3LT9A

A non-biological atp binding protein with a single point mutation (d65v), that contributes to optimized folding and ligand binding
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
b'DDDDKKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP BINDING PROTEIN-D65V
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lt9A00
2P0XA 2P09A 3LTAA 3DGOA 3LTDA 3LTCA 3LT9A 1UW1A 3DGMA 3LT8A 3LTBA 2P05A 3DGLA 3DGNA
chains in the Genus database with same CATH superfamily
4H3UA 3EJVA 1QAFA 3BB9A 2YX9A 4RBNA 2D1WA 2GU1A 3K63A 7RNTA 3F8HA 3JUMA 1D6YA 1NWWA 4WWUC 1GD3A 4OUQA 2OOVA 3PYJA 1BAOA 1BRKA 4WFOA 4N6LA 5TGNA 3DH2A 2CG1A 4R9LA 4N6MA 2OCTA 4LYLB 3KZTA 4XB5A 1BRHA 3RGRA 3OX9A 1DMMA 2CX0A 1IQXA 2IA7A 4K61A 1AY7A 3M8CA 1RHLA 4O2HA 1SIIA 3EX9A 5DRVA 3URPA 1OUNA 3GAXA 4G1MB 3S28A 4RZMA 3GWRA 5LC6A 4ZM8A 3PXMA 3WOFB 1OCVA 1UGHI 5EEOA 3DGNA 1QALA 2GEYA 5IG5A 3OXAA 1RGCA 3CPW2 3CCJ3 3ER7A 1B2MA 2XRXB 4LEHA 5HOHA 4K90B 3SOAA 1VQL3 3KN4A 4ORLA 1GY5A 3DM8A 2W9QA 1UUGB 1ZGXA 4BTWA 5AYRB 3NBBA 1NB3I 1D6ZA 2P0XA 3CPOA 1F8NA 2Q07A 3HZPA 1RGHA 6RNTA 3ZG5A 4I5QA 1RMSA 2W04A 4KFDA 5A0OB 1VQ73 2KF6A 1OHSA 2D42A 1MWUA 3PCSA 1LXEA 3HOHA 1YGWA 3GRDA 3NQYA 8RNTA 3J7Yd 2QA43 2Z76A 1E3VA 3IMAB 3SYUA 2ZHXB 4DKIA 3A76A 5LC7A 4J5KA 3AHSA 1HYFA 1IVUA 2GSPA 1FW7A 1GMPA 2KXGA 1RKYA 3BNCA 1YJ93 3S29A 2P09A 3N54B 1J2BA 5D81A 4XDVA 1RGLA 2Y73A 1W00A 1LQGC 2Z77A 1MNLA 1LNHA 4HAAA 1BNIA 4L8OA 2C4BA 2KCDA 1GY7A 4WYKA 1KQS2 5JBSA 4HM8B 1ASKA 2HMKB 1TP6A 3IPTA 1A90A 5IG4A 2QGUA 3WHOA 2W56B 3CCM3 3FKAA 1K41A 3MYTA 4HZ9B 2KF5A 1VQ63 1CH0A 1W02A 1QVF2 4J8TA 1I2GA 2W0QA 3MG2A 1FGTA 3PZWA 1MGRA 5AEWB 4RNYA 1BRSA 4CCVA 2E2UA 1N8R4 1V57A 3GSPA 4HM3B 3LT8A 4RNZA 1VQM3 4WYKB 3D79A 1GOYA 3AGOA 4L7KA 2ML5A 3ZFZA 4FMAA 4N6V0 3EC9A 2CWTA 9RNTA 1LQMB 1OHPA 4FCMA 3K5TA 1UUWB 1GSPA 1O7MB 1KD14 3AMOA 4XBTA 3G8ZA 5D83A 1NU3A 1B2XA 1DYUA 1O7HB 1RGKA 1RN7A 3N9HA 3DUKA 4EV5A 4HVNA 2CKFB 1O7PB 1VZZA 3FLJA 3S67A 4AKZA 4HKVB 1FA3A 3EF8A 1K8A4 1BU4A 1R4YA 1TRQA 2E2TA 2L1SA 3T0UA 4NPBA 1UGIA 1AQZA 1JV2B 1BRGA 1KC84 1VQ83 4OK0A 1BIRA 1JB4A 3O8YA 1WMNA 2PNCA 2XGNA 3JUPA 1W6CA 1IDPA 1I3IA 5STDA 1IV9A 3G16A 1C54A 2CFWA 4HM7B 1UW1A 3CCL3 1BNEA 1Q824 2Y74A 1JNQA 4NHFA 1BSAA 1W6GA 2CFLA 2Z7AA 2OQEA 3S27A 3PS8A 2XF3A 4MJDA 2W6JH 1RGAA 1CYVA 2CH9A 1T3BA 4HM6B 4MMYB 2F4YA 3A5EA 4FMDA 3B4OA 3EHCA 1U5OA 1ULIB 3EN1B 2CX1A 3KFQC 5AYSC 3KKGA 1WMPA 2R41A 3ECFA 1GOVA 3RNTA 3HIGA 2O9UX 1JZDA 3F9SA 4GB5A 1K28A 3D3LA 3DGOA 3TDGA 3BNBA 1SJWA 3WR2A 5CF2A 1BSBA 2W2CA 3FGYA 2BHMA 1LNIA 1CYUA 1B20A 3CNXA 3GZYB 1YHQ3 1ISKA 3X42A 1O7GB 1Y4KA 3WMDA 1YJN3 1Z1SA 1JBSA 3LTBA 4HM4B 2V1LA 3WODG 3X3YA 3G713 1JN5B 4Q53A 3HX8A 2K54A 3LOYA 1JKGB 2CW9A 3HI7A 2LQVA 1FGRA 2FGTA 3CC73 1M1K4 5AI1A 2W03A 1T2IA 2XEPA 4LGQA 5G1KA 4FMCA 4LMIA 4HM0B 4BIRA 1I70A 5FGOA 1YJW3 3JUNA 1YVSA 1TFOA 5FW5A 1TIJA 1IU7A 3X3ZA 1JRQA 3V98A 1RNBA 3CNMA 1LOVA 3JUQA 5BU4A 4R4KA 5CXOA 1N9JA 1IVWA 1LOYA 3GZRA 1STFI 2JDIH 3MHEA 4O8SA 3V99A 1RTUA 2YFIB 1EKMA 1C7HA 2GBWB 1NO3A 2MF7A 3UB1A 2ZA4A 1BNSA 2OQEC 3EQQB 1A2KA 4IPBA 3EBYA 4PEJA 1MWTA 1UI7A 1IT7A 1E97A 2M7OA 4OVMA 1GY6A 1IK3A 1Q864 3ZG0A 1WTHA 2HMJB 4H61A 3H51A 3DGYA 3NM2A 3X41A 3I553 3KE7A 4EW5A 1RGEA 3PCRA 4XDWA 4XBXA 3PGBA 1JB2A 3DGLA 4BTXA 1TRPA 3D5IA 3NUVA 4J5GA 3D9RA 2CC3A 1QVG2 2UGIA 3HIIA 5HGRA 5BIRA 1NNVA 1RNTA 1TJDA 2XFTA 3T8NA 2WOFA 3VGNA 1B2SA 4LSOA 4X2OA 3FF2A 2UUGC 3T8UA 1VQK3 1JJ22 1L5GB 3N8BA 3MG1A 1TU5A 2WGQA 1OH0A 3Q90A 1BSDA 5AEUB 3CD63 1TFKA 4GL6A 2H0HA 1BVIA 2CFGA 1QMAA 1W6YA 2RCDA 1YNVX 1IT8A 1Q40A 2K3DA 5DREA 3VF1A 3B8LA 1RCKA 2K0MA 4IT7A 1SPUA 