3LTGD

Crystal structure of the drosophila epidermal growth factor receptor ectodomain complexed with a low affinity spitz mutant
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
FPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for negative cooperativity in growth factor binding to an EGF receptor.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase/transferase regulator
molecule keywords Epidermal growth factor receptor
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3ltgD00
6COXA 1CVWL 1X7AL 1TLEA 1KIGL 1A3PA 2FZZL 1HCGB 3LTGD 3TZIA 4Y71B 1KLIL 3IJEB 3P5BL 4RS0A 1DIYA 3ELAL 2ADXA 1M1XB 2RNLA 1QFKL 2I9AA 4BXWA 3M37L 4JZFL 3N8WA 1HZ8A 1LMJA 2WG3C 5COXA 3KK6A 1Z6EL 2AYLA 1P0SL 2FLGA 1EQHA 1MQ5L 3EGFA 5CKMA 4NA9L 2W2OE 4C16A 1LPZA 1G1QA 2BO2A 5FDQA 1UZKA 2WPHE 1UZPA 5JB8E 4TGFA 1SZBA 1HT8A 2RA0L 1HREA 3GCXE 4CUDA 1PRHA 1W8BL 1TOZA 4D0FA 1DQBA 2EI8B 3SOQA 4RRZA 1IQIL 4LMFA 1XKAL 5F19A 3N8YB 3KRKA 1N7DA 3LN1A 2VVUL 1IQFL 2XBWL 3FCSB 3OLUA 4BTUA 4D0EA 2Y5FL 4Y79B 2VWMK 4JYUL 1CCFA 5JVZA 2W2QE 4FM5A 5KN5C 4NGAL 1WU1B 2BQWA 1IQNL 4ZXXL 1PGEA 1ATBA 1EMOA 2PR3B 1HAEA 2Y5HL 1CQEA 1IVOC 2PHBB 1HT5A 1IGZA 5EGMB 2Y7XB 1APOA 4MMYB 3KQEL 4ZAEB 1ATDA 2Y5GL 1NZIA 2CJIB 1F0RB 4MMXB 1EPHA 2TGFA 3LC5B 3POYA 3ZYGA 3CS7L 4ZHAB 1WHFA 2VH0B 2W86A 1Q4GA 1CX2A 4CUFA 1JL9A 2D1JB 1IQML 4ISIL 3F1SB 4Y7AB 2KV4A 1EPJA 1EGFA 1DVAL 3HPTA 3HO5A 2XC4L 3LC3B 2VVVL 3BT2A 1JV2B 3KQDL 1L5GB 2BOXA 1IQGL 2Y81B 3H5CB 3ENSA 2RHPA 3GCWE 2P3FN 2WYGB 4LORA 3KQBL 1OB1C 2NPRA 3NJPC 3HS5A 3NTBA 3LIWB 1KLJL 4JZDL 2J34B 3LN0A 2J2UB 4JYVL 2VWOL 2Y80B 1EMNA 3NTGA 4BDWA 3QMOA 1RFNB 1UZJA 5CISA 4BXSA 3ZYIB 3TBDA 2J38B 2M74A 4XL1A 1HJ7A 1IQKL 2MHPA 1YGCL 1NFWB 2XBXL 1EPIA 5E8DA 1HRFA 4X8TL 4COXA 1FAKL 1TPGA 1YO8A 3FFGL 1IQEL 1J9CL 1K37A 1PFXL 4M10A 1NFXB 5JW1A 2P93L 1CEJA 4CUEA 2DDUA 4X8UL 4YT6L 1FFMA 3LAQA 3GISX 3TK6B 1V3XB 4YZUB 1G2MB 1ZAQA 3TK5B 3ZYJB 1PXXA 2EI6B 3F6UL 1NQLB 1ATAA 4NG9L 1FSBA 1IOEL 1FE2A 4PH9A 2UWLB 3BPSE 5JVYA 4RRXA 4XLWA 1IOXA 2W3KB 1GK5A 2J95B 4XBMA 3QH0A 4CSYA 4O02B 4D90A 1UZQA 1N1IA 4ISHL 2P26A 3U7UG 5JBCE 3V65B 3HO4A 3RR3A 1AUTL 3CFWA 2OYUP 3TGFA 2KL7A 1HX2A 2WFTA 1PTHA 2BMGA 5JB9E 2I9BA 2FD6A 4ZH8B 1XKBA 2WFXB 3QCWA 2VWNL 3LTFB 1Z6CA 4OTYA 2P3FL 1XFEA 2G00L 2W26B 1G2LB 3HO3A 2XC0L 3KQCL 3NT1A 4Z0KB 5L2YL 3R05A 2UWPB 3FBYA 3CENL 1WHEA 1NFUB 2BOUA 2Y7ZB 3TH3L 2XBVL 3ASIA 3M36L 3N8YA 2H9EL 2EI7B 1ATEA 4Z0LA 2F9BL 4RRWA 3SW2A 2WPKE 1G1SA 2FLBL 4BTTA 1EQGA 3SOVA 3CA7A 1FF7A 1MQ6L 1EZQB 1CVUA 1CCVA 4MMZB 4X8SL 2K2TA 3V64C 2K2SB 3Q7DA 2P3TA 1KSNB 2XBYL 4ZXYL 1FAXL 1NT0A 2GD4A 2MGRA 2W2PE 3N8XA 2VJ3A 2WYJB 2YGPA 5KIRA 2W3IB 3N8VA 5JBAE 1I0UA 1O5DL 3N8ZA 1JBUL 1K36A 4Y7BB 3KL6B 4YT7L 1IQJL 1W7XL 1IGXA 1U67A 2WPLE 2OYEP 5CKNA 5I46L 2PUQL 4O1ZA 2WPME 2FLRL 1DX5I 1NFYB 5K0HB 2BOHA 3MDLA 1NPEB 1G1TA 3HS7A 1HAFA 1YUKB 2J4IB 3IITB 2P3UA 1IQHL 4X8VL 4Z6AL 1FJSL 1YUGA 1DDXA 4M11A 2BQ6A 