 2R72A 1WPXA 2EJRA 4WFFA 3ZMUA 2UXCB 4BWAA 2EZPA 3CRRA 1FD9A 4QJFB 1PNLA 1BBWA 4ICGA 2P6JA 3RUXA 1YXBA 5IYBO 2QHVA 4LF6B 2XUMA 5J9PC 4YRGA 4J15A 4RUEA 2H94A 1MOFA 2DVEA 3NENA 4YROA 1SESA 2H3OA 1FKAO 3WB0A 1DF4A 2YI8A 1H8HG 4R7CA 5FNVA 1AR4A 1KD1W 3BA9A 4P9PA 3UGQA 4OXSA 2EILC 5J2UA 3I56V 4H2SA 2BE3A 5L3CA 3B4SA 2E41A 4YYEA 2Y0PA 2LO1A 1I5XA 4F4LA 3HY0A 5BMVB 3T1YO 4PDVA 3TK1A 4YRIA 1SQPH 4X65O 1WJZA 2CDYA 2DJVA 1HP8A 1JA8A 5FLXN 1VQPV 1NH2B 4LWSA 3NEMA 1BMFG 4X1KA 3IAYA 3ZEDA 4QPJA 1L0NH 2YIBA 1IDSA 1AP5A 4LVJA 5H9CA 1H2KA 1Y66A 3JAKB 1SZXA 4CH5A 4FLZA 4YCVA 4H13B 1I94O 2ARTA 4YRQA 1MA1A 3V7RA 4JI7B 3K79A 3A2FA 3H1IH 5IYZB 1PL0A 1ZLZA 1JJCB 4PELA 3G6BA 4YY3B 4JI3O 4K86A 5ITZA 3C3TA 4JI7O 1AROP 3CCJV 4JI5O 4DQ2A 2Z0AA 4YRTA 1FYFA 1AR1B 2DOSA 4Z2WA 3K59A 1VQ5V 3HXUA 1KB9F 1UJWB 3PCOB 4RMFA 2ZQMA 3NETA 3SJBC 5KMGA 3F5WC 3LSQA 1YITV 3TEHA 3E89A 4FZ1A 4FLVA 5F5WA 2ARHA 4XTXA 4NXMB 1WYDA 2E1HA 5LL6Y 4YRLA 2XAHA 1SQVH 1XMQB 1M9NA 2X6AA 2VWJA 3L1AA 1QU7A 1AR5A 3ZCCA 4MVSA 1ZWIC 5E1AC 2C7IA 2JJ1G 4L87A 4RQEA 1KP2A 4CS2A 2QM4A 4H2UA 3E8FA 1V55C 4X64O 4TTVA 3N2KA 2AZ0A 5DN6G 2YXYA 1EN5A 4FFBA 5EZYA 1WNSA 3OUFA 3HPLC 3IFXA 1H2GA 4ZHQA 1ZX3A 3HTZA 3FAVB 4JTAB 3TGUH 4G85A 4LF8O 1Q6UA 2ZGWA 4JZ2A 4OPAA 4XTUA 2YI9A 3I5DA 5J2TA 1BHBA 1E24A 4X66O 2KB1A 1EZVH 1LNQA 1Q3EA 1B70A 2K1EA 5DM6V 3ML0A 4DR7B 2YEVB 2ADQB 3ETEA 4UVBA 1KKDA 4CC6A 3H1LH 2UUCO 2EAYA 4PA7A 2DYRB 2ZINA 3ASOC 1K92A 3SYQA 2CH7A 1M5IA 4U7OA 1M90W 3F5TA 1I94B 2AW9A 3IG2A 1R3IC 1EZJA 5A9GA 4CS3A 1LUVA 4UCRA 1IBLB 2JJ2G 1QVFU 4FLTA 2R9RB 5IY5B 4JPRA 3W7SA 3QG5A 5KAFZ 1Q6IA 1WQ7A 2Q4PA 2FB5A 3CC7V 1QNMA 1X59A 1D2DA 3ZHSA 1SQGA 2Q5ZA 1CPYA 3HKBA 3SPGA 4K0KO 2QA4V 2CK3G 4WFGA 4HNAB 4X89A 3SPHA 4LH7A 4K88A 3A7UA 2HEPA 4DR5B 2F4VB 2NNUA 1K3EA 4I9QA 2ITCC 4B3MO 2IJJA 2ILMA 3L4GB 1JPXA 3AG3C 3A0HZ 4E2LA 1E22A 3QO7A 4JYBA 1TUEB 4NTYA 1KMIZ 2ZXFA 3RYIB 3QNEA 5IWAO 3D3IA 4IT5A 3JAWA 1XHXA 1P4RA 3SJCC 1BBUA 2HG5C 1QF6A 2DQ3A 3M4PA 3FAVA 1GTOA 1RSOA 4J7KA 3BHPA 2HP8A 1JFFB 3GWKC 3CRMA 2XHBA 3ETGA 2JEUA 1G5IA 1VARA 1N4CA 1SQQH 4YDQA 3RGBA 2P7TC 3CCVV 2E76B 3JD4A 3WU2Z 2EIKB 1VF5B 4UP8A 2OCCB 3AK1A 3APQA 3BEHA 1Q81W 3CCRV 1HNXB 3MD0A 5CMUA 3C90A 2ZZFA 4JAUA 4IGGA 3AG1B 3L70H 2EULA 3HB3B 5CB4A 2F93B 4K8XA 3TETA 1VF6C 5EBWC 2F1MA 4BAYA 4UXNA 3VQYA 4E4EA 4JGSA 2UU9O 1YVWA 1YJWV 2DDZA 4X1IA 5IYDO 3E8HA 3HKEA 4W4KA 1QR9A 2AHZA 2XAJA 1WB8A 1GM8A 4DRXB 2HNIA 3LNMB 5KMGB 3MDSA 4X20A 12ASA 1PPJH 1BL8A 1PV0A 1ZL8A 3RKXA 2F43G 2I4NA 1HWYA 4JYCA 2CTWA 5BZBA 2E65A 4WJ3M 1O9GA 2RN9A 2Z3YA 3CHXA 4TVAB 4IHJA 5GONB 2EILB 5IT9N 1P49A 4GT1A 1OZ0A 4MVZA 3JD3A 2EJGA 1R6TA 2A8EA 1KOGA 4CH4A 1Q6HA 1SRYA 4DUYO 4FIPC 5B66Z 5L3GA 5L3BA 1XI1A 1SA0A 2PMEA 4KHPO 2QSAA 2F23A 2ZD9A 3DSQA 4ZTZB 3SPJA 4ZTUB 4YJ3B 1JJ2U 3SYAA 2V1DA 3RACA 4NB5A 4JYAO 1MNGA 4XDJA 2ZM6O 1MSDA 2DU5A 3BFRA 1JOYA 1O9HA 3K58A 4XTWA 3K9AA 2QM8A 4LVKA 1C0AA 2R9AA 2EX3A 3CXHF 3G80A 4JYAB 2AXTZ 3BRCA 3CS5A 2WLKA 5EBMC 1AI4A 4MVMA 2OTJV 2AGAA 2ARUA 1NZ6A 5LHIA 3WQZA 5D5QA 1K33A 2YSUB 2JDIG 4B08A 2PMFA 1GO3F 1LR1A 2Y69C 2WA4A 1QLNA 1WN7A 1WA8B 4TSFG 1SERA 4P73C 4H37A 4TQDA 1V54B 2EJ7A 1SQFA 3TUPA 4JV5O 2YS8A 4XTVA 4YXWG 2HHHB 4FLUA 5KNNA 4DR2B 3JSLA 4HT4A 1XBLA 3WFVA 2HVJC 3OMNB 1PNKA 3OUSA 3C3SA 2FMLA 1ROPA 4X1KB 1W59A 1E1RG 2GUZA 4AILC 3RW0A 2P90A 4GX2A 2WLHA 2EL9A 1IX9A 1L0LH 4I4TB 2PI4A 2DZCA 4YREA 5FPOA
chains in the Genus database with same CATH topology
4PG3A 4N21A 2HJFC 4JASA 2QHSA 2Q5HA 3ZMVA 2E5AA 3ZN1A 1NVPD 3RVZA 3W3SA 3H01A 2Q5IA 2P67A 2ARSA 3UGTA 3ABTA 11ASA 1VQ7V 1M57C 3KG2A 3SYOA 3A7RA 1EFRG 2DTOA 3UM7A 3IKLA 1R3JC 1S3JA 1HTTA 2XGTA 2OT5A 3PCOA 1COWG 3AG2B 4PA4A 2AHYA 5LGUA 2DXTA 4X88A 4YRSA 4MS2A 1NJ1A 1FFTB 3ASNC 3GWOA 4YRJA 4HZ3A 1RPRA 3I7FA 1GMGA 1NYRA 3VQWA 3RBZA 1NNHA 4LNSA 4XEOA 3OAAG 1PYSB 1WPXA 2EJRA 4WFFA 3ZMUA 2I4LA 3P8VA 4BWAA 2EZPA 3HXZA 3IGAC 4YRKA 3OGCC 2I4OA 4QJFB 4MTGA 1PNLA 1BBWA 2A79B 2P6JA 3RUXA 5IYBO 2B5UA 2QHVA 3T2MA 5L3FA 1G5HA 1LYLA 4UPAA 1DLBA 5J9PC 1S0VA 4P73A 4YRGA 4J15A 2LFSA 4RUEA 1VQ4V 2H94A 3FYIB 1MOFA 4R6ZA 3SPCA 2DVEA 3NENA 2DYRC 3JYCA 4MTFA 4YROA 3TEHB 1SESA 3ZRWB 1DF4A 4WFHA 4AH6A 4DO2A 1H8HG 4R7CA 3ZIAG 1FXKC 1J5WA 1OCCC 3LDDA 4QE7A 1KD1W 4P9PA 2QKSA 4JF3A 4OXSA 3UGQA 2EILC 3I56V 1NKDA 1XL4A 3E86A 4KUMA 4H2SA 4P71A 1K5QA 5L3CA 2E41A 4YYEA 2IH3C 3OW2U 3FB6C 2A0LA 3ZRVA 1I5XA 3CCMV 4F4LA 1USYA 1ADYA 3HY0A 3ABKB 4PDVA 1OCZC 3UFGA 1FXKA 5H6QA 2RHQB 4FPPA 2QHTA 3KFUA 3TK1A 4CH3A 4LC1A 5B1BB 1RPOA 3HXVA 4YRFA 5H6RA 4HVCA 1JQ0A 3OMIB 1VQPV 1NH2B 3QO5A 5IYCO 3NEMA 2ZIMA 1BMFG 1VQKV 4CH6A 3QO8A 4QPJA 3FB7C 1G8MA 1R3KC 5B1AC 3M4QA 1VQMV 1H4TA 1R6NA 3IKMB 4LVJA 3NELA 5H9CA 4CZZA 4QNHB 4XU3A 1Y66A 3T4DA 4OLFA 4YPFA 4CH5A 4G28B 4YCVA 1NVPB 1PYSA 2DYSC 2HVKC 2CIMA 2CGHA 3HFZA 2ARTA 1B7YB 3OD1A 3L4GA 4H2XA 4YRQA 2ZIOA 5K1PA 4YCUA 3V7RA 5KA6A 1L1FA 4FK5C 4WI1A 5E3IA 3B8NA 5B3SC 5CBFA 3K79A 5ELNA 4Q20A 3LUTB 1J95A 3REUA 2WPDG 3V8KA 1K9MW 3JD0A 1PL0A 4XBFA 4MW8A 1YB3A 3HXWA 2Q67A 4RDXA 5KUKA 1JJCB 4PELA 4KQEA 2WLIB 2FTKA 1F51A 1Q86W 4K86A 4P30A 3PJSK 4DXWA 4HWTA 3ERRA 5C52B 3CP1A 4HWPA 4WF9V 4HYOA 1AROP 1R73A 4WFAV 3CCJV 2I4MA 2C2AA 3RIRA 4LVLA 4DQ2A 2XAQA 3MEYA 2X6CA 4YRTA 1FYFA 1AR1B 4Q6GA 1VQZA 1VQ5V 3HXUA 1UJWB 1QCEA 4I9WA 3PCOB 4RMFA 2ZQMA 1QVGU 3CCLV 3NETA 4H2VA 4BW9A 1P7BA 4LP8A 1BIBA 3F5WC 1NBMG 3LSQA 4XDLA 3VOUA 1YITV 5HFLA 1GGMA 1XL6A 2XNDG 2ALYB 2EJ9A 1MSWD 3RF1A 1YTFD 4QPKA 3R07A 1W2BU 3E89A 3TEHA 3L2ZA 2IU0A 2Z5UA 5KA5A 1VQ8V 3X2QC 1YFSA 4HWSA 1K7DA 3CD6V 5HGQA 1JX9A 5F5WA 2W0FC 3SPIA 3CCUV 1WYDA 1Q82W 2E1HA 1YI2V 1YGBA 2DXUA 1E1QG 1OCCB 2W6IG 3OM3B 5IY5C 4P3NA 4YRLA 4K87A 4TQFA 3DGEA 4MVUA 2E3CA 3F7VC 2EIMC 2XAHA 4UVCA 4PHCA 4R8CA 2IY5A 1YIJV 1GM7A 1G4YB 2ZDIC 2E64A 1M9NA 4WFBV 3FJPA 1ASZA 3P30A 2X6AA 3NXSA 1KMNA 3CMQA 3L1AA 4YRRA 2DU7A 3B77A 