3LTPA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltpA00
3QF0A 5LZLA 2P1FA 5FF7A 4O11A 4U4MA 4JTLA 4O54A 1JCLA 3W1LA 3LHWA 5U4NA 1KFCA 1I8JA 3W7CA 5E93A 2C19A 3PF3A 2JGYA 3QSTA 3PB0A 4IMDA 4FNQA 4MUZA 5DN1A 4ALDA 2NWSA 3S5YA 3UPWA 1GT8A 1MO0A 1J4EA 5LGXA 1DV7A 2NWRA 3L9CA 2DP3A 3LOTA 3TXZA 4LC6A 3IIPA 2YR1A 4JDBA 3W1PA 2GVGA 1SU5A 2VFHA 4K7YA 3VKJA 1PIIA 2QKFA 1FQ0A 1QAPA 3SW6A 4IX0A 5D38A 4LU0A 1SZFA 3MP3A 4YXGA 4O10A 2C15A 5L9FA 2QUVA 4NZFA 3DFSA 1ADOA 4MY8A 4AHQA 1F73A 2QCGA 1ZFJA 4AF0A 2ABBA 1GJPA 4WY0A 3W75A 2Z6IA 4JN6A 2Y61A 3N14A 3MO7A 5DXXA 1ZALA 2A0NA 4H6KA 4FNRA 1KV5A 1X6UA 5KTLA 4O1BA 1FY6A 1O60A 3W7LA 4JX4A 1PCWA 1ONRA 4O1DA 1G4SA 3S5OA 3ZFHA 2WO5A 2LLEA 1KFKA 3GR8A 3UYCA 1KV8A 2NXHA 5BOOA 4HHPA 1IXNA 2C3ZA 4ZL1A 1XUZA 1M5WA 1GVRA 2DZSA 3OVQA 3MBFA 1RVGA 1KM5A 2YX0A 2PE4A 4UTTA 1TPVA 4O18A 1YDOA 3TSDA 2VC6A 1A5CA 1N55A 4MJZA 1W3NA 1GWJA 4ZQOA 3W7OA 3NZ1A 1IXQA 4ZQNA 3GKAA 3GXNA 2B7PA 3O63A 1F6PA 1LCOA 2HSAA 4EF8A 1L9WA 1LP6A 3I7RA 1XDMA 4W9TA 3E49A 1ZJIA 1I2OA 1UUMA 4ZZ9A 2QDGA 1Q6OA 2CLHA 3L0NA 3HGSA 4E2DA 1O5XA 3MMTA 3LBCA 3C2FA 1WBHA 3HG4A 1XBVA 3LRLA 4AWTA 4XBKA 1A53A 3O16A 1WYIA 2W79A 2W0UA 4AF0B 4PH6A 4UFLA 2WV8A 3N2XA 5FESA 3P81A 3W72A 3W73A 2ZRVA 3IGSA 3QMSA 3I7QA 2WNQA 2V2DA 1H7XA 4BI6A 1YTEA 4UNLA 4O28A 1FXPA 2OMAA 1O94A 3TW6A 3ATYA 1K7XA 3P67A 3P8JA 4M6PA 1RZMA 4R33A 4O4WA 4LVGA 1J2WA 3NPVA 2TMDA 4H3DA 5G2IA 3A9IA 3S6DA 3SGUA 4XTDA 5BMXA 3S42A 3CTLA 5KITA 1TPC1 2W6RA 1OJXA 2C18A 1AMKA 3HB9A 2FIQA 3W7MA 4PL1A 4POCA 3ABRA 1QO5A 4LUIA 5AYZA 4JIQA 1OYAA 2V5LA 3W71A 5KZEA 4K38A 3P8IA 1QPQA 1HFBA 1F76A 1IXPA 4DPQA 4CNNA 1H51A 3EKZA 5DXYA 1H63A 1H7OA 3NXFA 2CLEA 1XL9A 3SR7A 1DJNA 3LCWA 3TROA 1J5TA 1KFLA 2C6QA 4QQ3A 2D73A 4O0KA 3CLMA 1XBZA 3PSVA 3KVKA 1TV5A 2YFNA 2NV1A 1QDSA 3SJ3A 3BG3A 4IMEA 5BRBA 1Q6LA 5BMWA 3EXSA 1PCKA 1VZWA 2V2CA 1R46A 1GVQA 2QF7A 3TR2A 2OZ0A 1LOSA 1FBAA 3NPUA 3NQVA 4JEQA 1VLWA 1OF6A 2V81A 4ZVJA 3TQKA 2Q3OA 4R53A 1VPXA 1SO4A 4RR4A 3L0KA 2Q3RA 1Z48A 3GDLA 4WXYA 2VOMA 3OA3A 3T78A 5KZMA 4HT3A 1VRDA 5CGQA 2DZPA 3LRMA 3NZRA 4Z1AA 4FIQA 2VEMA 3MYOA 3GB6A 5AYXA 2PRLA 5LNUA 4DELA 4LW7A 1LM1A 4JTEA 4JTHA 1O4UA 1WBJA 1OFQA 3BLIA 4IGHA 2V82A 3LTYA 3VI2A 1YTDA 1Z42A 4FB7A 1VJIA 4EIVA 3S8HA 1EX5A 3TQVA 2DU2A 4K8EA 1M7PA 1LLWA 3R8RA 3EX3A 1XFBA 4JR5A 2JKAA 4LT9A 1LRTA 3NPXA 3AO0A 3W23A 1VYSX 2YFOA 1TTJA 4ZQMA 3IIVA 5SWUA 2Z0IA 3TFCA 1TPB1 2CFFA 1QNVA 3BW2A 1FCUA 3LCXA 4UR8A 3Q94A 2J27A 2FPTA 1OFAA 2FPYA 1UJPA 2Y89A 3NQCA 4JD4A 3YPIA 5AB3A 4G1KA 4K36A 4M5PA 2B7QA 5LNSA 3BK0A 1K7EA 2RDWA 2AAMA 1WX0A 3QEZA 1I2PA 4NJIA 4NXSA 4AXKA 4OWGA 5ABTA 3C8FA 3G0SA 3TQ0A 4E2BA 4OQVA 3CHVA 1D3GA 2TRSA 1B3OA 3CIWA 3NL5A 1TPDA 3VE9A 1GQNA 4HPXA 3MWAA 4JY9A 1OK6A 2XN0A 3LM7A 1SUXA 2H3DA 4UTJA 4S2BA 1YPFA 1HO4A 2RDTA 3CM4A 1RR2A 4Z0SA 1SZEA 2YSWA 4AVFA 5LHFA 2XFWA 4TX9A 1UBSA 4GNJA 1JCXA 1N7KA 4Z1CA 3OHIA 1I2RA 1R2TA 4TO8A 1OFDA 1OFEA 3LLDA 3G3MA 4FX7A 2NX3A 4WX2A 1OVDA 3STCA 3TU9A 3B03A 2QEZA 3QYQA 3C2OA 4D2JA 5C54A 3O05A 4UTWA 2WQPA 5AYYA 1LZOA 1U83A 2YYTA 2J9YA 4PODA 4DBEA 1XBXA 3EWZA 1P5BA 5C55A 6ALDA 4XWUA 2DZTA 2R14A 4XKYB 4OE7A 3NG3A 5CPNA 4CLMA 5C6MA 1GEQA 3QW3A 3P60A 4ZMGA 1L2UA 4FNPA 4IPJA 1JCMP 3EX2A 1KFEA 5IBXA 1WQ5A 2BLEA 3HG5A 2F7FA 3B04A 3G22A 3UY8A 5CSRA 2ABAA 2YDAA 2ZRWA 4DEFA 7TIMA 4JTSA 2DJLA 1TJRA 2GVJA 4UTTC 2B0MA 4AEOA 4LS0A 1FXQA 1GG1A 3PS7A 3PC0A 5HQEA 1QPRA 3THQA 3B0UX 1TPFA 4HNNA 4LWWA 1W5MA 4L4MA 5D05A 2VFDA 4MZ8A 3HGJA 3B0VC 1OYBA 5BNKA 2CLKA 4Z1DA 3W1RA 4LVBA 4GUHA 3CIXA 3HOJA 1H7NA 4QJ1A 4FF7A 2YPIA 1QFEA 3DFNA 3EWYA 2E5CA 1TREA 4DO4A 2AGKA 3FKRA 1VR6A 1SZGA 2FQIA 3W7NA 2VFIA 3F4NA 4GUFA 1A5AA 3P82A 2DZXA 1SSDA 4WOZA 2WKJA 3GZ3A 2B7OA 2ISVA 3BV4A 3QMRA 4R34A 4MYXA 2B7NA 3NM3A 5I3JA 1NF0A 4X3ZA 3OEXA 3TW7A 3NOEA 1G69A 1C8VA 3PY2A 4YWIA 1GVFA 3LI0A 3NR0A 2X2GA 3UPBA 3W3OA 1ZCOA 1ZY9A 3PWAA 2XN2A 4RXFA 2E6FA 1SW7A 2Y62A 3GDKA 3DHFA 1YDVA 3D0CA 4DO6A 1GTEA 1SQ7A 3W87A 3TIMA 4Y8FA 4JYEA 4ORIA 4JX5A 2XN1A 3GLCA 5G4EA 2QJHA 5TQLA 1QOQA 4HNVA 1GOXA 3HGOA 2CZFA 1JVNA 3BO9A 5AHNA 2ZBTA 5TIMA 5J5DA 3RMJA 3RU6A 4LS2A 4NZJA 2ISSA 1XCFA 4WY0F 3HJZA 2NX1A 5HR7A 3C56A 1VCVA 5E0KA 1W0MA 3W2KA 2YYUA 5F2IA 3TSMA 2Z1BA 3Q2DA 1XM3A 1SO6A 3UWVA 3QPYA 2HTMA 3PUOA 1YXYA 1AL8A 2C13A 3Q58A 1X7FA 2I14A 1LBMA 3EWWA 3IIXA 4X9SA 2GJNA 1HUVA 1L6YA 5D2YA 3FYOA 5AHIA 3L2IA 1BKSA 2R8WA 3EWUA 