5L2ZL 1IP0A 4G1MB 4AQTA 2VWLL 3C9AC 1XDTR 4Y76B 3U73A 1APQA 3N8WB 4Y6DB 2WG4B 4BTIA 2BZ6L 1LPGA 2BQ7A 1IQLL 4OTJA 2B7DL 2JKHL 5IKQA 1F7MA 2P95L 5IKRA 5JBBE 2P16L 1KLOA 1C5MF 1P9JA 1F7EA 4RUTA 2Y82B 5IKTA 2WPJE 5IKVA 1EBVA 3KCGL 3OLTA 3BT1A 1L3YA 3PGHA 2KB9A 2Y38A 1IJQA 1URKA 4A7IA 2MGPA 1F0SB 4E1GA 1EAIC 5CKQA 2XC5L 1EPGA 2VH6B 1B9WA 1LQDA 2UWOB 1U8CB 2BOKL 4RRYA 2W2NE 5F1AA 2J94B 2P28B 3DEMA 3SOBB 2WPIE 2Q1JB 3K9XA 1YUFA 2YGOA 2W2ME 4BDXA 1G1RA 2VVCK 1LPKA 2P94L 3HS6A 5L30L 1BF9A 3Q3KB 1MOXC 3MQEA 1COUA 1ADXA 4JZEL
chains in the Genus database with same CATH superfamily
6COXA 1CVWL 1X7AL 1TLEA 1KIGL 1A3PA 2FZZL 1HCGB 3LTGD 3TZIA 4Y71B 1KLIL 3IJEB 3P5BL 4RS0A 1DIYA 3ELAL 2ADXA 1M1XB 2RNLA 1QFKL 2I9AA 4BXWA 3M37L 4JZFL 3N8WA 1HZ8A 1LMJA 2WG3C 5COXA 3KK6A 1Z6EL 2AYLA 1P0SL 4A94C 2FLGA 1EQHA 1MQ5L 3EGFA 5CKMA 4NA9L 2W2OE 4C16A 1LPZA 1G1QA 2BO2A 2H9EC 5FDQA 1UZKA 2WPHE 1UZPA 5JB8E 4TGFA 1SZBA 1HT8A 2RA0L 1HREA 3GCXE 4CUDA 1PRHA 1W8BL 1TOZA 4D0FA 1DQBA 2EI8B 3SOQA 4RRZA 1IQIL 4LMFA 1XKAL 5F19A 3N8YB 2KNIA 3KRKA 1N7DA 3LN1A 2VRSA 2VVUL 1IQFL 2XBWL 3FCSB 3OLUA 4BTUA 4D0EA 2Y5FL 4Y79B 2VWMK 4JYUL 1CCFA 5JVZA 2W2QE 4FM5A 5KN5C 4NGAL 1WU1B 2BQWA 1IQNL 4ZXXL 1PGEA 1ATBA 1EMOA 2PR3B 1HAEA 2Y5HL 1CQEA 1IVOC 2PHBB 1HT5A 1IGZA 5EGMB 2Y7XB 1V1HA 1APOA 4MMYB 3KQEL 4GU3A 4ZAEB 1ATDA 2Y5GL 1NZIA 2CJIB 1F0RB 4MMXB 1EPHA 2TGFA 3LC5B 3POYA 3ZYGA 3CS7L 4ZHAB 1WHFA 2VH0B 2W86A 1Q4GA 2BT8A 1CX2A 4CUFA 1JL9A 2D1JB 1IQML 4ISIL 3F1SB 4Y7AB 2KV4A 1EPJA 1EGFA 1DVAL 3HPTA 3HO5A 2JJLA 2XC4L 3LC3B 2VVVL 3BT2A 1JV2B 3KQDL 1L5GB 2BOXA 1IQGL 2Y81B 3H5CB 3ENSA 2RHPA 3GCWE 2P3FN 2WYGB 4LORA 3KQBL 1OB1C 2NPRA 3NJPC 3HS5A 3NTBA 3LIWB 1KLJL 4JZDL 2J34B 3LN0A 2J2UB 4JYVL 2VWOL 2Y80B 1EMNA 3NTGA 4BDWA 3QMOA 1RFNB 1UZJA 5CISA 4BXSA 3ZYIB 3TBDA 2J38B 2M74A 4XL1A 1HJ7A 1IQKL 2MHPA 1YGCL 1NFWB 2XBXL 1EPIA 5E8DA 1HRFA 4X8TL 4COXA 1FAKL 1TPGA 1YO8A 3FFGL 2HORA 1IQEL 1J9CL 1K37A 1PFXL 4M10A 1NFXB 5JW1A 2P93L 1CEJA 4CUEA 2DDUA 4X8UL 4YT6L 1FFMA 3LAQA 3GISX 3TK6B 1V3XB 4YZUB 1G2MB 1ZAQA 3TK5B 3ZYJB 1PXXA 2EI6B 2WZPP 3F6UL 1NQLB 1ATAA 4NG9L 1FSBA 1IOEL 1FE2A 4PH9A 2UWLB 3BPSE 5JVYA 4RRXA 4XLWA 1IOXA 2W3KB 1GK5A 2J95B 4XBMA 3QH0A 4CSYA 4O02B 4D90A 1UZQA 1N1IA 3S6XA 4ISHL 2P26A 3U7UG 5JBCE 3V65B 3HO4A 3RR3A 1AUTL 3CFWA 2OYUP 3TGFA 2KL7A 1HX2A 2WFTA 1PTHA 2BMGA 5JB9E 2I9BA 2FD6A 4ZH8B 1XKBA 2WFXB 3QCWA 2VWNL 3LTFB 1Z6CA 4OTYA 2P3FL 1XFEA 2G00L 2W26B 1G2LB 3HO3A 2XC0L 3KQCL 3NT1A 4Z0KB 5L2YL 3R05A 2UWPB 3FBYA 3CENL 1WHEA 1NFUB 2BOUA 2Y7ZB 3TH3L 2XBVL 3ASIA 3M36L 3N8YA 2H9EL 2EI7B 1ATEA 4Z0LA 2F9BL 4RRWA 3SW2A 2WPKE 1G1SA 2FLBL 4BTTA 1EQGA 1QIUA 3CA7A 3SOVA 1FF7A 1MQ6L 1EZQB 1CVUA 1V1IA 1CCVA 4MMZB 4X8SL 2K2TA 3V64C 2K2SB 3Q7DA 2P3TA 1KSNB 2XBYL 4ZXYL 1FAXL 1NT0A 2BT7A 2GD4A 2MGRA 2W2PE 3N8XA 2VJ3A 2WYJB 2YGPA 5KIRA 2W3IB 3N8VA 5JBAE 1I0UA 1O5DL 3N8ZA 1JBUL 1LK9A 1K36A 1LMMA 4Y7BB 3KL6B 4YT7L 1IQJL 1W7XL 1IGXA 1U67A 