2XFSA 2BT3A 2ZDJA 2KF4A 3UJMA 3UL6A 5M18A 1IVVA 5I97A 2XR8B 4EBGA 1JZOA 1RRHA 4TX4A 3X40A 1PY3A 4EC6A 1VQQA 3DXOA 3MPHA 3OV4A 1Q814 2CIUA 1O7WB 4GHOA 4KZ1A 1TTOA 5G1LA 1I0VA 4K1VA 4X2HA 1BGSA 1Q40B 2WO0A 3AGNA 3K0ZA 2STDA 3CCR3 5KP3A 4CDLA 1GS3A 1G0TA 2J8XB 3DGMA 3OWYA 2CHCA 4FCZA 4N6TA 3VSYA 3ROBA 5KP4A 3CMA3 3K9MC 4WHAA 1GD4A 3IJEB 1B3SA 1UDII 1X1WA 3NM7A 1BUQA 1IV7A 1N5PA 5CK6A 1OGZA 3EBTA 3Q1CA 4KT3B 3EB8A 3LTAA 2FXTA 1IQYA 1GOUA 1W2B2 4RNTA 1CQSA 3MG3A 4STDA 1RSNA 3CU3A 1TUHA 3AMOB 1N5HA 3NQZA 4J9AA 1NB5I 3HK4A 1OACA 1I3FA 1BNFA 5JPPA 2YFJB 3CCV3 4NREA 1EUIC 1FUTA 3WA2X 1AVKA 2HMNB 1RLSA 4IIAA 1A67A 4EV2A 1K734 4AKYA 4R80A 1HU9A 1R4CA 2F5WA 2F86B 2W9PA 1G96A 1NDOB 1EEJA 1FUSA 2HOHA 3JVCA 4GSPA 2HMOB 3LZAA 2R4IA 3DY5A 4K1UA 2KRTA 3CC43 2INXA 3MWZA 1OF5A 1BUJA 1W7CA 2KAAA 3Q3FA 3NHXA 1VQ43 3SOYA 1OPYA 1N9EA 5KP1A 1CEWI 2LYXA 3BNDA 3NXJA 1JBTA 1PYLA 3NX0A 3CCS3 2YFLB 3NV0A 3K7CA 3NBRA 3X3XA 1UUVB 1US1A 1RN4A 3I563 1VQO3 1X1YA 2XSOB 3F8XA 7STDA 1VQN3 1X1XA 3FG3A 5AIIA 4HM5B 2RBIA 3G0KA 1D6UA 3OWUA 1B2UA 3V92A 2OTL3 1RDSA 4HBRA 1B27A 3WOEB 1KSIA 1I2EA 1Q9EA 1RGGA 3KSPA 3KIIA 3NV0B 4AEQA 3GZXB 1A2PA 4JRFA 1YIJ3 1SIHA 2BIRA 2F56A 3F7SA 2CWUA 5EQLA 3G4S3 1HZ1A 4FMBA 7GSPA 1FUWA 2P05A 1V58A 1DETA 1Q7Y4 3DMCA 5IW9A 2CK3H 3AHWA 1WMOA 6GSPA 1ZX2A 1DMNA 3LMLA 1BNJA 3CCQ3 3WA3A 1AV4A 1AR0A 4MMXB 1QJGA 2FNQA 1B2ZA 5IERA 4R1KA 1S5AA 5IENA 1LRAA 1UCKA 1MGWA 4N6UA 3B7CA 4WP5A 1I8VA 3BIRA 1M1XB 2F98A 2B1XB 4QWTA 2IYJA 1W4NA 1RJOA 5ELUA 1IQ8A 3FG4A 3GZBA 1BANA 1GMQA 3LTCA 1STDA 1O7NB 1MWRA 1K9M4 3G6E3 1DVDA 2GU3A 1N8QA 4HZBB 5AIHA 1LVNA 3U97A 4BL2A 5GSPA 2HMLB 6STDA 2IY2A 5IF6A 3BU4A 5G2GA 1ZS7A 1PFPA 1KWIA 1OGXA 4FR9A 2B24B 2BMQB 2KF3A 5D82A 3FH1A 2BO9B 3CME3 4MEIA 1OHOA 2QEX3 2F5MA 4KFEA 2L4VA 1DMQA 3E99A 1BRJA 1E3RA 1YGEA 1X1UA 3F14A 3LH4A 4HM1B 4EYCA 4KVHA 3LXUX 2E2VA 2BMRB 3SEDA 3CC23 2CFDA 4EXRA 1UCIA 1W2ZA 2OWPA 2H0IA 3NBJA 4LZIA 1SQWA 1BRNL 1VQ93 3LYGA 4O3VA 3CCU3 1LOWA 3WDGB 2IUKA 2H0GA 2CWVA 2W56A 2I9WA 3MSOA 3RDEA 2ZL8A 2A15A 1JBRA 4U13A 3F7XA 2MC8A 1EG9B 4CPKA 1M904 3UL5A 1RGFA 1DVCA 1BRIA 1EA2A 1MWSA 2OOVC 2XSHB 2O3OA 1UCJA 4KFFA 5AIFA 1YIT3 1T5YA 2AADA 4MMZB 1SARA 3FSDA 2QIYA 2SARA 1QAKA 1BNRA 3STDA 4N6NB 3SVAA 1BSCA 2IUJA 1W5ZA 3H3HA 5IG3A 2OTJ3 1A2VA 2UX0A 3MKIA 1VQP3 1I2FA 4HYZA 2AAEA 2CG0A 1DE3A 3CXC2 8CHOA 5CF1A 1T2HA 4CJNA 2IMJA 1IYYA 2Z6BA 1GMRA 4XM4A 1IVXA 2XGLA 1NJI4 1B21A 1ZO2A 3SX1A 2P38A 4HOHA 2GEXA 5ELJA 1WQLB 1FGMA 2GXFA 2WGOA 3BLZA 3QRDA 3JUOA 1YVBI 1S723 1FGQA 3S5CA 3KCHA 3U1WA 3D5GA 1YI23 1VQ53 3LT9A 1U8CB 3B4PA 3Q2PA 4N3VA 2SBLA 1PU4A 1V74A 5IEPA 1EQKA 3KSED 3OWSA 5BXQA 2RGQA 2RSXA 3L0RA 1G02A 5M1AA 2WOHA 2GBXB 1ROAA 4BL3A 2CFKA 1FZUA 1RN1A 1AVLA 1BSEA 3EE1A 5BVBA 5JPUA 4BU4A 1BOXA 2BNGA 4JF8A 5CLKA 4I4KA 5EVHA 3UNLA 1FYSA 3FG1A 4O02B 5M19A 1I0XA 4FCJA 4N6OB 2F99A 3ALAA 3EN8A 2C11A 1RCLA 4HM2B 3OW22 1FGOA 3D4AA 1WNHA 1LOXA 1ROVA 1HKXA 2BMOB 2C10A 2PZVA 3LTDA 3I0YA 3QK9A 4L8PA 1JB5A 5IG0A 4BTYA 1GYBA 5RNTA 1Q42A 2RFRA 4XBYA 5IEOA 3CCE3 1OF5B 1MOLA 1M9GA 2JQ5A 4HJLB 1W01A 3FF0A 1JN5A 3FCSB 2P0MA 2XH9A 5AIGA 2BU4A 1JKGA 4ILFA 1RRLA 1Q7HA 3SLUA 1BNGA 3DZLA 3BNEA 3FZWA 1UCLA 4R9KA 3RGAA 2HMMB 3F40A 1UI8A 2RNTA 2ML6A 3SXXA 1ULJB
chains in the Genus database with same CATH topology