5KMYA 1EEPA 1KA9F 1CW2A 4LVAA 2A1YA 2C1HA 4XZ9A 2RFGA 1EUNA 4H4IA 4K7VA 3HIJA 3QJAA 2VFFA 3G1XA 3CT7A 1YDNA 3PBYA 4YCPA 2Y88A 3I65A 2DZVA 4RZ5A 2ZZ1A 2PC4A 5F4WA 5AOUA 4ZQPA 1TB3A 4JX6A 4Z1BA 3W1MA 4I7VA 3OBKA 3G0UA 1V5XA 1NEYA 2ZQ0A 4IQLA 3NNTA 3MYPA 2GQAA 1LRQA 3W9ZA 3V1PA 4LTSA 3PUDA 2WOQA 1EWDA 3DFOA 2J9ZA 5CZJA 2BX7A 4RV8A 5D04C 4GC4A 4JGDA 5I3GA 3TAKA 4LUJA 5D30A 3T44A 3DZ1A 2E68A 3VE7A 3QSRA 3T40A 4O0ZA 5HWNA 4GFSA 3R2GA 3PBVA 4UMCA 1X1ZA 2YXGA 1KM4A 1XBYA 2VELA 2BZNA 5CPOA 5F2GA 3LXCA 2BTMA 1FDYA 2ZA3A 3MI2A 2Q8ZA 1YTKA 1ZAJA 1RQBA 2V8ZA 2C0AA 4NU7A 3S0CA 2QCCA 3MHGA 1MEIA 4FXSA 4NVTA 3TC7A 2ZTKA 2YGYA 2X1SA 4O50A 4I7UA 1OX5A 1GPWA 3FJLA 2V9DA 1AW2A 2VEKA 1SO3A 2VENA 3L21A 1JQXA 4UTIA 3WJWA 1SFLA 2RKXA 4BF9A 4MYAA 4M19A 2Y7EA 4RJEA 1YXDA 3TNOA 1SW0A 5HWJA 1DHPA 4HPJA 3L66A 3KOFA 4GE8A 4ADSA 2A2IA 4NT0A 1JCNA 1JRCA 3HMJG 4DQWA 1F05A 5F4XA 2E5DA 3N3MA 1WXJA 3K30A 1JR1A 1A5BA 5AHEA 4IJBA 4Z08A 3V75A 3W7PA 4OV4A 4JIPA 3W74A 3LCHA 1XKYA 1B4KA 1O95A 4MFEA 1EWEA 4KFNA 2H6RA 1F5ZA 3W84A 2QCHA 3OVPA 3LX9A 4IOTA 1XC4A 3NQDA 2FB3A 4A2SA 2PRMA 1UB3A 3W6YA 2QCNA 3JS3A 4MFDA 4AWSA 3IVUA 1I45A 2J88A 3O6DA 2J6XA 1TSIA 2Y85A 1WDWA 3B8DA 4QSHA 3W2UA 2A21A 3HO8A 2A6NA 2JK2A 4X2RA 3NQMA 1UUOA 4N2YA 1VYRA 4JXCA 4IPIA 4WY0B 3W1AA 1G6CA 1DQXA 4UTLA 1BTMA 3W1UA 4UTWC 1NFBA 3SGZA 4LOCA 3M41A 3LCIA 1TQJA 2A7RA 2CWNA 4N9CA 5CPMA 4N4QA 2GPTA 3DFPA 4GUGA 5HUPA 4KFOA 1F2JA 4LVFA 1ML1A 3NQGA 2BXVA 3A5VA 4IWWA 3DGRA 3IIOA 1OG0A 3A22A 1QO2A 5IBXC 1LDCA 4TU1A 1KFJA 2ZYFA 1PV8A 4O13A 5LKYA 2NUYA 1RV8A 4IUOA 3S1WA 1FWNA 4ADTA 3UNDA 5FEXA 1H61A 3MP5A 3I68A 1CX9A 1FDJA 3P84A 3C6CA 3NL2A 1IIHA 3GR7A 2WNZA 1TIMA 4YL2A 3W86A 4P61A 3DKJA 4DO5A 4AHOA 3NA8A 3E12A 1KTBA 1OHLA 5BW6A 2Z6JA 2V0TA 2ZTJA 1K8XA 4QAIA 1OX4A 3U2OA 5CZ0A 4YCOA 4O16A 3BLEA 3NQ7A 1AK5A 2H8XA 1KTCA 3BLFA 2TPSA 3IVTA 3ZS4A 1KBIA 1HTIA 4WOQA 5AC7A 2H8ZA 3C2RA 1K3UA 3W7JA 4EWND 1QPNA 4EF9A 1TTIA 4PFMA 3W1TA 1B57A 3LB0A 3NL6A 1OFOA 1IGSA 1ZNNA 4RCXA 1H7PA 4NJJA 1JUBA 1R30A 1B4EA 3QQ0A 4L4LA 3M7WA 4B5NA 3PULA 3IV3A 1MEWA 4UR7A 1XUUA 4YLWA 1DOSA 3LBMA 4Z0JA 4C1KA 1QCWA 3PBUA 3TSBA 3WK2A 1TTPA 1GYLA 5CZSA 3LTSA 3LHUA 2WJZA 2BWGA 2YW3A 2YZRA 4E38A 4QISA 3IEBA 2X1RA 4EOUA 4FNTA 5CG7A 4PL2A 3UWQA 2V30A 4JYFA 5T26A 4IXXA 1RD5A 5EBUA 5L6UA 3SZ8A 3N9SA 3UZJA 2KZHA 1FWTA 1MZHA 3BG9A 5CPLA 2QCEA 4GXMA 3SSJA 1DQWA 3L65A 3G3DA 5I3KA 1W3TA 1V7YA 3G0XA 4EVZA 2YW4A 3LGEA 1ZENA 1VHNA 3C2VA 5F1UA 1W1ZA 5FEWA 4KWVA 1NVMA 3CB8A 1ICPA 3TUUA 1ICQA 4DBDA 1BEUA 1K8ZA 1PHQA 1VH7A 4JTIA 4WQ6A 3W07A 3M5VA 1VC4A 1T96A 4FHAA 3KAOA 1F74A 2UV8G 3S5NA 3NGJA 3IRDA 2H90A 3FOKA 3TC6A 2FTPA 2H3BA 4FNSA 1E51A 3OIXA 3NO5A 5FF2A 4FO4A 3FJ6A 3SIZA 3LDVA 2I1OA 3FFSA 1L6SA 3PUEA 4MKNA 4HNTA 1K03A 4N6EA 3JRKA 5G5IA 4NJHA 2ZA2A 3B0PA 1R2RA 5HINA 2YCEA 3MHUA 2FDSA 2O7QA 3F03K 3CU2A 2EF9A 4XUGA 1LTDA 3SECA 1MXSA 2CU0A 4ONVA 2A5HA 2C16A 5HJLA 5H91A 6TIMA 4A21A 1FUYA 4M6QA 4JTTA 2CZEA 5K4XA 1A50A 3RLUA 4AWUA 1OFRA 1G7VA 3UWUA 4OHQA 1K8YA 3GIYA 4PTNA 3WK0A 2DJXA 4Y96A 1FDZA 2ZZ3A 3O8AA 5EPDA 3HGRA 4WXZA 3BVJA 4UIOA 3LXAA 1S5VA 2V2HA 4LNYA 3ZWTA 3EX1A 3R12A 1L6WA 1WV2A 4MJMA 2ZDRA 3L0GA 1GZGA 5K3VA 5LGZA 2E6AA 3UQNA 4UTMA 3W7HA 2G96A 2RH9A 2P0OA 5GVJA 2QCDA 1VHCA 5I3IA 1S3HA 1W5OA 3EWXA 2PURA 2VKZG 4RK8A 2NXGA 4ZQRA 3C4UA 1W5QA 4MOZA 4O15A 5HULA 4Q33A 3RF9A 3PM6A 3I7SA 3NM1A 1R2SA 3EX4A 2NZLA 2OJPA 3KRZA 4DF1A 5G1YA 1I2NA 3STFA 5DCDA 3S9YA 1EIXA 4GBUA 1SO5A 5LHEA 5DBTA 3G1SA 4JICA 4JTKA 1O5KA 2E09A 3INPA 3QRHA 3EEGA 2ZRUA 3NQ6A 4GWEA 1NF7A 3KFTA 4OV9A 1TCDA 4UCGA 3M6YA 4NXKA 1R47A 2FJKA 2ZZ6A 4JTFA 1FX6A 3W7IA 1FWWA 4IMGA 3E9AA 2OT0A 2A7NA 1TPEA 3I6RA 3O6CA 4BK9A 3G1FA 3MBDA 5DBUA 1GVSA 1W31A 3DENA 1JCYA 1VQTA 2E6YA 5CSSA 1RPXA 3ABSA 3ELFA 3EX6A 3W7KA 4AHPA 2X1TA 5DY2A 1T99A 4ML9A 1W5PA 4GUJA 1TRIA 3MUXA 1PS9A 1PVNA 4O1CA 5G1TA 5TBOA 2ZZ7A 2G5WA 3O06A 1THFD 1Q45A 3DKLA 4JTGA 2QCDB 4MVAA 3N19B 3AJXA 1VS1A 2QJIA 2A4AA 3W2LA 1OABA 3G1DA 5HR6A 1S5TA 3R13A 4QM1A 4JNMA 1TV8A 4LRSA 2BSLA 3IGXA 4S2CA 2ZRXA 1OYCA 2CW6A 2FPVA 4OBTA 1C9DA 3IGUA 4UMBA 2GJLA 4ADUA 1GG0A 3UY7A 3DAQA 2WSRA 1UASA 1YLVA 1G4EA 3BW4A 3TFXA 2VEIA 4I7WA 3LI1A 4NUWA 2GUUA 5A8GA 4TR9A 4NX5A 4FEZA 5LSMA 1X8FA 1ZAIA 3ATZA 4UXDA 3MJYA 4DF2A 3P5ZA 4LV4A 4BR1A 3S1VA 2JKEA 4AB4A 3MP4A 1QPOA 3QQ1A 2X1UA 1KM1A 3A5FA 4CNPA 1SPQA 4M7SA 5LNWA 3M5XA 3QMTA 4S1FA 3W2MA 