2WPLE 2OYEP 5CKNA 5I46L 2PUQL 4O1ZA 2WPME 2FLRL 1DX5I 1NFYB 5K0HB 2BOHA 3MDLA 1NPEB 1G1TA 3HS7A 1HAFA 1KKEA 1YUKB 2BSFA 2J4IB 3IITB 2P3UA 1IQHL 4X8VL 4Z6AL 1FJSL 1YUGA 2HOXA 1DDXA 4M11A 2BQ6A 5L2ZL 1IP0A 4G1MB 4AQTA 2VWLL 3C9AC 1XDTR 4Y76B 3U73A 1APQA 3N8WB 4Y6DB 2WG4B 4BTIA 2BZ6L 1LPGA 2BQ7A 1IQLL 4OTJA 2B7DL 2JKHL 5IKQA 1F7MA 2P95L 5IKRA 5JBBE 2P16L 1KLOA 1C5MF 1P9JA 1F7EA 4RUTA 2Y82B 5IKTA 2WPJE 5IKVA 1EBVA 3KCGL 3OLTA 4GU4A 2YGQA 3BT1A 1L3YA 3PGHA 2KB9A 2Y38A 1IJQA 1URKA 4A7IA 2MGPA 1F0SB 4E1GA 1EAIC 5CKQA 2XC5L 1EPGA 2VH6B 1B9WA 1LQDA 2UWOB 1U8CB 2BOKL 4RRYA 2W2NE 5F1AA 2J94B 2P28B 3DEMA 3SOBB 2WPIE 2Q1JB 3K9XA 1YUFA 2YGOA 2W2ME 4BDXA 1G1RA 2VVCK 1LPKA 2P94L 3HS6A 5L30L 1BF9A 3Q3KB 1MOXC 3MQEA 1COUA 1ADXA 4JZEL
chains in the Genus database with same CATH topology
6COXA 1CVWL 1X7AL 1TLEA 1KIGL 1A3PA 2FZZL 1HCGB 3LTGD 3TZIA 4Y71B 1KLIL 3IJEB 3P5BL 4RS0A 1DIYA 3ELAL 2ADXA 1M1XB 2RNLA 1QFKL 2I9AA 4BXWA 3M37L 4JZFL 3N8WA 1HZ8A 1LMJA 2WG3C 5COXA 3KK6A 1Z6EL 2AYLA 1P0SL 4A94C 2FLGA 1EQHA 1MQ5L 3EGFA 5CKMA 4NA9L 2W2OE 4C16A 1LPZA 1G1QA 2BO2A 2H9EC 5FDQA 1UZKA 2WPHE 1UZPA 5JB8E 4TGFA 1SZBA 1HT8A 2RA0L 1HREA 3GCXE 4CUDA 1PRHA 1W8BL 1TOZA 4D0FA 1DQBA 2EI8B 3SOQA 4RRZA 1IQIL 4LMFA 1XKAL 5F19A 3N8YB 2KNIA 3KRKA 1N7DA 3LN1A 2VVUL 1IQFL 2XBWL 3FCSB 3OLUA 4BTUA 4D0EA 2Y5FL 4Y79B 2VWMK 4JYUL 1CCFA 5JVZA 2W2QE 4FM5A 5KN5C 4NGAL 1WU1B 2BQWA 1IQNL 4ZXXL 1PGEA 1ATBA 1EMOA 2PR3B 1HAEA 2Y5HL 1CQEA 1IVOC 2PHBB 1HT5A 1IGZA 5EGMB 2Y7XB 1APOA 4MMYB 3KQEL 4ZAEB 1ATDA 2Y5GL 1NZIA 2CJIB 1F0RB 4MMXB 1EPHA 2TGFA 3LC5B 3POYA 3ZYGA 3CS7L 4ZHAB 1WHFA 2VH0B 2W86A 1Q4GA 1CX2A 4CUFA 1JL9A 2D1JB 1IQML 4ISIL 3F1SB 4Y7AB 2KV4A 1EPJA 1EGFA 1DVAL 3HPTA 3HO5A 2XC4L 3LC3B 2VVVL 3BT2A 1JV2B 3KQDL 1L5GB 2BOXA 1IQGL 2Y81B 3H5CB 3ENSA 2RHPA 3GCWE 2P3FN 2WYGB 4LORA 3KQBL 1OB1C 2NPRA 3NJPC 3HS5A 3NTBA 3LIWB 1KLJL 4JZDL 2J34B 3LN0A 2J2UB 4JYVL 2VWOL 2Y80B 1EMNA 3NTGA 4BDWA 3QMOA 1RFNB 1UZJA 5CISA 4BXSA 3ZYIB 3TBDA 2J38B 2M74A 4XL1A 1HJ7A 1IQKL 2MHPA 1YGCL 1NFWB 2XBXL 1EPIA 5E8DA 1HRFA 4X8TL 4COXA 1FAKL 1TPGA 1YO8A 3FFGL 1IQEL 1J9CL 1K37A 1PFXL 4M10A 1NFXB 5JW1A 2P93L 1CEJA 4CUEA 2DDUA 4X8UL 4YT6L 1FFMA 3LAQA 3GISX 3TK6B 1V3XB 4YZUB 1G2MB 1ZAQA 3TK5B 3ZYJB 1PXXA 2EI6B 2WZPP 3F6UL 1NQLB 1ATAA 4NG9L 1FSBA 1IOEL 1FE2A 4PH9A 2UWLB 3BPSE 5JVYA 4RRXA 4XLWA 1IOXA 2W3KB 1GK5A 2J95B 4XBMA 3QH0A 4CSYA 4O02B 4D90A 1UZQA 1N1IA 3S6XA 4ISHL 2P26A 3U7UG 5JBCE 3V65B 3HO4A 3RR3A 1AUTL 3CFWA 2OYUP 3TGFA 2KL7A 1HX2A 2WFTA 1PTHA 2BMGA 5JB9E 2I9BA 2FD6A 4ZH8B 1XKBA 2WFXB 3QCWA 2VWNL 3LTFB 1Z6CA 4OTYA 2P3FL 1XFEA 2G00L 2W26B 1G2LB 3HO3A 2XC0L 3KQCL 3NT1A 4Z0KB 5L2YL 3R05A 2UWPB 3FBYA 3CENL 1WHEA 1NFUB 2BOUA 2Y7ZB 3TH3L 2XBVL 3ASIA 3M36L 3N8YA 2H9EL 2EI7B 1ATEA 4Z0LA 2F9BL 4RRWA 3SW2A 2WPKE 1G1SA 2FLBL 4BTTA 1EQGA 3SOVA 3CA7A 1FF7A 1MQ6L 1EZQB 1CVUA 1CCVA 4MMZB 4X8SL 2K2TA 3V64C 2K2SB 3Q7DA 2P3TA 1KSNB 2XBYL 4ZXYL 1FAXL 1NT0A 