4H3UA 3EJVA 1QAFA 3BB9A 2YX9A 4RBNA 2D1WA 2GU1A 3K63A 3F8HA 3JUMA 1D6YA 1NWWA 4WWUC 1GD3A 4OUQA 2OOVA 3PYJA 4WFOA 4N6LA 5TGNA 2CG1A 4R9LA 4N6MA 2OCTA 3KZTA 4XB5A 3RGRA 3OX9A 1DMMA 1IQXA 2IA7A 4K61A 3M8CA 4O2HA 1SIIA 3EX9A 5DRVA 1OUNA 3GAXA 4G1MB 3S28A 4RZMA 3GWRA 5LC6A 4ZM8A 3PXMA 3WOFB 1OCVA 5EEOA 3DGNA 1QALA 2GEYA 5IG5A 3OXAA 3CPW2 3CCJ3 3ER7A 2XRXB 4LEHA 4K90B 3SOAA 1VQL3 3KN4A 4ORLA 1GY5A 3DM8A 2W9QA 4BTWA 5AYRB 3NBBA 1NB3I 1D6ZA 2P0XA 3CPOA 1F8NA 2Q07A 3HZPA 5A0OB 4KFDA 2W04A 1VQ73 1OHSA 2D42A 3PCSA 1LXEA 3NQYA 3GRDA 3J7Yd 2QA43 2Z76A 1E3VA 3IMAB 3A76A 5LC7A 1IVUA 2KXGA 1RKYA 3BNCA 1YJ93 3S29A 2P09A 3N54B 1J2BA 5D81A 4XDVA 2Y73A 1W00A 2Z77A 1MNLA 1LNHA 4L8OA 2KCDA 1GY7A 4WYKA 1KQS2 5JBSA 4HM8B 1ASKA 2HMKB 1TP6A 3IPTA 1A90A 5IG4A 2QGUA 3CCM3 2W56B 3FKAA 1K41A 3MYTA 4HZ9B 1VQ63 1W02A 1QVF2 4J8TA 2W0QA 3MG2A 3PZWA 1FGTA 5AEWB 4RNYA 4CCVA 2E2UA 1N8R4 4HM3B 1VQM3 3LT8A 4RNZA 4WYKB 4L7KA 2ML5A 4FMAA 4N6V0 3EC9A 2CWTA 1OHPA 4FCMA 3K5TA 1UUWB 1O7MB 1KD14 3AMOA 4XBTA 3G8ZA 5D83A 1NU3A 1DYUA 1O7HB 1RN7A 3N9HA 4EV5A 3DUKA 4HVNA 2CKFB 1O7PB 1VZZA 3FLJA 3S67A 4AKZA 4HKVB 1FA3A 3EF8A 1K8A4 2E2TA 3T0UA 1VQ83 1JV2B 1KC84 4OK0A 1JB4A 3O8YA 1WMNA 2PNCA 2XGNA 3JUPA 1W6CA 1IDPA 5STDA 1IV9A 3G16A 2CFWA 4HM7B 1UW1A 3CCL3 1Q824 2Y74A 1JNQA 4NHFA 1W6GA 2CFLA 2Z7AA 2OQEA 3S27A 3PS8A 2XF3A 4MJDA 2W6JH 1CYVA 2CH9A 4HM6B 4MMYB 4FMDA 3B4OA 3EHCA 1U5OA 1ULIB 3EN1B 3KFQC 5AYSC 3KKGA 1WMPA 3ECFA 3HIGA 2O9UX 3F9SA 4GB5A 1K28A 3D3LA 3DGOA 3TDGA 3BNBA 1SJWA 5CF2A 2W2CA 3FGYA 2BHMA 1CYUA 3CNXA 3GZYB 1YHQ3 1ISKA 3X42A 1O7GB 1Y4KA 3WMDA 1YJN3 1Z1SA 3LTBA 4HM4B 2V1LA 3WODG 3X3YA 3G713 1JN5B 4Q53A 3HX8A 2K54A 3LOYA 1JKGB 2CW9A 3HI7A 2LQVA 1FGRA 2FGTA 3CC73 1M1K4 5AI1A 2W03A 2XEPA 4LGQA 4FMCA 4LMIA 4HM0B 1YJW3 5FGOA 3JUNA 1TFOA 5FW5A 1TIJA 1IU7A 3X3ZA 1JRQA 3V98A 3CNMA 3JUQA 4R4KA 5CXOA 1N9JA 1IVWA 3GZRA 3MHEA 1STFI 2JDIH 4O8SA 3V99A 2YFIB 1EKMA 1C7HA 2GBWB 1NO3A 2MF7A 3UB1A 2OQEC 3EQQB 1A2KA 4IPBA 3EBYA 4PEJA 1UI7A 1IT7A 1E97A 2M7OA 4OVMA 1GY6A 1IK3A 1Q864 1WTHA 2HMJB 4H61A 3H51A 3NM2A 3X41A 3I553 3KE7A 4XDWA 3PCRA 4XBXA 3PGBA 1JB2A 3DGLA 3NUVA 3D9RA 2CC3A 1QVG2 3HIIA 5HGRA 2XFTA 3T8NA 2WOFA 3VGNA 4LSOA 4X2OA 3FF2A 3T8UA 1VQK3 1JJ22 1L5GB 3N8BA 3MG1A 1TU5A 2WGQA 1OH0A 3Q90A 5AEUB 3CD63 1TFKA 4GL6A 2CFGA 1QMAA 1W6YA 2RCDA 1IT8A 1Q40A 3VF1A 5DREA 3B8LA 2K0MA 4IT7A 1SPUA 2XFSA 2BT3A 2ZDJA 3UJMA 3UL6A 1IVVA 5I97A 2XR8B 4EBGA 1RRHA 4TX4A 3X40A 4EC6A 3DXOA 3MPHA 3OV4A 1Q814 2CIUA 1O7WB 4KZ1A 4K1VA 4X2HA 1Q40B 2WO0A 3K0ZA 3CCR3 2STDA 5KP3A 4CDLA 1GS3A 3OWYA 3DGMA 2CHCA 4FCZA 4N6TA 3VSYA 3ROBA 5KP4A 3CMA3 3K9MC 4WHAA 1GD4A 3IJEB 3NM7A 1BUQA 1IV7A 1N5PA 5CK6A 1OGZA 3EBTA 3Q1CA 3EB8A 3LTAA 2FXTA 1IQYA 1W2B2 1CQSA 3MG3A 4STDA 3CU3A 1TUHA 3AMOB 1N5HA 3NQZA 4J9AA 1NB5I 3HK4A 1OACA 5JPPA 2YFJB 3CCV3 4NREA 3WA2X 1AVKA 2HMNB 4IIAA 1A67A 4EV2A 1K734 4AKYA 4R80A 1HU9A 1R4CA 2W9PA 2F86B 1G96A 1NDOB 3JVCA 2HMOB 3LZAA 2R4IA 3DY5A 4K1UA 2KRTA 3CC43 2INXA 3MWZA 1OF5A 1W7CA 3NHXA 1VQ43 3SOYA 1OPYA 1N9EA 5KP1A 1CEWI 2LYXA 3BNDA 3NXJA 3NX0A 3CCS3 2YFLB 3NV0A 3K7CA 3NBRA 3X3XA 1UUVB 1US1A 3I563 1VQO3 2XSOB 3F8XA 7STDA 1VQN3 3FG3A 5AIIA 4HM5B 3G0KA 1D6UA 3OWUA 3V92A 2OTL3 4HBRA 3WOEB 1KSIA 3KSPA 3NV0B 3KIIA 4AEQA 3GZXB 4JRFA 1SIHA 3F7SA 2CWUA 5EQLA 3G4S3 4FMBA 1FUWA 2P05A 1Q7Y4 3DMCA 5IW9A 2CK3H 1WMOA 1ZX2A 1DMNA 3LMLA 3CCQ3 3WA3A 1AV4A 1AR0A 4MMXB 2FNQA 1QJGA 5IERA 4R1KA 1S5AA 5IENA 4N6UA 3B7CA 4WP5A 1M1XB 2F98A 2B1XB 4QWTA 1W4NA 1RJOA 5ELUA 1IQ8A 3FG4A 3GZBA 3LTCA 1STDA 1O7NB 1K9M4 3G6E3 1DVDA 2GU3A 1N8QA 4HZBB 5AIHA 1LVNA 3U97A 2HMLB 6STDA 5IF6A 5G2GA 1PFPA 1KWIA 1OGXA 4FR9A 2B24B 2BMQB 5D82A 3FH1A 2BO9B 3CME3 4MEIA 1OHOA 2QEX3 4KFEA 2L4VA 1DMQA 3E99A 3F14A 1E3RA 1YGEA 3LH4A 4EYCA 4HM1B 4KVHA 3LXUX 2E2VA 2BMRB 3SEDA 3CC23 2CFDA 4EXRA 1W2ZA 3NBJA 2OWPA 1YIJ3 1VQ93 4LZIA 1SQWA 3LYGA 4O3VA 3CCU3 3WDGB 2IUKA 2CWVA 2W56A 2I9WA 3MSOA 3RDEA 2ZL8A 2A15A 4U13A 3F7XA 2MC8A 