4A22A 1CI1A 4CNOA 3QPZA 2P10A 1KM6A 3W7GA 1LORA 3FLUA 4I9AA 2FLIA 2Q8LA 1H1ZA 3NL3A 4O17A 2QR6A 4Y9AA 3RLVA 1H5YA 4JY8A 3GNDA 3LHZA 4C1LA 1G7UA 4AMAA 3H55A 2EPHA 2CZ5A 1MSSA 3TDFA 4NNAA 3P74A 4UFJA 5LNRA 4K6AA 1IIGA 4N6FA 1Q6RA 3GDMA 3FEMA 5D2XA 4O53A 2TYSA 1Q3NA 1TQXA 3LCLA 4KKXA 1FWSA 3TJLA 3GXTA 1LOQA 4RKAA 3EXTA 3M16A 1SR9A 3G1VA 3GNNA 1DVJA 4TIMA 5G4WA 4BI7A 3PBWA 3QM3A 4Y90A 3CWOX 2RDUA 4XBSA 3LHYA 2GVLA 4RX0A 1OK4A 2G97A 3L67A 1QOPA 3HF3A 2QUTA 3U6WA 2ATSA 1SZNA 2VXNA 4HSOA 3HQ1A 3M43A 3SFKA 3M44A 2QDHA 4MPQA 2FFCA 2DZWA 1H62A 3S5ZA 3PVFA 3DHDA 3QW4B 2HS6A 3GDRA 1W54A 3B06A 3RK8A 1XI3A 2CZDA 3TXVA 3GXPA 1YADA 3TAOA 2V5BA 1DBTA 3G8EA 1KM2A 5EMUA 4FIRA 3W70A 3WK1A 4FX8A 4JDYA 2CLLA 4N4PA 4O14A 1HL2A 4LY8A 4KFPA 3THAA 3Q37A 2A85A 4XQ6A 3UXDA 5AFDA 2E6DA 5AHFA 1VLIA 3M0ZA 3P5YA 4NJKA 3MI3A 3FYPA 2QJGA 4JS3A 5D2TA 4E0CA 3O6YX 2HMCA 1U5JA 4Q4KA 3KRSA 4IMCA 1TPWA 4UFHA 2ZA1A 1K7FA 3KVJA 3S1UA 4O4VA 2JGQA 3M47A 2Y6ZA 1H60A 2NUXA 4CCDA 1G4PA 3WK3A 2GQ8A 2OT1A 3PB2A 3CWNA 2WNNA 2QCLA 2Y7DA 4OU1A 5HNRA 1M7OA 3EWBX 1LBLA 3UWWA 2OX1A 4MZYA 4K39A 1TMHA 1FCVA 4QIUA 5AHLA 1TPUA 4CQ8A 4MIMA 1TTQA 1TV7A 5IM51 4OGZA 4UTHA 1DKWA 1I2QA 3OG3A 1JULA 3WFAA 3NQFA 1YPIA 5K9CA 3L5AA 1EPXA 2ZZ4A 3LCGA 3NDOA 3WJYA 3QC3A 3O1NA 4PEKA 3DU0A 3USBA 4FX6M 2C14A 2CLFA 1XXXA 3GAKA 3UZ5A 4BWLA 4M7TA 5FF3A 1S5WA 2VFGA 1JUKA 3LLFA 1ALDA 3OVRA 3N9RA 3BPWA 3WJSA 4IXHA 2DORA 5EL1A 3UWYA 3GYEA 3KVMA 2A6LA 3ABOA 5K4ZA 4DPPA 1WA3A 4UMAA 1VCFA 5AC8A 3G1AA 1OF8A 2E5BA 1JUEA 5LNVA 1VYPX 4A29A 3UD6A 4GJ1A 1W56A 1KTNA 1TYGA 3ZWSA 3LERA 1PL9A 1A5SA 1H7RA 3TA6A 5EY5A 3L5LA 1H50A 1LYXA 4MY1A 3TE9A 1KLYA 1BWLA 1KM0A 2FB2A 4K37A 1M6JA 4P2VA 3P61A 5H2ZA 1SSGA 4RLIA 4Y6GA 3IIZA 5D32A 2EKCA 3W85A 3L5MA 4JTUA 1ZAHA 5DCEA 1ME7A 1UCWA 4K8HA 4UUIA 4WJEA 4GRSA 3HG3A 2WSYA 3C61A 3W88A 4UFIA 3BGGA 2EAWA 5E1QA 1GVOA 2J9XA 1VCGA 3M5YA 3NYZA 2ZZ2A 3HPZA 1C29A 1QR7A 3ANYA 3CEPA 3C0JA 2OCZA 4OT7A 1FCQA 2G95A 4DF0A 2NLIA 3VFLA 5AHMA 2Y70A 3T4CA 1IXOA 2X16A 1D3HA 1T0OA 4UFKA 1NSJA 2TSYA 3DXIA 3MW7A 5DELA 3PSWA 3DBPA 2NV2A 3KX6A 3EXRA 2CLIA 3FA5A 1VGAA 2QCMA 4RXGA 4PA8A 5D03A 4BFAA 3BW3A 3GKFA 1HO1A 5AC6A 4N02A 3E02A 1OX6A 4FXRA 1LLZA 3O15A 1ZHAA 2Y7GA 3TKFA 3W1QA 3JR2A 5F4SA 1H1YA 3B05A 1Z41A 2AQWA 4UTKA 4CQAA 1YXCA 3ABQA 3MI6A 5K9DA 1TRDA 4BI5A 1JQVA 1FWRA 1EA0A 3W7QA 1PE1A 2IQTA 4N9BA 1P0NA 1DORA 4HNUA 4HIBA 1OX4B 5D2VA 4ORMA 1AW5A 5D2WA 3GDTA 4YMZA 2GOUA 4NQ1A 1P1XA 3BARA 1WOAA 3W1XA 1OFPA 4HSNA 3G1HA 1W3IA 5FF4A 2EGZA 3DH7A 4AAJA 4NX0A 1EP1A 5MHBA 2QAFA 4J9JA 3EKLA 4Q32A 3EB2A 1KW1A 4A2RA 4CCCA 1TJPA 3IVSA 3H54A 3HPSA 5G2WA 2ATMA 2ZFAA 4XKYA 5C2XA 1EB3A 8TIMA 1G67A 3L68A 1QWGA 3UXAA 1TPH1 4MZ1A 4HKPA 4DXVA 3QFEA 3SY5A 2QUUA 3LHVA 3KXQA 3W76A 2E77A 4N9EA 2QAPA 3E96A 1N8FA 4IX2A 1K02A 5D33A 2R94A 3W7EA 4R7JA 3LXBA 1I4NA 5EA9A 4QNEA 2VFEA 4AH7A 3W1NA 3W22A 1SW3A 5F2LA 3RFAA 3DI1A 4RZ6A 4TMCA 1HG3A 3SI9A 3HG2A 4N9DA 3PR2A 5K2ZA 3UWZA 3G18A 3M5ZA 5HMSA 2NXIA 3S1XA 3GVGA 4PC8A 1P4CA 3A23A 3F1QA 5C5YA 4JTJA 1YYAA 1Z44A 3G1YA 1FCBA 4WZHA 3HBLA 3CEUA 4WD0A 5G2HA 3WJXA 1XDLA 1BWKA 1JRBA 2QCFA 3W83A 4M6VA 3LTPA 1Y0EA 2JBMA 3PAJA 2RHGA 4O19A 3DFTA 4ICNA 2PCQA 3LV6A 5FF0A 1DL3A 3NAVA 2ALDA 3B4UA 4JYDA 1LRNA 1P0KA 3DFQA 1LROA 3G24A 1TO3A 5EYWA 3C2EA 5HUOA 3KVLA 5KSWA 2ZRYA 3GK0A 2Y63A 1ME9A 1W8SA 1QMLA 5DY3A 3RNDA 3CQ0A 3NVTA 3TJXA 3T7VA 3TV8A 4MLRA 3DI0A 4LC8A 4O12A 3TH6A 1AG1O 5HWMA 3C52A 2ZZ5A 1EP2A 5D37A 3CPRA 5F1VA 2NX9A 1KLZA 3QZEA 2J24A 3N34A 4LV9A 1ICSA 4WUIA 5CKSA 4CCEA 1Q6QA 1RQEA 2ISWA 2HS8A 4O57A 1EP3A 3VCRA 2GQ9A 3STGA 3NEVA 4HN4A 1EUAA 4QNWA 4IMFA 1W37A 5KZDA 3MHFA 2Z2UA 3KRUA 2R91A 3A24A 3CC1A 5KINA 5EKYA 5D09A 3TCEA 5FI8A 1DJQA 2CLMA 2VEPA 5AN7A 4XTIA 1G4TA 1B9BA 4X22A 1LOLA 3P62A 4NNCA 4UNKA 1KBJA 4O8RA 1IF2A 3PG8A 3TMQA 4O1AA 2X30A 1LBFA 5CZTA 3QH2A 4UTUA 5K7JA 1T8XA 2CLOA 2E1DA 1WOBA 3NQAA 2NUWA 4PCFA 1OFBA 3E0IA 1NAL1 3M1ZA 3R89A 5F2MA 2WPBA 4BWLC 1AL7A 1JCJA 2PRHA 2Y7FA 1F7BA 3NQ8A 1AW1A 3GX9A 3LRKA 3F4WA 4FNUA 5I3HA 1JJKA 1H7WA 4GUIA 3HPXA 2DZUA 2WSQA 3PG9A 4TMBA 3H53A 3T55A 4RZ4A 3STEA 2ZCGA 5FEPA 3VNDA 3N2MA 4MLJA 3BG5A 3TX9A 3U8GA 5J5RA 1X1OA 4MY9A 5U7SA 3W7DA 2F84A 2EHHA 4UFMA 5DLCA 3FKKA 1GYNA 4CQ9A 3NQ2A 4NJGA 3GAYA 3KHJA 3A21A 3NQEA 4LVDA 5A5WA 1W5NA 3NPWA 3TK7A 4NNBA 1D9EA 2B4GA 3FIGA 3N73A 4U28A 3G8RA 3P7YA 3ZR4A 4QITA 3LV5A 3R5EA 1KFBA 2I9EA 4ZQCA 4LRTA 3FS2A 4LS1A 3BGJA 3W7RA 2JKPA 1MEHA 2O7SA 5I3FA 2ZRZA 3WJZA 3LCFA 3O07A 1KM3A 1PHWA 5D02A 1F6KA 5FEZA 1GTHA 4A3UA 1ME8A 4UC5A 3LHTA 3W2NA 5K9XA 4KWWA 2A7PA 5DCBA 3P80A 3TMLA 3C3NA 3W2JA 1SFJA 4O52A 1WAUA 1RQHA 3M9YA