2GD4A 2MGRA 2W2PE 3N8XA 2VJ3A 2WYJB 2YGPA 5KIRA 2W3IB 3N8VA 5JBAE 1I0UA 1O5DL 3N8ZA 1JBUL 1K36A 1LMMA 4Y7BB 3KL6B 4YT7L 1IQJL 1W7XL 1IGXA 1U67A 2WPLE 2OYEP 5CKNA 5I46L 2PUQL 4O1ZA 2WPME 2FLRL 1DX5I 1NFYB 5K0HB 2BOHA 3MDLA 1NPEB 1G1TA 3HS7A 1HAFA 1YUKB 2J4IB 3IITB 2P3UA 1IQHL 4X8VL 4Z6AL 1FJSL 1YUGA 1DDXA 4M11A 2BQ6A 5L2ZL 1IP0A 4G1MB 4AQTA 2VWLL 3C9AC 1XDTR 4Y76B 3U73A 1APQA 3N8WB 4Y6DB 2WG4B 4BTIA 2BZ6L 1LPGA 2BQ7A 1IQLL 4OTJA 2B7DL 2JKHL 5IKQA 1F7MA 2P95L 5IKRA 5JBBE 2P16L 1KLOA 1C5MF 1P9JA 1F7EA 4RUTA 2Y82B 5IKTA 2WPJE 5IKVA 1EBVA 3KCGL 3OLTA 2YGQA 3BT1A 1L3YA 3PGHA 2KB9A 2Y38A 1IJQA 1URKA 4A7IA 2MGPA 1F0SB 4E1GA 1EAIC 5CKQA 2XC5L 1EPGA 2VH6B 1B9WA 1LQDA 2UWOB 1U8CB 2BOKL 4RRYA 2W2NE 5F1AA 2J94B 2P28B 3DEMA 3SOBB 2WPIE 2Q1JB 3K9XA 1YUFA 2YGOA 2W2ME 4BDXA 1G1RA 2VVCK 1LPKA 2P94L 3HS6A 5L30L 1BF9A 3Q3KB 1MOXC 3MQEA 1COUA 1ADXA 4JZEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6COX A;  1CVW L;  1X7A L;  1TLE A;  1KIG L;  1A3P A;  2FZZ L;  1HCG B;  3LTG D;  3TZI A;  4Y71 B;  1KLI L;  3IJE B;  3P5B L;  4RS0 A;  1DIY A;  3ELA L;  2ADX A;  1M1X B;  2RNL A;  1QFK L;  2I9A A;  4BXW A;  3M37 L;  4JZF L;  3N8W A;  1HZ8 A;  1LMJ A;  2WG3 C;  5COX A;  3KK6 A;  1Z6E L;  2AYL A;  1P0S L;  2FLG A;  1EQH A;  1MQ5 L;  3EGF A;  5CKM A;  4NA9 L;  2W2O E;  4C16 A;  1LPZ A;  1G1Q A;  2BO2 A;  5FDQ A;  1UZK A;  2WPH E;  1UZP A;  5JB8 E;  4TGF A;  1SZB A;  1HT8 A;  2RA0 L;  1HRE A;  3GCX E;  4CUD A;  1PRH A;  1W8B L;  1TOZ A;  4D0F A;  1DQB A;  2EI8 B;  3SOQ A;  4RRZ A;  1IQI L;  4LMF A;  1XKA L;  5F19 A;  3N8Y B;  3KRK A;  1N7D A;  3LN1 A;  2VVU L;  1IQF L;  2XBW L;  3FCS B;  3OLU A;  4BTU A;  4D0E A;  2Y5F L;  4Y79 B;  2VWM K;  4JYU L;  1CCF A;  5JVZ A;  2W2Q E;  4FM5 A;  5KN5 C;  4NGA L;  1WU1 B;  2BQW A;  1IQN L;  4ZXX L;  1PGE A;  1ATB A;  1EMO A;  2PR3 B;  1HAE A;  2Y5H L;  1CQE A;  1IVO C;  2PHB B;  1HT5 A;  1IGZ A;  5EGM B;  2Y7X B;  1APO A;  4MMY B;  3KQE L;  4ZAE B;  1ATD A;  2Y5G L;  1NZI A;  2CJI B;  1F0R B;  4MMX B;  1EPH A;  2TGF A;  3LC5 B;  3POY A;  3ZYG A;  3CS7 L;  4ZHA B;  1WHF A;  2VH0 B;  2W86 A;  1Q4G A;  1CX2 A;  4CUF A;  1JL9 A;  2D1J B;  1IQM L;  4ISI L;  3F1S B;  4Y7A B;  2KV4 A;  1EPJ A;  1EGF A;  1DVA L;  3HPT A;  3HO5 A;  2XC4 L;  3LC3 B;  2VVV L;  3BT2 A;  1JV2 B;  3KQD L;  1L5G B;  2BOX A;  1IQG L;  2Y81 B;  3H5C B;  3ENS A;  2RHP A;  3GCW E;  2P3F N;  2WYG B;  4LOR A;  3KQB L;  1OB1 C;  2NPR A;  3NJP C;  3HS5 A;  3NTB A;  3LIW B;  1KLJ L;  4JZD L;  2J34 B;  3LN0 A;  2J2U B;  4JYV L;  2VWO L;  2Y80 B;  1EMN A;  3NTG A;  4BDW A;  3QMO A;  1RFN B;  1UZJ A;  5CIS A;  4BXS A;  3ZYI B;  3TBD A;  2J38 B;  2M74 A;  4XL1 A;  1HJ7 A;  1IQK L;  2MHP A;  1YGC L;  1NFW B;  2XBX L;  1EPI A;  5E8D A;  1HRF A;  4X8T L;  4COX A;  1FAK L;  1TPG A;  1YO8 A;  3FFG L;  1IQE L;  1J9C L;  1K37 A;  1PFX L;  4M10 A;  1NFX B;  5JW1 A;  2P93 L;  1CEJ A;  4CUE A;  2DDU A;  4X8U L;  4YT6 L;  1FFM A;  3LAQ A;  3GIS X;  3TK6 B;  1V3X B;  4YZU B;  1G2M B;  1ZAQ A;  3TK5 B;  3ZYJ B;  1PXX A;  2EI6 B;  3F6U L;  1NQL B;  1ATA A;  4NG9 L;  1FSB A;  1IOE L;  1FE2 A;  4PH9 A;  2UWL B;  3BPS E;  5JVY A;  4RRX A;  4XLW A;  1IOX A;  2W3K B;  1GK5 A;  2J95 B;  4XBM A;  3QH0 A;  4CSY A;  4O02 B;  4D90 A;  1UZQ A;  1N1I A;  4ISH L;  2P26 A;  3U7U G;  5JBC E;  3V65 B;  3HO4 A;  3RR3 A;  1AUT L;  3CFW A;  2OYU P;  3TGF A;  2KL7 A;  1HX2 A;  2WFT A;  1PTH A;  2BMG A;  5JB9 E;  2I9B A;  2FD6 A;  4ZH8 B;  1XKB A;  2WFX B;  3QCW A;  2VWN L;  3LTF B;  1Z6C A;  4OTY A;  2P3F L;  1XFE A;  2G00 L;  2W26 B;  1G2L B;  3HO3 A;  2XC0 L;  3KQC L;  3NT1 A;  4Z0K B;  5L2Y L;  3R05 A;  2UWP B;  3FBY A;  3CEN L;  1WHE A;  1NFU B;  2BOU A;  2Y7Z B;  3TH3 L;  2XBV L;  3ASI A;  3M36 L;  3N8Y A;  2H9E L;  2EI7 B;  1ATE A;  4Z0L A;  2F9B L;  4RRW A;  3SW2 A;  2WPK E;  1G1S A;  2FLB L;  4BTT A;  1EQG A;  3SOV A;  3CA7 A;  1FF7 A;  1MQ6 L;  1EZQ B;  1CVU A;  1CCV A;  4MMZ B;  4X8S L;  2K2T A;  3V64 C;  2K2S B;  3Q7D A;  2P3T A;  1KSN B;  2XBY L;  4ZXY L;  1FAX L;  1NT0 A;  2GD4 A;  2MGR A;  2W2P E;  3N8X A;  2VJ3 A;  2WYJ B;  2YGP A;  5KIR A;  2W3I B;  3N8V A;  5JBA E;  1I0U A;  1O5D L;  3N8Z A;  1JBU L;  1K36 A;  4Y7B B;  3KL6 B;  4YT7 L;  1IQJ L;  1W7X L;  1IGX A;  1U67 A;  2WPL E;  2OYE P;  5CKN A;  5I46 L;  2PUQ L;  4O1Z A;  2WPM E;  2FLR L;  1DX5 I;  1NFY B;  5K0H B;  2BOH A;  3MDL A;  1NPE B;  1G1T A;  3HS7 A;  1HAF A;  1YUK B;  2J4I B;  3IIT B;  2P3U A;  1IQH L;  4X8V L;  4Z6A L;  1FJS L;  1YUG A;  1DDX A;  4M11 A;  2BQ6 A;  5L2Z L;  1IP0 A;  4G1M B;  4AQT A;  2VWL L;  3C9A C;  1XDT R;  4Y76 B;  3U73 A;  1APQ A;  3N8W B;  4Y6D B;  2WG4 B;  4BTI A;  2BZ6 L;  1LPG A;  2BQ7 A;  1IQL L;  4OTJ A;  2B7D L;  2JKH L;  5IKQ A;  1F7M A;  2P95 L;  5IKR A;  5JBB E;  2P16 L;  1KLO A;  1C5M F;  1P9J A;  1F7E A;  4RUT A;  2Y82 B;  5IKT A;  2WPJ E;  5IKV A;  1EBV A;  3KCG L;  3OLT A;  3BT1 A;  1L3Y A;  3PGH A;  2KB9 A;  2Y38 A;  1IJQ A;  1URK A;  4A7I A;  2MGP A;  1F0S B;  4E1G A;  1EAI C;  5CKQ A;  2XC5 L;  1EPG A;  2VH6 B;  1B9W A;  1LQD A;  2UWO B;  1U8C B;  2BOK L;  4RRY A;  2W2N E;  5F1A A;  2J94 B;  2P28 B;  3DEM A;  3SOB B;  2WPI E;  2Q1J B;  3K9X A;  1YUF A;  2YGO A;  2W2M E;  4BDX A;  1G1R A;  2VVC K;  1LPK A;  2P94 L;  3HS6 A;  5L30 L;  1BF9 A;  3Q3K B;  1MOX C;  3MQE A;  1COU A;  1ADX A;  4JZE L; 
#chains in the Genus database with same CATH topology
 6COX A;  1CVW L;  1X7A L;  1TLE A;  1KIG L;  1A3P A;  2FZZ L;  1HCG B;  3LTG D;  3TZI A;  4Y71 B;  1KLI L;  3IJE B;  3P5B L;  4RS0 A;  1DIY A;  3ELA L;  2ADX A;  1M1X B;  2RNL A;  1QFK L;  2I9A A;  4BXW A;  3M37 L;  4JZF L;  3N8W A;  1HZ8 A;  1LMJ A;  2WG3 C;  5COX A;  3KK6 A;  1Z6E L;  2AYL A;  1P0S L;  4A94 C;  2FLG A;  1EQH A;  1MQ5 L;  3EGF A;  5CKM A;  4NA9 L;  2W2O E;  4C16 A;  1LPZ A;  1G1Q A;  2BO2 A;  2H9E C;  