3EFSA 1E79G 3ZCCA 4MVSA 2LP7A 4FMTA 4PA3A 2NS6A 4XEMA 4KR2A 3P8YA 5L3DA 1ZWIC 5E1AC 2C7IA 4H2WA 2JJ1G 2QHUA 4P75A 4L87A 4WCEV 3AG4B 1MG1A 4RQEA 1KP2A 1NR1A 1Q7YW 4H2UA 4CS2A 4YRPA 3STLC 3ABLB 3E8FA 1V55C 2UXXA 4TTVA 2ZTGA 2ZNIA 1QLEC 3TCUA 5DN6G 3PZCA 4HWRA 2ATKC 3OUFA 3HRIA 3HPLC 3IFXA 1H2GA 4BW5A 4YREA 3ABUA 2CJ9A 2WLMA 3LDEA 3AG1C 3DTUB 3HTZA 3UH0A 1YHQV 4JTAB 3A5ZA 4G85A 2ZXWC 2ZGWA 3A32A 4XTUA 3ZJZA 1W0KG 1BIAA 3ICAA 1BHBA 1E24A 3V8JA 2KB1A 4PDMA 2ALYA 4CS4A 1LNQA 3VQXA 1RIQA 1B70A 2K1EA 5DM6V 3B8MA 1NH2D 3ML0A 3HXXA 2BOBC 2YEVB 2AMCB 1YFTA 3ETEA 4UVBA 2Q69A 1KKDA 1QBZA 4JTDB 5B1BC 2EAYA 4PA7A 1M56B 2DYRB 2ZINA 2IY5B 3ASOC 2ZCEA 3CC2V 1K92A 1E1TA 4E51A 3SYQA 4MVRA 1FXHA 5B1AB 1RM1B 2EJFA 4U7NA 4LVKA 4U7OA 1M90W 3A7AA 5CA3A 3FYEB 2IH1C 1NQTA 2W6JG 3R65A 1SZTA 3IG2A 1JVMA 1R3IC 3ETDA 2JK5C 1EZJA 3K03A 4G27B 4OP0A 4CS3A 3AG2C 2ZT5A 2ZT8A 4P72A 3W7UA 4P71C 2JJ2G 4YRCA 1H4QA 5B1OA 1QVFU 2R9RB 5IY5B 4EKWA 4JPRA 1THZA 1KC8W 2P0LA 3W7SA 1NYQA 2ZT6A 1YJNV 1X56A 2EIJC 1USYC 2WWWA 3GB7C 1EQRA 1WQ7A 4HWOA 2DWEC 3CC7V 1EIYB 1H4VB 1OCOB 5FL7G 2HR3A 1W0JG 1X2GA 1CPYA 2JEXA 1Z7NA 3OE7G 2ZR2A 1EOVA 4G84A 1CEZA 3ZMZA 1EFWA 3SPGA 4J9YB 1B6QA 1IXMA 4GX1A 3CXCU 3RVYA 2Q7HA 1VQOV 2D3OW 1N9WA 4XTZA 2QA4V 2CK3G 4WFGA 1OCRC 3JD1A 4PA9A 4YRMA 1YSCA 1AI5A 4X89A 3HFVA 3SPHA 4K88A 4XU2A 4MTOA 1PNMA 2X0LA 3A7UA 4Q15A 2V7QG 5EC2C 5B3SB 2IJKA 1X54A 3HRKA 3BY6A 2NNUA 1K3EA 3CMEV 3FB8C 4LBEC 4H2YA 2EINB 5HFMA 1WU7A 4I5SA 2XAFA 2ITCC 1NJ6A 1ORQC 4CBCA 5LGTA 3LDCA 3MF1A 2IJJA 2PI5A 3LC0A 4QE9A 3L4GB 1JPXA 3AG3C 2DTIA 4UV9A 3K0DA 4E2LA 1E22A 1M1KW 3ABKC 3VQVA 3QO7A 4JYBA 1TUEB 2QEXV 2ZXWB 1R3LC 2EZOA 2ZXFA 3E9HA 4UV8A 1X01A 1H8EG 3QNEA 2RHSA 3D3IA 2Q68A 3OMAB 2XTIA 4MSWC 1W66A 2BOCC 1WLEA 4TVWA 2Y48A 3V7SA 2QE7G 4UP9A 4WF2A 1P4RA 3G71V 1BBUA 2OTLV 2HG5C 1ENVA 2DQ3A 4KP4A 1E1OA 2J3MA 4H2TA 5L3EA 1VQ6V 3M4PA 4O2DA 3TEGA 1GTOA 3OEEG 3JCZA 5LHHA 1K34A 3FKSG 1ADJA 2ZT7A 2QM7A 2DYSB 1N8RW 2RHQA 3WG7B 3VBBA 3ETGA 2JEUA 3LSSA 1G5IA 4JTCB 1EVLA 1K4DC 1ATIA 3CC4V 1AJPA 3CYOA 4YDQA 3HXYA 2DKGA 2P7TC 2WLJA 4RUFA 4QIWF 3JD4A 4ZKIA 5LHGA 3CCVV 4EX5A 3ZMSA 2EIKB 3A31A 4TWAA 4UP8A 4YRNA 2A9HA 1GK9A 2OCCB 3BEHA 1Q81W 4EO4A 1K97A 5LGNA 3CCRV 2Q6AA 3F7YC 3MD0A 1YJ9V 1WQWA 3ZRSA 1DTOA 3SJQC 4X5OA 3OFNG 3E35A 5CMUA 3T4ZA 2ZZFA 1B7YA 4JAUA 2AKWA 2WLLB 1X2HA 5CBGA 3E9IA 1V54C 3AG1B 3HB3B 3RGLA 3TETA 3SYPA 2X6BA 2EIJB 3E8BA 5EBWC 3STZC 1NJ5A 4BAYA 1WNLA 2ODRD 3G1ZA 4UUJC 3FB5C 4UXNA 1SETA 4NCXA 3VQYA 2CJBA 5ELOA 1S76D 4JGSA 3CPWU 4WJ4A 1NJIW 4LCUC 1M57B 3ABLC 3EFFK 4MVQA 2IJHA 3ABMC 1YJWV 4FJCC 2DDZA 3BFMA 4P3OA 4XU0A 2B1GA 3T1CA 1K4CC 1QLEB 3QTCA 5IYDO 3E8HA 3REXA 4P74C 4KR3A 3P32A 1IL2A 1FXVA 1Z7MA 3I55V 3K06A 3K3WA 2Q7GA 1G51A 4MTXA 1QF6A 1QR9A 2AHZA 1F23A 4GX0A 3ZMTA 3CCEV 2DZ9A 2XAJA 4R50A 4H2XB 2DQ0A 1RM1C 1GM8A 2HNIA 5EK0A 3LNMB 4MW3A 5C93A 1X55A 1PD3A 4X8AA 2CJAA 1KECA 3MQZA 1JCHA 2Y69B 5K1XA 2H8PC 2EBOA 4N23A 4RAIA 3CCSV 4HAMA 1AJNA 4ASUG 12ASA 2HKOA 1H4SA 3MHSC 2LFRA 1BL8A 2JIZG 3G4SV 2M7WA 2E10A 5CN0A 3RKXA 2XOKG 2NLJC 2F43G 5CBHA 3AEIA 2I4NA 1HWYA 2WLNA 4PA6A 4JYCA 5BZBA 2E65A 4WJ3M 1AJQA 3ASNB 2Q7EA 5KUMA 2ZDIA 2Z3YA 4TVAB 2XAGA 1MABG 1OCOC 3OR6C 4GX5A 4KFMA 1KMMA 4XTXA 2EILB 4GT1A 4H02A 3RKWA 1OZ0A 1H38A 2ZR3A 2HLDG 5C53B 1V55B 3ZRXA 1HC7A 2IW5A 4ZBMA 1B70B 3W7XA 2ODRC 2IU3A 1VQLV 2YEVA 4MVZA 3JD3A 2AMCA 4TVYA 3BJUA 2J3LA 2HFEC 1ASYA 2RHSB 3JD2A 2DW4A 3RKYA 2EJGA 2A8EA 1EIYA 1KOGA 2R9IA 4CH4A 3E2EA 1QE0A 1NR7A 1Y4MA 4MVOA 1SRYA 3CCQV 4FIPC 2EIKC 5L3GA 3ZRWA 5L3BA 2ZNJA 4RQFA 2OCCC 2ITDC 4BIZA 2PMEA 5EBLC 4H33A 1FS0G 2ZD9A 1FXKB 1EVKA 4P9OA 3DSQA 2FYKA 1I5YA 4ZTZB 3SPJA 3AG3B 1B76A 4ZTUB 1JJ2U 1F4NA 3E83A 2DJZA 3SYAA 3MHHC 1HXDA 3ZN0A 2V1DA 3G6EV 1JJCA 3RACA 2B1IA 4XDJA 2DWDC 2WAMA 1B8AA 4P74A 4LVMA 2QTOA 2DU5A 1EBOA 2WSSG 3IC7A 1M56C 2GSMB 4TT3G 1S77D 1JOYA 3EFRA 3ASOB 3K9AA 4XTWA 2X7RB 1PKXA 1YFRA 2QM8A 2G4CA 2MK3A 2EIMB 3M99B 3OR7C 5B1NA 1F4MA 1K5SA 2GHYA 4P2ZA 2XASA 4UVAA 3HFZB 1C0AA 3ABMB 2EINC 2UXNA 3P8TA 5EC1C 1GKFA 5LBQA 1WPYA 3D36A 1DF5A 2WLKA 3WG7C 5EBMC 1AI4A 1AI7A 4MVMA 2OTJV 2DTHA 3IALA 3V7CA 2IJIA 1CP9A 2C8MA 4TVAA 3K04A 2ARUA 4DPGA 3K0GA 5LHIA 1S5HC 4BIUA 2DEQA 3WQZA 1R6KA 1K33A 2YSUB 3EHBB 2WLIA 2JDIG 2PMFA 1GO3F 1NJ2A 2Y69C 3UKMA 5C51B 3AG4C 1YTFB 1QLNA 3CMAV 2ZZGA 1VQ9V 1OHHG 3W7TA 4TSFG 1SERA 1K73W 4P73C 4H37A 4TQDA 4WFEA 4JAVA 1V54B 2AKWB 2EWNA 4P72C 4P3PA 3TUPA 4HA8A 3HY1A 3A5YA 4PDLA 3RL6A 4XTVA 4YXWG 4MT8A 3X2QB 1KP3A 3A74A 5KNNA 1OCRB 2P5IA 5IDJA 4HT4A 4YRIA 3WFVA 1OCZB 4XU1A 4RO2A 2HVJC 4G2KA 4YCWA 1NJ8A 4Z1MG 3OMNB 4LVIA 1QR8A 1PNKA 1GM9A 2WLLA 3OUSA 4J9ZB 4XTYA 1AI6A 1ROPA 4YP0A 4UP7A 1E1RG 1L0WA 1S72V 5GW7A 3MF2A 3E8GA 3RW0A 2P90A 3W7WA 3A0RA 4GX2A 3V8LA 4XDKA 3K08A 4PDRA 1K8AW 2WLHA 3OEHG 4TWKA 2EL9A 1VQNV 1BHAA 4P75C 2ZZEA 1KQSU 3SYCA 2PI4A 2DZCA 4GCZA 4ZIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PG3 A;  2QHS A;  2Q5H A;  2E5A A;  3W3S A;  2Q5I A;  2ARS A;  3UGT A;  11AS A;  3A7R A;  2DTO A;  3IKL A;  1HTT A;  2XGT A;  3PCO A;  2DXT A;  4YRS A;  1NJ1 A;  4YRJ A;  3I7F A;  1NYR A;  3VQW A;  1NNH A;  4LNS A;  4XEO A;  1PYS B;  2I4L A;  3P8V A;  4BWA A;  3HXZ A;  4YRK A;  2I4O A;  1BBW A;  3RUX A;  2QHV A;  1G5H A;  1LYL A;  4UPA A;  4P73 A;  4YRG A;  4J15 A;  2DVE A;  3NEN A;  3TEH B;  4YRO A;  1SES A;  4AH6 A;  1J5W A;  3UGQ A;  4H2S A;  4P71 A;  2E41 A;  4YYE A;  3HY0 A;  1USY A;  1ADY A;  3UFG A;  2RHQ B;  2QHT A;  3KFU A;  4CH3 A;  4YRI A;  4YRF A;  3HXV A;  4HVC A;  3QO5 A;  3NEM A;  2ZIM A;  4CH6 A;  3QO8 A;  3M4Q A;  1H4T A;  3IKM B;  3NEL A;  4XU3 A;  4OLF A;  4YPF A;  4CH5 A;  4YCV A;  1PYS A;  2CIM A;  3OD1 A;  2CGH A;  3HFZ A;  2ART A;  1B7Y B;  3L4G A;  4H2X A;  4YRQ A;  2ZIO A;  5K1P A;  4YCU A;  3V7R A;  4WI1 A;  5E3I A;  5ELN A;  3REU A;  3V8K A;  1YB3 