3LTPA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltpA00
4IXXA 1ZAHA 5AHEA 2J24A 1ICSA 3KRSA 3H55A 4NJIA 5HUOA 3E02A 1QOQA 4Z0SA 3CHVA 5L6UA 3UXDA 3ABOA 2J88A 3NQ6A 4O11A 2E5DA 1H7NA 4AWTA 1DBTA 2QCDB 4IQLA 3EWBX 3ATYA 3R8RA 4Y90A 4YCPA 4UTKA 4PFMA 3HQ1A 1GWJA 5AHLA 4AHOA 1Y0EA 2CW6A 2IQTA 3HG5A 3MBFA 1ADOA 4QNEA 1PCKA 5DXXA 3KVMA 3UXAA 1R2TA 2X1SA 3JS3A 2RKXA 4M6QA 1QO2A 4JX4A 4UTIA 2Y7DA 2OT0A 1XBXA 1R30A 4DO6A 4CQ9A 4R33A 4MLJA 1V5XA 1T99A 4AMAA 4DF0A 1FDYA 1WQ5A 3QQ0A 5I3GA 1YDNA 2CZDA 3CEPA 3PBUA 5AYZA 1R2SA 5KZDA 1VCFA 1ZFJA 1ML1A 1Z48A 2YW3A 1Q6RA 3B4UA 4S1FA 2B7NA 5FF2A 1SW7A 2QUUA 1JQXA 3B0PA 4UNLA 3W7QA 2F84A 4O18A 3PF3A 3EWZA 1MZHA 3HMJG 1XC4A 3UY7A 1KM5A 5CPLA 4Y8FA 1L6YA 4W9TA 3CQ0A 3TR2A 4NNBA 4QSHA 1J4EA 1PV8A 1B4KA 1OFRA 3E0IA 3W7HA 1UCWA 2RHGA 3C8FA 5HWJA 3TXVA 3BVJA 1KFBA 3GAKA 2R94A 4WJEA 2EGZA 2YDAA 3S5ZA 4CNPA 3L5MA 5FF7A 2X30A 3W2UA 3MI2A 2P1FA 3TQKA 3NQCA 4RXGA 3NQGA 3P7YA 4MKNA 3KRZA 4MLRA 4NVTA 2CLIA 1H61A 3CM4A 1TPDA 1TPVA 3DFPA 3QMRA 2VEPA 4G1KA 1TMHA 1O94A 5L9FA 4EVZA 1QPOA 3THQA 1W8SA 4FNTA 3WK3A 3P8JA 4WQ6A 3RLVA 1ME9A 2ZCGA 5DLCA 1KM4A 2FIQA 4MY9A 4BI7A 3NQ7A 1YPFA 3W1NA 3EEGA 4QJ1A 3O63A 4LUIA 4JR5A 1KTCA 5F1UA 4AEOA 3LHTA 4CCCA 1FCBA 2AGKA 3TAKA 3L0KA 3NQ2A 2QCEA 2A6LA 2A7RA 4JY9A 3R13A 1ZENA 2E6AA 2J27A 4XWUA 1KM1A 6ALDA 4HSOA 5CSSA 1ME8A 1LBFA 4FNPA 4CQ8A 3T40A 3OIXA 1XCFA 2VEMA 1YLVA 1WYIA 3TK7A 3WJSA 3AO0A 3GDLA 4BWLA 4LY8A 4JTIA 4JTKA 1TPC1 3FIGA 3M16A 3NYZA 1PHQA 1E51A 3CC1A 3SFKA 1S3HA 5LHEA 1VHCA 3LM7A 1VYRA 3HJZA 4UFHA 1A5CA 4LRTA 1SSDA 3LDVA 3P67A 4CNOA 2JBMA 1O60A 5EMUA 4RV8A 4CCDA 3A5VA 5FF4A 2GVLA 1W5OA 1I2RA 3LERA 4IWWA 4AF0A 4GWEA 3GKFA 5EYWA 3TSMA 5HR7A 1TSIA 4Z1CA 1TPB1 4N9EA 3IIOA 2QDHA 4JTLA 2V8ZA 4O12A 1T96A 3GX9A 4LRSA 3BW4A 1LBLA 3SSJA 5K7JA 1LBMA 3W7NA 5AC7A 2Y7GA 4PODA 3N3MA 1QPNA 3P5ZA 3LXCA 3W86A 4JTEA 5D05A 2Z2UA 1OX6A 3KRUA 4K7YA 1Z42A 3QSTA 5BNKA 1LDCA 2R8WA 4AWUA 2QKFA 4JDYA 1AW5A 3DU0A 1OX4A 4JN6A 3DHDA 1EWEA 3FKRA 3M1ZA 3NXFA 4FX7A 4JIQA 4Y96A 3G1YA 3A21A 1XBZA 3IIXA 4GNJA 4U28A 3HGJA 2NUWA 3M9YA 1OF8A 2QJGA 3C2OA 1S5WA 2R14A 4LOCA 3QFEA 4KFPA 1TTQA 3PSVA 4Z1BA 1RQBA 2E1DA 3NM1A 2Y88A 3USBA 1ZJIA 3EKZA 2QAFA 2YFOA 2C15A 2I9EA 3CT7A 3DH7A 3TIMA 3PUOA 4QQ3A 4XBKA 3K30A 3W2MA 4OE7A 1DJQA 2PURA 2QCFA 3OHIA 3P61A 3HG4A 4WUIA 4N9CA 3SI9A 1O4UA 1W3NA 4NZJA 3G1DA 1H62A 2V5LA 3HO8A 1SFLA 3ELFA 5U4NA 2X1TA 1VLIA 2O7SA 2ISVA 1UB3A 3FEMA 3UPWA 5FEWA 2H8ZA 3ABRA 3F03K 3M5XA 3BG5A 2FB2A 3IRDA 3B04A 1SR9A 2E77A 4O4VA 1GYLA 1QFEA 3EWWA 3P84A 2I1OA 1OYAA 3UWQA 3MP5A 1MEWA 1IIGA 2CLMA 3M7WA 3TROA 4LWWA 4WZHA 4UIOA 1G4EA 4FNRA 1S5VA 3NQVA 5EY5A 1OG0A 2ZZ6A 4TMCA 4FHAA 1CW2A 2YXGA 2ZZ3A 3STFA 3CIWA 3LRKA 3MHFA 3BW2A 4ZQCA 4DO5A 5AHMA 1YXDA 3MUXA 5D2YA 2G96A 2GPTA 1NEYA 3BPWA 3T44A 3C2VA 2Y85A 3W75A 4A29A 2H3DA 1JUKA 4O1DA 2EKCA 4O15A 3BGGA 4FNUA 3QF0A 3FFSA 1RR2A 1H51A 3HGRA 1D3HA 3PM6A 3QC3A 1DVJA 1G4TA 4MVAA 3E49A 1JCJA 1S5TA 1N7KA 1WDWA 3WJZA 4E2DA 3OVRA 5C5YA 1I45A 2F7FA 2P10A 1JQVA 1RVGA 2H3BA 5AC6A 5KTLA 4B5NA 4FX8A 2YSWA 4IMGA 1EP2A 4LV9A 4O57A 3HG3A 3DKLA 4NJJA 1UASA 4A21A 4UMCA 2JKPA 5LNUA 2B4GA 3VE7A 2AQWA 5LNVA 1EP1A 2RDWA 4O28A 4FX6M 3UY8A 1H60A 3GNNA 3ZFHA 4QNWA 2Y89A 3QW4B 4PL2A 2YFNA 1VQTA 5AHIA 2WSQA 3GVGA 1RZMA 4KFOA 2XN1A 4JDBA 3EX4A 2HSAA 1GG0A 4I7VA 4K38A 4O16A 4WOZA 4J9JA 2G5WA 1H7XA 1B57A 3C56A 2NX1A 4JTUA 3QPYA 3BARA 1L6WA 1FCVA 3DGRA 2CU0A 4QITA 1XUZA 3HOJA 5GVJA 3LI0A 2A0NA 2UV8G 1I2NA 3RU6A 3WFAA 1RPXA 3DI0A 2GVGA 2Z6IA 3PG9A 5MHBA 3TUUA 1AMKA 3QMTA 1OFOA 4CCEA 1H1YA 5AYYA 5DCDA 3GK0A 3PB0A 4POCA 4FXSA 1OYCA 1JCNA 4UTHA 1AW1A 2ZRZA 1FUYA 2OJPA 4OHQA 3W6YA 5F2MA 3SGUA 2ZRXA 3W1RA 4AH7A 4DF1A 3VE9A 3EX2A 1TTPA 2BXVA 1GOXA 2HMCA 1MSSA 3W2NA 4FNSA 4UR7A 3O06A 2E5CA 3W7JA 4Z1DA 4HNNA 3W7KA 1LM1A 3GR8A 6TIMA 3RK8A 3S1VA 5LNWA 3L2IA 2GQ8A 2YW4A 4LNYA 1AK5A 5EKYA 1W1ZA 4DF2A 3PBVA 5DXYA 1EX5A 3ZS4A 4IUOA 1K8XA 1JCYA 3SIZA 4O1CA 1Z41A 3P60A 3W07A 4X9SA 3FLUA 1AG1O 1LRQA 3GKAA 5D37A 1KFLA 1XXXA 4AF0B 4IMFA 5KINA 2H6RA 1KTNA 1ZHAA 1OABA 4UMAA 4KFNA 3W1AA 5KZMA 1KM2A 3O05A 4IX0A 5KZEA 2CWNA 5AHNA 1A5BA 4H4IA 1ME7A 3WJXA 2CLLA 4ML9A 5AOUA 3NEVA 3S6DA 2ZZ1A 2RFGA 5CG7A 1N55A 3NQEA 2ATMA 3N2XA 3MW7A 2QEZA 3PWAA 3W7EA 1DOSA 1PE1A 3Q2DA 3MO7A 4QM1A 2HS6A 5D2WA 2ZRYA 3TW6A 4MY8A 3FS2A 1QOPA 3C0JA 1SZFA 4NXKA 4JS3A 3NL3A 1FWSA 1GEQA 3S5OA 2WJZA 3TJLA 2G97A 1G69A 1XDLA 4I7WA 5I3FA 3STGA 1OX4B 4JTFA 1UBSA 2EHHA 1QPQA 4E0CA 3LOTA 1G6CA 3OG3A 4TU1A 3BLEA 1F6KA 3W1LA 3DFTA 2GJNA 1GZGA 4IPIA 4YCOA 1I2PA 2DZSA 3NL5A 3GLCA 1LTDA 4PL1A 4FEZA 1LOQA 1PL9A 2E6DA 4LT9A 1ALDA 4HNVA 3TU9A 5EA9A 3NQ8A 4LS0A 5CZTA 3EWUA 1MXSA 4O19A 4RJEA 3RF9A 1SFJA 3NL6A 4DBDA 3JRKA 5I3JA 3UWVA 3GZ3A 3NR0A 1XL9A 3W9ZA 2GOUA 3LRLA 3L0GA 2BWGA 1FBAA 4XZ9A 5TIMA 4JIPA 2CFFA 2NZLA 1SO4A 1JCXA 3SZ8A 1F74A 4O10A 3S0CA 4UNKA 3NPVA 3I65A 3L21A 1GT8A 3CLMA 3VCRA 4JTJA 3TNOA 3UD6A 2VFHA 3RLUA 4WXYA 1RQHA 1LROA 1X1OA 3W85A 1F7BA 4JD4A 5F4XA 5CSRA 1SZGA 