chains in the Genus database with same CATH superfamily
3ZJ7A 5LZLA 3AISA 1XYFA 2P1FA 1EF3A 2VI0A 4JTLA 4PRWA 3W1LA 3R0KA 2VX7A 3W7CA 1LL4A 4FNQA 3VKCA 3TZNA 1NOUA 3OB8A 4C5YA 1SYTA 1J4EA 1NARA 3L9CA 3TXZA 3LOTA 2HXTA 1XIMA 5E09A 1E15A 3W1PA 2GVGA 4BF7A 4AMCA 1T8QA 2J7BA 2WJEA 3SW6A 3RCYA 1FP8A 3MP3A 3IV8A 5L9FA 4U5KA 2OYKA 4D6EA 1E3XA 2QNEA 1UIOA 1ADOA 5IDIA 3W75A 2DW6A 3URBA 2TODA 4FNRA 4AZHA 4NRRA 3W7LA 3S46A 3ZFHA 4O1DA 4X63A 2CXGA 4EP8C 3VVGA 2LLEA 1KFKA 1KV8A 4PB4A 1IXNA 1XUZA 1H41A 1XQLA 2P3EA 2ONEA 2DZSA 3OVQA 3MBFA 1MNZA 4UTTA 3WH5A 3H4GA 1YDOA 4H01A 2YLLA 1MDRA 1OG6A 1IXQA 2XUCA 1K9FA 3WENA 3GKAA 2B7PA 2BHUA 4OZOA 4R9XA 3GTFA 3FXYA 1LP6A 4JIIX 3T81A 3KEHA 3R8HA 2HDJA 2WVUA 3GC2A 2CLHA 1UWAA 1XLLA 4AD4A 3N2BA 3QR0A 3MMTA 1GVYA 1I1WA 3AMDA 3VDBA 4XBKA 2FHFA 4AZ7A 2W79A 2CKRA 3OLEA 3FGCA 1R38A 3H2CA 1CDGA 1YNQA 3W72A 4J3XA 2QJMA 3IGSA 2VX5A 2V2DA 1KNWA 2R6OA 1U5VA 4ERIA 2R1KA 3VILA 4B5XA 2XWEA 2JF6A 5GQBA 2A3BA 1AMYA 4CUCA 4M6PA 1RZMA 1KR0A 4S3KA 4LVGA 4BS0A 3S6DA 1CIUA 1UD6A 2WZHA 3S42A 3CYJA 4KCUA 1XLDA 5BROA 1OJXA 3HB9A 2OKTA 3PJTA 2IPFA 3HFTA 5CLTA 4C6IA 2DUAA 1QJWA 1AJ0A 5AYZA 2V5LA 1IXPA 3U57A 4CNNA 4XSMA 1X97A 3SCOA 1F4AA 1H7OA 3NXFA 2CLEA 1XL9A 1CTNA 1DJNA 2PLJA 5E6YA 4GK8A 1J5TA 3UJSA 3E1F1 4QQ3A 3CLMA 1XBZA 4PUUA 2J25A 4WHBA 3V5OA 3EKGA 2OKOA 1XIBA 3BG3A 4Q8UA 3FGCB 4CQDA 1HF6A 5GNZA 2AL2A 1PCKA 5I00A 1R46A 4DYKA 4I6VA 3NSNA 3TR2A 1FBAA 3WQVA 4JEQA 1OF6A 4ZVJA 3GU2A 1J6OA 1SO4A 4HNCA 3L0KA 4UQCA 1C92A 4WXYA 1P0DA 5AVNA 4RE0A 5D4YA 4HT3A 2G4FA 3MSDA 5CJNA 1VRDA 5B7ZA 3SCUA 3H4WA 3VD5A 4TTUA 4LAUA 5AYXA 3WMLA 1IEWA 3A4XA 5AYBA 4LANA 3IJ7A 4G6CA 1KKOA 1OFQA 4IGHA 3WDPP 1YTDA 4URIA 1Z42A 4FB7A 5A6JA 2DU2A 1XLEA 4A8LA 1M7PA 1LLWA 4B90A 1HQTA 3R8RA 1EFZA 4XAGA 3NPXA 3EPMA 4INFA 3GUWA 2OZ3A 5M2FX 3WLQA 1FCUA 3HZ3A 1E6XM 1UD8A 2REQA 3ZMRA 1A5KC 1OFAA 2Y89A 3NQCA 2AL2B 3KP1A 4X60A 4BQ5A 1PYMA 1YIXA 4TTGA 4TVCA 4NJIA 3F5JA 4OWGA 2BOFX 4F66A 2WCGA 5H1WA 3G0SA 2FMOA 3W29A 3VE9A 4WKFA 3SUSA 4HZ7A 3AJ7A 1M1BA 4H6RA 1YPFA 2RDTA 4RNIA 2QDEA 2DV0A 4JFTA 4Z0SA 1K9EA 3G5EA 3HV9A 3QKEA 4D1IA 1SZEA 4AVFA 5LHFA 2XFWA 2J13A 2BFGA 3N17A 1GOIA 1RLDA 4Z1CA 4DM2A 3H2OA 1OFDA 1OFEA 1C8YA 5AC5A 4FX7A 1QNQA 1DXFA 2VDGA 2NQLA 3STCA 4I9MA 3B03A 1Q5MA 4UTWA 3U9IA 1M9HA 2XH7A 4W7VA 1U83A 1CNVA 1J0JA 4RPPA 5C55A 6ALDA 4QAWA 3FHQA 4L80A 1JYWA 7CGTA 5KETA 2QUMA 2I7GA 1EHAA 3QW3A 4ZMGA 3SCPA 2JEQA 4TUFA 3JVAA 4F79A 4AG0A 1WQ5A 2BLEA 1RK5A 3I4EA 1BYAA 1A0CA 3UY8A 3MSGA 2ABAA 2ZRWA 3UBPC 4JTSA 4ZSUA 1M65A 1DJYA 2V63A 4AEOA 4D8ZA 1GG1A 3EOUA 3PAOA 1QPRA 2J4GA 1C7SA 1UKSA 4HNNA 4LWWA 4S38A 4PRRA 4FLSA 1O12A 5TD4A 3W1RA 3CIXA 3HOJA 2G0WA 4HGXA 1H7NA 4QJ1A 4DX3A 3DFNA 1TREA 1UKTA 2AGKA 1LG1A 3RPDA 1VR6A 1Q8AA 4H41A 3VMPA 1OC6A 4GUFA 4AISA 2DZXA 1SSDA 2B7OA 2ISVA 3GDBA 3TQPA 4DO7A 3RX4A 1QNPA 3NM3A 5I3JA 1NF0A 1G69A 2BVWA 1KO0A 1GVFA 5CPTA 2BXYA 1L8NA 3W3OA 1ZCOA 5HAOA 1ZY9A 1G01A 2P3ZA 1RCQA 2XN2A 1CGVA 1POKA 4RXFA 3T05A 2Y62A 1VPQA 3DHFA 1DWHM 3UXKA 1GTEA 3W87A 2PDQA 1UZ4A 3EOLA 1M7XA 4A6GA 4P7NA 4E2VA 1GOXA 3WQOA 1VEPA 5AHNA 2ZBTA 4LS2A 1OM0A 4WY0F 1R3VA 2BGQA 4DUOA 3W2KA 1WDPA 3E2RA 1D7FA 2XVLA 2Z1BA 3UWVA 3MTWA 2FDMA 1EX1A 3A13A 3ONBA 3Q58A 4QG8A 2CWXA 1LBMA 3EWWA 4HMEA 4X9SA 2GJNA 1HUVA 3FYOA 2R8WA 1OCBA 3EWUA 4J27A 1CW2A 1TE1A 4I90A 2C1HA 4BQ4A 4XZ9A 5DT7A 2IKJA 1XPYA 2P0IA 3G1XA 1ZPTA 3CT7A 4YCPA 1PTGA 3T08A 2Y88A 3GQYA 3I65A 4MUPA 2E67A 3GBDA 5F4WA 1TB3A 4I7VA 1YE6A 4DI9A 3OBKA 4IQLA 5M1TA 2ZUWA 3W9ZA 3V1PA 3TTEA 4LTSA 2WBKA 2WOQA 1EO7A 2W62A 8XIMA 3K13A 4TOQA 4X9YA 3QTPA 1D7KA 5CZJA 3QR1A 3WG6A 4RV8A 5D04C 4GC4A 5I3GA 3WFLA 4GX9A 4LUJA 3T44A 1S5MA 3VE7A 3AHXA 4PGLA 3C8NA 3NYDA 1D8CA 3P6LA 3PBVA 1RHCA 2DY3A 4PUEA 3XIMA 4YJ5A 1VFFA 4CU7A 2PP3A 2ZUVA 5CPOA 3LXCA 1FDYA 1YTKA 3WMBA 2C0AA 3LS9A 1H4PA 4C6JA 1BD0A 3FY1A 1GONA 1IQ8A 4C91A 4W89A 1CECA 2ZTKA 2X1SA 4O50A 1GPWA 3FJLA 2V9DA 1VIZA 4Q8NA 1SO3A 4OVXA 1JQXA 3F4CA 1VJZA 1V4YA 3MO4A 2VVNA 2RKXA 3WQ8A 1KC7A 4IF2A 2YA0A 1XS2A 4RJEA 4K2SA 2VZSA 2VQUA 4GE8A 1CLKA 4ADSA 2A2IA 1BTCA 1OCJA 4HMNA 3WDJA 4WK9A 4ZB5A 1IR2A 5C7VA 4DQWA 3OOQA 3O3RA 1DIEA 1SMAA 