A;  3HXW A;  4RDX A;  1JJC B;  4KQE A;  4K86 A;  5C52 B;  4HWT A;  3ERR A;  4HWP A;  2I4M A;  3RIR A;  4DQ2 A;  3MEY A;  4YRT A;  1FYF A;  1VQZ A;  3HXU A;  3PCO B;  4RMF A;  3NET A;  4H2V A;  4BW9 A;  1BIB A;  3LSQ A;  3RF1 A;  1GGM A;  2EJ9 A;  2ALY B;  3R07 A;  3TEH A;  3L2Z A;  5HGQ A;  1YFS A;  4HWS A;  5F5W A;  4Q6G A;  4XTX A;  1WYD A;  2E1H A;  1YGB A;  2DXU A;  4P3N A;  4YRL A;  4K87 A;  4TQF A;  2E3C A;  3RGL A;  4PHC A;  2IY5 A;  2E64 A;  3FJP A;  1ASZ A;  1KMN A;  3CMQ A;  3L1A A;  4YRR A;  2DU7 A;  3EFS A;  4XEM A;  4KR2 A;  3P8Y A;  2C7I A;  4H2W A;  2QHU A;  4P75 A;  4L87 A;  4RQE A;  4H2U A;  4CS2 A;  4YRP A;  4TTV A;  2ZTG A;  2ZNI A;  3PZC A;  4HWR A;  3HRI A;  2CJ9 A;  3UH0 A;  3HTZ A;  3A5Z A;  4G85 A;  3A32 A;  2ZGW A;  4XTU A;  1BIA A;  3ICA A;  1E24 A;  3V8J A;  2ALY A;  4CS4 A;  3VQX A;  1RIQ A;  1B70 A;  3HXX A;  2AMC B;  1YFT A;  2EAY A;  2ZIN A;  2IY5 B;  2ZCE A;  1E1T A;  4E51 A;  2EJF A;  3A7A A;  3IG2 A;  4CS3 A;  4OP0 A;  2ZT5 A;  2ZT8 A;  4P72 A;  4P71 C;  4YRC A;  1H4Q A;  2P0L A;  2ZT6 A;  1NYQ A;  1X56 A;  1USY C;  1EQR A;  1WQ7 A;  4HWO A;  1EIY B;  1H4V B;  1X2G A;  4G84 A;  1Z7N A;  2ZR2 A;  1EOV A;  1EFW A;  4XTZ A;  2Q7H A;  1N9W A;  4YRM A;  3HFV A;  4K88 A;  4XU2 A;  4Q15 A;  3A7U A;  1X54 A;  3HRK A;  4H2Y A;  1WU7 A;  1NJ6 A;  3MF1 A;  3LC0 A;  3L4G B;  2DTI A;  1E22 A;  3VQV A;  3QO7 A;  2ZXF A;  3E9H A;  1X01 A;  3QNE A;  2RHS A;  2XTI A;  1W66 A;  1WLE A;  4TVW A;  3V7S A;  4UP9 A;  4WF2 A;  1BBU A;  4H2T A;  1QF6 A;  2DQ3 A;  1E1O A;  4O2D A;  2J3M A;  3TEG A;  3M4P A;  1ADJ A;  2ZT7 A;  2RHQ A;  3VBB A;  3LSS A;  1G5I A;  1EVL A;  1ATI A;  4YDQ A;  3HXY A;  2DKG A;  4EX5 A;  4TWA A;  3A31 A;  4YRN A;  4UP8 A;  4EO4 A;  1WQW A;  4X5O A;  2ZZF A;  1B7Y A;  3E9I A;  2AKW A;  1X2H A;  1NJ5 A;  1WNL A;  2ODR D;  3G1Z A;  1SET A;  4NCX A;  3VQY A;  2CJB A;  5ELO A;  4WJ4 A;  3BFM A;  2DDZ A;  4XU0 A;  4P3O A;  3QTC A;  3REX A;  4P74 C;  4KR3 A;  1IL2 A;  1Z7M A;  2Q7G A;  1G51 A;  2DZ9 A;  4H2X B;  2DQ0 A;  2HNI A;  1X55 A;  2CJA A;  5K1X A;  1H4S A;  12AS A;  2E10 A;  3RKX A;  2I4N A;  2E65 A;  4WJ3 M;  2Q7E A;  4TVA B;  1KMM A;  3RKW A;  4H02 A;  2ZR3 A;  5C53 B;  1HC7 A;  1B70 B;  2ODR C;  2AMC A;  4TVY A;  3BJU A;  2J3L A;  1ASY A;  2RHS B;  3RKY A;  2EJG A;  1EIY A;  1KOG A;  4CH4 A;  1QE0 A;  1SRY A;  2ZNJ A;  2PME A;  4RQF A;  1EVK A;  3DSQ A;  2FYK A;  4ZTZ B;  1B76 A;  4ZTU B;  2DJZ A;  1HXD A;  1JJC A;  3RAC A;  1B8A A;  4P74 A;  2DU5 A;  3EFR A;  4XTW A;  1YFR A;  2G4C A;  3HFZ B;  1C0A A;  3P8T A;  1WPY A;  3IAL A;  2DTH A;  3V7C A;  2C8M A;  4TVA A;  2ARU A;  4DPG A;  2DEQ A;  3WQZ A;  2PMF A;  1NJ2 A;  5C51 B;  2ZZG A;  1SER A;  4P73 C;  4TQD A;  4P72 C;  2AKW B;  2EWN A;  4P3P A;  3TUP A;  4HA8 A;  3HY1 A;  3A5Y A;  3RL6 A;  4XTV A;  3A74 A;  5KNN A;  2P5I A;  4XU1 A;  4YCW A;  1NJ8 A;  4XTY A;  4YP0 A;  4UP7 A;  1L0W A;  3MF2 A;  3V8L A;  2EL9 A;  4P75 C;  2ZZE A;  2DZC A;  4YRE A;  4ZIB A; 
#chains in the Genus database with same CATH topology
 4X64 B;  4N21 A;  2QHS A;  2Q5H A;  3ZMV A;  2E5A A;  4DV1 O;  3ZN1 A;  3R66 A;  3RVZ A;  4EEQ A;  5IYZ A;  1M57 C;  1N0J A;  1Z5W A;  3MAQ A;  4B3S O;  1S3J A;  2DXT A;  4YRS A;  4MS2 A;  4HZ3 A;  3RYC B;  1GMG A;  4X66 B;  1NYR A;  3RBZ A;  4I0X A;  2PZS A;  3OGI B;  1PYS B;  4JYY A;  4DV2 B;  2I4L A;  3A8T A;  3SJA C;  4EFB A;  5BR8 O;  2I4O A;  3QF7 A;  2B5U A;  1G5H A;  4UPA A;  2OIG A;  4P73 A;  1U97 A;  1TVK A;  2LFS A;  1VQ4 V;  1WPB A;  3SPC A;  2DYR C;  2W0X A;  3JYC A;  3TEH B;  3ZRW B;  3DC6 A;  4AH6 A;  2QWR B;  2UXD O;  4DO2 A;  3BAA A;  1FXK C;  3RT3 C;  1N34 O;  2QKS A;  1H2S B;  1HW7 A;  4P71 A;  3CSX A;  2IH3 C;  1DK1 A;  1VF6 A;  3FB6 C;  3CCM V;  5BXZ A;  2UXD B;  2BCC H;  2QHT A;  5B1B B;  3HXV A;  3H1K H;  3OMI B;  4D7T A;  3QO5 A;  4NR1 A;  2ZIM A;  4DR4 B;  2KSD A;  5B1A C;  1VQM V;  3NEL A;  4CZZ A;  5LOV B;  1NVP B;  2DYS C;  2HVK C;  2CIM A;  3JAR B;  2ZM6 B;  4YCU A;  3BAB A;  4WI1 A;  5CBF A;  2N74 A;  5ELN A;  1J95 A;  2YIB D;  3AG7 A;  2P4V A;  4HNA A;  4XBF A;  5J2T B;  3B40 A;  4PI0 A;  5KUK A;  2WLI B;  3OD4 A;  5C52 B;  4HWT A;  5JH7 A;  3CP1 A;  5IWA B;  4DR3 O;  1B3Q A;  4WF9 V;  4TV8 B;  2C2A A;  4LVL A;  3D3Q A;  2BTQ B;  3MEY A;  4RWU A;  2A7W A;  3CCL V;  3K9S A;  1P7B A;  4LP8 A;  4B3T B;  1NBM G;  2ALY B;  1YTF D;  4QPK A;  2PY5 A;  2Y4T A;  5HGQ A;  1YFS A;  2N05 A;  1AVM A;  3CCU V;  1VEW A;  1YGB A;  2DXU A;  1OCC B;  1BS3 A;  2W6I G;  4P3N A;  4MVU A;  4UVC A;  4YHH O;  5LP6 C;  1YIJ V;  1G4Y B;  4B7K A;  3E22 B;  3U0Z A;  3UQ8 A;  5JJJ B;  1KMN A;  3CMQ A;  4YRR A;  2DU7 A;  2QR4 A;  2JS3 A;  1E79 G;  1YCI A;  4PA3 A;  4FMT A;  2NS6 A;  1I08 A;  3ZHU A;  2KG7 A;  3ZHV A;  2QHU A;  1AIL A;  5C8Y B;  2QKA A;  4P75 A;  4WCE V;  1Q7Y W;  4W4L A;  1NR1 A;  4ZI7 A;  4NTX A;  4DW0 A;  4YRP A;  3STL C;  2UXX A;  2ZE7 A;  2ZTG A;  4J7Z A;  3LDE A;  4DV4 B;  4OX9 O;  3DTU B;  3KKY A;  3CEI A;  4GKK B;  4NYK A;  2ZXW C;  3A32 A;  1PM9 A;  1W0K G;  3ICA A;  3ICX A;  3HR0 A;  3JAW B;  1XOU A;  2PYL A;  3VQX A;  1RIQ A;  2ZE6 A;  3B8M A;  5KHK A;  1J5E O;  2Q69 A;  4J42 A;  4LF6 O;  4X9Q A;  4FZ0 A;  1IBK O;  2GTS A;  1B04 A;  5E79 Z;  3J81 N;  1MMM A;  4E51 A;  1FXH A;  3H1J H;  4U7N A;  5H2F Z;  2QWP B;  3A7A A;  5JH7 B;  2YID A;  2W6J G;  1P84 F;  2A3Q A;  4B7E A;  3UT5 B;  2UUA B;  4G27 B;  4UB6 Z;  4OP0 A;  3AG2 C;  2ZT8 A;  4P72 A;  5B1O A;  1XMO B;  3SGI A;  1THZ A;  4A5U B;  1WP7 A;  2WWW A;  5D5P A;  1EQR A;  4HWO A;  4X1Y A;  2DWE C;  1BE3 H;  1SC5 B;  1TAE A;  1H4V B;  5FL7 G;  1X2G A;  4DV3 B;  1XNQ B;  2JEX A;  4G84 A;  3OE7 G;  1EOV A;  1CEZ A;  3ZMZ A;  1XRE A;  2PYJ A;  3LNN A;  1B6Q A;  2Q7H A;  3HKE B;  4UB8 