2YX0A 4MFDA 2QCCA 3I7RA 5KSWA 2HS8A 3NZRA 4PC8A 2ZRVA 4JICA 2W6RA 1YXCA 3TCEA 2WSYA 1FXQA 3LCXA 5D04C 2Y6ZA 5D2XA 3PR2A 3Q58A 2WSRA 1OK6A 1TQJA 1A53A 2A1YA 5LZLA 4OT7A 1VC4A 1IXQA 2PCQA 4LTSA 4N9DA 3W83A 1A5SA 5D38A 5CZSA 1Q45A 2DJXA 1GVSA 5I3HA 5CZ0A 5HR6A 4O53A 2ZQ0A 4DPQA 3S1WA 4JYFA 1TV7A 3I68A 2NX9A 4Z0JA 4GUIA 1DKWA 3FKKA 2FLIA 1R2RA 3UZJA 3E9AA 1OFEA 1XM3A 3A5FA 3L67A 4XKYA 1KFJA 2PRHA 4GUHA 3G0XA 4M7TA 1MO0A 3TFXA 3LX9A 3W7OA 4TMBA 1ONRA 1JJKA 2J6XA 3BLIA 3G8RA 1C9DA 1PS9A 1YYAA 1VRDA 2NXHA 2V2DA 4ONVA 2FTPA 1KA9F 4GC4A 2ZTJA 1FWNA 3I7QA 3G1HA 3G3DA 5D30A 4ADUA 2NX3A 4LC8A 1LORA 2VKZG 4IPJA 2YCEA 2EAWA 5FESA 5LHFA 3W1UA 1W37A 5G4EA 4O17A 1C29A 3N34A 1XBVA 3IVSA 4NJHA 2P0OA 2ZZ2A 3IVTA 4R53A 4N9BA 4MZYA 2YZRA 3W70A 4UTTC 4UFIA 4NJGA 3M43A 2ZBTA 3EWXA 4HN4A 5G4WA 3UYCA 1IXPA 1TPFA 4YMZA 3F4WA 3MWAA 1EPXA 3B06A 4A2SA 3EXTA 4MY1A 4JEQA 1ZCOA 2ZZ7A 4JYDA 2DZUA 2WNQA 4TO8A 4LU0A 4HIBA 1JCMP 3T78A 1YXYA 3IGSA 2JKAA 3W72A 4GUFA 2ATSA 4LVFA 3W71A 4U4MA 3HGOA 3Q94A 1LZOA 5K4ZA 5G1YA 3W74A 2YYUA 3QRHA 1EP3A 1OYBA 1G7UA 3RFAA 4K8HA 4O13A 1TPUA 5J5RA 4CNNA 4FO4A 5F1VA 3CU2A 4DPPA 2E68A 4WD0A 3HIJA 5LSMA 3KHJA 4K37A 5FI8A 3C61A 7TIMA 1BEUA 3LV6A 2QCNA 4O14A 3WK2A 1KFEA 4OBTA 3CTLA 3PAJA 2NWRA 1TV5A 4FIRA 3DBPA 1FWTA 3THAA 3HF3A 3W7LA 3BGJA 2ISSA 4RR4A 3FA5A 4FNQA 5D09A 2A21A 3N2MA 2AAMA 3PUEA 4O1BA 2DORA 3W7PA 2Z0IA 1TTJA 2V2HA 1TPEA 4N4QA 3CEUA 4NUWA 2OT1A 3NA8A 1I2QA 3STCA 3W1TA 3IVUA 3LI1A 4UFLA 2ABAA 2NLIA 4ZQNA 3HGSA 2QJIA 4HSNA 3B8DA 4M6PA 3LCGA 4OV4A 2E09A 1JRCA 2GQAA 1A50A 3WK0A 4ZQRA 2Q8ZA 3C2FA 2DZPA 3PC0A 2VEIA 3P5YA 3L68A 3KVKA 5K9XA 4N4PA 2HTMA 4MIMA 1AL8A 1ZALA 1K7EA 1HTIA 2CLKA 2WQPA 4GFSA 1Q6LA 3SW6A 2R91A 3FYOA 2Z1BA 4ORMA 4LC6A 3OEXA 1VYPX 1P4CA 1KFCA 4X2RA 4O54A 3UWYA 2QJHA 2ZA2A 3EB2A 4KWVA 1BWKA 3Q37A 3P8IA 1VS1A 1WAUA 1GVQA 2VFEA 5IBXC 1GJPA 1KTBA 1RQEA 3LHVA 1W54A 3GR7A 1XUUA 3GB6A 3LCFA 4BF9A 3UNDA 5U7SA 2Y63A 3EX6A 3YPIA 1IXNA 3S1XA 2QCDA 1JUBA 4ICNA 3O16A 4EOUA 1GVRA 3LHZA 5C2XA 1T8XA 3QJAA 1FWWA 3S1UA 4L4LA 1B4EA 3IIPA 3TX9A 3DAQA 4TR9A 2C16A 1NF7A 5CKSA 1P5BA 1O5XA 2Z6JA 1WBHA 1YTEA 2ZA1A 5K3VA 1L9WA 1QNVA 2B7PA 2D73A 4UTLA 4ZMGA 5D02A 4N6EA 3W2LA 4IMCA 1F6PA 1PCWA 1WOBA 4LVGA 2FDSA 3TQ0A 3QSRA 2PRLA 3QM3A 5BOOA 1K8YA 5AFDA 3QYQA 2FJKA 2BZNA 3C2EA 3R12A 2VXNA 1LLWA 3IIZA 1T0OA 4UTUA 3PBYA 3O6CA 3LGEA 4RX0A 4UCGA 1EA0A 1Q6QA 3M5VA 3TSBA 3BV4A 4ZZ9A 1YTDA 2VELA 3GAYA 4NQ1A 3G8EA 3IEBA 4DELA 1H50A 1GTEA 3N9RA 4ZL1A 1KBIA 2A5HA 3DKJA 4AHPA 2JK2A 5HULA 4PEKA 3ZWTA 3N19B 4KKXA 2C3ZA 2A2IA 4WOQA 5D32A 3TC7A 1SO5A 4N2YA 1TCDA 2TYSA 1N8FA 5G1TA 5HQEA 3W7MA 1XI3A 4TIMA 3GYEA 5C54A 1SU5A 4IMEA 3ATZA 3LCIA 4XKYB 1UUMA 5DBTA 2ZRUA 3HPZA 2TMDA 1OFDA 1TJRA 2Q3OA 4BI5A 1EB3A 3R89A 2E6FA 1H1ZA 1AL7A 1GQNA 4RZ4A 1G7VA 1LLZA 1FWRA 1P0KA 1K7FA 5H91A 2V5BA 2Y7EA 4AAJA 3DI1A 2J9ZA 3VNDA 1FDJA 3TA6A 4FIQA 4K39A 1RV8A 2V30A 1GTHA 1W3IA 4YXGA 2RDTA 2V82A 1K02A 5DCEA 5G2WA 3QPZA 3O8AA 4JXCA 4NU7A 3W1MA 2G95A 1B9BA 5LKYA 3PUDA 1HFBA 4FF7A 4N02A 4M6VA 3UPBA 3W3OA 2NUYA 4OGZA 1XDMA 4X3ZA 2GJLA 4I7UA 2QUVA 1W5QA 1VGAA 3LLDA 1BTMA 3BK0A 5FEZA 5E93A 3W84A 1W5MA 3D0CA 2NV2A 1GG1A 4M7SA 3UWUA 4UTTA 3TDFA 2QCLA 4GRSA 3UWWA 1CX9A 4R7JA 1W31A 2I14A 3RNDA 4NNAA 1LOSA 4XTIA 2DZVA 3M44A 5EL1A 1OFPA 3R2GA 3TKFA 1GVOA 4HPXA 5LGXA 1J5TA 2A4AA 3PB2A 2ZTKA 3H54A 4LVDA 2W0UA 2ZDRA 2OMAA 4NT0A 3SJ3A 4ZQOA 1WA3A 5KMYA 3ABSA 4JYEA 2CZFA 1K03A 4MJMA 3TSDA 1TRDA 3VI2A 3NNTA 5K4XA 2OZ0A 3F4NA 1OJXA 1WXJA 3RMJA 2YPIA 4N6FA 1HUVA 2DP3A 4K8EA 1VH7A 1KW1A 4JTHA 4ORIA 4JTSA 5DY2A 3AJXA 2VOMA 2NWSA 3W73A 3GDTA 4H3DA 3VFLA 1Q6OA 1DHPA 3DZ1A 3OVPA 1M7OA 4OQVA 3G3MA 4BI6A 3DFSA 1FX6A 1WX0A 3TFCA 3NO5A 2O7QA 3MHUA 2BX7A 3PBWA 3ABQA 3CB8A 3IGXA 3CWOX 5FEPA 2NV1A 5G5IA 3B0VC 4PCFA 3E12A 4A22A 2DZXA 3GDMA 3T7VA 5AYXA 5TBOA 4OU1A 4KWWA 3W2JA 3G1SA 5E1QA 4LUJA 3W7IA 1TPWA 4O4WA 5F4SA 2WNNA 3KVJA 5J5DA 5AHFA 3EXSA 4O50A 1SPQA 5D2TA 2YYTA 4Q33A 4AHQA 1W3TA 5K2ZA 3HG2A 1XKYA 4ADTA 3PG8A 4WX2A 5EPDA 4FB7A 1VJIA 1YPIA 5HWNA 3OA3A 3LRMA 3W1PA 1C8VA 4CQAA 4IOTA 2V81A 4UFMA 4EWND 1K3UA 3LCHA 3KXQA 3UWZA 3GIYA 4O0KA 3O6YX 2FPYA 4OV9A 3MP4A 3EX1A 3GXNA 4P61A 3EX3A 4AB4A 3P81A 4HKPA 5IBXA 5HWMA 3EKLA 1I4NA 1NAL1 1SW3A 1KM3A 2WNZA 5G2IA 1VZWA 4PTNA 2A6NA 1QCWA 1EWDA 4UC5A 2W79A 2A85A 3P62A 1H7WA 3N14A 1H7OA 1F5ZA 4S2BA 3QW3A 5BRBA 4K7VA 4UTWC 4MPQA 3IGUA 1TB3A 3W1QA 2QCHA 2RH9A 3DFNA 1EUAA 4MFEA 4ZVJA 3A9IA 1H5YA 2EPHA 3S8HA 3L9CA 4XUGA 2Q8LA 3ANYA 2WOQA 4Z08A 2VC6A 4MOZA 3A23A 3MYOA 4C1LA 4L4MA 1SSGA 5AN7A 4O52A 1SW0A 3W7GA 4QIUA 1ZNNA 4I9AA 4MYXA 1JULA 1SQ7A 1THFD 4ZQMA 1B3OA 3PULA 1F05A 3NQAA 1D9EA 2H90A 4NXSA 4JX5A 2ABBA 5DN1A 3TMQA 3PS7A 4ADSA 3I7SA 3LCLA 1P0NA 5CPMA 1M5WA 1HO4A 4UMBA 2X2GA 5SWUA 4UFJA 1HG3A 4LV4A 2JKEA 3G24A 1VCVA 1V7YA 3LB0A 3L65A 3NZ1A 3P74A 3NOEA 1U5JA 2A7NA 2RDUA 2CZEA 3G1XA 5D33A 4LVAA 5A8GA 2Y70A 4M19A 3MI6A 3TXZA 4LS1A 3SR7A 2OCZA 5CPOA 4X22A 2QF7A 1MEHA 5F2GA 3NM3A 4MJZA 1UJPA 1TYGA 4MZ8A 