1EG9B 1M904 3UL5A 1DVCA 1EA2A 2OOVC 2XSHB 2O3OA 5AIFA 4KFFA 1YIT3 1T5YA 4MMZB 3FSDA 2QIYA 1QAKA 3STDA 4N6NB 3SVAA 2IUJA 1W5ZA 3H3HA 5IG3A 2OTJ3 1A2VA 2UX0A 3MKIA 1VQP3 4HYZA 2CG0A 3CXC2 8CHOA 5CF1A 2IMJA 2Z6BA 4XM4A 1IVXA 2XGLA 1NJI4 1ZO2A 3SX1A 2P38A 2GEXA 5ELJA 1WQLB 1FGMA 2GXFA 2WGOA 3BLZA 3QRDA 3JUOA 1YVBI 1S723 1FGQA 3S5CA 3U1WA 1VQ53 1YI23 3LT9A 1U8CB 3B4PA 3Q2PA 4N3VA 2SBLA 1PU4A 1V74A 5IEPA 1EQKA 3KSED 3OWSA 5BXQA 2RGQA 2RSXA 3L0RA 2WOHA 2GBXB 1ROAA 2CFKA 1AVLA 3EE1A 5BVBA 5JPUA 2BNGA 4JF8A 5CLKA 4I4KA 5EVHA 3UNLA 4O02B 3FG1A 4FCJA 4N6OB 2F99A 3ALAA 3EN8A 2C11A 4HM2B 3OW22 1FGOA 1WNHA 1LOXA 2PZVA 1ROVA 1HKXA 2BMOB 2C10A 3LTDA 3I0YA 3QK9A 4L8PA 1JB5A 5IG0A 4BTYA 1GYBA 2RFRA 1Q42A 4XBYA 5IEOA 3CCE3 1OF5B 1MOLA 1M9GA 2JQ5A 4HJLB 1W01A 3FF0A 1JN5A 3FCSB 2P0MA 2XH9A 5AIGA 1JKGA 3SLUA 1RRLA 3DZLA 3BNEA 3FZWA 4R9KA 3RGAA 2HMMB 3F40A 1UI8A 4BTXA 2ML6A 3SXXA 1ULJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0X A;  2P09 A;  3LTA A;  3DGO A;  3LTD A;  3LTC A;  3LT9 A;  1UW1 A;  3DGM A;  3LT8 A;  3LTB A;  2P05 A;  3DGL A;  3DGN A; 
#chains in the Genus database with same CATH topology
 4H3U A;  3EJV A;  1QAF A;  3BB9 A;  2YX9 A;  4RBN A;  2D1W A;  2GU1 A;  3K63 A;  7RNT A;  3F8H A;  3JUM A;  1D6Y A;  1NWW A;  4WWU C;  1GD3 A;  4OUQ A;  2OOV A;  3PYJ A;  1BAO A;  1BRK A;  4WFO A;  4N6L A;  5TGN A;  3DH2 A;  2CG1 A;  4R9L A;  4N6M A;  2OCT A;  4LYL B;  3KZT A;  4XB5 A;  1BRH A;  3RGR A;  3OX9 A;  1DMM A;  2CX0 A;  1IQX A;  2IA7 A;  4K61 A;  1AY7 A;  3M8C A;  1RHL A;  4O2H A;  1SII A;  3EX9 A;  5DRV A;  3URP A;  1OUN A;  3GAX A;  4G1M B;  3S28 A;  4RZM A;  3GWR A;  5LC6 A;  4ZM8 A;  3PXM A;  3WOF B;  1OCV A;  1UGH I;  5EEO A;  3DGN A;  1QAL A;  2GEY A;  5IG5 A;  3OXA A;  1RGC A;  3CPW 2;  3CCJ 3;  3ER7 A;  1B2M A;  2XRX B;  4LEH A;  5HOH A;  4K90 B;  3SOA A;  1VQL 3;  3KN4 A;  4ORL A;  1GY5 A;  3DM8 A;  2W9Q A;  1UUG B;  1ZGX A;  4BTW A;  5AYR B;  3NBB A;  1NB3 I;  1D6Z A;  2P0X A;  3CPO A;  1F8N A;  2Q07 A;  3HZP A;  1RGH A;  6RNT A;  3ZG5 A;  4I5Q A;  1RMS A;  2W04 A;  4KFD A;  5A0O B;  1VQ7 3;  2KF6 A;  1OHS A;  2D42 A;  1MWU A;  3PCS A;  1LXE A;  3HOH A;  1YGW A;  3GRD A;  3NQY A;  8RNT A;  3J7Y d;  2QA4 3;  2Z76 A;  1E3V A;  3IMA B;  3SYU A;  2ZHX B;  4DKI A;  3A76 A;  5LC7 A;  4J5K A;  3AHS A;  1HYF A;  1IVU A;  2GSP A;  1FW7 A;  1GMP A;  2KXG A;  1RKY A;  3BNC A;  1YJ9 3;  3S29 A;  2P09 A;  3N54 B;  1J2B A;  5D81 A;  4XDV A;  1RGL A;  2Y73 A;  1W00 A;  1LQG C;  2Z77 A;  1MNL A;  1LNH A;  4HAA A;  1BNI A;  4L8O A;  2C4B A;  2KCD A;  1GY7 A;  4WYK A;  1KQS 2;  5JBS A;  4HM8 B;  1ASK A;  2HMK B;  1TP6 A;  3IPT A;  1A90 A;  5IG4 A;  2QGU A;  3WHO A;  2W56 B;  3CCM 3;  3FKA A;  1K41 A;  3MYT A;  4HZ9 B;  2KF5 A;  1VQ6 3;  1CH0 A;  1W02 A;  1QVF 2;  4J8T A;  1I2G A;  2W0Q A;  3MG2 A;  1FGT A;  3PZW A;  1MGR A;  5AEW B;  4RNY A;  1BRS A;  4CCV A;  2E2U A;  1N8R 4;  1V57 A;  3GSP A;  4HM3 B;  3LT8 A;  4RNZ A;  1VQM 3;  4WYK B;  3D79 A;  1GOY A;  3AGO A;  4L7K A;  2ML5 A;  3ZFZ A;  4FMA A;  4N6V 0;  3EC9 A;  2CWT A;  9RNT A;  1LQM B;  1OHP A;  4FCM A;  3K5T A;  1UUW B;  1GSP A;  1O7M B;  1KD1 4;  3AMO A;  4XBT A;  3G8Z A;  5D83 A;  1NU3 A;  1B2X A;  1DYU A;  1O7H B;  1RGK A;  1RN7 A;  3N9H A;  3DUK A;  4EV5 A;  4HVN A;  2CKF B;  1O7P B;  1VZZ A;  3FLJ A;  3S67 A;  4AKZ A;  4HKV B;  1FA3 A;  3EF8 A;  1K8A 4;  1BU4 A;  1R4Y A;  1TRQ A;  2E2T A;  2L1S A;  3T0U A;  4NPB A;  1UGI A;  1AQZ A;  1JV2 B;  1BRG A;  1KC8 4;  1VQ8 3;  4OK0 A;  1BIR A;  1JB4 A;  3O8Y A;  1WMN A;  2PNC A;  2XGN A;  3JUP A;  1W6C