5JU6A 2HROA 3HPAA 1PEZA 1WXJA 3AUJA 3ZJKA 5JVLA 3R6IA 4XIAA 1JR1A 3LNPA 1G1YA 3F2DA 4YVXA 1ZBCA 5BWFA 4JIPA 3L4TA 3UFYA 1NWTA 1XKYA 2V6AA 4MFEA 2H6RA 5C9UA 2FZNA 1RCOB 4QROA 2A79A 2FB3A 2PP0A 4A2SA 5HK4A 1UB3A 2XIOA 2HNHA 3W6YA 2E8YA 1DIOA 5LXEA 1JXJA 2J88A 2Y5JA 4Q8PA 4KRZA 4QG9A 5CAKA 1TSIA 3LLXA 1WDWA 4H00A 1GQLA 2NVCA 3B8DA 3SCSA 1HKMA 3HO8A 2A6NA 2V38A 3DBNA 3NQMA 5HMEA 3CIVA 3E2QA 4AWEA 3W1AA 1DQXA 4UTLA 1BTMA 1ZUAX 1JDDA 3KS5A 4PSRA 4KFOA 3EOSA 3NQGA 3OW1A 2D24A 2QLYA 3DGRA 3IIOA 3GG0A 3MMWA 1VF8A 1Y8BA 3NJ3A 5IBXC 1LDCA 1VFOA 4TU1A 2ZYFA 5LKYA 1RVKA 4U5IA 3VGHA 4IUOA 1SJDA 3IWPA 2CZVA 4C6NA 5CEWA 2Z29A 3MP5A 3KTSA 2FZ9A 1FDJA 4FXFA 1IIHA 3KL0A 3ZLGA 1TIMA 2AQOA 2GDQA 4P61A 5IHRA 1ISWA 2Y8VA 4EANA 5DRCA 5C9XA 4MNMA 2F2HA 3NA8A 1E0TA 1LG2A 4JL2A 2ZTJA 1ONWA 3QOMA 4YCOA 4ZXOA 5CJMA 4I9TA 1VEOA 3FYYA 3ZT7A 3AIEA 2Z26A 2ZVIA 2X0YA 4JTRA 4EF9A 1TTIA 4NAFA 4PCSA 2XSAA 1B57A 3LB0A 1OFOA 2A3EA 1V3IA 4CNTA 3W6LA 5CBBA 3LPGA 4RCXA 1NP0A 1JUBA 1R30A 3C5QA 4LAKA 4B5NA 1JGMA 5IFPA 2HXUA 2ZOXA 1Q2RA 4YLWA 3WQ6A 2JEPA 3WQDA 4NYYA 1OIMA 3LTSA 2WJZA 2YW3A 4QISA 1H0GA 5A95A 5HATA 3ARSA 4G1NA 4IMAA 4PL2A 2OR2A 3UWQA 4DXXA 2CBIA 4FI4A 4DRSA 1BG9A 1Z9AA 1B1YA 2V5DA 3Q4DA 4AZ5A 4M51A 2KZHA 1FWTA 3UZYA 3UT0A 4D6GA 3BG9A 1UZHA 4GXMA 1DQWA 2DH3A 2V3EA 3I3BA 3L65A 3SSJA 5BYWA 3G3DA 5CC7A 3G0XA 4HA3A 1W1ZA 3CB8A 1ICPA 3TUUA 4DBDA 2W66A 3ZVHA 3ITOA 4ZO8A 4JTIA 4WQ6A 1UJQA 1VC4A 3KAOA 4OTKA 3IRDA 2H90A 3ITCA 5CZKA 1V0MA 1E51A 3VUPA 3NO5A 4JQ2A 1V6WA 1FA2A 3FJ6A 4P7OA 2CYGA 1AH4A 1X98A 2IXVA 4E2OA 3FFSA 4JL1A 4MKNA 2E3ZA 4HNTA 4NJHA 1XLIA 2YXXA 3DEQA 4ZTXA 3MHUA 1D8WA 3UVAA 2O7QA 9RUBA 3F03K 3KBVA 1W3JA 4IPPA 1LTDA 1R3RA 2CU0A 4ONVA 2A5HA 4LYQA 1J0HA 1MXGA 1A50A 3RLUA 7REQA 1OFRA 1XV8A 5JH2A 3U7BA 1K8YA 2DJXA 1W3LA 2ACQA 4I5RA 4EWJA 4WXZA 2VOTA 1TVLA 4F9DA 4UIOA 3AICA 4YHGA 2V2HA 1OD0A 3ZWTA 2CHNA 3R12A 1B0IA 3KTXA 4HCLA 1L6WA 5EFFA 2ZDRA 1A4LA 1HP5A 1U22A 4UTMA 3W7HA 3ZVHB 5GNXA 2P0OA 4F0LA 4BA0A 5I3IA 4A8RA 3S1GA 3EWXA 4OUEA 4RK8A 4GH3A 4ZQRA 1W5QA 4JKMA 4MOZA 4Q6JA 4YYFA 5HULA 4CD7A 2WAGA 4BKNA 3I7SA 4GNKB 3AWOA 3EX4A 3NM1A 1WDQA 5G1YA 3TLQA 3STFA 5E70A 3SY1A 1PTAA 3S9YA 3WLIA 3OYZA 4V1XA 5A8OA 1RJRA 3G1SA 3B97A 1UMYA 3MT1A 4D71A 3INPA 3LBOA 2PWGA 3K4AA 1QOXA 1GOKA 3EEGA 4PTDA 4F3HA 4C90A 4GWEA 3BAKA 2HK1A 1X6NA 2IKGA 1BRLA 4UCGA 1MYRA 3G6MA 3M6YA 3ORWA 2FJKA 2ZZ6A 7REQB 1CLVA 4IMGA 4YIWA 3E9AA 3KCOA 2OODA 3MBDA 3RDKA 4FOJA 1GVSA 3DENA 1JCYA 3NTYA 4M1BA 1PZ2A 1RPXA 3ABSA 4GBDA 3ABZA 3EX6A 3HU7A 3W7KA 4AHPA 1T99A 2QV5A 4ML9A 4GUJA 2W9MA 3B8UA 4W8BA 3SM0A 3MUXA 2Y5SA 3GVWA 5TBOA 2ZZ7A 1E70M 3PZQA 1V8EA 2ANUA 3DKLA 1XRVA 3N19B 4LUTA 2XM1A 5EGRA 1VS1A 2CIPA 1A47A 4MF4A 3G1DA 1Q85A 2Z00A 2INZA 2DZAA 2GUBA 2OQYA 4QM1A 1TV8A 1R85A 2VGFA 4LRSA 2ZRXA 3FDKA 2CW6A 3OTRA 4S39A 3GC5A 1SJAA 1ITXA 2O4MA 1BGGA 3DAQA 1MUMA 1UASA 1YLVA 1EYWA 3GTXA 3M0XA 4LNCA 3TOPA 3TFXA 4GCXA 4JCMA 4HMDA 5LIKX 3P93A 2R9RA 3LI1A 3CHDA 1J8VA 3NGFA 4F0HA 4HN8A 1BRLB 5LSMA 2VZVA 1JPMA 4B5WA 1S1PA 4ACYA 3O7UA 4UXDA 3P5ZA 3KLLA 2PWHA 4BR1A 4DAIA 3Q67A 4JQAA 1XHGA 1ITCA 5AVHA 4HNLA 1NDVA 1LJYA 5LNWA 3QMTA 4S1FA 3VDHA 4CNOA 3QPZA 4GOAA 1PDYA 3W7GA 5LXXA 4JIRA 3SN4A 4I9AA 2Q8LA 2WWCA 3FNDA 1H1ZA 4O17A 5A8QA 3WQ5A 3RM9A 1DJXA 2E40A 2R82A 1FRBA 3AYTA 3UNTA 3GNDA 2W67A 4PMZA 1BSLA 1WDRA 3JU2A 4DN1A 3TDFA 1XIGA 1R7OA 2PDUA 4N6FA 6A3HA 5D2XA 1ESWA 4N0RA 4CU6A 3TJLA 5BOEA 1UOZA 3MKKA 3G1VA 3IPWA 4B92A 5G4WA 4K8GA 2XINA 4ATDA 4EPBC 3UCDA 4XBSA 1OK4A 4K3ZA 3REQA 4ZOEA 4Q7BA 1JPDX 1XRSA 2OYLA 1HJXA 1NFGA 3U6WA 4HPGA 4L64A 3UETA 4BQ3A 3HQ1A 3FCPA 1XSJA 1KB3A 1T6MA 3V35A 3AXKA 1NDWA 3E5BA 4IZGA 3FA4A 4CN4A 1HW6A 5BRPA 3TAOA 3CZEA 4GI8A 2VRQA 2AMGA 2V5BA 3WQPA 1DBTA 3G8EA 5EMUA 3SB0A 3VGGA 3W70A 4L9ZA 1QU4A 4JDYA 2EJAA 2CLLA 1BYBA 3UYIA 4PMNA 3THAA 3UXDA 1MW0A 2DFAA 1C3FA 4GQRA 5I6SA 3NCOA 3ITYA 1UOKA 3P5YA 4NJKA 5C7HA 4JAWA 2PGEA 4JS3A 1GOOA 3O6YX 2DH2A 1W9VA 3T0BA 3KRSA 5HQMA 4HJFA 1Q8JA 1IYXA 2E28A 3KVJA 3S1UA 4O4VA 3H7VA 9CGTA 5DMNA 2GQ8A 1TZ9A 3CWNA 3AU6A 1LBLA 2DZBA 3GVVA 3PTQA 1TPUA 1HIZA 4GVFA 1TV7A 5IM51 4LCSA 4Y2WA 3REQB 4NI3A 3RM4A 4KT2A 3GD6A 3OG3A 1JULA 3WFAA 1BAGA 5K9CA 3EGJA 3EA1A 3H2AA 3N4EA 4YWSA 4B5UA 4H04A 3RX2A 3PZMA 1GKRA 4FX6M 2C14A 1MXDA 3SAZA 2CLFA 2QT3A 4U3CA 4R5EA 3UZ5A 4BWLA 3MKCA 2VFGA 1JUKA 1SGJA 1EJVC 3BPWA 4X0VA 4W7UA 3H21A 4IIEA 1HGYA 1WA3A 