3MMTA 2A7PA 3T55A 2CZ5A 3W2KA 3UQNA 1UUOA 3BG9A 3W87A 4A3UA 3TQVA 1DQWA 1PVNA 3NGJA 2WPBA 1M6JA 4GUGA 4P2VA 3S5NA 3O1NA 4HNTA 3B05A 1ZY9A 2PE4A 1W5PA 1JR1A 3NVTA 2NXIA 4OWGA 3U6WA 3G0UA 1Q3NA 2X1RA 5HUPA 3QEZA 4WY0A 4IMDA 3O15A 3ZWSA 3O07A 3PVFA 1FCQA 4BK9A 3CIXA 3INPA 3LBMA 2FPVA 1G67A 4IGHA 4RXFA 1FQ0A 1EIXA 3E96A 4CLMA 2XFWA 1PHWA 1WV2A 4NNCA 1L6SA 3TAOA 4BFAA 5BMXA 1DV7A 1FY6A 3M5YA 3N73A 5EBUA 1GVFA 4K36A 3IIVA 1DQXA 1OF6A 3WK1A 1KBJA 1DJNA 4YWIA 3WJYA 1KLYA 1NF0A 5H2ZA 4PA8A 2ZRWA 5A5WA 3MYPA 1X1ZA 3PSWA 4S2CA 1IXOA 3LTYA 5LGZA 5C6MA 5HJLA 2KZHA 3KAOA 1CI1A 4C1KA 4Q32A 3A24A 2V2CA 2ZFAA 3DXIA 5CGQA 1YDOA 2H8XA 3W7CA 1G4SA 5CPNA 1BWLA 4D2JA 2ZZ5A 2EF9A 3TE9A 4DBEA 3ZR4A 3P80A 2FQIA 3HB9A 3LHWA 5I3IA 1KV5A 1DORA 3GXTA 1JVNA 2XN2A 1TO3A 2Y61A 3HPXA 1OHLA 2QCMA 5F4WA 3M47A 3S9YA 4DO4A 1BKSA 1TREA 2C0AA 3NL2A 1U83A 1VYSX 1QPRA 3V75A 3FOKA 4GXMA 1SZEA 1F76A 3KVLA 3LCWA 2VFIA 3W22A 1EUNA 2GVJA 4GE8A 4MUZA 2PC4A 1TTIA 4RZ5A 1QDSA 1GPWA 3NPWA 1YADA 3G18A 1WOAA 3HPSA 1I2OA 1OK4A 1QWGA 3BLFA 2TSYA 4H6KA 2C1HA 1AW2A 4NX5A 4HPJA 2B7QA 2FB3A 2ZYFA 1P1XA 2ALDA 4K6AA 3LHUA 3U2OA 1KLZA 5HMSA 1PIIA 3GDRA 1TIMA 3LXBA 3MP3A 4UR8A 2QCGA 3NQMA 3STEA 4GBUA 4LS2A 3W23A 5F2LA 4BR1A 5FF3A 4YLWA 4EIVA 4Z1AA 4JX6A 2CLEA 3T4CA 5KITA 4FXRA 4R34A 1SZNA 4RKAA 1H7RA 3TMLA 4LVBA 1X6UA 3LHYA 1O95A 3G1AA 3TJXA 3H53A 5DY3A 5IM51 3S5YA 3QZEA 2OX1A 3C6CA 1TPH1 1J2WA 4WY0F 5CZJA 2VENA 5FF0A 5K9DA 4GUJA 4HHPA 2ZA3A 1RD5A 4DEFA 1KFKA 3U8GA 3M41A 4JTGA 3LTSA 2E5BA 2YGYA 2CLOA 4E2BA 5E0KA 3TH6A 2DZWA 4NX0A 3C2RA 5C55A 2J9YA 1LP6A 2VFFA 3C4UA 5DBUA 1GYNA 1NSJA 3F1QA 1X8FA 3DHFA 1W5NA 1JUEA 4PH6A 1LCOA 3BO9A 5K9CA 2VFGA 2QR6A 1KV8A 3M6YA 5BW6A 3OVQA 1HL2A 5D2VA 1TQXA 2B7OA 3SY5A 2QAPA 3KOFA 3NPXA 3FYPA 8TIMA 4WXZA 3B0UX 4IJBA 1VHNA 2B0MA 3BW3A 3DENA 3P82A 3LXAA 5G2HA 3GNDA 1SUXA 4UFKA 1FDZA 4RZ6A 1XFBA 4MZ1A 1TJPA 1LYXA 3NPUA 2Y7FA 2C13A 2V0TA 4RCXA 1Z44A 2WV8A 4UTWA 4NZFA 1KM0A 3NAVA 2C14A 1JCLA 3O6DA 1VPXA 1TRIA 3CWNA 2QDGA 1QO5A 1W56A 5BMWA 4E38A 3N9SA 4DQWA 4MYAA 1F73A 4GJ1A 1K8ZA 2J9XA 3KFTA 2E6YA 4XBSA 2C19A 3C3NA 3MHGA 5AC8A 3C52A 1ICPA 3MBDA 1ZAIA 1OFAA 1VR6A 3SGZA 4EF8A 1LRNA 2VFDA 3L5AA 4BWLC 2DU2A 3B03A 3BG3A 1TV8A 3VKJA 1DL3A 2YR1A 2NXGA 3W7RA 1VLWA 1A5AA 5HINA 3SECA 3W1XA 4QAIA 1IGSA 4JNMA 4RLIA 1G4PA 1QMLA 5I3KA 2C6QA 1VCGA 2NUXA 4UTJA 1MEIA 3OBKA 3UZ5A 4Q4KA 3QQ1A 3EWYA 3L5LA 3KX6A 2JGYA 3NG3A 5F2IA 3CPRA 4M5PA 4AVFA 5AB3A 3R5EA 2TPSA 2FPTA 2X1UA 3JR2A 2BLEA 1IIHA 3GXPA 4YL2A 1XBYA 3IV3A 3NQFA 3L0NA 4WY0B 3W76A 3NQDA 1K7XA 2WKJA 2PRMA 4ALDA 1EEPA 3A22A 3W88A 1SO3A 1X7FA 1LOLA 2V9DA 1OFBA 4JTTA 1QAPA 2FFCA 5DCBA 1NVMA 4DXVA 1L2UA 4ZQPA 3LLFA 2TRSA 1R47A 2QUTA 3QMSA 5LNSA 1SO6A 3M0ZA 2CLHA 3TW7A 1YDVA 4IXHA 5TQLA 3TC6A 1ICQA 1KM6A 4UUIA 2DJLA 3LV5A 4UXDA 3G1FA 1M7PA 3WJWA 4EF9A 4AXKA 2GUUA 4XTDA 4UTMA 1YTKA 3G22A 3PY2A 3LTPA 4QISA 3G1VA 3DFOA 1D3GA 1HO1A 2ISWA 3QH2A 2Q3RA 4HT3A 3HBLA 2Y62A 3I6RA 3FJLA 2BSLA 4LW7A 2C18A 1WBJA 1R46A 3G0SA 2CLFA 1F2JA 2BTMA 3MJYA 4O0ZA 4A2RA 1LRTA 3TV8A 4AWSA 5FEXA 3S42A 1NFBA 1QR7A 2VEKA 1FCUA 1H63A 1ZAJA 4Y6GA 5LNRA 3GDKA 5T26A 2XN0A 1FXPA 2GQ9A 2JGQA 1OVDA 5D03A 4JY8A 5ABTA 3V1PA 2DZTA 1O5KA 2WO5A 1H7PA 1JRBA 3L66A 3W7DA 4TX9A 4Y9AA 3NDOA 4XQ6A 4RK8A 4NJKA 4O1AA 5DELA 4HNUA 2ZZ4A 3MI3A 4IX2A 2LLEA 4O8RA 3DFQA 1IF2A 1OX5A 1OFQA 5HNRA 1I8JA 3M5ZA 3LBCA 4JGDA 1W0MA 2X16A 3FJ6A 3EXRA
chains in the Genus database with same CATH superfamily
1XP3A 4FOKA 1ZAHA 4WDXA 2Q71A 4S3JA 1ICSA 2PSNA 4TVUA 4KGLA 2W66A 3ITYA 3FXGA 1DJWA 2REQA 3WF4A 3EEZA 5L6UA 3ABOA 2J88A 4O11A 4JCMA 3FJNA 3JW7A 4CD5A 3R8RA 4Y90A 2OEMA 2DSZA 5AHLA 3RCYA 5F7UA 2IQTA 3HG5A 3E2QA 1UR1A 2OXNA 1ADOA 4QNEA 4H9YA 2YA1A 3RILA 2VMFA 2RKXA 1GOIA 4GIRA 1B2YA 1XFCA 4GD0A 3ISIX 5JIPA 4R33A 2OQYA 4MLJA 1T99A 1ZLPA 2IPFA 5I3GA 5AYZA 1R2SA 3CV7A 1IQ8A 4HZMA 1Z48A 2B7NA 2DSWA 2VR5A 2F84A 4QLKA 1Z32X 1NOFA 1PKMA 1XC4A 1KRBC 1J6OA 5CPLA 1QNRA 1RBLA 1J4EA 3VKKA 2OZ3A 3CV1A 3A13A 3ZJ7A 2RHGA 3C8FA 3C0QA 1KFBA 1R0MA 3GAKA 1GW1A 1LT7A 2YDAA 2UZ9A 3POCA 4YTUA 3WF2A 3SDOA 2WK2A 2PWHA 1XYZA 4RXGA 3TCSA 1GNXA 1BVZA 3UP8A 3P7YA 1AZ1A 4WRHA 2RDXA 4NVTA 4XK2A 3LYEA 2CLIA 1NWSA 1TPDA 3LPFA 4CD8A 2C1GA 1TMHA 5CH9A 1O94A 3AICA 3THQA 1W8SA 1I75A 2Y8VA 3WK3A 3RLVA 1ME9A 1JGIA 5DLCA 4ACZB 2FIQA 4CUCA 4LQ1A 1JF6A 2WMKA 3W1NA 4L9YA 3A3XA 9XIMA 1ODUA 4JTRA 1YNYA 1EC9A 1FCBA 2AGKA 3ITLA 1NJJA 4PMRA 3VO0A 4GZJA 3FSTA 3C3UA 4C1NA 1F3WA 1MFUA 4LAOA 3M0IA 3AHVA 1UW9A 4XWUA 3USZA 5T91A 2VI0A 2I5IA 1LBFA 4FNPA 3GE7A 1PTDA 4IQJA 3GSMA 1NELA 2PCEA 3GDLA 1Q4WA 4JTKA 3T05A 3BV7A 2XGBA 2XFFA 1NP0A 4GQGA 3KTXA 5M2FX 3EAUA 4PMQA 1PHQA 2QLYA 1T6MA 3SFKA 1EXPA 1MXDA 5EFFA 3N4EA 2OG9A 3LM7A 3CNYA 4G2DA 4LRTA 3SCTA 1SSDA 3LDVA 4JFVA 4CNOA 1X98A 3WUGA 5CC7A 1O60A 4F0RA 4H19A 5EMUA 5I00A 1IT0A 3VGBA 4IWWA 4GWEA 3TSMA 5EYWA 3L12A 4Q7IA 1TPB1 4KBXA 2WKGA 2VC9A 3UA3A 5IFTA 2QDHA 5M1TA 4DJDC 4LALA 3GX9A 3PZNA 1K70A 4AX7A 5CG0A 3W7NA 5AC7A 2PDCA 4LYKA 3L4ZA 3RG6A 