Z;  2QWO B;  4KXR A;  1OCR C;  3S3X A;  1YSC A;  1AI5 A;  3HFV A;  4LWS B;  5EC2 C;  5B3S B;  2IJK A;  3HRK A;  3FB8 C;  1SS3 A;  4LBE C;  5EYP A;  4H2Y A;  1U96 A;  2PUS A;  4JI6 B;  1ORQ C;  4CBC A;  2AZ2 A;  3H9V A;  5JJN B;  2KG7 B;  3LC0 A;  4I55 B;  3O9O A;  4ZOL A;  1HR0 B;  1XHZ A;  1AP6 A;  3GVM A;  1M1K W;  3ABK C;  5LMU O;  1WP8 A;  2QEX V;  4YHH B;  1CXZ B;  3N2G B;  2RHS A;  1H8E G;  4I50 B;  1WLE A;  4TVW A;  2QE7 G;  2VQE O;  1HR0 O;  4H2T A;  3L71 H;  1ENV A;  4KP4 A;  1E1O A;  5L3E A;  2QTS A;  3JCZ A;  5LHH A;  1WA8 A;  3FKS G;  2ZT7 A;  1N8R W;  2Q8V A;  3WG7 B;  4I7Z B;  3VBB A;  1M4U A;  3L9D A;  1EVL A;  1K4D C;  1ATI A;  3CC4 V;  1AJP A;  3CYO A;  2DKG A;  2CAZ C;  4QIW F;  4TWA A;  5LOV A;  2Q6A A;  1FAF A;  4NXM O;  1YJ9 V;  1WQW A;  3ZRS A;  2D2C B;  4X5O A;  3T4Z A;  1H2M A;  3JAR A;  4LF7 B;  3E9I A;  4PV1 B;  4FLX A;  2EIJ B;  1WNL A;  3G1Z A;  4PJ0 Z;  4DV7 O;  3RYF B;  5ELO A;  4I4T A;  4B3R B;  1NJI W;  1M57 B;  3ABL C;  3ABM C;  5H5N A;  5KAI Z;  3RYH A;  3EXA A;  4GYC B;  4KR3 A;  1FXV A;  1HNZ O;  3I55 V;  3K06 A;  3K3W A;  2Q7G A;  2VS0 A;  1G51 A;  4MTX A;  1Z7M A;  4X1Y B;  2OYQ A;  1F23 A;  4GX0 A;  3ZMT A;  3CCE V;  1H2N A;  5EK0 A;  5C93 A;  1LUW A;  1PD3 A;  3K5O A;  3MQZ A;  2JGU A;  1GN2 A;  3U10 A;  4N23 A;  3D36 C;  2HKO A;  2JGD B;  3MHS C;  2LFR A;  2JIZ G;  2E10 A;  5CN0 A;  2XOK G;  5CBH A;  1R1B A;  3DXR A;  2Q7E A;  2XAG A;  2RNB A;  4X62 B;  3OR6 C;  2UUC B;  3RKW A;  1H38 A;  3ZRX A;  1HC7 A;  2IW5 A;  1B70 B;  4DYL A;  3W7X A;  2YEV A;  3BJU A;  2ZKO A;  2RHS B;  2UUA O;  2DW4 A;  1GN3 A;  1Y4M A;  4LFC B;  3ZS8 C;  4RQF A;  4BIZ A;  2ITD C;  5EBL C;  1FS0 G;  1ZUQ A;  1EVK A;  4P9O A;  2FYK A;  1I5Y A;  3AG3 B;  3E83 A;  2DJZ A;  2BTO A;  3ZN0 A;  3G6E V;  2B1I A;  2DWD C;  1B8A A;  2E75 B;  4TT3 G;  5BMV A;  1M56 C;  2GSM B;  1S77 D;  5JQG A;  1YFR A;  1NTZ H;  2Q9L A;  4X20 B;  1F4M A;  2GHY A;  4UVA A;  3J7A U;  4LF4 B;  3P8T A;  5LBQ A;  4LF5 O;  4DR5 O;  2LJ2 A;  3D36 A;  3IAL A;  4DV5 O;  2DTH A;  3V7C A;  1SKV A;  2IJI A;  4DR6 O;  4TVA A;  2YIC A;  3K04 A;  4GKJ B;  1S5H C;  4O2A A;  2WLI A;  5LMU B;  1NJ2 A;  1N32 O;  5C51 B;  1YTF B;  3ZBH A;  4CC5 A;  3CMA V;  5F2V O;  2ZZG A;  1OHH G;  2RQ6 A;  4DV5 B;  4LF7 O;  2CE4 A;  4GKJ O;  1D5A A;  4JAV A;  2AKW B;  4P72 C;  4HA8 A;  3A5Y A;  3RL6 A;  1BGY H;  4PD4 F;  1Q90 D;  2E74 B;  4MT8 A;  1KP3 A;  1WAZ A;  3BPZ A;  4DV7 B;  2P5I A;  5LMN O;  3FX7 A;  4RO2 A;  4Z1M G;  1QQC A;  2WLL A;  4J9Z B;  4NTW A;  1F7Y A;  2G38 A;  3E8G A;  1IBM B;  3V8L A;  1NT2 B;  1K8A W;  1HNX O;  1BHA A;  4NKG B;  4CS4 A;  5LXT A;  1JMK C;  4AHC A;  2BSK A;  3NR7 A;  4JAS A;  1NVP D;  1EN4 A;  3W3S A;  3H01 A;  2UXC O;  2E5L O;  2A06 H;  3A7R A;  3SYO A;  1EFR G;  3Q4H B;  3UM7 A;  3IKL A;  2UXB B;  2XGT A;  2UU9 B;  4PA4 A;  3OTO B;  2QKC A;  4YRJ A;  4DV6 B;  3B2E E;  3OAA G;  4F6R A;  4BR6 A;  1KU9 A;  3IGA C;  3OGC C;  1IXB A;  3KCY A;  4MTG A;  3O65 A;  2A79 B;  3OTO O;  3TJT A;  3T2M A;  5L3F A;  1S5J A;  1S0V A;  5J2U B;  4R6Z A;  3SR2 C;  4IYI A;  4MTF A;  1Y74 B;  4WFH A;  4YIP A;  3BVO A;  3T1Y B;  3ZIA G;  1L8D A;  1J5W A;  1Z2G A;  3LDD A;  4QE7 A;  2HJD A;  1TGO A;  2P4K A;  1WB7 A;  4JF3 A;  4JAA A;  4KUM A;  4DK0 A;  3JAT A;  1I7F A;  2P5O A;  2A0L A;  3ZRV A;  1N33 O;  1XQ8 A;  2O57 A;  1USY A;  1OCZ C;  3H1H H;  5H6Q A;  4DR7 O;  4LC1 A;  1RPO A;  5H6R A;  5IYC O;  4LFC O;  3L73 H;  1VQK V;  3QO8 A;  3M4Q A;  5KX5 A;  1R6N A;  4XU3 A;  4QNH B;  4OLF A;  4YPF A;  2GDS A;  3CRQ A;  1PYS A;  2CGH A;  3HFZ A;  1B7Y B;  4X65 B;  4YY3 O;  2ZIO A;  4Z1V A;  5K1P A;  4UFZ A;  1L1F A;  4FK5 C;  3M7M X;  5E3I A;  3ZX6 A;  5B3S C;  5ITZ B;  1IBL O;  3LUT B;  4JI5 B;  3V8K A;  2GTA A;  1K9M W;  4MW8 A;  1YB3 A;  4YJ3 A;  3HXW A;  2Q67 A;  2YC0 A;  4RDX A;  4J41 A;  4LF4 O;  4KQE A;  1F51 A;  4DXW A;  3PJS K;  5LMN B;  1B06 A;  2LW1 A;  4HWP A;  4WFA V;  1R73 A;  5JCO A;  1FFX B;  2VQE B;  5TIS Z;  2GV9 A;  2XAQ A;  2RJZ A;  1D5N A;  2X6C A;  1XDC A;  3AK3 A;  3RFR A;  1VQZ A;  4PI2 A;  4JI0 O;  4I9W A;  4WBN B;  2KKW A;  4H2V A;  2RDC A;  2YXL A;  3VOU A;  1Y76 A;  3RF1 A;  1GGM A;  1XL6 A;  2EJ9 A;  1MSW D;  1W2B U;  4JI2 O;  1VQ8 V;  4HWS A;  3ZHR A;  3CD6 V;  4JV5 B;  1E1Q G;  5IY5 C;  4TQF A;  3DGE A;  3F7V C;  2EIM C;  4PHC A;  4R8C A;  4O4L A;  2IY5 A;  5JVD B;  2UXB O;  2ZDI C;  2Q73 A;  4WFB V;  3FJP A;  1KYO F;  3NXS A;  1RSO B;  4O4H A;  3B77 A;  1HDJ A;  2LP7 A;  2N04 A;  2CTQ A;  5L3D A;  4TUY B;  2QJ1 A;  3AG4 B;  4UCS A;  3ABL B;  3TCU A;  2E5L B;  3PZC A;  2ATK C;  4UCU A;  3HRI A;  4D7S A;  2UUB B;  2WLM A;  4PHZ A;  1M93 A;  3A5Z A;  5AG2 A;  5JCO C;  3N2G A;  5EZY B;  3V8J A;  4PDM A;  2ALY A;  2ODM A;  3K5L A;  2BOB C;  2AMC B;  5KHI A;  1YFT A;  2FKX A;  1QBZ A;  4JTD B;  1IVS A;  5B1B C;  4LR3 A;  3CC2 V;  4IYH A;  3U11 A;  1E1T A;  4MVR A;  5B1A B;  1RM1 B;  5CA3 A;  3FYE B;  1NQT A;  1SZT A;  4ABM A;  3ETD A;  1VP7 A;  3K03 A;  4FFK A;  1NTM H;  3W7U A;  4P71 C;  3APO A;  1KC8 W;  1Y67 A;  4K0K B;  1YJN V;  4K8Z A;  1X56 A;  1P7G A;  2F95 B;  1SF9 A;  1OCO B;  1UPG A;  2HR3 A;  2F4V O;  2ZR2 A;  1EFW A;  4J9Y B;  4XTZ A;  3CXC U;  1VQO V;  2D3O W;  1N9W A;  4O4L B;  3JD1 A;  4PA9 A;  1H2L A;  5IE9 A;  3JAM N;  4XU2 A;  4Q15 A;  2FL4 A;  3BY6 A;  3HKB B;  4DK1 A;  5HFM A;  4OGQ B;  3CJH A;  1WU7 A;  1TUB A;  4LH6 A;  1NJ6 A;  3LDC A;  3MF1 A;  4O4J A;  3KCX A;  4TUY A;  2JGD A;  2DTI A;  2P22 C;  2CTP A;  4UV9 A;  3K0D A;  3VQV A;  5JWP A;  4YJ2 B;  1BCC H;  4UV8 A;  1X01 A;  4J80 A;  3OMA B;  4DR3 B;  2XTI A;  4MSW C;  3T1H B;  1W66 A;  1IZ3 A;  2BOC C;  3UT5 A;  2Y48 A;  4UP9 A;  4WF2 A;  3G71 V;  1VQ6 V;  3OEE G;  1HNW B;  3BA8 A;  1ADJ A;  2LW7 A;  3LSS A;  4DW1 A;  4JI2 B;  4U3J B;  4ZIB A;  3HXY A;  5CB4 B;  4RUF A;  1IBM O;  4ZKI A;  3A31 A;  2A9H A;  4EO4 A;  3N2K B;  1K97 A;  4U3F H;  3F7Y C;  1DTO A;  3WB1 A;  3E35 A;  1B7Y A;  1MZE A;  2FYU H;  2WLL B;  1X2H A;  4TOI A;  4IIJ A;  3E8B A;  1NJ5 A;  2HHH O;  4NCX A;  4D6T H;  1S76 D;  3CPW U;  4WJ4 A;  4LCU C;  3BFM A;  3EFF K;  4MVQ A;  2IJH A;  4P3O A;  1X4T A;  4FJC C;  1K4C C;  1QLE B;  3REX A;  3P32 A;  1IL2 A;  2YXH A;  2DZ9 A;  1Q43 A;  2UUB O;  3Q4H A;  5GTH Z;  1Y6X A;  5C8Y A;  4H2X B;  2DQ0 A;  3FD9 A;  4MW3 A;  4ZI7 B;  3CE2 A;  4WBN A;  2CJA A;  1IUR A;  1I0H A;  4X1I B;  1JCH A;  1G1X B;  2Y69 B;  3D8C A;  4HBN A;  2H8P C;  3CCS V;  4HAM A;  4DV1 B;  1AJN A;  1H4S A;  4FM2 A;  3G4S V;  2NLJ C;  2WLN A;  4PA6 A;  3TXS A;  4FLW A;  3RYC A;  3ASN B;  2ZDI A;  4NVP A;  1EM1 A;  2GBO A;  3LSU A;  1KMM A;  4H02 A;  2ZR3 A;  5C53 B;  1V55 B;  4ZBM A;  1GH6 A;  4TVY A;  2YUA A;  4FVM A;  3JAK A;  1VIB A;  3EVK A;  3RKY A;  1EIY A;  4IHJ B;  3E2E A;  1NR7 A;  4MVO A;  2EIK C;  1GN4 A;  3ZRW A;  5B5E Z;  2ETN A;  2OCC C;  2WA3 A;  4H33 A;  4EB6 B;  1B76 A;  1HXD A;  1JJC A;  4LVM A;  2QTO A;  2YDE A;  5DEC A;  3AK2 A;  1KKC A;  3RYI A;  3IC7 A;  3K5M A;  3EFR A;  3ASO B;  2X7R B;  4JZG A;  1XNR B;  2NN4 A;  2MK3 A;  3M99 B;  2G4C A;  3OR7 C;  5B1N A;  4P2Z A;  4LFB B;  3HFZ B;  2XAS A;  2EIN C;  1N0N A;  2UXN A;  5EC1 C;  3G67 A;  4F6E A;  5LA6 A;  1AB3 A;  3WG7 C;  3N27 A;  2C8M A;  4DPG A;  3CB2 A;  4BIU A;  4DV0 O;  4LFB O;  4L8J A;  1R6K A;  3K57 A;  2QWQ B;  1OV9 A;  2L6L A;  4WFE A;  2PTM A;  2EWN A;  4PDL A;  4KL1 A;  5IDJ A;  3ZHT A;  1XMQ O;  4XU1 A;  4G2K A;  2OIE A;  1NJ8 A;  2LQT A;  4LVI A;  1AI6 A;  4H44 B;  3HKD A;  3MF2 A;  2QDO A;  3L74 H;  3K08 A;  2JVD A;  4PDR A;  4TWK A;  1VQN V;  4B3S B;  5JJE B;  2CGN A;  4GCZ A;  1QE0 A;  4PG3 A;  2GUZ B;  1VF7 A;  3BCC H;  2P67 A;  2ARS A;  3ABT A;  11AS A;  1VQ7 V;  3KG2 A;  2DTO A;  3FFQ A;  1KUQ A;  1FJG O;  2ADP A;  4JI8 O;  4LF8 B;  4O4I A;  1COW G;  3AG2 B;  4YJ2 A;  5CA0 B;  1NJ1 A;  1FFT B;  3GWO A;  4JI4 O;  3VQW A;  3M8A A;  1NNH A;  4LNS A;  4XEO A;  2R70 A;  3CRC A;  3P8V A;  5GON A;  3HXZ A;  4YRK A;  1NI8 A;  2OWO A;  1RP3 B;  1LYL A;  1DLB A;  4JI1 B;  1J5E B;  1Y76 B;  1N36 O;  3FYI B;  1JJO A;  4YIO A;  1OCC C;  3DC5 A;  1QHT A;  5LYJ A;  4JI1 O;  1NKD A;  1XL4 A;  3E86 A;  2Y4U A;  4O2B B;  1K5Q A;  3OW2 U;  1BSM A;  3ETQ A;  1ADY A;  1XNR O;  3ABK B;  3UFG A;  1FXK A;  2RHQ B;  4FPP A;  3KFU A;  4CH3 A;  4YRF A;  4HVC A;  1JQ0 A;  4NXN O;  4C7U A;  4CH6 A;  1T5E A;  3FB7 C;  1G8M A;  1R3K C;  1DGS A;  1H4T A;  3IKM B;  3T4D A;  4DV0 B;  4G28 B;  3OD1 A;  3L4G A;  4H2X A;  5GTI Z;  1TA8 A;  2OCH A;  5KA6 A;  1Z5V A;  4BIO A;  3B8N A;  4Q20 A;  3REU A;  2WPD G;  4TV8 A;  3JD0 A;  1YDX A;  3PN1 A;  3OT7 A;  1S5L Z;  2FTK A;  1Q86 W;  4P30 A;  3ERR A;  4K35 A;  4UCO A;  2I4M A;  4HYO A;  3RIR A;  2LGQ A;  4FFB B;  5A2Q N;  3CX5 F;  3JAT B;  2Y0I A;  1QCE A;  3A0B Z;  1QVG U;  5CA0 A;  4BW9 A;  1N32 B;  1BIB A;  4XDL A;  1V9P A;  5HFL A;  2XND G;  2BTQ A;  3E22 A;  4LF9 O;  4I55 A;  3R07 A;  3L2Z A;  2IU0 A;  2Z5U A;  5KA5 A;  3X2Q C;  1K7D A;  1JX9 A;  1SQX H;  2W0F C;  4Q6G A;  3SPI A;  1Q82 W;  1YI2 V;  1PL4 A;  3OM3 B;  5CA1 B;  5KX5 B;  2VQF B;  4DR2 O;  4K87 A;  3RGL A;  2E3C A;  4EB6 A;  5KHJ A;  1GM7 A;  1FJG B;  3JAS B;  2E64 A;  4LF9 B;  3THO A;  1ASZ A;  3P30 A;  4FM1 A;  4JI4 B;  3EFS A;  4DV2 O;  4I0X B;  4XEM A;  4KR2 A;  3P8Y A;  5LYJ B;  4H2W A;  3JAL A;  4O2B A;  4DV4 O;  5IJ0 A;  1MG1 A;  2VRZ A;  3L72 H;  3IJ4 A;  1N36 B;  2ZNI A;  1QLE C;  1GAX A;  4HWR A;  2XT9 A;  1FFX A;  2M6Y A;  4BW5 A;  3ABU A;  5KLV H;  4JI8 B;  2CJ9 A;  1Q8I A;  4J11 A;  3AG1 C;  3UH0 A;  1GN6 A;  1YHQ V;  1N34 B;  3IC9 A;  3ZJZ A;  3RYF A;  1BIA A;  4DV6 O;  2F66 C;  4LFA B;  4OX9 B;  4TV9 A;  1NH2 D;  3HXX A;  2QWN B;  4DR1 B;  5FNV B;  1M56 B;  2IY5 B;  2V4D A;  2DN9 A;  2MW2 B;  2ZCE A;  4GUN A;  1URF A;  1ZAU A;  4X62 O;  4U3J A;  2EJF A;  3HKD B;  2IH1 C;  3R65 A;  4DR1 O;  1JVM A;  2JK5 C;  4DUY B;  2DE0 X;  1IBK B;  2ZT5 A;  1YEW A;  4DV3 O;  4KHP B;  4IL6 Z;  4YRC A;  1H4Q A;  3DXR B;  4EKW A;  4IIJ B;  2P0L A;  2ZT6 A;  2ZT9 B;  1NYQ A;  2EIJ C;  1USY C;  3GB7 C;  1MZF A;  5KHH A;  2PF4 E;  1EIY B;  5IJ9 A;  1W0J G;  4J10 A;  4DR4 O;  1Z7N A;  2K9P A;  1IXM A;  4GX1 A;  3RVY A;  4JI6 O;  1US6 A;  3S3W A;  3L75 H;  4YRM A;  4EFE A;  3JAS A;  4MTO A;  4GZR B;  1PNM A;  2X0L A;  2V7Q G;  1X54 A;  1XNQ O;  3CME V;  2EIN B;  4I5S A;  2XAF A;  4H0L B;  2CGO A;  5LGT A;  1NTK H;  3UO2 A;  4I50 A;  2PI5 A;  4QE9 A;  3CWB H;  2NR5 A;  4LNU A;  5LA6 B;  2ZXW B;  1R3L C;  4J7J A;  2ZE8 A;  1Q5O A;  2EZO A;  3E9H A;  2DMX A;  2Q0O C;  2Q68 A;  5KHG A;  3V7S A;  1FPO A;  1GRJ A;  4ZOL B;  2OTL V;  4O2D A;  2J3M A;  3TEG A;  3JSN A;  4JI0 B;  1K34 A;  2QM7 A;  2DYS B;  2RHQ A;  4LF5 B;  4JTC B;  3J80 N;  4DR6 B;  4O2A B;  1NU1 H;  2ZE5 A;  2WLJ A;  3K5N A;  5LHG A;  5FPR A;  4EX5 A;  3ZMS A;  4YRN A;  2VQF O;  2QGN A;  1GK9 A;  2CTR A;  4AQY O;  2P06 A;  5LGN A;  5EIB C;  2CUG A;  3SJQ C;  3OFN G;  2AKW A;  5CBG A;  3WB2 A;  1V54 C;  4GKK O;  5BY1 A;  3SYP A;  2X6B A;  3STZ C;  3CJH B;  1HNZ B;  3SDL A;  4AQY B;  2JRI A;  1XIL A;  4UUJ C;  2Q0A A;  2VWK A;  3FB5 C;  1SET A;  2ODR D;  5JVD A;  2CJB A;  4O4J B;  4ZHQ B;  3B09 A;  1XEQ A;  4XU0 A;  2B1G A;  1KBH A;  3T1C A;  2YIA A;  4AI8 A;  3QTC A;  4P74 C;  3KZI Z;  5BR8 B;  5IJ9 B;  4R50 A;  1RM1 C;  4O4I B;  4B3R O;  2RCV A;  3HKC B;  1X55 A;  4X8A A;  1KEC A;  3RYH B;  2XTA A;  5LP6 B;  5K1X A;  1FYJ A;  2L35 A;  2EBO A;  1BT8 A;  4RAI A;  4ASU G;  2B9Z A;  1ZTE A;  2M7W A;  4LFA O;  3AEI A;  2CH7 B;  5CA1 A;  1AJQ A;  