A;  1IDP A;  1I3I A;  5STD A;  1IV9 A;  3G16 A;  1C54 A;  2CFW A;  4HM7 B;  1UW1 A;  3CCL 3;  1BNE A;  1Q82 4;  2Y74 A;  1JNQ A;  4NHF A;  1BSA A;  1W6G A;  2CFL A;  2Z7A A;  2OQE A;  3S27 A;  3PS8 A;  2XF3 A;  4MJD A;  2W6J H;  1RGA A;  1CYV A;  2CH9 A;  1T3B A;  4HM6 B;  4MMY B;  2F4Y A;  3A5E A;  4FMD A;  3B4O A;  3EHC A;  1U5O A;  1ULI B;  3EN1 B;  2CX1 A;  3KFQ C;  5AYS C;  3KKG A;  1WMP A;  2R41 A;  3ECF A;  1GOV A;  3RNT A;  3HIG A;  2O9U X;  1JZD A;  3F9S A;  4GB5 A;  1K28 A;  3D3L A;  3DGO A;  3TDG A;  3BNB A;  1SJW A;  3WR2 A;  5CF2 A;  1BSB A;  2W2C A;  3FGY A;  2BHM A;  1LNI A;  1CYU A;  1B20 A;  3CNX A;  3GZY B;  1YHQ 3;  1ISK A;  3X42 A;  1O7G B;  1Y4K A;  3WMD A;  1YJN 3;  1Z1S A;  1JBS A;  3LTB A;  4HM4 B;  2V1L A;  3WOD G;  3X3Y A;  3G71 3;  1JN5 B;  4Q53 A;  3HX8 A;  2K54 A;  3LOY A;  1JKG B;  2CW9 A;  3HI7 A;  2LQV A;  1FGR A;  2FGT A;  3CC7 3;  1M1K 4;  5AI1 A;  2W03 A;  1T2I A;  2XEP A;  4LGQ A;  5G1K A;  4FMC A;  4LMI A;  4HM0 B;  4BIR A;  1I70 A;  5FGO A;  1YJW 3;  3JUN A;  1YVS A;  1TFO A;  5FW5 A;  1TIJ A;  1IU7 A;  3X3Z A;  1JRQ A;  3V98 A;  1RNB A;  3CNM A;  1LOV A;  3JUQ A;  5BU4 A;  4R4K A;  5CXO A;  1N9J A;  1IVW A;  1LOY A;  3GZR A;  1STF I;  2JDI H;  3MHE A;  4O8S A;  3V99 A;  1RTU A;  2YFI B;  1EKM A;  1C7H A;  2GBW B;  1NO3 A;  2MF7 A;  3UB1 A;  2ZA4 A;  1BNS A;  2OQE C;  3EQQ B;  1A2K A;  4IPB A;  3EBY A;  4PEJ A;  1MWT A;  1UI7 A;  1IT7 A;  1E97 A;  2M7O A;  4OVM A;  1GY6 A;  1IK3 A;  1Q86 4;  3ZG0 A;  1WTH A;  2HMJ B;  4H61 A;  3H51 A;  3DGY A;  3NM2 A;  3X41 A;  3I55 3;  3KE7 A;  4EW5 A;  1RGE A;  3PCR A;  4XDW A;  4XBX A;  3PGB A;  1JB2 A;  3DGL A;  4BTX A;  1TRP A;  3D5I A;  3NUV A;  4J5G A;  3D9R A;  2CC3 A;  1QVG 2;  2UGI A;  3HII A;  5HGR A;  5BIR A;  1NNV A;  1RNT A;  1TJD A;  2XFT A;  3T8N A;  2WOF A;  3VGN A;  1B2S A;  4LSO A;  4X2O A;  3FF2 A;  2UUG C;  3T8U A;  1VQK 3;  1JJ2 2;  1L5G B;  3N8B A;  3MG1 A;  1TU5 A;  2WGQ A;  1OH0 A;  3Q90 A;  1BSD A;  5AEU B;  3CD6 3;  1TFK A;  4GL6 A;  2H0H A;  1BVI A;  2CFG A;  1QMA A;  1W6Y A;  2RCD A;  1YNV X;  1IT8 A;  1Q40 A;  2K3D A;  5DRE A;  3VF1 A;  3B8L A;  1RCK A;  2K0M A;  4IT7 A;  1SPU A;  2XFS A;  2BT3 A;  2ZDJ A;  2KF4 A;  3UJM A;  3UL6 A;  5M18 A;  1IVV A;  5I97 A;  2XR8 B;  4EBG A;  1JZO A;  1RRH A;  4TX4 A;  3X40 A;  1PY3 A;  4EC6 A;  1VQQ A;  3DXO A;  3MPH A;  3OV4 A;  1Q81 4;  2CIU A;  1O7W B;  4GHO A;  4KZ1 A;  1TTO A;  5G1L A;  1I0V A;  4K1V A;  4X2H A;  1BGS A;  1Q40 B;  2WO0 A;  3AGN A;  3K0Z A;  2STD A;  3CCR 3;  5KP3 A;  4CDL A;  1GS3 A;  1G0T A;  2J8X B;  3DGM A;  3OWY A;  2CHC A;  4FCZ A;  4N6T A;  3VSY A;  3ROB A;  5KP4 A;  3CMA 3;  3K9M C;  4WHA A;  1GD4 A;  3IJE B;  1B3S A;  1UDI I;  1X1W A;  3NM7 A;  1BUQ A;  1IV7 A;  1N5P A;  5CK6 A;  1OGZ A;  3EBT A;  3Q1C A;  4KT3 B;  3EB8 A;  3LTA A;  2FXT A;  1IQY A;  1GOU A;  1W2B 2;  4RNT A;  1CQS A;  3MG3 A;  4STD A;  1RSN A;  3CU3 A;  1TUH A;  3AMO B;  1N5H A;  3NQZ A;  4J9A A;  1NB5 I;  3HK4 A;  1OAC A;  1I3F A;  1BNF A;  5JPP A;  2YFJ B;  3CCV 3;  4NRE A;  1EUI C;  1FUT A;  3WA2 X;  1AVK A;  2HMN B;  1RLS A;  4IIA A;  1A67 A;  4EV2 A;  1K73 4;  4AKY A;  4R80 A;  1HU9 A;  1R4C A;  2F5W A;  2F86 B;  2W9P A;  1G96 A;  1NDO B;  1EEJ A;  1FUS A;  2HOH A;  3JVC A;  4GSP A;  2HMO B;  3LZA A;  2R4I A;  3DY5 A;  4K1U A;  2KRT A;  3CC4 3;  2INX A;  3MWZ A;  1OF5 A;  1BUJ A;  1W7C A;  2KAA A;  3Q3F A;  3NHX A;  1VQ4 3;  3SOY A;  1OPY A;  1N9E A;  5KP1 A;  1CEW I;  2LYX A;  3BND A;  3NXJ A;  1JBT A;  1PYL A;  3NX0 A;  3CCS 3;  2YFL B;  3NV0 A;  3K7C A;  