3LXCA 2QDDA 3G6MA 3QGVA 1SR0A 1OX6A 1EXBA 4K7YA 1LWHA 4PRWA 4PTWA 2QKFA 3GHSA 1KCZA 1VPQA 1EEXA 1HF6A 3WNLA 2GVEA 3IJ6A 3M1ZA 3VC5A 4N42A 3VKBA 5REQB 4U28A 5M5DA 2QJGA 2JALA 2R14A 4F0LA 3QFEA 3AYTA 4NP7A 4UB9A 4U33A 4Z1BA 2E1DA 3SRHA 3AS0A 5A8OA 2QIWA 5HMFA 3TIMA 2C15A 3CT7A 3UETA 3AYVA 4QQ3A 3N4FA 4XBKA 2W67A 1HJUA 4QG9A 3VABA 3SJNA 2PURA 3OHIA 2CBJA 4PRRA 4WUIA 4N9CA 3K8MA 1O4UA 1W3NA 1N82A 3QGAC 1B3VA 2PLKA 3GFZA 1SFLA 3ELFA 5U4NA 4H00A 1W2PA 3QR3A 3KP0A 3UPWA 3ZM8A 4PBFA 3CH9A 3OU8A 1QFEA 1K8CA 2I1OA 1MEWA 1CXFA 3U0HA 1G4EA 1VPYA 5G1MA 2GGEA 1S5VA 1DTUA 5EY5A 2EJAA 3GNRA 3GG1A 4I9JA 1J5SA 1KRAC 2DSKA 2ZZ3A 3RM9A 1LL7A 1X7IA 5AHMA 5D2YA 2G96A 3NDYA 3VXGA 1NEYA 3OO2A 3W81A 3PFRA 1E9YB 2QV5A 4A29A 3W75A 4O1DA 4IIDA 2XH4A 4Q22A 3BGAA 1D3HA 3PM6A 1G4TA 3E5BA 1Q7ZA 1GQJA 3OVRA 4I3GA 1XLCA 5C5YA 1I45A 1HNYA 3O2LA 4P5UA 1UQZA 1QU4A 1Y65A 5AC6A 1ZBVA 4FX8A 2PI6A 5CAKA 4NG3A 4LV9A 3ITOA 3TW9A 3DYOA 2DV0A 3N6QA 3OQ8A 4A21A 4I6VA 2JKPA 1DWGM 5I6SA 2B4GA 1XIBA 1GYMA 2AQWA 5LNVA 2PDIA 2Z25A 1H60A 3SQMA 4U10A 4OJYA 2Y89A 3QW4B 4PMVA 4H7VA 5AHIA 4ILSA 4KFOA 3EX4A 1GG0A 4O16A 5C9UA 1GQIA 2NT1A 2ZOXA 3C56A 2NX1A 3CQJA 4C6JA 3QPYA 2CITA 1ZQ5A 3DGRA 4B4HA 5JQ9A 4JKKA 3URQA 4I8DA 4DWSA 3H6OA 1RPXA 1SJDA 4W85A 3AYRA 4G9PA 3PB0A 4FXSA 2GGJA 3BWWA 1OYCA 3ANUA 4DJFA 3N12A 1OZQA 4FA3A 3SGUA 1RA5A 1TTPA 2ZE0A 2HMCA 3V4BA 4PULA 4GX8A 1MRQA 5HMDA 4JFWA 3O06A 5I78A 3KM8A 3W7JA 5BU9A 4HNNA 1LM1A 6TIMA 1OCNA 1JDAA 3TNBA 5LNWA 2GQ8A 2YA0A 2YW4A 4LNYA 1W1ZA 2RJHA 5DXYA 2ACRA 1EX5A 3ZS4A 3K1DA 4TTGA 1K8XA 3MA8A 1OGGA 1JCYA 2R24A 1M68A 3CQHA 1IGWA 4X9SA 3GKAA 4A6GA 1XXXA 4H2HA 1ZHAA 3TTOA 3OJGA 1OCJA 3RUBL 3W1AA 3LS9A 1EJXC 4IX0A 5AHNA 3DFHA 3GXIA 4ML9A 4D6FA 3EOEA 4FMVA 4DUVA 4GY1A 2ZZ1A 2RFGA 3SCNA 5CG7A 3MCMA 1CLVA 2FTWA 1DOSA 3UJFA 4KWUA 1AFSA 2HS6A 3SO7A 3DOPA 3KOYA 3FS2A 1XW8A 1CXHA 1QOPA 3C0JA 5H6HA 4E3VA 4RDZA 4NXKA 4JS3A 3ZXWA 1FWSA 1GEQA 1MUCA 3S5OA 2OOGA 4IM4A 1HL9A 3SN4A 1UBSA 1QPQA 5E09A 3B8TA 3WLOA 1F6KA 2Z2BA 2XGZA 4IPIA 3FA3A 4YCOA 3I10A 4FEZA 1UWUA 3AC0A 4LT9A 4H41A 3TTQA 4LS0A 5CZTA 1L0PA 4GYKA 3RXZA 3RF9A 4IIEA 4DBDA 3UWVA 3KL0A 2WLZA 3AHXA 3T8QA 3UESA 4DYEA 4RPPA 2VRKA 3DYPA 3L0GA 4HZ6A 1W9UA 4XZ9A 1WDQA 1VBGA 3MCOA 1SO4A 4LPCA 2WZEA 2WXDM 1JCXA 3UXLA 1O1HA 3SZ8A 3U5YA 1AQ0A 3S0CA 4QBXA 3I65A 3VCRA 2PDKA 1E0UA 3RLUA 1RLCL 4Z42C 3UZZA 1X1OA 2HBXA 2Y1HA 3W85A 2WANA 1F7BA 2PD5A 3N2TA 1KKRA 2YX0A 4MFDA 4ZB5A 3PZTA 3R0UA 3NZRA 8XIMA 1M53A 2W6RA 3W27A 3T0BA 1UMYA 1YXCA 3FSUA 2WSYA 4C91A 3VA8A 4NZ3A 3PR2A 3Q58A 1OK6A 3BURA 3E2RA 1A53A 1QTWA 4QLJA 1IXQA 4LSBA 4N9DA 3EA3A 5D38A 2DJXA 5I3HA 4J3VA 4Q4OA 2PTWA 5HR6A 1YNQA 5MKGA 4HA4A 5HATA 1EOKA 2V67A 2ESCA 2E9MA 2FLIA 4DRSA 1ZB5A 3E9AA 3SCSA 3VZYA 4EWJA 1RJRA 4D8AA 3FN9A 2PDMA 5J8LA 1MO0A 1WZAA 3LX9A 3S47A 4TMBA 2YL6A 1JJKA 2J6XA 4C7GA 1M41A 4IIGA 1J0HA 1JZ6A 2PP1A 3K8KA 4IL2A 4XD4A 2V2DA 4R7WA 1FWNA 1VBRA 3I7QA 3BQ5A 3G3DA 2DT2A 2NX3A 4IG2A 3WEOA 1E0VA 4A3HA 4IPJA 5LHFA 1DJGA 1HJVA 2VT0A 4Q8NA 2GWNA 1A0CA 3SQSA 3GXFA 4NJHA 2ZZ2A 2G3NA 1F61A 5HOSA 3GW3A 4LUTB 4N9BA 5EGRA 4MZYA 5AYIA 2YZRA 3W70A 4B5UA 4UTTC 4UFIA 4NJGA 3M43A 2OVLA 3QKEA 2ZBTA 4HN4A 5G4WA 3GXDA 1EPXA 3F5JA 1AJ2A 3N4AA 4MY1A 4D71A 2ZZ7A 1UR2A 4UR9A 2XVKA 1JCMP 3TZFA 1YXYA 3IGSA 4L9ZA 2QXWA 4DBUA 4UWMA 4P7LA 1SGJA 1R3QA 3JUGA 4XAYA 2DUAA 1KB3A 1PX3A 2YYUA 4EK7A 3QRHA 1Z3NA 1F3EA 1G7UA 1N2VA 4CQCA 4K8HA 3GHUA 2DIJA 4QEEA 4WD0A 3AIQA 1TE6A 3KHJA 4LB4A 4URIA 3MDWA 3C61A 7TIMA 1BEUA 3LV6A 2QCNA 4EP8C 1AA1B 4CEUC 3WK2A 2QQ6A 2OODA 1UWSA 3UG8A 4RR4A 4GFIA 4X2PA 3EOUA 1Q85A 2CYGA 1UKSA 2Z0IA 3OVGA 1EYEA 1EBGA 2V2HA 3VIJA 3NA8A 1C92A 3LI1A 4UFLA 4DJEC 2ABAA 4H9TA 3NSXA 4AW7A 4HSNA 3XISA 2ZXBA 3LCGA 3WK0A 4Z2GA 3C2FA 9XIAA 3PC0A 3UYIA 2ISDA 1AQHA 2WBGA 1K7EA 1VJSA 4ZSUA 2CLKA 3HZ3A 5E0CA 2VZVA 2NV9A 3MZNA 3SY8A 1UIOA 1LUCB 4RNFA 2D0FA 3OEXA 4JTDA 3WDJA 2W27A 4X2RA 1DP0A 3NTYA 3UWYA 3H2CA 3EB2A 1GOQA 1XQKA 2AAAA 2WAGA 2W91A 1GVQA 2X40A 3AIWA 4QE1A 3LHVA 3GR7A 1TX2A 1O66A 3YPIA 4ZOAA 3DERA 4DZAA 3S1XA 1JUBA 3O16A 1DIKA 1GVRA 1K9EA 2YCLA 2JIWA 3WQWA 4JL1A 3S1UA 3RGTA 4RNJA 1EH9A 3DAQA 1XKJA 2GSHA 2VZSA 4TR9A 4OZOA 1VBHA 2Z6JA 4D8LA 1YTEA 5IDZA 1F07A 2D73A 3PZQA 1OC7A 1TUXA 2W92A 4JEJA 1F6PA 5E6YA 4F40A 1IZCA 2PWFA 5FJRA 1HIZA 3FHAA 2J6VA 3QM3A 3I3BA 1YNPA 4F79A 5AFDA 1F8MA 1LLOA 3QYQA 5B7ZA 3C2EA 4PUUA 2OX4A 1LLWA 3S2NA 3IIZA 2OLSA 4PB3A 1A5KC 2WVUA 3PBYA 3QV6A 3O3RA 5C0QA 1XCWA 4UCGA 1EA0A 3TSBA 2FGLA 5BOEA 1UKQA 4AD4A 3UJ2A 3GAYA 4U3CA 3IEBA 3VMOA 1H50A 4HPGA 3JZUA 1KBIA 3DKJA 4AHPA 2JK2A 5HULA 1AJ0A 1QPKA 1GPFA 1M04A 3VNZA 1YHTA 1K77A 2J4GA 1BQCA 1N8FA 5EB8A 3W25A 2CKSA 4TIMA 5C54A 4IMEA 3LY0A 3BSGA 1VENA 2UY4A 2PZNA 1RCOB 2TMDA 2INZA 2OQHA 4BI5A 2J74A 1H1ZA 1EYWA 1G7VA 4D6IA 1G94A 2Z2AA 4GY0A 4XG1A 2QNEA 1XIEA 1F9CA 1FWRA 4AAJA 4E8CA 1FDJA 2HXUA 1E6NA 4K39A 3OTRA 1RV8A 2V30A 1GTHA 3TP4A 2DQWA 2RDTA 3OGRA 3CYVA 5G2WA 4M24A 2VGGA 4JXCA 3AHTA 4A3QA 2DW7A 3QZAA 2EG6A 1B9BA 3MANA 3PUDA 