5KUM A;  1MAB G;  1OCO C;  4GX5 A;  4KFM A;  1OJH A;  2HLD G;  4FM0 A;  1BZK A;  4LNU B;  1N33 B;  2IU3 A;  1VQL V;  2ODR C;  2AMC A;  1XUQ A;  2J3L A;  2HFE C;  3P3P A;  1ASY A;  4NXN B;  3JD2 A;  3JAL B;  2R9I A;  3CCQ V;  1XMO O;  1Y74 A;  2ZNJ A;  5EYP B;  5JQG B;  1YF2 A;  1FXK B;  1G6U A;  2RMK B;  1F4N A;  3MHH C;  1RFY A;  4QGP A;  2IBZ H;  2WAM A;  4P74 A;  1EBO A;  2WSS G;  4OPH A;  1PKX A;  2EIM B;  1K5S A;  1SQB H;  3ABM B;  4TV9 B;  4GLX A;  4UCT A;  1UFI A;  1GKF A;  1WPY A;  1DF5 A;  1AI7 A;  1CP9 A;  4K3A A;  3UCS C;  4B3M B;  3CRA A;  3K0G A;  3ZHQ A;  2DEQ A;  2JS5 A;  3EHB B;  1EN6 A;  4B3T O;  3UKM A;  3AG4 C;  1TUB B;  1JFF A;  1VQ9 V;  3W7T A;  3TXQ A;  1K73 W;  2LGW A;  4P3P A;  5DED A;  1PP9 H;  1ZL8 B;  2PGG A;  3HY1 A;  3T1H O;  3HKC A;  3UO3 A;  3X2Q B;  1BQ0 A;  5EIB D;  4UCV A;  4JI3 B;  3A74 A;  1OCR B;  5LP6 A;  1NS1 A;  1TVK B;  1HNW O;  1OCZ B;  4YCW A;  3JCU Z;  3QVN A;  3RN4 A;  1QR8 A;  1GM9 A;  4XTY A;  2IM9 A;  3OTF A;  5LXT B;  4YP0 A;  1BQZ A;  4UP7 A;  2BSK B;  1L0W A;  1S72 V;  5GW7 A;  1YZB A;  3W7W A;  3A0R A;  4XDK A;  3P3N A;  3OEH G;  2KQX A;  4P75 C;  2ZZE A;  1JR9 A;  1VMG A;  3RWR D;  3SYC A;  1KQS U;  1SA0 B;  2HJF C;  4DUZ O;  1A32 A;  1ZSP A;  4FLY A;  2Q5I A;  4F6R B;  3UGT A;  1R3J C;  1HTT A;  5IJ0 B;  2OT5 A;  4DRX A;  3PCO A;  2AHY A;  5LGU A;  4X88 A;  3ASN C;  4O4H B;  1RPR A;  3I7F A;  4DUZ B;  2R72 A;  1WPX A;  2EJR A;  4WFF A;  3ZMU A;  2UXC B;  4BWA A;  2EZP A;  3CRR A;  1FD9 A;  4QJF B;  1PNL A;  1BBW A;  4ICG A;  2P6J A;  3RUX A;  1YXB A;  5IYB O;  2QHV A;  4LF6 B;  2XUM A;  5J9P C;  4YRG A;  4J15 A;  4RUE A;  2H94 A;  1MOF A;  2DVE A;  3NEN A;  4YRO A;  1SES A;  2H3O A;  1FKA O;  3WB0 A;  1DF4 A;  2YI8 A;  1H8H G;  4R7C A;  5FNV A;  1AR4 A;  1KD1 W;  3BA9 A;  4P9P A;  3UGQ A;  4OXS A;  2EIL C;  5J2U A;  3I56 V;  4H2S A;  2BE3 A;  5L3C A;  3B4S A;  2E41 A;  4YYE A;  2Y0P A;  2LO1 A;  1I5X A;  4F4L A;  3HY0 A;  5BMV B;  3T1Y O;  4PDV A;  3TK1 A;  4YRI A;  1SQP H;  4X65 O;  1WJZ A;  2CDY A;  2DJV A;  1HP8 A;  1JA8 A;  5FLX N;  1VQP V;  1NH2 B;  4LWS A;  3NEM A;  1BMF G;  4X1K A;  3IAY A;  3ZED A;  4QPJ A;  1L0N H;  2YIB A;  1IDS A;  1AP5 A;  4LVJ A;  5H9C A;  1H2K A;  1Y66 A;  3JAK B;  1SZX A;  4CH5 A;  4FLZ A;  4YCV A;  4H13 B;  1I94 O;  2ART A;  4YRQ A;  1MA1 A;  3V7R A;  4JI7 B;  3K79 A;  3A2F A;  3H1I H;  5IYZ B;  1PL0 A;  1ZLZ A;  1JJC B;  4PEL A;  3G6B A;  4YY3 B;  4JI3 O;  4K86 A;  5ITZ A;  3C3T A;  4JI7 O;  1ARO P;  3CCJ V;  4JI5 O;  4DQ2 A;  2Z0A A;  4YRT A;  1FYF A;  1AR1 B;  2DOS A;  4Z2W A;  3K59 A;  1VQ5 V;  3HXU A;  1KB9 F;  1UJW B;  3PCO B;  4RMF A;  2ZQM A;  3NET A;  3SJB C;  5KMG A;  3F5W C;  3LSQ A;  1YIT V;  3TEH A;  3E89 A;  4FZ1 A;  4FLV A;  5F5W A;  2ARH A;  4XTX A;  4NXM B;  1WYD A;  2E1H A;  5LL6 Y;  4YRL A;  2XAH A;  1SQV H;  1XMQ B;  1M9N A;  2X6A A;  2VWJ A;  3L1A A;  1QU7 A;  1AR5 A;  3ZCC A;  4MVS A;  1ZWI C;  5E1A C;  2C7I A;  2JJ1 G;  4L87 A;  4RQE A;  1KP2 A;  4CS2 A;  2QM4 A;  4H2U A;  3E8F A;  1V55 C;  4X64 O;  4TTV A;  3N2K A;  2AZ0 A;  5DN6 G;  2YXY A;  1EN5 A;  4FFB A;  5EZY A;  1WNS A;  3OUF A;  3HPL C;  3IFX A;  1H2G A;  4ZHQ A;  1ZX3 A;  3HTZ A;  3FAV B;  4JTA B;  3TGU H;  4G85 A;  4LF8 O;  1Q6U A;  2ZGW A;  4JZ2 A;  4OPA A;  4XTU A;  2YI9 A;  3I5D A;  5J2T A;  1BHB A;  1E24 A;  4X66 O;  2KB1 A;  1EZV H;  1LNQ A;  1Q3E A;  1B70 A;  2K1E A;  5DM6 V;  3ML0 A;  4DR7 B;  2YEV B;  2ADQ B;  3ETE A;  4UVB A;  1KKD A;  4CC6 A;  3H1L H;  2UUC O;  2EAY A;  4PA7 A;  2DYR B;  2ZIN A;  3ASO C;  1K92 A;  3SYQ A;  2CH7 A;  1M5I A;  4U7O A;  1M90 W;  3F5T A;  1I94 B;  2AW9 A;  3IG2 A;  1R3I C;  1EZJ A;  5A9G A;  4CS3 A;  1LUV A;  4UCR A;  1IBL B;  2JJ2 G;  1QVF U;  4FLT A;  2R9R B;  5IY5 B;  4JPR A;  3W7S A;  3QG5 A;  5KAF Z;  1Q6I A;  1WQ7 A;  2Q4P A;  2FB5 A;  3CC7 V;  1QNM A;  1X59 A;  1D2D A;  3ZHS A;  1SQG A;  2Q5Z A;  1CPY A;  3HKB A;  3SPG A;  4K0K O;  2QA4 V;  2CK3 G;  4WFG A;  4HNA B;  4X89 A;  3SPH A;  4LH7 A;  4K88 A;  3A7U A;  2HEP A;  4DR5 B;  2F4V B;  2NNU A;  1K3E A;  4I9Q A;  2ITC C;  4B3M O;  2IJJ A;  2ILM A;  3L4G B;  1JPX A;  3AG3 C;  3A0H Z;  4E2L A;  1E22 A;  3QO7 A;  4JYB A;  1TUE B;  4NTY A;  1KMI Z;  2ZXF A;  3RYI B;  3QNE A;  5IWA O;  3D3I A;  4IT5 A;  3JAW A;  1XHX A;  1P4R A;  3SJC C;  1BBU A;  2HG5 C;  1QF6 A;  2DQ3 A;  3M4P A;  3FAV A;  1GTO A;  1RSO A;  4J7K A;  3BHP A;  2HP8 A;  1JFF B;  3GWK C;  3CRM A;  2XHB A;  3ETG A;  2JEU A;  1G5I A;  1VAR A;  1N4C A;  1SQQ H;  4YDQ A;  3RGB A;  2P7T C;  3CCV V;  2E76 B;  3JD4 A;  3WU2 Z;  2EIK B;  1VF5 B;  4UP8 A;  2OCC B;  3AK1 A;  3APQ A;  3BEH A;  1Q81 W;  3CCR V;  1HNX B;  3MD0 A;  5CMU A;  3C90 A;  2ZZF A;  4JAU A;  4IGG A;  3AG1 B;  3L70 H;  2EUL A;  3HB3 B;  5CB4 A;  2F93 B;  4K8X A;  3TET A;  1VF6 C;  5EBW C;  2F1M A;  4BAY A;  4UXN A;  3VQY A;  4E4E A;  4JGS A;  2UU9 O;  1YVW A;  1YJW V;  2DDZ A;  4X1I A;  5IYD O;  3E8H A;  3HKE A;  4W4K A;  1QR9 A;  2AHZ A;  2XAJ A;  1WB8 A;  1GM8 A;  4DRX B;  2HNI A;  3LNM B;  5KMG B;  3MDS A;  4X20 A;  12AS A;  1PPJ H;  1BL8 A;  1PV0 A;  1ZL8 A;  3RKX A;  2F43 G;  2I4N A;  1HWY A;  4JYC A;  2CTW A;  5BZB A;  2E65 A;  4WJ3 M;  1O9G A;  2RN9 A;  2Z3Y A;  3CHX A;  4TVA B;  4IHJ A;  5GON B;  2EIL B;  5IT9 N;  1P49 A;  4GT1 A;  1OZ0 A;  4MVZ A;  3JD3 A;  2EJG A;  1R6T A;  2A8E A;  1KOG A;  4CH4 A;  1Q6H A;  1SRY A;  4DUY O;  4FIP C;  5B66 Z;  5L3G A;  5L3B A;  1XI1 A;  1SA0 A;  2PME A;  4KHP O;  2QSA A;  2F23 A;  2ZD9 A;  3DSQ A;  4ZTZ B;  3SPJ A;  4ZTU B;  4YJ3 B;  1JJ2 U;  3SYA A;  2V1D A;  3RAC A;  4NB5 A;  4JYA O;  1MNG A;  4XDJ A;  2ZM6 O;  1MSD A;  2DU5 A;  3BFR A;  1JOY A;  1O9H A;  3K58 A;  4XTW A;  3K9A A;  2QM8 A;  4LVK A;  1C0A A;  2R9A A;  2EX3 A;  3CXH F;  3G80 A;  4JYA B;  2AXT Z;  3BRC A;  3CS5 A;  2WLK A;  5EBM C;  1AI4 A;  4MVM A;  2OTJ V;  2AGA A;  2ARU A;  1NZ6 A;  5LHI A;  3WQZ A;  5D5Q A;  1K33 A;  2YSU B;  2JDI G;  4B08 A;  2PMF A;  1GO3 F;  1LR1 A;  2Y69 C;  2WA4 A;  1QLN A;  1WN7 A;  1WA8 B;  4TSF G;  1SER A;  4P73 C;  4H37 A;  4TQD A;  1V54 B;  2EJ7 A;  1SQF A;  3TUP A;  4JV5 O;  2YS8 A;  4XTV A;  4YXW G;  2HHH B;  4FLU A;  5KNN A;  4DR2 B;  3JSL A;  4HT4 A;  1XBL A;  3WFV A;  2HVJ C;  3OMN B;  1PNK A;  3OUS A;  3C3S A;  2FML A;  1ROP A;  4X1K B;  1W59 A;  1E1R G;  2GUZ A;  4AIL C;  3RW0 A;  2P90 A;  4GX2 A;  2WLH A;  2EL9 A;  1IX9 A;  1L0L H;  4I4T B;  2PI4 A;  2DZC A;  4YRE A;  5FPO A; 