5FDQ A;  1UZK A;  2WPH E;  1UZP A;  5JB8 E;  4TGF A;  1SZB A;  1HT8 A;  2RA0 L;  1HRE A;  3GCX E;  4CUD A;  1PRH A;  1W8B L;  1TOZ A;  4D0F A;  1DQB A;  2EI8 B;  3SOQ A;  4RRZ A;  1IQI L;  4LMF A;  1XKA L;  5F19 A;  3N8Y B;  2KNI A;  3KRK A;  1N7D A;  3LN1 A;  2VRS A;  2VVU L;  1IQF L;  2XBW L;  3FCS B;  3OLU A;  4BTU A;  4D0E A;  2Y5F L;  4Y79 B;  2VWM K;  4JYU L;  1CCF A;  5JVZ A;  2W2Q E;  4FM5 A;  5KN5 C;  4NGA L;  1WU1 B;  2BQW A;  1IQN L;  4ZXX L;  1PGE A;  1ATB A;  1EMO A;  2PR3 B;  1HAE A;  2Y5H L;  1CQE A;  1IVO C;  2PHB B;  1HT5 A;  1IGZ A;  5EGM B;  2Y7X B;  1V1H A;  1APO A;  4MMY B;  3KQE L;  4GU3 A;  4ZAE B;  1ATD A;  2Y5G L;  1NZI A;  2CJI B;  1F0R B;  4MMX B;  1EPH A;  2TGF A;  3LC5 B;  3POY A;  3ZYG A;  3CS7 L;  4ZHA B;  1WHF A;  2VH0 B;  2W86 A;  1Q4G A;  2BT8 A;  1CX2 A;  4CUF A;  1JL9 A;  2D1J B;  1IQM L;  4ISI L;  3F1S B;  4Y7A B;  2KV4 A;  1EPJ A;  1EGF A;  1DVA L;  3HPT A;  3HO5 A;  2JJL A;  2XC4 L;  3LC3 B;  2VVV L;  3BT2 A;  1JV2 B;  3KQD L;  1L5G B;  2BOX A;  1IQG L;  2Y81 B;  3H5C B;  3ENS A;  2RHP A;  3GCW E;  2P3F N;  2WYG B;  4LOR A;  3KQB L;  1OB1 C;  2NPR A;  3NJP C;  3HS5 A;  3NTB A;  3LIW B;  1KLJ L;  4JZD L;  2J34 B;  3LN0 A;  2J2U B;  4JYV L;  2VWO L;  2Y80 B;  1EMN A;  3NTG A;  4BDW A;  3QMO A;  1RFN B;  1UZJ A;  5CIS A;  4BXS A;  3ZYI B;  3TBD A;  2J38 B;  2M74 A;  4XL1 A;  1HJ7 A;  1IQK L;  2MHP A;  1YGC L;  1NFW B;  2XBX L;  1EPI A;  5E8D A;  1HRF A;  4X8T L;  4COX A;  1FAK L;  1TPG A;  1YO8 A;  3FFG L;  2HOR A;  1IQE L;  1J9C L;  1K37 A;  1PFX L;  4M10 A;  1NFX B;  5JW1 A;  2P93 L;  1CEJ A;  4CUE A;  2DDU A;  4X8U L;  4YT6 L;  1FFM A;  3LAQ A;  3GIS X;  3TK6 B;  1V3X B;  4YZU B;  1G2M B;  1ZAQ A;  3TK5 B;  3ZYJ B;  1PXX A;  2EI6 B;  2WZP P;  3F6U L;  1NQL B;  1ATA A;  4NG9 L;  1FSB A;  1IOE L;  1FE2 A;  4PH9 A;  2UWL B;  3BPS E;  5JVY A;  4RRX A;  4XLW A;  1IOX A;  2W3K B;  1GK5 A;  2J95 B;  4XBM A;  3QH0 A;  4CSY A;  4O02 B;  4D90 A;  1UZQ A;  1N1I A;  3S6X A;  4ISH L;  2P26 A;  3U7U G;  5JBC E;  3V65 B;  3HO4 A;  3RR3 A;  1AUT L;  3CFW A;  2OYU P;  3TGF A;  2KL7 A;  1HX2 A;  2WFT A;  1PTH A;  2BMG A;  5JB9 E;  2I9B A;  2FD6 A;  4ZH8 B;  1XKB A;  2WFX B;  3QCW A;  2VWN L;  3LTF B;  1Z6C A;  4OTY A;  2P3F L;  1XFE A;  2G00 L;  2W26 B;  1G2L B;  3HO3 A;  2XC0 L;  3KQC L;  3NT1 A;  4Z0K B;  5L2Y L;  3R05 A;  2UWP B;  3FBY A;  3CEN L;  1WHE A;  1NFU B;  2BOU A;  2Y7Z B;  3TH3 L;  2XBV L;  3ASI A;  3M36 L;  3N8Y A;  2H9E L;  2EI7 B;  1ATE A;  4Z0L A;  2F9B L;  4RRW A;  3SW2 A;  2WPK E;  1G1S A;  2FLB L;  4BTT A;  1EQG A;  1QIU A;  3CA7 A;  3SOV A;  1FF7 A;  1MQ6 L;  1EZQ B;  1CVU A;  1V1I A;  1CCV A;  4MMZ B;  4X8S L;  2K2T A;  3V64 C;  2K2S B;  3Q7D A;  2P3T A;  1KSN B;  2XBY L;  4ZXY L;  1FAX L;  1NT0 A;  2BT7 A;  2GD4 A;  2MGR A;  2W2P E;  3N8X A;  2VJ3 A;  2WYJ B;  2YGP A;  5KIR A;  2W3I B;  3N8V A;  5JBA E;  1I0U A;  