3LTLA

Crystal structure of human big1 sec7 domain
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
LKQQKEIIEQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Brefeldin A-inhibited guanine nucleotide-exchange protein 1
publication title The Sec7 domain structures of human BIG1 and Cytohesin1 Arf nucleotide exchange factors
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 73
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 3ltlA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 3ltlA02
4OIYA 1R8QE 3SWVA 4D7RA 4JMOA 4Z21A 2R09A 2R0DA 1R8SE 4JXHA 4JMIA 3LTLA 1PBVA 4A4PA 1KU1A 1R8ME 1XT0B 1XSZA 1BC9A 4D7QA 3L8NA 4L5MA 1S9DE 4C0AA 4JWLA 1RE0B 4C7PA
chains in the Genus database with same CATH superfamily
3SWVA 1C1KA 1SAVA 3ABOA 4Z21A 1AIIA 1W3WA 1BCYA 1YCNA 2R09A 2R0DA 3ABQA 1N00A 2Q4CA 3ANYA 1YJ0A 1BC1A 1KU1A 2RANA 2K6XA 2H0KA 1AVCA 2HYVA 4HREA 1ALAA 2QEZA 4EVFA 4JWLA 1RE0B 3BRXA 1Q8DA 1W7BA 1XJLA 3SOHB 4JMOA 1BCZA 4MDVA 3TW5A 2OY9A 3AO0A 1BC0A 3USYA 4FHRB 4JXHA 1W45A 4JMIA 1HAKA 1HVGA 1G5NA 1ANNA 1AXNA 1DM5A 4KN7X 1MCXA 1XSZA 2XO3A 2ZOCA 2IICA 1BO9A 1I4AA 4L5MA 2ZHIA 4MDUA 2HYWA 2VXGA 1ANWA 1A8BA 1HM6A 4D7RA 1BC3A 3USWA 1UPTB 1ANXA 1HVDA 4FQ0C 1YIIA 1R8SE 3ABRA 3LTLA 4EVHA 1PBVA 4A4PA 3ABSA 1R8ME 1XT0B 2XO2A 1AVRA 1DK5A 1YGMA 1A8AA 1N44A 4D7QA 3L8NA 1LKVX 3HJLA 2H0LA 1R4AE 4C0AA 2ZHJA 4C7PA 4OIYA 1N41A 4Q2SA 1R8QE 1QC7A 2HSNA 2H0MA 4JK1X 1HVFA 1AOWA 4KMUX 1HVEA 3AJCA 2HYUA 1N42A 1BCWA 4X9PA 1AEIA 2IE6A 1BC9A 1M9IA 2IE7A 1AVHA 2II2A 1S9DE 4KN4X
chains in the Genus database with same CATH topology
4OIYA 1Q8DA 1R8QE 3SOHB 3SWVA 4D7RA 1QC7A 3USWA 2HSNA 4JMOA 4Z21A 3TW5A 4JK1X 2R09A 4FQ0C 2R0DA 3USYA 4KMUX 4FHRB 1R8SE 4JXHA 4JMIA 3LTLA 3AJCA 1PBVA 4KN7X 1KU1A 4A4PA 1R8ME 1XT0B 2K6XA 1XSZA 1BC9A 4D7QA 3L8NA 1LKVX 3HJLA 4L5MA 1S9DE 4C0AA 4JWLA 1RE0B 4KN4X 4C7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIY A;  1R8Q E;  3SWV A;  4D7R A;  4JMO A;  4Z21 A;  2R09 A;  2R0D A;  1R8S E;  4JXH A;  4JMI A;  3LTL A;  1PBV A;  4A4P A;  1KU1 A;  1R8M E;  1XT0 B;  1XSZ A;  1BC9 A;  4D7Q A;  3L8N A;  4L5M A;  1S9D E;  4C0A A;  4JWL A;  1RE0 B;  4C7P A; 
#chains in the Genus database with same CATH topology
 3SWV A;  1C1K A;  1SAV A;  3ABO A;  4Z21 A;  1AII A;  1W3W A;  1BCY A;  1YCN A;  2R09 A;  2R0D A;  3ABQ A;  1N00 A;  2Q4C A;  3ANY A;  1YJ0 A;  1BC1 A;  1KU1 A;  2RAN A;  2K6X A;  2H0K A;  1AVC A;  2HYV A;  4HRE A;  1ALA A;  2QEZ A;  4EVF A;  4JWL A;  1RE0 B;  3BRX A;  1Q8D A;  1W7B A;  1XJL A;  3SOH B;  4JMO A;  1BCZ A;  4MDV A;  3TW5 A;  2OY9 A;  3AO0 A;  1BC0 A;  3USY A;  4FHR B;  4JXH A;  1W45 A;  4JMI A;  1HAK A;  1HVG A;  1G5N A;  1ANN A;  1AXN A;  1DM5 A;  4KN7 X;  1MCX A;  1XSZ A;  2XO3 A;  2ZOC A;  2IIC A;  1BO9 A;  1I4A A;  4L5M A;  2ZHI A;  4MDU A;  2HYW A;  2VXG A;  1ANW A;  1A8B A;  1HM6 A;  4D7R A;  1BC3 A;  3USW A;  1UPT B;  1ANX A;  1HVD A;  4FQ0 C;  1YII A;  1R8S E;  3ABR A;  3LTL A;  4EVH A;  1PBV A;  4A4P A;  3ABS A;  1R8M E;  1XT0 B;  2XO2 A;  1AVR A;  1DK5 A;  1YGM A;  1A8A A;  1N44 A;  4D7Q A;  3L8N A;  1LKV X;  3HJL A;  2H0L A;  1R4A E;  4C0A A;  2ZHJ A;  4C7P A;  4OIY A;  1N41 A;  4Q2S A;  1R8Q E;  1QC7 A;  2HSN A;  2H0M A;  4JK1 X;  1HVF A;  1AOW A;  4KMU X;  1HVE A;  3AJC A;  2HYU A;  1N42 A;  1BCW A;  4X9P A;  1AEI A;  2IE6 A;  1BC9 A;  1M9I A;  2IE7 A;  1AVH A;  2II2 A;  1S9D E;  4KN4 X; 
#chains in the Genus database with same CATH homology
 4OIY A;  1Q8D A;  1R8Q E;  3SOH B;  3SWV A;  4D7R A;  1QC7 A;  3USW A;  2HSN A;  4JMO A;  4Z21 A;  3TW5 A;  4JK1 X;  2R09 A;  4FQ0 C;  2R0D A;  3USY A;  4KMU X;  4FHR B;  1R8S E;  4JXH A;  4JMI A;  3LTL A;  3AJC A;  1PBV A;  4KN7 X;  1KU1 A;  4A4P A;  1R8M E;  1XT0 B;  2K6X A;  1XSZ A;  1BC9 A;  4D7Q A;  3L8N A;  1LKV X;  3HJL A;  4L5M A;  1S9D E;  4C0A A;  4JWL A;  1RE0 B;  4KN4 X;  4C7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...