3NBR A;  3X3X A;  1UUV B;  1US1 A;  1RN4 A;  3I56 3;  1VQO 3;  1X1Y A;  2XSO B;  3F8X A;  7STD A;  1VQN 3;  1X1X A;  3FG3 A;  5AII A;  4HM5 B;  2RBI A;  3G0K A;  1D6U A;  3OWU A;  1B2U A;  3V92 A;  2OTL 3;  1RDS A;  4HBR A;  1B27 A;  3WOE B;  1KSI A;  1I2E A;  1Q9E A;  1RGG A;  3KSP A;  3KII A;  3NV0 B;  4AEQ A;  3GZX B;  1A2P A;  4JRF A;  1YIJ 3;  1SIH A;  2BIR A;  2F56 A;  3F7S A;  2CWU A;  5EQL A;  3G4S 3;  1HZ1 A;  4FMB A;  7GSP A;  1FUW A;  2P05 A;  1V58 A;  1DET A;  1Q7Y 4;  3DMC A;  5IW9 A;  2CK3 H;  3AHW A;  1WMO A;  6GSP A;  1ZX2 A;  1DMN A;  3LML A;  1BNJ A;  3CCQ 3;  3WA3 A;  1AV4 A;  1AR0 A;  4MMX B;  1QJG A;  2FNQ A;  1B2Z A;  5IER A;  4R1K A;  1S5A A;  5IEN A;  1LRA A;  1UCK A;  1MGW A;  4N6U A;  3B7C A;  4WP5 A;  1I8V A;  3BIR A;  1M1X B;  2F98 A;  2B1X B;  4QWT A;  2IYJ A;  1W4N A;  1RJO A;  5ELU A;  1IQ8 A;  3FG4 A;  3GZB A;  1BAN A;  1GMQ A;  3LTC A;  1STD A;  1O7N B;  1MWR A;  1K9M 4;  3G6E 3;  1DVD A;  2GU3 A;  1N8Q A;  4HZB B;  5AIH A;  1LVN A;  3U97 A;  4BL2 A;  5GSP A;  2HML B;  6STD A;  2IY2 A;  5IF6 A;  3BU4 A;  5G2G A;  1ZS7 A;  1PFP A;  1KWI A;  1OGX A;  4FR9 A;  2B24 B;  2BMQ B;  2KF3 A;  5D82 A;  3FH1 A;  2BO9 B;  3CME 3;  4MEI A;  1OHO A;  2QEX 3;  2F5M A;  4KFE A;  2L4V A;  1DMQ A;  3E99 A;  1BRJ A;  1E3R A;  1YGE A;  1X1U A;  3F14 A;  3LH4 A;  4HM1 B;  4EYC A;  4KVH A;  3LXU X;  2E2V A;  2BMR B;  3SED A;  3CC2 3;  2CFD A;  4EXR A;  1UCI A;  1W2Z A;  2OWP A;  2H0I A;  3NBJ A;  4LZI A;  1SQW A;  1BRN L;  1VQ9 3;  3LYG A;  4O3V A;  3CCU 3;  1LOW A;  3WDG B;  2IUK A;  2H0G A;  2CWV A;  2W56 A;  2I9W A;  3MSO A;  3RDE A;  2ZL8 A;  2A15 A;  1JBR A;  4U13 A;  3F7X A;  2MC8 A;  1EG9 B;  4CPK A;  1M90 4;  3UL5 A;  1RGF A;  1DVC A;  1BRI A;  1EA2 A;  1MWS A;  2OOV C;  2XSH B;  2O3O A;  1UCJ A;  4KFF A;  5AIF A;  1YIT 3;  1T5Y A;  2AAD A;  4MMZ B;  1SAR A;  3FSD A;  2QIY A;  2SAR A;  1QAK A;  1BNR A;  3STD A;  4N6N B;  3SVA A;  1BSC A;  2IUJ A;  1W5Z A;  3H3H A;  5IG3 A;  2OTJ 3;  1A2V A;  2UX0 A;  3MKI A;  1VQP 3;  1I2F A;  4HYZ A;  2AAE A;  2CG0 A;  1DE3 A;  3CXC 2;  8CHO A;  5CF1 A;  1T2H A;  4CJN A;  2IMJ A;  1IYY A;  2Z6B A;  1GMR A;  4XM4 A;  1IVX A;  2XGL A;  1NJI 4;  1B21 A;  1ZO2 A;  3SX1 A;  2P38 A;  4HOH A;  2GEX A;  5ELJ A;  1WQL B;  1FGM A;  2GXF A;  2WGO A;  3BLZ A;  3QRD A;  3JUO A;  1YVB I;  1S72 3;  1FGQ A;  3S5C A;  3KCH A;  3U1W A;  3D5G A;  1YI2 3;  1VQ5 3;  3LT9 A;  1U8C B;  3B4P A;  3Q2P A;  4N3V A;  2SBL A;  1PU4 A;  1V74 A;  5IEP A;  1EQK A;  3KSE D;  3OWS A;  5BXQ A;  2RGQ A;  2RSX A;  3L0R A;  1G02 A;  5M1A A;  2WOH A;  2GBX B;  1ROA A;  4BL3 A;  2CFK A;  1FZU A;  1RN1 A;  1AVL A;  1BSE A;  3EE1 A;  5BVB A;  5JPU A;  4BU4 A;  1BOX A;  2BNG A;  4JF8 A;  5CLK A;  4I4K A;  5EVH A;  3UNL A;  1FYS A;  3FG1 A;  4O02 B;  5M19 A;  1I0X A;  4FCJ A;  4N6O B;  2F99 A;  3ALA A;  3EN8 A;  2C11 A;  1RCL A;  4HM2 B;  3OW2 2;  1FGO A;  3D4A A;  1WNH A;  1LOX A;  1ROV A;  1HKX A;  2BMO B;  2C10 A;  2PZV A;  3LTD A;  3I0Y A;  3QK9 A;  4L8P A;  1JB5 A;  5IG0 A;  4BTY A;  1GYB A;  5RNT A;  1Q42 A;  2RFR A;  4XBY A;  5IEO A;  3CCE 3;  1OF5 B;  1MOL A;  1M9G A;  2JQ5 A;  4HJL B;  1W01 A;  3FF0 A;  1JN5 A;  3FCS B;  2P0M A;  2XH9 A;  5AIG A;  2BU4 A;  1JKG A;  4ILF A;  1RRL A;  1Q7H A;  3SLU A;  1BNG A;  3DZL A;  3BNE A;  3FZW A;  1UCL A;  4R9K A;  3RGA A;  2HMM B;  3F40 A;  1UI8 A;  2RNT A;  2ML6 A;  3SXX A;  1ULJ B; 
#chains in the Genus database with same CATH homology