1O5D L;  3N8Z A;  1JBU L;  1LK9 A;  1K36 A;  1LMM A;  4Y7B B;  3KL6 B;  4YT7 L;  1IQJ L;  1W7X L;  1IGX A;  1U67 A;  2WPL E;  2OYE P;  5CKN A;  5I46 L;  2PUQ L;  4O1Z A;  2WPM E;  2FLR L;  1DX5 I;  1NFY B;  5K0H B;  2BOH A;  3MDL A;  1NPE B;  1G1T A;  3HS7 A;  1HAF A;  1KKE A;  1YUK B;  2BSF A;  2J4I B;  3IIT B;  2P3U A;  1IQH L;  4X8V L;  4Z6A L;  1FJS L;  1YUG A;  2HOX A;  1DDX A;  4M11 A;  2BQ6 A;  5L2Z L;  1IP0 A;  4G1M B;  4AQT A;  2VWL L;  3C9A C;  1XDT R;  4Y76 B;  3U73 A;  1APQ A;  3N8W B;  4Y6D B;  2WG4 B;  4BTI A;  2BZ6 L;  1LPG A;  2BQ7 A;  1IQL L;  4OTJ A;  2B7D L;  2JKH L;  5IKQ A;  1F7M A;  2P95 L;  5IKR A;  5JBB E;  2P16 L;  1KLO A;  1C5M F;  1P9J A;  1F7E A;  4RUT A;  2Y82 B;  5IKT A;  2WPJ E;  5IKV A;  1EBV A;  3KCG L;  3OLT A;  4GU4 A;  2YGQ A;  3BT1 A;  1L3Y A;  3PGH A;  2KB9 A;  2Y38 A;  1IJQ A;  1URK A;  4A7I A;  2MGP A;  1F0S B;  4E1G A;  1EAI C;  5CKQ A;  2XC5 L;  1EPG A;  2VH6 B;  1B9W A;  1LQD A;  2UWO B;  1U8C B;  2BOK L;  4RRY A;  2W2N E;  5F1A A;  2J94 B;  2P28 B;  3DEM A;  3SOB B;  2WPI E;  2Q1J B;  3K9X A;  1YUF A;  2YGO A;  2W2M E;  4BDX A;  1G1R A;  2VVC K;  1LPK A;  2P94 L;  3HS6 A;  5L30 L;  1BF9 A;  3Q3K B;  1MOX C;  3MQE A;  1COU A;  1ADX A;  4JZE L; 
#chains in the Genus database with same CATH homology
 6COX A;  1CVW L;  1X7A L;  1TLE A;  1KIG L;  1A3P A;  2FZZ L;  1HCG B;  3LTG D;  3TZI A;  4Y71 B;  1KLI L;  3IJE B;  3P5B L;  4RS0 A;  1DIY A;  3ELA L;  2ADX A;  1M1X B;  2RNL A;  1QFK L;  2I9A A;  4BXW A;  3M37 L;  4JZF L;  3N8W A;  1HZ8 A;  1LMJ A;  2WG3 C;  5COX A;  3KK6 A;  1Z6E L;  2AYL A;  1P0S L;  4A94 C;  2FLG A;  1EQH A;  1MQ5 L;  3EGF A;  5CKM A;  4NA9 L;  2W2O E;  4C16 A;  1LPZ A;  1G1Q A;  2BO2 A;  2H9E C;  5FDQ A;  1UZK A;  2WPH E;  1UZP A;  5JB8 E;  4TGF A;  1SZB A;  1HT8 A;  2RA0 L;  1HRE A;  3GCX E;  4CUD A;  1PRH A;  1W8B L;  1TOZ A;  4D0F A;  1DQB A;  2EI8 B;  3SOQ A;  4RRZ A;  1IQI L;  4LMF A;  1XKA L;  5F19 A;  3N8Y B;  2KNI A;  3KRK A;  1N7D A;  3LN1 A;  2VVU L;  1IQF L;  2XBW L;  3FCS B;  3OLU A;  4BTU A;  4D0E A;  2Y5F L;  4Y79 B;  2VWM K;  4JYU L;  1CCF A;  5JVZ A;  2W2Q E;  4FM5 A;  5KN5 C;  4NGA L;  1WU1 B;  2BQW A;  1IQN L;  4ZXX L;  1PGE A;  1ATB A;  1EMO A;  2PR3 B;  1HAE A;  2Y5H L;  1CQE A;  1IVO C;  2PHB B;  1HT5 A;  1IGZ A;  5EGM B;  2Y7X B;  1APO A;  4MMY B;  3KQE L;  4ZAE B;  1ATD A;  2Y5G L;  1NZI A;  2CJI B;  1F0R B;  4MMX B;  1EPH A;  2TGF A;  3LC5 B;  3POY A;  3ZYG A;  3CS7 L;  4ZHA B;  1WHF A;  2VH0 B;  2W86 A;  1Q4G A;  1CX2 A;  4CUF A;  1JL9 A;  2D1J B;  1IQM L;  4ISI L;  3F1S B;  4Y7A B;  2KV4 A;  1EPJ A;  1EGF A;  1DVA L;  3HPT A;  3HO5 A;  2XC4 L;  3LC3 B;  2VVV L;  3BT2 A;  1JV2 B;  3KQD L;  1L5G B;  2BOX A;  1IQG L;  2Y81 B;  3H5C B;  3ENS A;  2RHP A;  3GCW E;  2P3F N;  2WYG B;  4LOR A;  3KQB L;  1OB1 C;  2NPR A;  3NJP C;  3HS5 A;  3NTB A;  3LIW B;  1KLJ L;  4JZD L;  2J34 B;  3LN0 