3THUA 5AC8A 1JUEA 4A29A 3R94A 1GYMA 4GJ1A 3BLPX 2V5CA 2D0HA 3LERA 3NO1A 1AUSL 4L4OA 1W1TA 4MY1A 4MB1A 1YMYA 5CC6A 2FB2A 1J6PA 4CD4A 4AIOA 3VDGA 4P2VA 3VCCA 5E5CA 1W1YA 4Y6GA 5D32A 1G0CA 3B4YA 3ZLFA 3RPTA 4CKQA 1E1CA 1UCWA 3MU7A 4K8HA 4GNVA 3XISA 1MQPA 4L65A 1LWIA 2WSYA 3W88A 3E74A 4KW2A 3BGGA 4YPJA 1XD0A 4YYCA 1EC9A 1QR7A 1XF0A 3CEPA 1AFSA 4W5UA 1CZ1A 3VFLA 4WDXA 3GFXA 3K1DA 4JZ5A 3PZ9A 1NSJA 3OLGA 4WDUA 4OKDA 3M46A 4UCFA 4C6PA 5REQA 2EPNA 3OODA 3KX6A 1FH8A 3EXRA 2VD9A 3FA5A 3MDWA 2ZUTA 4IIDA 1X38A 1HO1A 4N02A 3ES8A 1UR2A 3TKFA 3JR2A 1H1YA 1J0KA 3OZYA 5E0FA 5T9CE 1Z41A 2AQWA 4CQAA 1GVEA 2XISA 2GSJA 1YXCA 1TRDA 1E72M 4A3RA 1FWRA 2J8GA 1Z3NA 2Q6ZA 2IQTA 5BRQA 1P0NA 1DORA 2D3NA 1OX4B 5D2WA 4YMZA 2GOUA 4NQ1A 3TC3A 3W1XA 4Y7EA 5A6MA 4FPSA 1E1CB 2EGZA 5H6HA 4AAJA 2WK2A 3UA4A 1B54A 3KBJA 5MHBA 2QAFA 2XGBA 1K77A 3HPSA 3W25A 1QHOA 1EB3A 4BZYA 4W7WA 1JAKA 1QI0A 1VPYA 4DXVA 3SY5A 4XZMX 2F61A 3CASA 3HMCA 4UQDA 2DT0A 3W7EA 1I4NA 5EA9A 3VO0A 4GHRA 3EB3A 3W1NA 3W22A 1SW3A 1WP6A 3D46A 5F2LA 4TMCA 4RZ6A 3FEQA 1HG3A 3N13A 3IJDA 3SI9A 4LXFA 3VDCA 1J79A 5I78A 4N9DA 3PR2A 5K2ZA 4XD4A 2XZ9A 1B9ZA 1DIDA 3F2BA 4IG2B 5B7YA 4PC8A 4QBXA 2J7CA 4H9MA 3F1QA 1JEZA 4GZJA 1HL8A 1FCBA 1XLCA 3CEUA 3GNXA 4CD8A 2NQZA 4B91A 3VOJA 3W83A 3S2NA 4HVXA 1OIFA 3LTPA 5A3HA 1SM9A 3CV1A 3EWCA 3QLLA 2YL9A 3WUBA 3MVIA 3M0JA 3T0CA 2OO0A 1WDDA 1R9YA 4V2XA 3U4FA 2WHJA 4H2HA 2IXUA 2OU4A 3W27A 3QC0A 1LROA 2OTDA 3G24A 3KVLA 2BVYA 2Y63A 2GQ3A 1A5UA 1E56A 2OWXA 3QLDA 1QHZA 3NQBA 3NVTA 4ZTYA 2PDGA 3AQUA 1M7JA 4PB3A 3C86A 2Y8UA 1E43A 3C52A 3DC8A 5F1VA 2NX9A 1KLZA 3RN6A 4AXNA 4LV9A 1FFQA 1ICSA 2GJPA 1XYMA 4O57A 2GQ9A 3G6LA 3STGA 3NEVA 4QNWA 4IMFA 4HHLA 2XH0A 1W37A 3PZNA 2Z2UA 4QLKA 3A24A 4MGGA 1R86A 2PDJA 2VEGA 1E9LA 2NT0A 4G7FA 4IGSA 2DVTA 4LBRA 3KZPA 1DJQA 2XFRA 4G7EA 4JTCA 5AN7A 4XTIA 2GSEA 4GYPA 4MWAE 3W01A 4O8RA 4O1AA 2X30A 1LBFA 5FJRA 3RILA 5K7JA 4AQLA 2E1DA 1OFBA 1NAL1 3M1ZA 4GVHA 3SRDA 4PMXA 5B80A 1AL7A 2D0FA 1R6WA 1JCJA 4FOKA 3CLWA 2PF0A 3NQ8A 4C6EA 3F4WA 5I3HA 2YKKA 2HPIA 1V3JA 2PTDA 3STEA 1UH3A 3VNDA 1XW8A 4QGCA 4MLJA 1BHGA 3BG5A 2XHYA 5U7SA 5BWAA 1SJCA 4CQ9A 4GIAA 3VC5A 3GAYA 3KHJA 4LUYA 3NQEA 1W5NA 4QXIA 2B4GA 4XO6A 1C8QA 1R3TA 1A5LC 1VBRA 3UZWA 4U28A 1HVQA 4KETA 1I0BA 3W6MA 4TV5A 4AC1X 4NSBA 3TA9A 3R5EA 1E0UA 1KFBA 3RLHA 3VNYA 3W26A 3VNLA 3FS2A 3BGJA 1MVYA 4QP0A 2OB3A 1HX0A 3CH9A 2PDFA 1W1IE 3ARYA 2ZRZA 3O07A 1PX4A 1F6KA 3GW0A 4ZOBA 4G7EB 5FEZA 3R4IA 4A3UA 3V0UA 2PLKA 2A7PA 4PE8A 4LUSA 1J96A 4QLLA 4Q8MA 3TYBA 4XVDA 5JQ9A 1PDZA 4R27A 3QF0A 3WQ4A 1W1VA 3R10A 2HV5A 4EPKA 4NIRA 5FF7A 1JD7A 3TCSA 1JCLA 3THCA 3LHWA 1RBAA 4KGJA 4AEFA 4ZODA 1XICA 1OZMA 3QSTA 3BSHA 4IMDA 2DDXA 4Y9PA 2VZOA 2NWSA 5JMUA 2WYSA 3K1GA 1T40A 1MO0A 5LGXA 4XZBA 4CVUA 2NWRA 2DP3A 4QJ3B 2G4JA 5M03A 2YR1A 4Z1YA 4JDBA 3ITXA 3ERPA 1WPCA 1QAPA 3C3UA 5EMLA 4O10A 2C15A 2QUVA 3WD4A 2WHLA 2QVHA 2X05A 1F73A 1P0EA 1SFTA 2Y61A 4JN6A 2CBUA 5EU9A 1KV5A 4L56A 4FS9A 1NELA 5XIMA 1XYBA 3CL8A 3GR8A 1VFMA 5BOOA 4LUSB 4IQEA 4JTDA 1GVRA 1HP4A 3A47A 4RPQA 1NJJA 1GNXA 1RVGA 3TSDA 1N55A 4MJZA 4ZQOA 4C6BA 1UC5A 3W7OA 2X1IA 1EIBA 4Q8VA 3SUVA 4W93A 3ZJ6A 1MUCA 4F0MA 4YTQA 5D9OA 1I2OA 1D2KA 4ZZ9A 2QDGA 1TZ7A 2WVTA 3IK4A 4QS6A 4ROPA 2DIKA 4PMUA 2WC7A 1O5XA 3WUFA 3LBCA 2VRJA 3C2FA 2QUNA 3MMDA 1E5NA 4LX4A 3WDIA 5TF0A 3O16A 2W0UA 2XPKA 4PH6A 4UFLA 3N2XA 1U33A 5FESA 4HU0A 3AXXA 4HA4A 3AMCA 4AY7A 2XU2A 3QMSA 4IIHA 1AJ2A 1H7XA 1P7TA 3BOLA 4BI6A 4B9ZA 4EPDC 3R11A 1EHNA 1FXPA 2OMAA 2HNEA 3P8JA 3BLOA 4R33A 3VKKA 1UD2A 3KL5A 1GGOA 1TJ0A 3NPVA 3BURA 2TMDA 4H3DA 4J35A 3A9IA 2ZUMA 1E6PA 1CWYA 2GDVA 4MNKA 3BC9A 3GVRA 2BOEX 1TPC1 1Q65A 2C18A 3KE0A 4L9YA 3W7MA 1QO5A 1KGUA 2PODA 1Q2SA 1XR2A 3PTMA 3W71A 5KZEA 2C1GA 3NVDA 1NOFA 1XLJA 6REQA 4DPQA 4XD5A 2QV4A 4C1NA 1H51A 2DVXA 1E4NA 5FACA 3GTHA 4C5ZA 3OVGA 3LCWA 4NL1A 4QLJA 3FDGA 1E6RA 2CKSA 2ICSA 1NIUA 3PSVA 2YFNA 2Z24A 2GJXB 5BRBA 5BMWA 3EXSA 1GVQA 3ARRA 4P8VA 3I3DA 1P7TB 4MSSA 3QV7A 2XSBA 5FIPA 1VPXA 3LY0A 1SFSA 2WLZA 3UZXA 2VOMA 3OA3A 1A4MA 1KRBC 4WR3A 5CGQA 2YZ5A 3WD0A 1WUEA 4Z1AA 4FIQA 2VEMA 2OO6A 3MC5A 3MYOA 3GB6A 4GJIA 1CXLA 1FH7A 1T41A 1RA5A 4PBEA 4PCTA 1QHPA 1O4UA 1WBJA 4P7LA 3WIJA 3BLIA 4ZE4A 4FLQA 3LTYA 3VI2A 3EBVA 1VJIA 6REQB 4EIVA 3ZXWA 4AX6A 2YBVA 3TQVA 3DDMA 4K8EA 4C6FA 3V7PA 4ZCWA 4JR5A 2PF8A 2JKAA 4LT9A 1M01A 4CEXC 3W23A 3FJ4A 3HURA 2YFOA 1TTJA 5CLWA 3UGVA 1HT6A 