 4H3U A;  3EJV A;  1QAF A;  3BB9 A;  2YX9 A;  4RBN A;  2D1W A;  2GU1 A;  3K63 A;  3F8H A;  3JUM A;  1D6Y A;  1NWW A;  4WWU C;  1GD3 A;  4OUQ A;  2OOV A;  3PYJ A;  4WFO A;  4N6L A;  5TGN A;  2CG1 A;  4R9L A;  4N6M A;  2OCT A;  3KZT A;  4XB5 A;  3RGR A;  3OX9 A;  1DMM A;  1IQX A;  2IA7 A;  4K61 A;  3M8C A;  4O2H A;  1SII A;  3EX9 A;  5DRV A;  1OUN A;  3GAX A;  4G1M B;  3S28 A;  4RZM A;  3GWR A;  5LC6 A;  4ZM8 A;  3PXM A;  3WOF B;  1OCV A;  5EEO A;  3DGN A;  1QAL A;  2GEY A;  5IG5 A;  3OXA A;  3CPW 2;  3CCJ 3;  3ER7 A;  2XRX B;  4LEH A;  4K90 B;  3SOA A;  1VQL 3;  3KN4 A;  4ORL A;  1GY5 A;  3DM8 A;  2W9Q A;  4BTW A;  5AYR B;  3NBB A;  1NB3 I;  1D6Z A;  2P0X A;  3CPO A;  1F8N A;  2Q07 A;  3HZP A;  5A0O B;  4KFD A;  2W04 A;  1VQ7 3;  1OHS A;  2D42 A;  3PCS A;  1LXE A;  3NQY A;  3GRD A;  3J7Y d;  2QA4 3;  2Z76 A;  1E3V A;  3IMA B;  3A76 A;  5LC7 A;  1IVU A;  2KXG A;  1RKY A;  3BNC A;  1YJ9 3;  3S29 A;  2P09 A;  3N54 B;  1J2B A;  5D81 A;  4XDV A;  2Y73 A;  1W00 A;  2Z77 A;  1MNL A;  1LNH A;  4L8O A;  2KCD A;  1GY7 A;  4WYK A;  1KQS 2;  5JBS A;  4HM8 B;  1ASK A;  2HMK B;  1TP6 A;  3IPT A;  1A90 A;  5IG4 A;  2QGU A;  3CCM 3;  2W56 B;  3FKA A;  1K41 A;  3MYT A;  4HZ9 B;  1VQ6 3;  1W02 A;  1QVF 2;  4J8T A;  2W0Q A;  3MG2 A;  3PZW A;  1FGT A;  5AEW B;  4RNY A;  4CCV A;  2E2U A;  1N8R 4;  4HM3 B;  1VQM 3;  3LT8 A;  4RNZ A;  4WYK B;  4L7K A;  2ML5 A;  4FMA A;  4N6V 0;  3EC9 A;  2CWT A;  1OHP A;  4FCM A;  3K5T A;  1UUW B;  1O7M B;  1KD1 4;  3AMO A;  4XBT A;  3G8Z A;  5D83 A;  1NU3 A;  1DYU A;  1O7H B;  1RN7 A;  3N9H A;  4EV5 A;  3DUK A;  4HVN A;  2CKF B;  1O7P B;  1VZZ A;  3FLJ A;  3S67 A;  4AKZ A;  4HKV B;  1FA3 A;  3EF8 A;  1K8A 4;  2E2T A;  3T0U A;  1VQ8 3;  1JV2 B;  1KC8 4;  4OK0 A;  1JB4 A;  3O8Y A;  1WMN A;  2PNC A;  2XGN A;  3JUP A;  1W6C A;  1IDP A;  5STD A;  1IV9 A;  3G16 A;  2CFW A;  4HM7 B;  1UW1 A;  3CCL 3;  1Q82 4;  2Y74 A;  1JNQ A;  4NHF A;  1W6G A;  2CFL A;  2Z7A A;  2OQE A;  3S27 A;  3PS8 A;  2XF3 A;  4MJD A;  2W6J H;  1CYV A;  2CH9 A;  4HM6 B;  4MMY B;  4FMD A;  3B4O A;  3EHC A;  1U5O A;  1ULI B;  3EN1 B;  3KFQ C;  5AYS C;  3KKG A;  1WMP A;  3ECF A;  3HIG A;  2O9U X;  3F9S A;  4GB5 A;  1K28 A;  3D3L A;  3DGO A;  3TDG A;  3BNB A;  1SJW A;  5CF2 A;  2W2C A;  3FGY A;  2BHM A;  1CYU A;  3CNX A;  3GZY B;  1YHQ 3;  1ISK A;  3X42 A;  1O7G B;  1Y4K A;  3WMD A;  1YJN 3;  1Z1S A;  3LTB A;  4HM4 B;  2V1L A;  3WOD G;  3X3Y A;  3G71 3;  1JN5 B;  4Q53 A;  3HX8 A;  2K54 A;  3LOY A;  1JKG B;  2CW9 A;  3HI7 A;  2LQV A;  1FGR A;  2FGT A;  3CC7 3;  1M1K 4;  5AI1 A;  2W03 A;  2XEP A;  4LGQ A;  4FMC A;  4LMI A;  4HM0 B;  1YJW 3;  5FGO A;  3JUN A;  1TFO A;  5FW5 A;  1TIJ A;  1IU7 A;  3X3Z A;  1JRQ A;  3V98 A;  3CNM A;  3JUQ A;  4R4K A;  5CXO A;  1N9J A;  1IVW A;  3GZR A;  3MHE A;  1STF I;  2JDI H;  4O8S A;  3V99 A;  2YFI B;  1EKM A;  1C7H A;  2GBW B;  1NO3 A;  2MF7 A;  3UB1 A;  2OQE C;  3EQQ B;  1A2K A;  4IPB A;  3EBY A;  4PEJ A;  1UI7 A;  1IT7 A;  1E97 A;  2M7O A;  4OVM A;  1GY6 A;  1IK3 A;  1Q86 4;  1WTH A;  2HMJ B;  4H61 A;  3H51 A;  3NM2 A;  3X41 A;  3I55 3;  3KE7 A;  4XDW A;  3PCR A;  4XBX A;  3PGB A;  1JB2 A;  3DGL A;  3NUV A;  3D9R A;  2CC3 A;  1QVG 2;  3HII A;  5HGR A;  2XFT A;  3T8N A;  2WOF A;  3VGN A;  4LSO A;  4X2O A;  3FF2 A;  3T8U A;  1VQK 3;  1JJ2 2;  1L5G B;  3N8B A;  3MG1 A;  1TU5 A;  2WGQ A;  1OH0 A;  3Q90 A;  5AEU B;  3CD6 3;  1TFK A;  4GL6 A;  2CFG A;  1QMA A;  1W6Y A;  2RCD A;  1IT8 A;  1Q40 A;  3VF1 A;  5DRE A;  3B8L A;  2K0M A;  4IT7 A;  1SPU A;  2XFS A;  2BT3 A;  2ZDJ A;  3UJM A;  3UL6 A;  1IVV A;  5I97 A;  2XR8 B;  4EBG A;  1RRH A;  4TX4 A;  3X40 A;  4EC6 A;  3DXO A;  3MPH A;  3OV4 A;  1Q81 4;  