3H12A 4DN1A 3UCDA 2PPGA 4N02A 3FX4A 1XRSA 1PZ0A 4GHRA 2CC0A 5GPRA 4OGZA 4X3ZA 2QUVA 1JZ3A 1T41A 4BEUA 1BTMA 1UOKA 4V2XA 1VFFA 3WQVA 1E0TA 4LF1A 3K2GA 2D2HA 2WMIB 3TDFA 4PSRA 5FJUA 2VO5A 4KT2A 3GFYA 2AL2A 2JE8A 3RNDA 4H6EA 1QHZA 5ABFB 1MW3A 3E38A 5EL1A 2V6AA 3VYLA 4HPXA 1J5TA 2A4AA 2ZTKA 3KE0A 1OIFA 1B3YA 3W37A 4ZQOA 4OUIA 3A64A 3ABSA 3QV8A 1UG6A 3UXKA 2MUCA 1EJ7L 3VI2A 1HVQA 5K4XA 2EPLX 2OZ0A 3TN5A 1E72M 4HU3A 3LK6A 1OJXA 1ZBKA 5LA1A 4HTYA 4J2MA 4K8EA 1KW1A 4ORIA 1POJA 5GJNA 5DY2A 4RNIA 3AJXA 2VOMA 2X0HA 1EQPA 4REQA 3S2CA 3W73A 4H3DA 3VFLA 1DHPA 3OVPA 3MC5A 3B0YA 1T5AA 4BI6A 3DFSA 1FX6A 3OYXA 2VP8A 3OZYA 4LEQA 1CCWB 2O7QA 1W9BM 4N0RA 2QPUA 1DYSA 3MHUA 3ABQA 3CB8A 3REQA 4QS5A 4IGMA 3ZQ9A 3CUJA 5I3DA 2NV1A 5G5IA 4PBGA 1E4MM 3E12A 4A22A 1U30A 3P3BA 4W7WA 3T7VA 5AYXA 5CQ1A 3QVQA 4PTMA 3RX4A 2EJ1A 3K4DA 5E1QA 4LUJA 1TPWA 4HZ8A 4QHRA 1OQFA 1A3HA 1SPQA 3NSNA 4D8ZA 1TR1A 1AODA 1W3TA 4DYKA 3HG2A 5ECVA 3I6TA 2HE5A 1ECEA 3PG8A 4KWOA 4JNYA 4KMQA 3T07A 5HBFA 5HNTA 4RNHA 2X1IA 2V81A 4EWND 2GDUA 1U2YA 1OCQA 3GIYA 2FPYA 4OV9A 3MP4A 4Y9NA 1E3ZA 1XD0A 1MXGA 3CZKA 4P61A 2GWGA 4AB4A 9CGTA 5BU6A 2J7BA 5I07A 1GZ1A 4PYSA 5HWMA 4XIMA 4O1EA 1KC7A 2KAUC 3VMNA 3EKLA 4GG9A 3VDCA 2Z26A 1ADDA 1QCWA 2ZUVA 4GYJA 5HJXA 4EAYA 5IRPA 1F8IA 1XSKA 2HPIA 5BRBA 4MPQA 3IGUA 2VD9A 1V93A 2J79A 1EUAA 4BS0A 4MFEA 2O0TA 3VOIA 3CAVA 3S8HA 4MM1A 2GDVA 2Q8LA 3GY1A 3WFLA 1JEZA 2ZKMX 1HN1A 4D6CA 4H6QA 2VC6A 4MOZA 3A23A 4PCPA 4YTSA 1PZ3A 4O52A 5C9WA 4GZ7A 1SW0A 3W7GA 2C8NA 2PP0A 3L4WA 1ZNNA 3GHRA 4I9AA 3SM0A 1B3OA 3PULA 1F05A 5BXSA 4JX5A 5DN1A 4JIEA 3PS7A 3I7SA 1P0NA 2PLCA 4W87A 4JOMA 1HO4A 3TEVA 1HG3A 1J12A 3QTGA 4KESA 4GZEA 1U5HA 4ZOEA 4PUKA 4B9YA 3WUBA 4AD2A 3P74A 3NOEA 3UNTA 2V5DA 3LBOA 1EQCA 2GUBA 3SUSA 4M19A 1WZKA 3WUFA 4HJWA 3XINA 3F7JA 4LS1A 3SR7A 2OCZA 3AZTA 2PBOA 4MJZA 3JZEA 4RDVA 4C6KA 3WDHA 1IYXA 4JZ5A 3UQNA 1KQYA 3BG9A 3EOSA 4EANA 3KS5A 3WNNA 2WPBA 4GC3A 1M6JA 2V5JA 1MQPA 2FHFA 1NTHA 3AISA 3A3HA 4KCWA 1HKKA 4YIWA 1PO9A 1ZY9A 4KPLA 2JIEA 2NXIA 1JAKA 3VDGA 1CGXA 3PZMA 2YL9A 4B16A 3PVFA 3WFZA 1A5UA 3HA1A 2FPVA 4MWAE 3VPLA 4RXFA 2GGHA 2OELA 3VAVA 2XFWA 2Z7KA 4NNCA 4H9XA 4L1GA 3TAOA 4PTDA 5AVHA 3SGGA 3HURA 3ALGA 4TXEA 4GXWA 3BH4A 1VEMA 5H1WA 1Y5VA 3WJYA 2VYOA 2Q02A 3BJSA 5A5WA 3MYPA 1UHVA 2R1NA 4MNKA 3LTYA 4J40A 2OSWA 4B5VA 3O0FA 2GL5A 2WVVB 5LIWX 5C6MA 1W1B1 1WB0A 1CI1A 3WF0A 5A6SA 2I7GA 4AUBA 1OM0A 1S2VA 4HD5A 4ES4A 1W9DM 4QXIA 1MYRA 4D2JA 2ZZ5A 3TE9A 3P80A 3ARPA 3LHWA 3RIKA 3GXTA 4UQCA 1TO3A 2Y61A 4CEXC 4GA8A 1E0WA 5F4WA 2PGRA 1RLDA 1BKSA 2QJMA 2C0AA 4TOQA 2H9AA 1TR9A 3FOKA 4GISA 1SZEA 3GVWA 1GOWA 4DYJA 3MMDA 1EUNA 1AD1A 2PC4A 1TTIA 4L9XA 3NPWA 3G18A 2OLHA 2VDGA 1X97A 3FGCA 3BLFA 1EZWA 2TSYA 1AD4A 3CT2A 1AW2A 4NX5A 4J3SA 2FB3A 3U2OA 3RYSA 3KS6A 1BRLB 1ZCCA 2D0HA 5BZAA 1TIMA 4K1GA 4WKFA 3SSZA 5F2LA 4BR1A 1UROA 5FF3A 1GUVA 1UKPA 4Z1AA 3WNMA 3U48A 4NIRA 4FXRA 4RKAA 3BLLA 3OOQA 4LVBA 1JF5A 2J7EA 5LIUX 4UQEA 2E9LA 1P0BA 3L4XA 1J2WA 1XH2A 1I9CB 5K9DA 1KRMA 3ICJA 1XISA 2VHLA 1RD5A 3WDPP 1REQB 1KFKA 3T0TA 3GQYA 2BFGA 1C7TA 2O9RA 3NO1A 4FR1A 4C6IA 1GW9A 2YGYA 4E2BA 3TH6A 1VFMA 3U2EA 3EKGA 1GYNA 3F1QA 1MQRA 1HKIA 1UA3A 1JUEA 1LCOA 4MWAD 4W7UA 5EMJA 2VFGA 2DSUA 5A1AA 1FH8A 3M6YA 1GORA 5IHRA 4MUPA 1I0DA 1VHNA 3H2NA 3BW3A 3DENA 3P82A 3UVAA 3BTNA 1JDCA 4XAFA 4UFKA 2FHCA 2EPMX 3VIKA 4MZ1A 1LYXA 2C13A 1TV2A 5A6AA 4GVGA 4NZFA 3NAVA 3TTYA 2C14A 1EX1A 1JCLA 1XR2A 3O6DA 2EBNA 4KIEA 3ITVA 4FXFA 1LQ0A 2VRJA 1Q6CA 4GJ1A 4GO9A 5DO8A 2E3ZA 1Q8AA 3MSYA 3CIVA 2CZVA 3A47A 3MHGA 2YXXA 4LBSA 3R8GA 4CN6A 3B4YA 4XSMA 3MBDA 2ZVIA 3WQOA 2NLYA 1TFVA 4EF8A 4LYRA 2DU2A 2DT1A 3VKJA 1IEVA 5D8WA 1VLWA 1RJPA 3UFYA 1IGSA 2VUNA 3H22A 4JAWA 1PXGA 1CB7B 3OBKA 4M80A 3EDDA 3BOFA 3WMLA 3L5LA 4M3PA 4QLLA 5DEZA 1TZ9A 3V0TA 5CGTA 5AB3A 1LWIA 1VFLA 2TPSA 5DFAA 2X1UA 1IIHA 1VP5A 2Y5JA 1UZ1A 3IANA 4GGBA 4YL2A 1VF8A 3NQFA 3NZQA 3MSDA 2WKJA 3VIMA 1A0EA 4ALDA 2PTYA 1EOMA 4BA0A 1SO3A 3QOMA 1OFBA 2ZXAA 4S3AA 1QAPA 3TJIA 1D7FA 3KRBA 2CPUA 1J10A 5FACA 2QUTA 3WLKX 3VTRA 1SO6A 4MF4A 1ICQA 3BMVA 3WMCA 1H11A 1S1PA 1XC6A 2ZUTA 3W28A 4QISA 2V68A 4XZLX 4JQAA 4Q3MA 4BEQA 3R43A 1Q6EA 3FJLA 4LW7A 1H3GA 3WCZA 2BTMA 3MJYA 3RN6A 4O0ZA 5CZKA 4A2RA 3ZJ6A 2YIHA 1XF0A 1CENA 5T26A 3B9OA 1Q5MA 5C2GA 5ABTA 3FV9A 2DZTA 1O5KA 3L66A 1JRBA 4ZCWA 4HQVA 4CN4A 2ZXQA 4RPQA 3NDOA 4RK8A 5REQA 4A3YA 4O1AA 4C90A 4JTAA 1P0DA 4KETA 3FHQA 4LBUA 4F4RA 6ENLA 3VD7A 5HNRA 1XRFA 3M5ZA 3UA4A 3WQ8A 1H09A 2DSVA 4JGDA 3CL7A 3PTKA 2EPKX 3FJ6A 1C93A 3ZT5A 1X6NA 4XD3A 2J24A 4AZIA 4NJIA 2VZTA 1NOUA 1QOQA 1HT6A 3GHTA 4ZSTA 1V3MA 4H01A 2GJRA 3UXDA 2W63A 2E5DA 4W8BA 3AALA 2J47A 2QCDB 4XO7A 3OYZA 4PFMA 2QJJA 1SZRA 2CW6A 1U1HA 4IJCA 2GGGA 5DXXA 3KVMA 2IKHA 4DM1A 4EKJA 1X6LA 3VKAA 3XIMA 3JS3A 5DF0A 2Y7DA 4IIFA 5IOBA 2OT0A 4ERGA 1R30A 4GYPA 4DO6A 5EMYA 1FWBC 4HNOA 3TN3A 1YDNA 2CZDA 1VCFA 4GIEA 3B4UA 4MB5A 2PDPA 3F2CA 4FK9A 1J9YA 3UR2A 1PEZA 3FDGA 2Z4GA 1VFHA 1MZHA 4CGTA 4AZ7A 4QJ3B 1B54A 2IXVA 4W9TA 3BSHA 1J2BA 5KEZA 1BGGA 