1K70A 2Z0IA 4Q3MA 3TFCA 1FWDC 3AUOA 1S2UA 1EJSC 1ZBKA 3LCXA 3CHCA 2EPLX 2WLYA 1TX0A 2J27A 2FPTA 4UQAA 4AU0A 2FPYA 1UJPA 3FVDA 4GCAA 5AB3A 4G1KA 1WZLA 4L6HA 1GOQA 3BK0A 2RDWA 2AAMA 4J3TA 1WX0A 1I2PA 4AXKA 1HJSA 1J5SA 3CHVA 2TRSA 1B3OA 3NL5A 1XRTA 4PZVA 4JY9A 1P43A 3WY1A 4UTJA 2ZC8A 4QJ4B 1REQA 3WELA 4M29A 5JXQA 4KWOA 1AD1A 2PWVA 3QV9A 3R7MA 4TX9A 1L2QA 4GNJA 3I4KA 1JCXA 4PUJA 3L4WA 1EQPA 4TO8A 1TJ1A 3ARVA 1P6CA 3G3MA 4U2ZA 4WX2A 3QYSA 1XGZA 2W4XA 2Y1HA 5IXEA 2BBFA 4D2JA 1CENA 3O05A 2WQPA 5AYYA 2YYTA 4QDMA 2J9YA 2PWUA 4DBEA 1P5BA 4XWUA 1VBHA 3AOFA 4CLMA 4FXJA 2AQVA 4BHYA 3P60A 1L2UA 4IPJA 4US5A 1KFEA 3APYA 3K4WA 2OEKA 3A64A 3WH7A 7TIMA 2VNCA 2DJLA 3V3WA 4UTTC 4G9PA 2VUYA 5A6AA 3PS7A 5HQEA 3THQA 3ARXA 3NWRA 2VFDA 3HGJA 3BLDA 4Z1DA 1GVIA 4LVBA 4GUHA 3T1GA 1NWRA 2I57A 5A8MA 1PIFA 4FF7A 1QFEA 4ERAA 1TVPA 1LWHA 1SZGA 3UEQA 2F6KA 3P82A 3M0YA 4WKAA 4P8UA 1XKJA 4ASTA 2Y2WA 3BLKA 1OCNA 3TW7A 2NVAA 3PY2A 2OWWA 3LI0A 3NR0A 2I5GA 4PFHA 4ILSA 2KX9A 1UD4A 4LEFA 3PWAA 1BVWA 3LSBA 3DIPA 3F4VA 4YTRA 2A3HA 1MQQA 2XN1A 1MWOA 3VOGA 5T8GA 3RITA 5A2CA 1CXIA 1XJBA 4IIBA 3HM7A 2CXEA 2ISFA 3HGOA 2DSZA 2CZFA 1JVNA 2XH4A 5TIMA 3RM8A 2ISSA 1XCFA 1K1DA 2NX1A 5HR7A 3C56A 1QBBA 1VCVA 1UWUA 5E0KA 1W0MA 2XFFA 2YYUA 3C0SA 1OB0A 3QY8A 3B9EA 1XM3A 2HTMA 3IIXA 1L6YA 3ARPA 1KXHA 3HA1A 3L2IA 1BKSA 1JZ3A 3WLLA 5KMYA 1KA9F 1E4MM 2OOGA 2RFGA 4H4IA 3QJAA 1GZJA 3QY6A 4AIEA 2DZVA 4B16A 5FSDC 2PC4A 4YNGA 4ZQPA 4JX6A 3K8KA 1BKHA 4Z1BA 1F4HA 2UZ9A 1IWAA 4XB3A 1DHKA 4H9TA 3NNTA 1DEDA 3AIVA 3W28A 5IRPA 4Z2GA 3LM3A 2XH2A 3VKDA 5HDRA 3VNZA 3M7SA 1A0EA 1XLFA 4OIFA 5D9NA 1HJUA 1K4GA 1V0NA 1VB9A 3DGBA 3TYZA 4XD3A 1JDFA 4GFSA 3R2GA 1LUCA 1B3YA 1VFHA 3N15A 2EEXA 4UMCA 3AYSA 1EJTC 4REQA 1HJQA 3LG3A 2V5JA 2BTMA 2Q8ZA 2FHCA 1MEIA 3CT2A 4AC7C 2XJ7A 3BSGA 2XFYA 3WF4A 2VENA 4MNLA 1VD6A 4P7QA 3WCZA 3WJWA 1SFLA 3BMVA 2Z7KA 1GOMA 2ZWZA 2BS9A 4AZBA 4F40A 2WMIB 2NLYA 3OGRA 2J8FA 1DHPA 4B3KA 1POJA 1J11A 3S2MA 2VZTA 1FKWA 2C79A 3L4UA 3OQ8A 1PZ1A 1JDAA 1ELSA 1EC8A 4P5UA 1JCNA 1ZRQA 9XIMA 3N3MA 3A9BA 3GFYA 3BCJA 4HU8A 1A5BA 5AHEA 3KL3A 4Z08A 3V75A 3W7PA 5HNUA 3W74A 3LCHA 1EWEA 4KFNA 3H7UA 3W84A 1LUCB 3OVPA 1XC4A 5C9WA 2GSHA 2RGLA 4REQB 1GQKA 1XIDA 1FFRA 3BXWA 3PTKA 1Q6FA 3O6DA 5M3WA 3MZ2A 4OUIA 4QCEA 2A21A 3RCMA 1C7TA 2JK2A 2XG9A 1UUOA 4WY0B 1WZKA 4UTWC 1NFBA 2YCLA 1V93A 2WB5A 4LOCA 4I6KA 1NM9A 5CPMA 3CAKA 3DFPA 1XWYA 1V03A 5BZAA 1PZ3A 2FGLA 1F2JA 4L6OA 4QDPA 2BXVA 3A5VA 2RJGA 4IWWA 1OG0A 2VZUA 1OQFA 3BL3A 4O13A 4Q4RA 4XAPA 1RV8A 1Q7QA 1MFVA 4XZWA 5FJUA 4ADTA 5A6BD 1RAKA 5A2BA 2PDYA 3I68A 3WYZA 3E3HA 3P84A 3NL2A 2YDRA 5LA2A 3QBUA 3EOEA 3MKVA 3FVMA 4AHOA 1X8CA 3QHNA 5TNVA 2G3JA 3E12A 1VIWA 1BQGA 1OHLA 5BW6A 2Z6JA 3VPLA 2V3FA 7XIMA 4ACZA 1P0BA 1UWIA 3N2TA 4CEUC 1XIHA 4EACA 1AK5A 3IVTA 2AAAA 4HA1A 1HTIA 4WOQA 3WDRA 3UR7A 3CQKA 5AC7A 2H8ZA 8CGTA 3C2RA 3CO4A 3W7JA 1TE6A 3SCTA 1W17A 4HTYA 3W1TA 1EDGA 2MNRA 4J3VA 2ACRA 2VO5A 4B4HA 3L7RA 3K2GA 2YCLB 3GVQA 3MY9A 4NJJA 1QI3A 3MSRA 1B4EA 3QQ0A 3K5XA 3M7WA 4L5ZA 2XVNA 3U0HA 4NASA 5TAOA 5ABHA 3T07A 3B0XA 1QCWA 3PBUA 3WK2A 4C1KA 1ISXA 4MWAA 2YCIX 4RE2A 4HB7A 1CGWA 2BWGA 2X1RA 3UXLA 1IZJA 4ROQA 5CGTA 5T26A 3B8SA 1RD5A 2QGYA 3P0WA 2FVMA 4I5UA 4PCPA 4PUWA 5I3KA 1W3TA 4KEVA 3LGEA 1VHNA 1UYQA 3C2VA 5F1UA 4KWVA 1NVMA 1EGMA 3CHFA 3VA8A 1KXTA 1BEUA 1V0KA 3SUWA 1VH7A 3AHYA 1YX1A 3DHPA 2WJFA 1TMQA 1Y7VA 3TC6A 2FTPA 3OLDA 1GK8A 4KS0A 4XZNX 4FNSA 2JIEA 3OIXA 5FF2A 3AALA 4L6DA 2D3LA 2G37A 1U5HA 3SIZA 2BODX 2PU1A 4B9YA 1LT8A 4M6UA 1L6SA 4LFYA 4LAMA 2ZA2A 1R2RA 1JI2A 3PK7A 5HINA 1P6BA 3RJYA 2YCEA 2ZVRA 5BCAA 2ZC1A 1PXGA 4MWAB 2GGEA 4UQ9A 4XUGA 1CGUA 1ZQ5A 5H91A 4PSPA 4GY7A 4GY0A 3PUGA 3WK0A 5EMYA 3GG1A 4Y96A 3H6OA 1FDZA 5EPDA 2PBGA 5HMDA 3AZSA 3V36A 3VGDA 1EJRC 3LXAA 1S5VA 4LNYA 1E9ZB 4F2TA 1WV2A 1XG4A 1XLGA 3A4WA 2Q02A 3VUSA 2DIJA 2WMFA 3L4ZA 2HE8A 2G96A 5HMFA 2RH9A 3SRFA 5GVJA 3N9KA 1VHCA 1S3HA 1W5OA 1BLIA 3AIUA 3GFZA 2VKZG 4IL2A 5JBEA 3SN0A 1QI2A 3CQJA 3S6TA 4O15A 4MB3A 3RF9A 3E0WA 4AIUA 5A2AA 1MDLA 1DIKA 4PMJA 1TUFA 3AU2A 4UNIA 2EG7A 4GBUA 4XUYA 3L12A 4JICA 3K4DA 3PNZA 1TR1A 1KRAC 2SFPA 4JOMA 1KCZA 1ONXA 5J8LA 1R47A 3VNIA 7TAAA 4JTFA 1QW8A 4G5DA 4U33A 4Q4SA 3ALFA 5E0CA 4KPLA 3GU9A 1NWUA 2A7NA 2AL1A 3R79A 4ES4A 4B5TA 4Y9MA 2VTFA 3T09A 1TA3B 4RDYA 4S3AA 5CSSA 1XX1A 3P0XA 4HHHA 2GJRA 2GGJA 3MPGA 2MANA 1K9DA 2BGSA 3BLLA 4X2PA 1H5VA 3VM7A 3O06A 2WM0A 