#chains in the Genus database with same CATH homology
 4PG3 A;  4N21 A;  2HJF C;  4JAS A;  2QHS A;  2Q5H A;  3ZMV A;  2E5A A;  3ZN1 A;  1NVP D;  3RVZ A;  3W3S A;  3H01 A;  2Q5I A;  2P67 A;  2ARS A;  3UGT A;  3ABT A;  11AS A;  1VQ7 V;  1M57 C;  3KG2 A;  3SYO A;  3A7R A;  1EFR G;  2DTO A;  3UM7 A;  3IKL A;  1R3J C;  1S3J A;  1HTT A;  2XGT A;  2OT5 A;  3PCO A;  1COW G;  3AG2 B;  4PA4 A;  2AHY A;  5LGU A;  2DXT A;  4X88 A;  4YRS A;  4MS2 A;  1NJ1 A;  1FFT B;  3ASN C;  3GWO A;  4YRJ A;  4HZ3 A;  1RPR A;  3I7F A;  1GMG A;  1NYR A;  3VQW A;  3RBZ A;  1NNH A;  4LNS A;  4XEO A;  3OAA G;  1PYS B;  1WPX A;  2EJR A;  4WFF A;  3ZMU A;  2I4L A;  3P8V A;  4BWA A;  2EZP A;  3HXZ A;  3IGA C;  4YRK A;  3OGC C;  2I4O A;  4QJF B;  4MTG A;  1PNL A;  1BBW A;  2A79 B;  2P6J A;  3RUX A;  5IYB O;  2B5U A;  2QHV A;  3T2M A;  5L3F A;  1G5H A;  1LYL A;  4UPA A;  1DLB A;  5J9P C;  1S0V A;  4P73 A;  4YRG A;  4J15 A;  2LFS A;  4RUE A;  1VQ4 V;  2H94 A;  3FYI B;  1MOF A;  4R6Z A;  3SPC A;  2DVE A;  3NEN A;  2DYR C;  3JYC A;  4MTF A;  4YRO A;  3TEH B;  1SES A;  3ZRW B;  1DF4 A;  4WFH A;  4AH6 A;  4DO2 A;  1H8H G;  4R7C A;  3ZIA G;  1FXK C;  1J5W A;  1OCC C;  3LDD A;  4QE7 A;  1KD1 W;  4P9P A;  2QKS A;  4JF3 A;  4OXS A;  3UGQ A;  2EIL C;  3I56 V;  1NKD A;  1XL4 A;  3E86 A;  4KUM A;  4H2S A;  4P71 A;  1K5Q A;  5L3C A;  2E41 A;  4YYE A;  2IH3 C;  3OW2 U;  3FB6 C;  2A0L A;  3ZRV A;  1I5X A;  3CCM V;  4F4L A;  1USY A;  1ADY A;  3HY0 A;  3ABK B;  4PDV A;  1OCZ C;  3UFG A;  1FXK A;  5H6Q A;  2RHQ B;  4FPP A;  2QHT A;  3KFU A;  3TK1 A;  4CH3 A;  4LC1 A;  5B1B B;  1RPO A;  3HXV A;  4YRF A;  5H6R A;  4HVC A;  1JQ0 A;  3OMI B;  1VQP V;  1NH2 B;  3QO5 A;  5IYC O;  3NEM A;  2ZIM A;  1BMF G;  1VQK V;  4CH6 A;  3QO8 A;  4QPJ A;  3FB7 C;  1G8M A;  1R3K C;  5B1A C;  3M4Q A;  1VQM V;  1H4T A;  1R6N A;  3IKM B;  4LVJ A;  3NEL A;  5H9C A;  4CZZ A;  4QNH B;  4XU3 A;  1Y66 A;  3T4D A;  4OLF A;  4YPF A;  4CH5 A;  4G28 B;  4YCV A;  1NVP B;  1PYS A;  2DYS C;  2HVK C;  2CIM A;  2CGH A;  3HFZ A;  2ART A;  1B7Y B;  3OD1 A;  3L4G A;  4H2X A;  4YRQ A;  2ZIO A;  5K1P A;  4YCU A;  3V7R A;  5KA6 A;  1L1F A;  4FK5 C;  4WI1 A;  5E3I A;  3B8N A;  5B3S C;  5CBF A;  3K79 A;  5ELN A;  4Q20 A;  3LUT B;  1J95 A;  3REU A;  2WPD G;  3V8K A;  1K9M W;  3JD0 A;  1PL0 A;  4XBF A;  4MW8 A;  1YB3 A;  3HXW A;  2Q67 A;  4RDX A;  5KUK A;  1JJC B;  4PEL A;  4KQE A;  2WLI B;  2FTK A;  1F51 A;  1Q86 W;  4K86 A;  4P30 A;  3PJS K;  4DXW A;  4HWT A;  3ERR A;  5C52 B;  3CP1 A;  4HWP A;  4WF9 V;  4HYO A;  1ARO P;  1R73 A;  4WFA V;  3CCJ V;  2I4M A;  2C2A A;  3RIR A;  4LVL A;  4DQ2 A;  2XAQ A;  3MEY A;  2X6C A;  4YRT A;  1FYF A;  1AR1 B;  4Q6G A;  1VQZ A;  1VQ5 V;  3HXU A;  1UJW B;  1QCE A;  4I9W A;  3PCO B;  4RMF A;  2ZQM A;  1QVG U;  3CCL V;  3NET A;  4H2V A;  4BW9 A;  1P7B A;  4LP8 A;  1BIB A;  3F5W C;  1NBM G;  3LSQ A;  4XDL A;  3VOU A;  1YIT V;  5HFL A;  1GGM A;  1XL6 A;  2XND G;  2ALY B;  2EJ9 A;  1MSW D;  3RF1 A;  1YTF D;  4QPK A;  3R07 A;  1W2B U;  3E89 A;  3TEH A;  3L2Z A;  2IU0 A;  2Z5U A;  5KA5 A;  1VQ8 V;  3X2Q C;  1YFS A;  4HWS A;  1K7D A;  3CD6 V;  5HGQ A;  1JX9 A;  5F5W A;  2W0F C;  3SPI A;  3CCU V;  1WYD A;  1Q82 W;  2E1H A;  1YI2 V;  1YGB A;  2DXU A;  1E1Q G;  1OCC B;  2W6I G;  3OM3 B;  5IY5 C;  4P3N A;  4YRL A;  4K87 A;  4TQF A;  3DGE A;  4MVU A;  2E3C A;  3F7V C;  2EIM C;  2XAH A;  4UVC A;  4PHC A;  4R8C A;  2IY5 A;  1YIJ V;  1GM7 A;  1G4Y B;  2ZDI C;  2E64 A;  1M9N A;  4WFB V;  3FJP A;  1ASZ A;  3P30 A;  2X6A A;  3NXS A;  1KMN A;  3CMQ A;  3L1A A;  4YRR A;  2DU7 A;  3B77 A;  3EFS A;  1E79 G;  3ZCC A;  4MVS A;  2LP7 A;  4FMT A;  4PA3 A;  2NS6 A;  4XEM A;  4KR2 A;  3P8Y A;  5L3D A;  1ZWI C;  5E1A C;  2C7I A;  4H2W A;  2JJ1 G;  2QHU A;  4P75 A;  4L87 A;  4WCE V;  3AG4 B;  1MG1 A;  4RQE A;  1KP2 A;  1NR1 A;  1Q7Y W;  4H2U A;  4CS2 A;  4YRP A;  3STL C;  3ABL B;  3E8F A;  1V55 C;  2UXX A;  4TTV A;  2ZTG A;  2ZNI A;  1QLE C;  3TCU A;  5DN6 G;  3PZC A;  4HWR A;  2ATK C;  3OUF A;  3HRI A;  3HPL C;  3IFX A;  1H2G A;  4BW5 A;  4YRE A;  3ABU A;  2CJ9 A;  2WLM A;  3LDE A;  3AG1 C;  3DTU B;  3HTZ A;  3UH0 A;  1YHQ V;  4JTA B;  3A5Z A;  4G85 A;  2ZXW C;  2ZGW A;  3A32 A;  4XTU A;  3ZJZ A;  1W0K G;  1BIA A;  3ICA A;  1BHB A;  1E24 A;  3V8J A;  2KB1 A;  4PDM A;  2ALY A;  4CS4 A;  1LNQ A;  3VQX A;  1RIQ A;  1B70 A;  2K1E A;  5DM6 V;  3B8M A;  1NH2 D;  3ML0 A;  3HXX A;  2BOB C;  2YEV B;  2AMC B;  1YFT A;  3ETE A;  4UVB A;  2Q69 A;  1KKD A;  1QBZ A;  4JTD B;  5B1B C;  2EAY A;  4PA7 A;  1M56 B;  2DYR B;  2ZIN A;  2IY5 B;  3ASO C;  2ZCE A;  3CC2 V;  1K92 A;  1E1T A;  4E51 A;  3SYQ A;  4MVR A;  1FXH A;  5B1A B;  1RM1 B;  2EJF A;  4U7N A;  4LVK A;  4U7O A;  1M90 W;  3A7A A;  5CA3 A;  3FYE B;  2IH1 C;  1NQT A;  2W6J G;  3R65 A;  1SZT A;  3IG2 A;  1JVM A;  1R3I C;  3ETD A;  2JK5 C;  1EZJ A;  3K03 A;  4G27 B;  4OP0 A;  4CS3 A;  3AG2 C;  2ZT5 A;  2ZT8 A;  4P72 A;  3W7U A;  4P71 C;  2JJ2 G;  4YRC A;  1H4Q A;  5B1O A;  1QVF U;  2R9R B;  5IY5 B;  4EKW A;  4JPR A;  1THZ A;  1KC8 W;  2P0L A;  3W7S A;  1NYQ A;  2ZT6 