1OFRA 3W7HA 1UCWA 5HWJA 1CTNA 3TWAA 2XUCA 3U3HA 2GQ3A 2R94A 3TTSA 2R1KA 4UCFA 4C6MA 1GK8A 4CNPA 4KRTA 1DHKA 4U2YA 2X30A 3MI2A 3AJ7A 2E8YA 2PWUA 4C7FA 5M17A 3H2EA 4Q6JA 1XRTA 4MLRA 8RUCA 3RITA 1H61A 3CM4A 3DFPA 3GC2A 2VEPA 4G1KA 3U2CA 4KGJA 3TYDA 4EVZA 1TJ0A 3P8JA 4PUDA 2VM8A 4QDMA 3AS1A 4MY9A 4QJ1A 4LUIA 4AEOA 3LHTA 4CCCA 1UP0A 3NWRA 1NDYA 4QDWA 3TAKA 3L0KA 2PGWA 4JQ3A 2QCEA 1DTNA 3T2OA 1XG4A 2E6AA 4EPEC 4C6NA 1PTGA 3L4YA 3I6EA 5FD0A 4CVWA 1R9YA 3EDKA 2WKLA 3QLLA 1XCFA 3WQ6A 1WYIA 3TK7A 4ZA0A 3TLLA 3WJSA 4LY8A 4JTIA 4Y7EA 3KWSA 1H4PA 3FIGA 3TR9A 3B9NA 3NYZA 3APYA 3LD5A 3OLEA 1S3HA 2PTZA 3SFWA 2X8RA 4IL0A 3MPGA 3LU2A 1VHCA 1XHGA 2ASHA 1VYRA 1M03A 4UFHA 1A5CA 3RJYA 3C0SA 1PAMA 1WPCA 2BOFX 3FY1A 4FALA 2PB1A 3M46A 5FF4A 3LERA 2PFHA 1P43A 4MMWA 4ATWA 3K4WA 4JTLA 2V8ZA 1T96A 3GC4A 1KBBA 3HJEA 2JF7A 1LBLA 3BLPX 2G41A 3SSJA 1CGUA 3P5ZA 1Q7QA 4B4FA 3LNPA 3TN4A 3WDQA 3HPFA 2HROA 3KW3A 3QBUA 4JTEA 4W93A 1XH1A 1Z42A 4CN1A 2VRQA 2R8WA 4MB4A 2WCGA 4AWUA 1PWMA 2YOCA 1AW5A 3GU2A 3FKRA 1YEYA 4JIQA 4Y96A 3A21A 2BGQA 1PPIA 2R1PA 2VX5A 1XV8A 4GI4A 1O68A 1OF8A 5LXEA 1U5VA 2PEVA 1S5WA 1XCXA 5DRCA 4LOCA 3P14A 4M0XA 5KZ6A 3PSVA 1EGMA 1MRAA 1RQBA 4AD5A 2Y88A 3EKZA 2QUMA 3DH7A 4OBRA 3HG4A 4AZBA 1E15A 5CC5A 3RCMA 4NZJA 3ENLA 4GQRA 1H62A 1FWEC 3HO8A 7PTDA 4XO6A 2X1TA 1UB3A 3FEMA 4MTVA 3ABRA 3M5XA 3BG5A 2FB2A 3IRDA 2A3AA 4MG4A 3TC3A 4GVFA 4O4VA 1GYLA 3EWWA 2CHRA 2CLMA 1IIGA 3EDEA 3M7WA 1BWVA 3CL8A 2OB3A 1WCGA 3NQVA 3SN0A 8A3HA 1ESWA 1KR0A 4FHAA 1CW2A 2V38A 1Z69A 3F5KA 2NVCA 4YTTA 2YXGA 1K9TA 5BOFA 3MHFA 4ZQCA 1AZ2A 1OSEA 3BPWA 3CXOA 1CYGA 3MUZ1 3GBDA 2Y85A 3DC8A 2XH2A 2EKCA 1V02E 2VX7A 1RR2A 5E9AA 1H51A 1JCJA 1V6XA 3T0DA 1BLIA 4HU8A 4CVUA 2FGZA 2Z28A 4X9YA 4E2DA 1E1CB 2P10A 3EWCA 3GU1A 1RVGA 1UUQA 2ZICA 3VX0A 3HFYA 2JF6A 3L4VA 2CWXA 2VTFA 1WZMA 1RAKA 2J77A 4O57A 7REQB 2GOKA 1UASA 4MADA 4UMCA 1PZ2A 4ZENA 3H23A 4NZCA 5CJNA 4FX6M 5CPQA 2EG7A 1EJUC 3PPGA 3UY8A 3ZIZA 1XLIA 5FJOA 2YFNA 2C7FA 2WC3A 2YDRA 2XSAA 1RZMA 2BOGX 2AGTA 4IGNA 4K38A 4WOZA 1XLDA 4J9JA 2DVXA 2G5WA 1B57A 4LUTA 1TVPA 3GO2A 4A4AA 1A80A 1ITUA 5FKYA 1L6WA 1UWQA 2YXOA 2J25A 2P53A 4BHYA 5BCAA 1BTCA 2CU0A 4QITA 2GK1B 2X0SA 1OGBA 3E0WA 3HOJA 4QTGA 5XIMA 3VIGA 2UV8G 1TV3A 2E9BA 3DX5A 2GVGA 2Z6IA 3CZEA 3H2AA 5MHBA 1XLEA 2YBVA 3AMGA 3WLHA 4J3UA 1OFOA 1YE4A 1H1YA 2YZ5A 4UTHA 2OJPA 4OHQA 2XFYA 3EB4A 1OZMA 1CXLA 5F2MA 1TA3B 2ZRXA 2QHAA 1QWKA 3CAQA 2V3FA 2DQXA 5D9MA 1UYQA 3RO8A 2F6KA 1R6WA 3GR8A 5C71A 3S1VA 1YBQB 1LQAA 3QR1A 5EKYA 3PBVA 3TONA 1S3TC 4X60A 3A12A 3SIZA 4O1CA 5CPSA 1J0KA 3FLUA 1NU5A 5FAGA 5HANA 1FWJC 4B3LA 3KHDA 3WMSA 4B3KA 4PFHA 5B7YA 4JTQA 4KFNA 5KZMA 1DJHA 2XDFA 3O05A 5KZEA 1GKPA 1A5BA 1ME7A 4GX9A 1D8WA 3WJXA 2TAAA 2UWFA 3S6DA 1N55A 2ATMA 2GFTA 5JH2A 4Z17A 1LQ2A 2QEZA 2ISFA 3LZ3A 3W7EA 1PE1A 3Q2DA 4FF5A 4J3WA 4QM1A 4B2DD 3GVVA 1MNSA 1LUCA 1FHVA 4AD1A 3NL3A 3UEQA 3U2ZA 2VGIA 1B3ZA 1QOXA 4LANA 1OX4B 3GRIA 1EPVA 3QGKC 3V0SA 4GNVA 3BLEA 3ALFA 3THDA 1ISWA 1R3TA 1ZP3A 3OBAA 1F6YA 1I2PA 3NL5A 2FH6A 3WLNA 3MV01 3OGSA 2FKPA 1PL9A 3SCOA 4I6KA 3SADA 1FHLA 1KCLA 5EA9A 1RVKA 3U5UA 1SFJA 3NL6A 4DWSD 3ES8A 5I3JA 1CXIA 1E1EA 1V0LA 1XL9A 4HSHA 1FHUA 3W24A 3ZO9A 4DJFD 2QGHA 3NPVA 1A5MC 1YQ2A 1GT8A 3TNOA 4NL1A 3O6AA 4WXYA 1IT7A 1RQHA 1GQKA 3MKCA 1DIOA 2NSXA 4P7QA 3HTWA 5CSRA 4AY1A 3EPNA 5D9NA 3QHNA 4Q8OA 1L2QA 1XQLA 3WLSA 2D2OA 3AS3A 1TUFA 3AQUA 2FGBA 1GVEA 5D2XA 2WSRA 4H6RA 3V5FA 1TQJA 1ZP4A 4JKLA 2A1YA 8XIAA 2NW0A 1Z6KA 1US0A 4LTSA 5CZSA 1GVSA 1V77A 3AUJA 4DPQA 4B90A 3M0MA 1B3WA 2L5HA 3W53A 4G7FA 1DKWA 3FKKA 3UZJA 5BRPA 2BY3A 3DDMA 1SM9A 4LBRA 3TFXA 3DC0A 3W7OA 4PB5A 2IUZA 4P8WA 1PS9A 4G8TA 1YYAA 2C1IA 3S9IA 2IPGA 2FYMA 4CD4A 1KA9F 4GC4A 3M0YA 3APGA 3URNA 2XPKA 4LC8A 4QE5A 3WKZA 2YCEA 4D72A 3IUHA 3V16A 1QVBA 3M0VA 4CCZA 1JDDA 3IVTA 4MGGA 2X7VA 4R53A 5G4HC 5LA2A 4AIBA 2QPXA 2PWEA 1US3A 1YRRA 4GMEA 3EWXA 4KW2A 5ABHA 3UYCA 1TPFA 4YMZA 5AZ1A 3MWAA 1R3WA 4J7RA 4WHBA 3EXTA 4F0HA 2P88A 1ZCOA 3VOGA 4PMJA 4ZODA 4AYSA 4JYDA 2DZUA 1OD0A 4CQBA 4TO8A 3AROA 2HK1A 5D9PA 4ZXLA 2JKAA 1IWBA 2CHOA 3GDBA 4GUFA 3S6TA 3VNLA 2O9TA 5C8BB 2WMIA 1LZOA 1PSCA 3GTHA 5BXRA 4HHLA 2WMJA 5G1YA 3VNYA 3W74A 1GOMA 3LPOA 1TPUA 3H7VA 4FO4A 5F1VA 3CU2A 1IZJA 3J7HA 4DAFA 3HIJA 5LSMA 5FI8A 3CUGA 2J66A 4I90A 1NQKA 1E4LA 3B97A 4OBTA 3CTLA 2PU0A 3VGEA 3PAJA 1J01A 4FIRA 4RUBA 2E8ZA 4E4FA 1JDEA 4WIWA 2HVNA 2WHJA 3TVAA 4LAZA 1RK6A 1UMLA 3FA5A 1UD3A 4MJ2A 1J8VA 3VOCA 4HU4A 5D09A 2A21A 2AAMA 3W7PA 3N13A 3UCCA 5DMLA 4KIRA 4GVIA 1GQLA 4MWAA 1TPEA 4NUWA 1QI5A 1R87A 4LF2A 1U1UA 3FCPA 1E5JA 4ZQNA 3EB3A 1TIWA 2QJIA 3B8DA 1JRCA 1A50A 2PU1A 4NAFB 1UR4A 3GC5A 4TQTA 1E56A 2HTMA 3WL0A 4CNSA 3N6HA 3IV8A 2V3GA 2D0GA 2WQPA 2R91A 4ORMA 4Q4QA 1VYPX 4D1JA 2VVSA 1P4CA 1KFCA 1XYFA 2UY2A 4M56A 4LY4A 3MUY1 4WLCA 5DX7A 4E5TA 5H8UA 2ZA2A 4Z2IA 1BWKA 2Q8XA 3Q37A 4AG0A 4PCSA 3P8IA 4AY8A 1DIEA 5IBXC 1KTBA 1RQEA 1W54A 3R25A 3EMCA 3GB6A 2PTDA 4YTQA 5J04A 4C6EA 2Y63A 1TVNA 4WR3A 4E2OA 2VCAA 4ICNA 4EOUA 1FKXA 3LHZA 4KEZA 1QI0A 