A;  2J2U B;  4JYV L;  2VWO L;  2Y80 B;  1EMN A;  3NTG A;  4BDW A;  3QMO A;  1RFN B;  1UZJ A;  5CIS A;  4BXS A;  3ZYI B;  3TBD A;  2J38 B;  2M74 A;  4XL1 A;  1HJ7 A;  1IQK L;  2MHP A;  1YGC L;  1NFW B;  2XBX L;  1EPI A;  5E8D A;  1HRF A;  4X8T L;  4COX A;  1FAK L;  1TPG A;  1YO8 A;  3FFG L;  1IQE L;  1J9C L;  1K37 A;  1PFX L;  4M10 A;  1NFX B;  5JW1 A;  2P93 L;  1CEJ A;  4CUE A;  2DDU A;  4X8U L;  4YT6 L;  1FFM A;  3LAQ A;  3GIS X;  3TK6 B;  1V3X B;  4YZU B;  1G2M B;  1ZAQ A;  3TK5 B;  3ZYJ B;  1PXX A;  2EI6 B;  2WZP P;  3F6U L;  1NQL B;  1ATA A;  4NG9 L;  1FSB A;  1IOE L;  1FE2 A;  4PH9 A;  2UWL B;  3BPS E;  5JVY A;  4RRX A;  4XLW A;  1IOX A;  2W3K B;  1GK5 A;  2J95 B;  4XBM A;  3QH0 A;  4CSY A;  4O02 B;  4D90 A;  1UZQ A;  1N1I A;  3S6X A;  4ISH L;  2P26 A;  3U7U G;  5JBC E;  3V65 B;  3HO4 A;  3RR3 A;  1AUT L;  3CFW A;  2OYU P;  3TGF A;  2KL7 A;  1HX2 A;  2WFT A;  1PTH A;  2BMG A;  5JB9 E;  2I9B A;  2FD6 A;  4ZH8 B;  1XKB A;  2WFX B;  3QCW A;  2VWN L;  3LTF B;  1Z6C A;  4OTY A;  2P3F L;  1XFE A;  2G00 L;  2W26 B;  1G2L B;  3HO3 A;  2XC0 L;  3KQC L;  3NT1 A;  4Z0K B;  5L2Y L;  3R05 A;  2UWP B;  3FBY A;  3CEN L;  1WHE A;  1NFU B;  2BOU A;  2Y7Z B;  3TH3 L;  2XBV L;  3ASI A;  3M36 L;  3N8Y A;  2H9E L;  2EI7 B;  1ATE A;  4Z0L A;  2F9B L;  4RRW A;  3SW2 A;  2WPK E;  1G1S A;  2FLB L;  4BTT A;  1EQG A;  3SOV A;  3CA7 A;  1FF7 A;  1MQ6 L;  1EZQ B;  1CVU A;  1CCV A;  4MMZ B;  4X8S L;  2K2T A;  3V64 C;  2K2S B;  3Q7D A;  2P3T A;  1KSN B;  2XBY L;  4ZXY L;  1FAX L;  1NT0 A;  2GD4 A;  2MGR A;  2W2P E;  3N8X A;  2VJ3 A;  2WYJ B;  2YGP A;  5KIR A;  2W3I B;  3N8V A;  5JBA E;  1I0U A;  1O5D L;  3N8Z A;  1JBU L;  1K36 A;  1LMM A;  4Y7B B;  3KL6 B;  4YT7 L;  1IQJ L;  1W7X L;  1IGX A;  1U67 A;  2WPL E;  2OYE P;  5CKN A;  5I46 L;  2PUQ L;  4O1Z A;  2WPM E;  2FLR L;  1DX5 I;  1NFY B;  5K0H B;  2BOH A;  3MDL A;  1NPE B;  1G1T A;  3HS7 A;  1HAF A;  1YUK B;  2J4I B;  3IIT B;  2P3U A;  1IQH L;  4X8V L;  4Z6A L;  1FJS L;  1YUG A;  1DDX A;  4M11 A;  2BQ6 A;  5L2Z L;  1IP0 A;  4G1M B;  4AQT A;  2VWL L;  3C9A C;  1XDT R;  4Y76 B;  3U73 A;  1APQ A;  3N8W B;  4Y6D B;  2WG4 B;  4BTI A;  2BZ6 L;  1LPG A;  2BQ7 A;  1IQL L;  4OTJ A;  2B7D L;  2JKH L;  5IKQ A;  1F7M A;  2P95 L;  5IKR A;  5JBB E;  2P16 L;  1KLO A;  1C5M F;  1P9J A;  1F7E A;  4RUT A;  2Y82 B;  5IKT A;  2WPJ E;  5IKV A;  1EBV A;  3KCG L;  3OLT A;  2YGQ A;  3BT1 A;  1L3Y A;  3PGH A;  2KB9 A;  2Y38 A;  1IJQ A;  1URK A;  4A7I A;  2MGP A;  1F0S B;  4E1G A;  1EAI C;  5CKQ A;  2XC5 L;  1EPG A;  2VH6 B;  1B9W A;  1LQD A;  2UWO B;  1U8C B;  2BOK L;  4RRY A;  2W2N E;  5F1A A;  2J94 B;  2P28 B;  3DEM A;  3SOB B;  2WPI E;  2Q1J B;  3K9X A;  1YUF A;  2YGO A;  2W2M E;  4BDX A;  1G1R A;  2VVC K;  1LPK A;  2P94 L;  3HS6 A;  5L30 L;  1BF9 A;  3Q3K B;  1MOX C;  3MQE A;  1COU A;  1ADX A;  4JZE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...