2CIU A;  1O7W B;  4KZ1 A;  4K1V A;  4X2H A;  1Q40 B;  2WO0 A;  3K0Z A;  3CCR 3;  2STD A;  5KP3 A;  4CDL A;  1GS3 A;  3OWY A;  3DGM A;  2CHC A;  4FCZ A;  4N6T A;  3VSY A;  3ROB A;  5KP4 A;  3CMA 3;  3K9M C;  4WHA A;  1GD4 A;  3IJE B;  3NM7 A;  1BUQ A;  1IV7 A;  1N5P A;  5CK6 A;  1OGZ A;  3EBT A;  3Q1C A;  3EB8 A;  3LTA A;  2FXT A;  1IQY A;  1W2B 2;  1CQS A;  3MG3 A;  4STD A;  3CU3 A;  1TUH A;  3AMO B;  1N5H A;  3NQZ A;  4J9A A;  1NB5 I;  3HK4 A;  1OAC A;  5JPP A;  2YFJ B;  3CCV 3;  4NRE A;  3WA2 X;  1AVK A;  2HMN B;  4IIA A;  1A67 A;  4EV2 A;  1K73 4;  4AKY A;  4R80 A;  1HU9 A;  1R4C A;  2W9P A;  2F86 B;  1G96 A;  1NDO B;  3JVC A;  2HMO B;  3LZA A;  2R4I A;  3DY5 A;  4K1U A;  2KRT A;  3CC4 3;  2INX A;  3MWZ A;  1OF5 A;  1W7C A;  3NHX A;  1VQ4 3;  3SOY A;  1OPY A;  1N9E A;  5KP1 A;  1CEW I;  2LYX A;  3BND A;  3NXJ A;  3NX0 A;  3CCS 3;  2YFL B;  3NV0 A;  3K7C A;  3NBR A;  3X3X A;  1UUV B;  1US1 A;  3I56 3;  1VQO 3;  2XSO B;  3F8X A;  7STD A;  1VQN 3;  3FG3 A;  5AII A;  4HM5 B;  3G0K A;  1D6U A;  3OWU A;  3V92 A;  2OTL 3;  4HBR A;  3WOE B;  1KSI A;  3KSP A;  3NV0 B;  3KII A;  4AEQ A;  3GZX B;  4JRF A;  1SIH A;  3F7S A;  2CWU A;  5EQL A;  3G4S 3;  4FMB A;  1FUW A;  2P05 A;  1Q7Y 4;  3DMC A;  5IW9 A;  2CK3 H;  1WMO A;  1ZX2 A;  1DMN A;  3LML A;  3CCQ 3;  3WA3 A;  1AV4 A;  1AR0 A;  4MMX B;  2FNQ A;  1QJG A;  5IER A;  4R1K A;  1S5A A;  5IEN A;  4N6U A;  3B7C A;  4WP5 A;  1M1X B;  2F98 A;  2B1X B;  4QWT A;  1W4N A;  1RJO A;  5ELU A;  1IQ8 A;  3FG4 A;  3GZB A;  3LTC A;  1STD A;  1O7N B;  1K9M 4;  3G6E 3;  1DVD A;  2GU3 A;  1N8Q A;  4HZB B;  5AIH A;  1LVN A;  3U97 A;  2HML B;  6STD A;  5IF6 A;  5G2G A;  1PFP A;  1KWI A;  1OGX A;  4FR9 A;  2B24 B;  2BMQ B;  5D82 A;  3FH1 A;  2BO9 B;  3CME 3;  4MEI A;  1OHO A;  2QEX 3;  4KFE A;  2L4V A;  1DMQ A;  3E99 A;  3F14 A;  1E3R A;  1YGE A;  3LH4 A;  4EYC A;  4HM1 B;  4KVH A;  3LXU X;  2E2V A;  2BMR B;  3SED A;  3CC2 3;  2CFD A;  4EXR A;  1W2Z A;  3NBJ A;  2OWP A;  1YIJ 3;  1VQ9 3;  4LZI A;  1SQW A;  3LYG A;  4O3V A;  3CCU 3;  3WDG B;  2IUK A;  2CWV A;  2W56 A;  2I9W A;  3MSO A;  3RDE A;  2ZL8 A;  2A15 A;  4U13 A;  3F7X A;  2MC8 A;  1EG9 B;  1M90 4;  3UL5 A;  1DVC A;  1EA2 A;  2OOV C;  2XSH B;  2O3O A;  5AIF A;  4KFF A;  1YIT 3;  1T5Y A;  4MMZ B;  3FSD A;  2QIY A;  1QAK A;  3STD A;  4N6N B;  3SVA A;  2IUJ A;  1W5Z A;  3H3H A;  5IG3 A;  2OTJ 3;  1A2V A;  2UX0 A;  3MKI A;  1VQP 3;  4HYZ A;  2CG0 A;  3CXC 2;  8CHO A;  5CF1 A;  2IMJ A;  2Z6B A;  4XM4 A;  1IVX A;  2XGL A;  1NJI 4;  1ZO2 A;  3SX1 A;  2P38 A;  2GEX A;  5ELJ A;  1WQL B;  1FGM A;  2GXF A;  2WGO A;  3BLZ A;  3QRD A;  3JUO A;  1YVB I;  1S72 3;  1FGQ A;  3S5C A;  3U1W A;  1VQ5 3;  1YI2 3;  3LT9 A;  1U8C B;  3B4P A;  3Q2P A;  4N3V A;  2SBL A;  1PU4 A;  1V74 A;  5IEP A;  1EQK A;  3KSE D;  3OWS A;  5BXQ A;  2RGQ A;  2RSX A;  3L0R A;  2WOH A;  2GBX B;  1ROA A;  2CFK A;  1AVL A;  3EE1 A;  5BVB A;  5JPU A;  2BNG A;  4JF8 A;  5CLK A;  4I4K A;  5EVH A;  3UNL A;  4O02 B;  3FG1 A;  4FCJ A;  4N6O B;  2F99 A;  3ALA A;  3EN8 A;  2C11 A;  4HM2 B;  3OW2 2;  1FGO A;  1WNH A;  1LOX A;  2PZV A;  1ROV A;  1HKX A;  2BMO B;  2C10 A;  3LTD A;  3I0Y A;  3QK9 A;  4L8P A;  1JB5 A;  5IG0 A;  4BTY A;  1GYB A;  2RFR A;  1Q42 A;  4XBY A;  5IEO A;  3CCE 3;  1OF5 B;  1MOL A;  1M9G A;  2JQ5 A;  4HJL B;  1W01 A;  3FF0 A;  1JN5 A;  3FCS B;  2P0M A;  2XH9 A;  5AIG A;  1JKG A;  3SLU A;  1RRL A;  3DZL A;  3BNE A;  3FZW A;  4R9K A;  3RGA A;  2HMM B;  3F40 A;  1UI8 A;  4BTX A;  2ML6 A;  3SXX A;  1ULJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...