5C2XA 1T8XA 1K4GA 3QJAA 1JXJA 3S5SA 1XH0A 4L4LA 1XLHA 4PMNA 3BQ6A 3TX9A 1X39A 4FSAA 1F3XA 4YVXA 1O5XA 1XIDA 1VIWA 1L9WA 1QNVA 3NCOA 4FOJA 3SUVA 4IMCA 4LVGA 1PCWA 2WVTA 2FDSA 1XIFA 3QSRA 3E74A 5BOOA 1K8YA 1EJWC 2FJKA 2VXNA 1R85A 3AIUA 3OLDA 5ABEA 3AFBA 3O6CA 3E0LA 4W8LA 4RX0A 1PYFA 3M5VA 3AU6A 1KGWA 4ZZ9A 2D69A 3BICA 1K6WA 4NQ1A 2ZUUA 1GTEA 2WMGA 2TODA 1SJBA 4ZL1A 2A5HA 2YL8A 4PEKA 4H1ZA 2YA2A 3DCPA 3TYZA 5D32A 4NY2A 3TC7A 4GBDA 1JPKA 1UZ4A 5HQEA 3NZGA 2NQLA 1JZ5A 1XI3A 1FVPA 1SMAA 4NZ4A 3VDHA 3LZ5A 3SCQA 1SU5A 3TJ4A 3ZJ8A 3LCIA 4XKYB 1UUMA 3H2OA 3N17A 1W6TA 4IF2A 2DIEA 4AEFA 4DBWA 1JZ7A 4GQBA 5CBBA 1MQQA 3AS2A 2P3EA 4L80A 2Y7EA 3SRKA 2J9ZA 4L1WA 3E6EA 4A8NA 4FIQA 1FWAC 4FAMA 4XX6A 2INFA 6REQB 1JIBA 4HTBA 4BQ5A 3QPZA 2HJPA 3O8AA 3NOYA 3WL1A 1HVXA 4HN8A 3W1MA 5LKYA 3HN3A 4AEEA 4GIAA 1FFQA 3UPBA 2NT0A 4F66A 2Q01A 2NUYA 2YLAA 1ENUA 1VGAA 4MWAC 3LLDA 5E93A 3W84A 3RO6A 3D0CA 5BRQA 5LIYX 2HNHA 4K3ZA 4M7SA 3UWUA 3SCRA 4GLEA 1EA9C 2I5GA 2QF8A 1QASA 1WXZA 3UWWA 1W31A 4GABA 5FSEC 3BANA 4NNAA 4I5UA 4XTIA 4ZFCA 3TKFA 2HISA 2XINA 4E6MA 2WVVA 4LVDA 1E73M 2ZDRA 5CLWA 4NT0A 1V3LA 1XLFA 2CZFA 1K03A 3B8UA 2VGFA 2ONEA 1TRDA 1DWAM 4DUOA 1N8WA 2SFPA 3WUEA 4JQ2A 1AH0A 3MO4A 4MNJA 4XV0A 2YPIA 3WYZA 4IP7A 1EHAA 1HUVA 3KBNA 2DP3A 1PB0A 1VH7A 4JTHA 1O5QA 3NSMA 1YKWA 2BHUA 1GEHA 4F3HA 2QV4A 2VX6A 2ZWZA 4DY1A 3MDUA 4CKQA 7XIMA 5T9CE 4RE4A 1QK0A 1QNPA 1ZUAX 3RM8A 1WX0A 3IJ7A 3TFCA 2VL4A 1HL8A 3IGXA 4H8HA 3FVDA 3WBEA 4WEVX 3CWOX 1JFXA 3BCJA 3GDMA 4LX4A 4OU1A 4J3TA 3NVDA 3QHOA 3T08A 3W7IA 1PX4A 2PDFA 4O4WA 2WNNA 3VKDA 3KVJA 5J5DA 5AHFA 4O50A 4IPPA 5D2TA 3S2LA 4AXNA 5K2ZA 4LEFA 1XKYA 4Y9MA 3S4TA 2VDIA 4ATLA 1OBAA 3PPFA 4WX2A 1W9VA 1VKFA 5EPDA 2FVKA 1VJIA 5HWNA 2CXGA 3TZNA 1C8VA 2CBUA 4CQAA 4TVCA 3LMYA 3OP2A 4EX4A 2BS9A 4DLFA 1IEQA 2JEPA 1O5RA 3F2BA 3EMQA 4GPNA 1SW3A 2WBKA 1QRQA 1REQA 1NH6A 2WNZA 3WO8A 2W61A 1FKWA 4PTNA 2A6NA 1EWDA 2A85A 2CLPA 1H7WA 2AOSA 1H7OA 3A6OA 1F5ZA 3CHFA 3R6IA 4S2BA 3V1HA 4UTWC 1BVNP 5HNNA 2RH9A 1I0BA 4S3EA 4Q6XA 4ZVJA 6XIMA 1CGYA 3L9CA 4XUGA 2QDEA 1YIXA 1ECQA 3C2YA 2WOQA 1V79A 4XZNX 4R3UA 4Z08A 3MYOA 1XYCA 4MNMA 2O4QA 4NAEB 1Z89A 3GTFA 3IAQA 4MYXA 2ANUA 1THFD 1ZSXA 1D9EA 2ABBA 3MQTA 4ZGYA 1TV4A 4UMBA 3W02A 1SJCA 4UFJA 1J0IA 3ZSTA 1EJSC 1ITXA 1UOZA 4D9PA 1O6IA 3DYMA 1V7YA 4PR4A 3L65A 3NZ1A 1BYDA 2WZIA 2RDUA 5D33A 1ISVA 2Y70A 1VEPA 1C3FA 3TXZA 1GCYA 4HP5A 4N7QA 4B5TA 3NM3A 4AX6A 2VNCA 2CZ5A 3W2KA 2ON3A 3W87A 3H7RA 1DQWA 1QK2A 3NGJA 4P2VA 1DWHM 4HPNA 4NRRA 4HNTA 3M0XA 1KFWA 2HVOA 3S6OA 3NVTA 3B9EA 3U7VA 2OYKA 2VZUA 1US2A 2X1RA 4P8VA 4IMDA 1WNOA 3AWNA 3WIJA 1V6VA 2OGJA 4BK9A 1FA2A 1HP5A 3NUKA 1V3JA 1FQ0A 1EIXA 3E96A 3SRDA 1UWIA 1L6SA 5BMXA 1Z7AA 1FY6A 3M5YA 4INFA 1GVFA 4ZO9A 3NXLA 1DQXA 5C9XA 3WK1A 1DJNA 3RCNA 1EIBA 1KLYA 1NF0A 3N2CA 3RLHA 1X1ZA 3FJ4A 2OWXA 2CESA 2GSJA 4RV3A 1O1ZA 4S2CA 1R9XA 3HMCA 8CGTA 2VCBA 2BNJA 5A3HA 5HJLA 1UD8A 1ZS2A 2JFEX 1KBKA 4Q32A 3A24A 1YDOA 2PDQA 3JVAA 5A69A 2CERA 2EF9A 4LYPA 4DBEA 3ZR4A 3SB0A 4BQ4A 1LL6A 2VWSA 3HPXA 1OHLA 1P1MA 4QRNA 2QCMA 3BAIA 4HMCA 5C70A 4WJ8A 1ODZA 1KCXA 2O56A 3R58A 1BQGA 3V75A 2BGSA 4GXMA 1FWDC 4BF5A 1W17A 1C9WA 1F76A 3KVLA 1OCBA 3W82A 3KBMA 1GPWA 3HPSA 1I2OA 1OK4A 1QWGA 5JXQA 2C1HA 4HPJA 2B7QA 2F8QA 2ZYFA 1P1XA 2I9UA 5HMSA 3GDRA 3BE7A 3LXBA 3MP3A 4UR8A 4HHHA 4GBUA 3W23A 2ACSA 1YDYA 2WW5A 4O0QA 3D3AA 3AZSA 3LGGA 2CLEA 1KO0A 5KITA 4S38A 1HXJA 4R34A 1SZNA 1WDRA 3OZOA 1JYXA 1H7RA 3IK2A 1X6UA 4XVEA 3TJXA 1MDLA 3H53A 5DY3A 5IM51 4ERAA 1TWDA 4C65A 3OW1A 4WY0F 2J62A 3RX2A 5CZJA 2VENA 4K8GA 3D3FA 4HHPA 1T40A 3L2LA 4C60A 4JTGA 3VK5A 3VMPA 4H8UA 4FOUA 4UQBA 3BOXA 4NX0A 5C55A 2J9YA 1LP6A 1OC5A 2YB4A 3HV9A 4WDTA 4CNTA 2VFFA 3C4UA 5T9BG 2F6XA 4PMZA 4AZGA 3CQKA 3KLKA 3DHFA 4RL3A 3AZRA 3BO9A 1QHPA 3GS6A 3OVQA 1HL2A 5D2VA 3SY5A 4AQLA 8TIMA 4WXZA 4LAUA 1KR1A 3CJPA 2Z1WA 4IP4A 3N9KA 3WNOA 2BP1A 1NWUA 1TJPA 3STPA 2Y7FA 1FWIC 1KXHA 1KM0A 2OGYA 3RJXA 3KL5A 4AIOA 4B2DA 1QO5A 3POHA 5EBAA 4NKCA 1CDGA 3N9SA 3WN6A 4MYAA 1K8ZA 5EMKA 1V02A 3OGVA 2E6YA 5TD4A 4RE2A 2C19A 1OADA 4XKMA 1GKRA 4O8AA 1T7LA 5DMNA 3KDNA 3H4XA 5FCZA 4DM2A 3TYBA 5HINA 1AH3A 4QAIA 2A3HA 3KZSA 3E3HA 5I3KA 2C6QA 4QEHA 3WLLA 1MEIA 3UZ5A 3OB8A 3QQ1A 3ZMRA 3CHEA 1W1VA 4M1BA 1C90A 1XDJA 4QSFA 2YCIX 3R5EA 3UZXA 5CSYA 2X41A 3JR2A 2P50A 1TELA 3GXPA 2XH7A 3IV3A 3S2MA 1QBBA 3NQDA 4HOXA 2W9MA 4KERA 2YL5A 4JTTA 5A6LA 4IMAA 4EACA 2XSXA 4XD6A 2FFCA 5DCBA 4DXVA 1NFPA 2W3ZA 3TOPA 4JHMA 1R47A 4LB3A 3WLQA 2CLHA 4GKTA 4JN8A 4LGXA 1KM6A 4UUIA 2OSYA 1E1FA 4WGHA 1K6AA 1NFGA 4EPBC 2GUUA 4ERIA 4XTDA 4UTMA 4K1WA 3LTPA 1FOBA 1S1RA 4H9MA 1HO1A 1E6QM 2Q3RA 3ARYA 4HT3A 2Y62A 1R8LA 2BSLA 1O12A 4NYUA 1V8EA 2XZ7A 2XIIA 1R46A 3G0SA 2CLFA 4H7CA 1F2JA 3TV8A 3NEHA 3S42A 1DPMA 1FP8A 2PWVA 1SMDA 3GFXA 2GQ9A 3W38A 3SCPA 4M82A 5D03A 3PZIA 2GJXA 3A4WA 2Z00A 4W89A 3V1PA 5GNYA 1XLMA 1VFSA 3M07A 2WO5A 2V69A 4KEVA 3W7DA 2PUZA 3EA1A 3GUWA 3SURA 4HCHA 2DW6A 2GJPA 4IFRA 1H5VA 4Y9PA 3MI3A 4RW3A 2LLEA 3NJ3A 4NZ1A 4XISA 5HAOA 3G6LA 