A;  1YJN V;  1X56 A;  2EIJ C;  1USY C;  2WWW A;  3GB7 C;  1EQR A;  1WQ7 A;  4HWO A;  2DWE C;  3CC7 V;  1EIY B;  1H4V B;  1OCO B;  5FL7 G;  2HR3 A;  1W0J G;  1X2G A;  1CPY A;  2JEX A;  1Z7N A;  3OE7 G;  2ZR2 A;  1EOV A;  4G84 A;  1CEZ A;  3ZMZ A;  1EFW A;  3SPG A;  4J9Y B;  1B6Q A;  1IXM A;  4GX1 A;  3CXC U;  3RVY A;  2Q7H A;  1VQO V;  2D3O W;  1N9W A;  4XTZ A;  2QA4 V;  2CK3 G;  4WFG A;  1OCR C;  3JD1 A;  4PA9 A;  4YRM A;  1YSC A;  1AI5 A;  4X89 A;  3HFV A;  3SPH A;  4K88 A;  4XU2 A;  4MTO A;  1PNM A;  2X0L A;  3A7U A;  4Q15 A;  2V7Q G;  5EC2 C;  5B3S B;  2IJK A;  1X54 A;  3HRK A;  3BY6 A;  2NNU A;  1K3E A;  3CME V;  3FB8 C;  4LBE C;  4H2Y A;  2EIN B;  5HFM A;  1WU7 A;  4I5S A;  2XAF A;  2ITC C;  1NJ6 A;  1ORQ C;  4CBC A;  5LGT A;  3LDC A;  3MF1 A;  2IJJ A;  2PI5 A;  3LC0 A;  4QE9 A;  3L4G B;  1JPX A;  3AG3 C;  2DTI A;  4UV9 A;  3K0D A;  4E2L A;  1E22 A;  1M1K W;  3ABK C;  3VQV A;  3QO7 A;  4JYB A;  1TUE B;  2QEX V;  2ZXW B;  1R3L C;  2EZO A;  2ZXF A;  3E9H A;  4UV8 A;  1X01 A;  1H8E G;  3QNE A;  2RHS A;  3D3I A;  2Q68 A;  3OMA B;  2XTI A;  4MSW C;  1W66 A;  2BOC C;  1WLE A;  4TVW A;  2Y48 A;  3V7S A;  2QE7 G;  4UP9 A;  4WF2 A;  1P4R A;  3G71 V;  1BBU A;  2OTL V;  2HG5 C;  1ENV A;  2DQ3 A;  4KP4 A;  1E1O A;  2J3M A;  4H2T A;  5L3E A;  1VQ6 V;  3M4P A;  4O2D A;  3TEG A;  1GTO A;  3OEE G;  3JCZ A;  5LHH A;  1K34 A;  3FKS G;  1ADJ A;  2ZT7 A;  2QM7 A;  2DYS B;  1N8R W;  2RHQ A;  3WG7 B;  3VBB A;  3ETG A;  2JEU A;  3LSS A;  1G5I A;  4JTC B;  1EVL A;  1K4D C;  1ATI A;  3CC4 V;  1AJP A;  3CYO A;  4YDQ A;  3HXY A;  2DKG A;  2P7T C;  2WLJ A;  4RUF A;  4QIW F;  3JD4 A;  4ZKI A;  5LHG A;  3CCV V;  4EX5 A;  3ZMS A;  2EIK B;  3A31 A;  4TWA A;  4UP8 A;  4YRN A;  2A9H A;  1GK9 A;  2OCC B;  3BEH A;  1Q81 W;  4EO4 A;  1K97 A;  5LGN A;  3CCR V;  2Q6A A;  3F7Y C;  3MD0 A;  1YJ9 V;  1WQW A;  3ZRS A;  1DTO A;  3SJQ C;  4X5O A;  3OFN G;  3E35 A;  5CMU A;  3T4Z A;  2ZZF A;  1B7Y A;  4JAU A;  2AKW A;  2WLL B;  1X2H A;  5CBG A;  3E9I A;  1V54 C;  3AG1 B;  3HB3 B;  3RGL A;  3TET A;  3SYP A;  2X6B A;  2EIJ B;  3E8B A;  5EBW C;  3STZ C;  1NJ5 A;  4BAY A;  1WNL A;  2ODR D;  3G1Z A;  4UUJ C;  3FB5 C;  4UXN A;  1SET A;  4NCX A;  3VQY A;  2CJB A;  5ELO A;  1S76 D;  4JGS A;  3CPW U;  4WJ4 A;  1NJI W;  4LCU C;  1M57 B;  3ABL C;  3EFF K;  4MVQ A;  2IJH A;  3ABM C;  1YJW V;  4FJC C;  2DDZ A;  3BFM A;  4P3O A;  4XU0 A;  2B1G A;  3T1C A;  1K4C C;  1QLE B;  3QTC A;  5IYD O;  3E8H A;  3REX A;  4P74 C;  4KR3 A;  3P32 A;  1IL2 A;  1FXV A;  1Z7M A;  3I55 V;  3K06 A;  3K3W A;  2Q7G A;  1G51 A;  4MTX A;  1QF6 A;  1QR9 A;  2AHZ A;  1F23 A;  4GX0 A;  3ZMT A;  3CCE V;  2DZ9 A;  2XAJ A;  4R50 A;  4H2X B;  2DQ0 A;  1RM1 C;  1GM8 A;  2HNI A;  5EK0 A;  3LNM B;  4MW3 A;  5C93 A;  1X55 A;  1PD3 A;  4X8A A;  2CJA A;  1KEC A;  3MQZ A;  1JCH A;  2Y69 B;  5K1X A;  2H8P C;  2EBO A;  4N23 A;  4RAI A;  3CCS V;  4HAM A;  1AJN A;  4ASU G;  12AS A;  2HKO A;  1H4S A;  3MHS C;  2LFR A;  1BL8 A;  2JIZ G;  3G4S V;  2M7W A;  2E10 A;  5CN0 A;  3RKX A;  2XOK G;  2NLJ C;  2F43 G;  5CBH A;  3AEI A;  2I4N A;  1HWY A;  2WLN A;  4PA6 A;  4JYC A;  5BZB A;  2E65 A;  4WJ3 M;  1AJQ A;  3ASN B;  2Q7E A;  5KUM A;  2ZDI A;  2Z3Y A;  4TVA B;  2XAG A;  1MAB G;  1OCO C;  3OR6 C;  4GX5 A;  4KFM A;  1KMM A;  4XTX A;  2EIL B;  4GT1 A;  4H02 A;  3RKW A;  1OZ0 A;  1H38 A;  2ZR3 A;  2HLD G;  5C53 B;  1V55 B;  3ZRX A;  1HC7 A;  2IW5 A;  4ZBM A;  1B70 B;  3W7X A;  2ODR C;  2IU3 A;  1VQL V;  2YEV A;  4MVZ A;  3JD3 A;  2AMC A;  4TVY A;  3BJU A;  2J3L A;  2HFE C;  1ASY A;  2RHS B;  3JD2 A;  2DW4 A;  3RKY A;  2EJG A;  2A8E A;  1EIY A;  1KOG A;  2R9I A;  4CH4 A;  3E2E A;  1QE0 A;  1NR7 A;  1Y4M A;  4MVO A;  1SRY A;  3CCQ V;  4FIP C;  2EIK C;  5L3G A;  3ZRW A;  5L3B A;  2ZNJ A;  4RQF A;  2OCC C;  2ITD C;  4BIZ A;  2PME A;  5EBL C;  4H33 A;  1FS0 G;  2ZD9 A;  1FXK B;  1EVK A;  4P9O A;  3DSQ A;  2FYK A;  1I5Y A;  4ZTZ B;  3SPJ A;  3AG3 B;  1B76 A;  4ZTU B;  1JJ2 U;  1F4N A;  3E83 A;  2DJZ A;  3SYA A;  3MHH C;  1HXD A;  3ZN0 A;  2V1D A;  3G6E V;  1JJC A;  3RAC A;  2B1I A;  4XDJ A;  2DWD C;  2WAM A;  1B8A A;  4P74 A;  4LVM A;  2QTO A;  2DU5 A;  1EBO A;  2WSS G;  3IC7 A;  1M56 C;  2GSM B;  4TT3 G;  1S77 D;  1JOY A;  3EFR A;  3ASO B;  3K9A A;  4XTW A;  2X7R B;  1PKX A;  1YFR A;  2QM8 A;  2G4C A;  2MK3 A;  2EIM B;  3M99 B;  3OR7 C;  5B1N A;  1F4M A;  1K5S A;  2GHY A;  4P2Z A;  2XAS A;  4UVA A;  3HFZ B;  1C0A A;  3ABM B;  2EIN C;  2UXN A;  3P8T A;  5EC1 C;  1GKF A;  5LBQ A;  1WPY A;  3D36 A;  1DF5 A;  2WLK A;  3WG7 C;  5EBM C;  1AI4 A;  1AI7 A;  4MVM A;  2OTJ V;  2DTH A;  3IAL A;  3V7C A;  2IJI A;  1CP9 A;  2C8M A;  4TVA A;  3K04 A;  2ARU A;  4DPG A;  3K0G A;  5LHI A;  1S5H C;  4BIU A;  2DEQ A;  3WQZ A;  1R6K A;  1K33 A;  2YSU B;  3EHB B;  2WLI A;  2JDI G;  2PMF A;  1GO3 F;  1NJ2 A;  2Y69 C;  3UKM A;  5C51 B;  3AG4 C;  1YTF B;  1QLN A;  3CMA V;  2ZZG A;  1VQ9 V;  1OHH G;  3W7T A;  4TSF G;  1SER A;  1K73 W;  4P73 C;  4H37 A;  4TQD A;  4WFE A;  4JAV A;  1V54 B;  2AKW B;  2EWN A;  4P72 C;  4P3P A;  3TUP A;  4HA8 A;  3HY1 A;  3A5Y A;  4PDL A;  3RL6 A;  4XTV A;  4YXW G;  4MT8 A;  3X2Q B;  1KP3 A;  3A74 A;  5KNN A;  1OCR B;  2P5I A;  5IDJ A;  4HT4 A;  4YRI A;  3WFV A;  1OCZ B;  4XU1 A;  4RO2 A;  2HVJ C;  4G2K A;  4YCW A;  1NJ8 A;  4Z1M G;  3OMN B;  4LVI A;  1QR8 A;  1PNK A;  1GM9 A;  2WLL A;  3OUS A;  4J9Z B;  4XTY A;  1AI6 A;  1ROP A;  4YP0 A;  4UP7 A;  1E1R G;  1L0W A;  1S72 V;  5GW7 A;  3MF2 A;  3E8G A;  3RW0 A;  2P90 A;  3W7W A;  3A0R A;  4GX2 A;  3V8L A;  4XDK A;  3K08 A;  4PDR A;  1K8A W;  2WLH A;  3OEH G;  4TWK A;  2EL9 A;  1VQN V;  1BHA A;  4P75 C;  2ZZE A;  1KQS U;  3SYC A;  2PI4 A;  2DZC A;  4GCZ A;  4ZIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...