4PUWA 5A95A 1I8JA 1F4HA 2A3CA 2X16A 2QS8A 2BMBA 1E5NA 3EXRA 3O9NA 1VBJA 3W6MA 4X61A 3KRSA 4F9DA 5I7GA 3H55A 5HUOA 1BSLA 3QFWA 1PBGA 4LCQA 3P0XA 2P8CA 2VEFA 1LT8A 1DE6A 4AD3A 4HGXA 3FNDA 1DBTA 2BVDA 3CHCA 3EWBX 3ATYA 1Q65A 3GTIA 2XYLA 3S2JA 2PGEA 4AHOA 2J13A 4U3AA 3U57A 2I56A 2PA6A 1R2TA 2X1SA 1QO2A 3GVQA 4IICA 4WVXA 4XZHA 1XBXA 4QAWA 5C2CA 4CQ9A 1V5XA 4AMAA 2KX9A 3W6LA 1D8CA 4P8UA 1ZFJA 3F2DA 1FTXA 1Q6RA 2BB0A 5FF2A 1SW7A 3B0PA 1M7JA 4UNLA 2WJEA 3W7QA 4O18A 4GJIA 3HMJG 1KM5A 4L56A 2XSBA 1L6YA 3CQ0A 4NNBA 1E3XA 4BQ3A 4JIIX 4DHGA 1B4KA 4WSHA 1PKLA 3CBWA 2WHMA 4PN2A 3KOWA 1OIMA 4WJEA 2EGZA 5BXTA 4PSPA 4WJXA 3S5ZA 7REQA 1V3KA 1J0YA 1JPHA 3N2OA 5FF7A 3W2UA 2BV9A 1XG3A 2P1FA 3TQKA 1CIUA 4G5DA 4HOWA 1RA0A 4DWSC 2PF8A 1K9FA 2AQOA 3CV2A 1BF6A 3TOYA 1JZ4A 1TPVA 3A4JA 1OWQA 4XZBA 3L7RA 1QPOA 3GG8A 3B8SA 4WQ6A 1TMLA 2CXEA 3VM7A 2ZCGA 1V6WA 4FLRA 4DJFC 3GM8A 4UZSA 3EEGA 3UZWA 1P6BA 3O63A 1UP2A 4JR5A 3CUXA 3PP7A 4GO8A 1KTCA 3VNJA 3AMCA 5F1UA 1H1NA 2WZHA 1NQ6A 3IJDA 4OTKA 3NQ2A 3WNKA 3LSCA 2A6LA 2A7RA 4XZWA 3CMJA 1E9IA 2P76A 2J27A 5ENLA 3R79A 3GVRA 2RJGA 3AU2A 1ME8A 1TA3A 2PWGA 4WCJA 1EC8A 3VOHA 3K8LA 2DPEA 3BMWA 4CQ8A 3T40A 3OIXA 2VEMA 4BWLA 3AO0A 5EU9A 3M0HA 2BXYA 1UH4A 2D23A 3M16A 1XIIA 1EFZA 1E51A 2FZNA 1YBQA 3WZ0E 5LHEA 2YKKA 3UWEA 5C7VA 3HJZA 1YX1A 1JI1A 1K1DA 2AL2B 3GR4A 3CZGA 1A5OC 1Q66A 4CCDA 3A5VA 4JFUA 4U2ZA 3ABXA 3CO4A 3I3EA 1W5OA 1UP3A 1TSIA 4H7ZA 2D1ZA 5CC6A 4N9EA 3IIOA 4B5SA 2PGFA 5A2CA 4YVVA 1XIJA 5EMLA 2WJFA 4LRSA 1PYMA 3BW4A 4IIBA 3VD9A 1OY0A 4YS1A 3OZPA 3H8AA 4HCLA 1ITQA 2PZ0A 1LBMA 1AVAA 2Y7GA 4PODA 1QPNA 3KBVA 3GG7A 4HMNA 2Z2UA 7ENLA 3KRUA 5BNKA 2IS7A 4ZE4A 1EJTC 3KBSA 1W9PA 3PWIA 1OX4A 3DHDA 2A79A 1EWEA 1JZ8A 4FX7A 2WC4A 3G1YA 3B8VA 1XBZA 3MU7A 4ZTXA 4GNJA 3M9YA 3C2OA 4DNMA 1OB0A 3T9PA 4KFPA 3GWQA 3ZLHA 1WDDA 1TTQA 1X1NA 1RPKA 1IV8A 3NM1A 4PUEA 3USBA 1ZJIA 2YFOA 2I9EA 3PUOA 3K30A 3W2MA 3U9IA 4OE7A 2QCFA 2XZ9A 1W1IE 5E6ZA 2WB5A 7A3HA 3G1DA 1U22A 2V5LA 3AHZA 1BSIA 3WH6A 3ONBA 3F4DA 1KWGA 2O7SA 3OZMA 5I0DA 2G3JA 2ISVA 3QY7A 3V5CA 2FMNA 1Q8JA 3UR8A 5FEWA 2H8ZA 4S3FA 1R5YA 4DB7A 2E77A 1JAEA 4A8LA 2A3BA 4ZO6A 3BDKA 3MP5A 1FFRA 1IT8A 3TROA 1BG9A 1ZGDA 3GNXA 5JBFA 3TYEA 4TMCA 3I3DA 2ZX6A 3M64A 4LCRA 1S5MA 3CQIA 1W8GA 5A6MA 3BW2A 3L2MA 4Q8TA 1BKHA 3AXMA 4DO5A 1CWYA 3D47A 2QIIA 3OPSA 2XTKA 2AMXA 3T44A 1Q7MA 3C2VA 3N29A 3V7PA 3BGGA 1UD5A 3QF0A 4R7OA 2OKTA 3HGRA 6PTDA 3QC3A 4JHZA 3LG3A 1C8QA 3E49A 1S5TA 3QOKA 1B1YA 1N7KA 3B40A 1WDWA 3WJZA 2BGNE 3G77A 1JQVA 2H3BA 4B5NA 3IWPA 4IMGA 3RPMA 3R4IA 3DKLA 4NJJA 1A49A 1Z8AA 1GVYA 4YHGA 1CGWA 5LNUA 4ZTYA 3KTCA 3GUGA 2D3NA 2B31A 4PL2A 2WSQA 1NY1A 3GVGA 2ZX7A 3S9ZA 2HSAA 1P7TB 3WF3A 1C8YA 2EEXA 2QULA 4JTUA 4ZOCA 2AMGA 2YCJA 3VOFA 4UQAA 2OZTA 4E3TA 1AH4A 3CYJA 3RU6A 1I2NA 3DI0A 1ZL1A 3PG9A 4RDWA 3TUUA 4D6HA 2EG8A 3O7UA 4F2BA 4HOZA 3SN1A 2QGYA 4XD5A 5AYYA 5DCDA 4POCA 4UOJA 3WEZA 1AW1A 1FUYA 3W6YA 3R0DA 4ZFMA 3W4RA 3W1RA 4JFSA 4AH7A 4DF1A 4KRZA 3VE9A 2BXVA 3ARTA 5BYWA 3W2NA 1BD0A 3WBWA 2E5CA 4G6CA 4Z1DA 1E6SM 1G0CA 1EC7A 3RK8A 3VD3A 3L2IA 3H2MA 2HZGA 3CPGA 5H8PA 2DGAA 1FH9A 4DF2A 2EKGA 5I03A 1DWJM 1EL3A 1Q2SA 1O7AA 3P60A 3W07A 1AG1O 2PMQA 2YDQA 5D37A 4AF0B 4L6OA 4IMFA 5KINA 3VM5A 3P0WA 4YWSA 2W5FA 3GIPA 3NFUA 1OABA 3LMZA 5XINA 3PZ9A 2CWNA 3BZGA 4KEMA 4H4IA 1QBAA 3IJ8A 2IXUA 4NAFA 3N2XA 3MW7A 1DXEA 3PWAA 5I77A 3MO7A 2ZC1A 4WDUA 1NARA 3SCUA 4C6QA 4MY8A 3FA4A 1HGYA 2WJZA 2D3LA 2XVGA 5AC4A 1G69A 4I7WA 3W01A 1BF2A 4DJDA 1QT1A 4JTFA 4ZO7A 4E0CA 3LOTA 2VC5A 4GNKB 3DFTA 2GJNA 2DH2A 1VFTA 2DZSA 4J28A 1LTDA 4PL1A 3KWXA 1HX0A 3VC6A 4XBJA 1LOQA 1ALDA 6XIAA 3ES7A 4HNVA 3FGCB 3MY9A 1PDZA 3BLKA 3M0LA 4L61A 1VIZA 2Y0FA 3NQ8A 4ZO8A 4ZOBA 4J4KA 1ZJBA 3OODA 2A3EA 3NR0A 4UNIA 2GOUA 2JQXA 3LRLA 3K5XA 2E4TA 1FBAA 3K13A 5TIMA 4ZB0A 4O10A 4UNKA 4XUYA 3CLMA 1V4YA 4PUJA 3UD6A 4GH1A 2VFHA 4DX3A 4E4PA 1P6CA 3ABZA 1LROA 3N25A 5F4XA 2Z1SA 1KKOA 3RM4A 4LXFA 2XWEA 1CLXA 4DBSA 3MUAA 5KSWA 4JICA 3VZZA 3TCEA 3IACA 3LCXA 2Y6ZA 2BY0A 2R9RA 4WSJA 4KQNA 1E6ZA 5HPCA 4OT7A 2J7CA 5I09A 1A5SA 1TWSA 2X05A 3UJRA 5CZ0A 4UOQA 4JYFA 3I68A 2NX9A 4Z0JA 2I16A 2P3ZA 2HXTA 5M03A 1DJZA 4GUIA 2O4MA 1WXYA 4L6HA 2DH3A 4YNGA 1XM3A 3L67A 2DT3A 3IS4A 5DRIA 4XKYA 4L4OA 3G0XA 4M7TA 3VIOA 4ROPA 3W26A 3G8RA 5BXPA 4R85A 3UW6A 1VRDA 2NXHA 4ONVA 4NI8A 2ZTJA 1GHRA 2VVNA 3G1HA 3QV7A 3VU2A 4ADUA 2CBVA 1LORA 2BHYA 2VKZG 5FESA 3L4UA 3W1UA 1W37A 4O17A 3IVSA 1QW8A 4ZE5A 2VWTA 6REQA 3CAWA 2WWCA 1S2AA 4YYFA 2IW0A 2XISA 3B06A 3LLXA 4A2SA 4JEQA 3PZOA 4WKHA 1XJBA 4B5WA 4V27A 4KEUA 2F6UA 3JU2A 5AKQA 2ATSA 4LVFA 4UOZA 1KWKA 4U4MA 3Q94A 1Z9AA 4XVDA 5K4ZA 2NQHA 5CXPA 4O13A 4CNNA 2XIMA 3UPMA 4YYCA 1BG4A 4DPPA 2E68A 3AI0A 3VX1A 4K37A 3BL3A 1QJWA 1ELSA 3MSGA 4TV5A 1KFEA 2J8GA 3T42A 3VZXA 1FWTA 3THAA 3HF3A 4J3XA 5A2BA 3BGJA 3ZSSA 4FNQA 3N2MA 3PUEA 4O1BA 2DORA 1TTJA 4AYGA 3HU7A 2ZX5A 3MUCA 5I79A 2RAGA 4N4QA 3CEUA 2IKIA 1I2QA 2OT1A 3CO8A 3W1TA 1XGDA 3IVUA 1EF2A 1I1XA 1JPIA 1H0GA 2NLIA 3ZVHA 3VKCA 4G1NA 2OWCA 3SAZA 4OV4A 2GQAA