4NZ4A 5LIWX 3TTQA 1V3KA 1EBGA 2A4AA 3W2LA 1DJGA 2V68A 3R13A 3STPA 2I16A 1RBOB 1ITQA 4MNJA 2FPVA 4OBTA 3I6EA 1UPMB 4UZSA 1F8IA 1GG0A 1GOWA 3UY7A 4EXQA 1YW1A 4EXAA 2G3FA 2J66A 3NDYA 1CLXA 4I7WA 5H8UA 4B2DA 3WLOA 4NUWA 3C0LA 2G3MA 4NX5A 2F9RA 3QQWA 5I03A 4A3QA 1V77A 4DF2A 3MJYA 3CMFA 1TCMA 3WH9A 3MP4A 3VNJA 3L4XA 3W2MA 4A22A 4WF7A 1OC5A 3T2PA 3VMOA 2P10A 3DCPA 4M56A 3TVAA 1BGAA 1LORA 5A1AA 7A3HA 4KGLA 1XFCA 1KCKA 3DOPA 1JFHA 1UD5A 2QR6A 3A3XA 4QRNA 4KH2A 1H5YA 4JY8A 3SIMA 4C1LA 1OEPA 4AMAA 2EPHA 2CZ5A 4H7VA 4MB5A 4GABA 1E40A 4NNAA 5LNRA 3ITVA 3WEZA 1UWSA 4O53A 1Q7MA 4DJDA 5LA1A 1TQXA 2AKZA 1FWSA 1LOQA 3GNOA 3EXTA 3GNNA 1JDEA 4TIMA 4Z2LA 4PMDA 4LCQA 3QM3A 1QNOA 4Y90A 4GVIA 1A80A 3LHYA 3RGTA 2ESCA 3F2CA 5C0QA 3L67A 4DI8A 1LQ0A 3HF3A 3TN4A 2QPXA 5HBFA 5CSYA 4M82A 2ATSA 2Z2AA 3WQCA 5HJXA 2VXNA 4M24A 1CXKA 3MQTA 1TV2A 1EBHA 4FZIA 4MPQA 2FFCA 4US5D 3R1ZA 2DZWA 1H62A 2Z4GA 4TX8A 3S5ZA 3PVFA 3PP7A 2VWTA 3SURA 1DWFM 1MNSA 1XRFA 2EPMX 1YADA 5FAJA 1AQHA 2X0HA 2PFHA 4FIRA 4FX8A 3ARTA 2E8ZA 4N4PA 3QV8A 1W91A 1XISA 2A85A 4ZOCA 2RAGA 4JPGA 3OIHA 5AHFA 2E4TA 4YS1A 2VHLA 1EC7A 2BDQA 3EDKA 3OZOA 3OG2A 3RLGA 5D2TA 4DWDA 3MS8A 1S2TA 3A4JA 3OA5A 4R7OA 2X0SA 2JGQA 3E0FA 1G4PA 1B90A 3PB2A 2WNNA 1GUVA 5HNRA 3EWBX 5HQLA 1V6YA 1UA3A 2OX1A 4MZYA 2POTA 1Q4WA 1OWQA 4QIUA 4CQ8A 4MIMA 1TTQA 5C9ZA 4GACA 4OGZA 4HP5A 4C6QA 4QX4A 5KZ6A 1YPIA 1XGDA 3L5AA 1JYNA 3DFHA 1IT8A 3ZYZA 5BOFA 1R9ZA 3QC3A 1BXBA 4HPNA 4PEKA 1GQIA 1XLHA 1DWAM 1XXXA 4UQEA 3GAKA 3VD3A 4GISA 2AMXA 2NV9A 3OVRA 2FH8A 3SQSA 4IXHA 1ODUA 1OT2A 3RUBL 3KVMA 3CUGA 3URQA 3ABOA 5K4ZA 4DPPA 3PZGA 1OF8A 5LNVA 1UIPA 1JGIA 3UD6A 4OOZA 5HNNA 1TYGA 2Y24A 1CB7B 3B9OA 2ZXAA 2HVMA 5EY5A 3L5LA 1H50A 2PWEA 3D5HA 4P8XA 3PZVA 4K37A 5A94A 3O9NA 4J3UA 5H2ZA 1VP5A 4RLIA 1KWKA 1QTWA 1UHVA 2FVLA 4UQBA 4B4FA 5DCEA 1ME7A 2G50A 2HVNA 1NQ6A 4GRSA 4S3JA 1TUXA 3HG3A 2Z25A 4EXBA 2EAWA 4TVUA 2J9XA 3M5YA 4HNOA 2ZZ2A 1NH6A 1RUSA 4K68A 3HPZA 4S3DA 3ANYA 5HNTA 1LLOA 3BQ6A 4OT7A 4DF0A 2NLIA 1IEQA 2Y70A 3S6OA 3T4CA 2PGRA 3VYLA 2NW0A 4H2CA 3QFWA 1IXOA 1D3HA 1T0OA 1N8IA 4ZB2A 1MW1A 2TSYA 2WZMA 3MW7A 4HD5A 4DM1A 2OEJA 1RJPA 1T5AA 3DBPA 2NV2A 1JYXA 1CGTA 4GIEA 4C6LA 2Z1WA 2GDUA 3CZ8A 3GKFA 3LENA 4PN2A 1OX6A 1LLZA 1ZHAA 3W1QA 5F4SA 4JN8A 1XGEA 3U2CA 1WO2A 3O2LA 1QK2A 1ZS2A 4M8UA 4H6QA 4Q8TA 4KESA 2G3NA 1KR1A 5A69A 3WLTA 3M0LA 3ABQA 5K9DA 1QPKA 1J0IA 1EA0A 1PE1A 4KIEA 4AW7A 4HIBA 5D2VA 2ZX9A 3GDTA 3K46A 4PR4A 4JTAA 3WL0A 3CGTA 1F3TA 1YHTA 1E1EA 3G1HA 5FF4A 3RR1A 3CXOA 3SEPA 5DO8A 2PDIA 3EB2A 3IVSA 1PWLA 5CBJA 2ZX6A 4R3UA 5C2XA 4LB3A 1G67A 4XVEA 1TPH1 2E9MA 4NG3A 1DP0A 3QFEA 3EDEA 3WNLA 1ZTVA 2QUUA 3LHVA 1L0PA 4N9EA 3E96A 2OLAA 4GG9A 4I8DA 4JIEA 1B31A 3WNMA 2R94A 4MAVA 2VFEA 3ECQA 3RFAA 3DI1A 1S2VA 2W27A 4DYJA 2XZ7A 3XINA 3TNBA 1E5JA 1UR8A 5HMSA 4ZO7A 2F6XA 4LBUA 4WZHA 2RUSA 1FWJC 3WNPA 4WD0A 3WJXA 1R3SA 3WLRA 1ZL1A 1M04A 2OQHA 2CC0A 6ENLA 2QMKA 3PAJA 2RHGA 4YVPA 4YU1A 3NZPA 3TJ4A 3LEPA 3HQOA 1OGSA 4U31A 1XP3A 1JZ8A 4JBRA 5EYWA 3C2EA 3GK0A 4LEQA 4HPHA 1BPLB 4QJ5B 1EDTA 3RNDA 3TJXA 3T7VA 3H2EA 3VIGA 1UG6A 1ECEA 3DI0A 2B81A 6TAAA 4P8WA 3OQEA 4MJ2A 3TH6A 1AG1O 3ID7A 3CPRA 2C1IA 3BTNA 1OBAA 2J24A 5LYRA 2CEQA 1HKIA 4WUIA 4S23A 1Q6QA 1RQEA 3VCRA 1PKMA 1E71M 3KRUA 5C2GA 3N6JA 3TN3A 1AODA 3CMJA 2BVDA 2DT3A 4L1WA 5KINA 5EKYA 4FAMA 1QVBA 3PBGA 3LGDA 3WUEA 3VGBA 4DZIA 1V3HA 5LIXX 3ARZA 1I60A 3ZLHA 5D9PA 2QS8A 1LOLA 3N2OA 4J3SA 1KBJA 4GY1A 3NZQA 5I0DA 2Z1XA 1H2JA 4UTUA 3RIKA 1WOBA 4PCFA 4LGXA 3E0IA 3R89A 5F2MA 4BWLC 4ZFMA 1XLBA 3TR9A 3BAIA 3SADA 1F7BA 4FNUA 3AWNA 2J62A 5ABFB 4GYKA 1Q7ZA 1R3YA 2WSQA 3T55A 3VOIA 3BWWA 4G2DA 2OZTA 1GZ1A 1H3GA 3TWAA 4UFMA 1GYNA 3NQ2A 2GGGA 1ECQA 4NJGA 3DN5A 1CBGA 1W1B1 3A21A 1V51A 5A5WA 3NPWA 2BG5A 3TK7A 4NNBA 3N73A 3G8RA 4WCJA 3ZR4A 3LV5A 3W82A 1UBPC 3NEHA 4AEEA 1V6XA 4ZQCA 3CYVA 1K6AA 3W7RA 4YTUA 4K1GA 3BGAA 1RPKA 5I3FA 3WLNA 3BANA 3ANVA 4KEMA 1KQZA 5IOBA 4UC5A 3BQ5A 1DTUA 1GKPA 4CCZA 3PFMA 1Q63A 1UC4A 3W2JA 1R7AA 3BE7A 2ZADA 1RQHA 2XIJA 4Q8OA 2YL5A 4O11A 2OQLA 5U4NA 1GW9A 1M68A 2Q8XA 1I8JA 5E93A 1OC7A 2JGYA 1LQ2A 1XG3A 3V4BA 5DN1A 1A5OC 3S5YA 3SCNA 2BY0A 2E9LA 1TV4A 4LQ1A 4E4FA 3AZTA 4LC6A 4MJ4A 4GYJA 4GI9A 3VIHA 4D8AA 3CNYA 3N29A 3SRKA 2VFHA 4K7YA 3SQMA 1PIIA 2QKFA 1FQ0A 2FGBA 3MCOA 3GXFA 4IX0A 3BMXA 4H83A 4LU0A 1WE5A 2JQXA 4NZFA 2DIEA 5M17A 5FJJA 4D6FA 3URNA 2EBNA 2ABBA 1GJPA 4I9JA 2Z6IA 5I02A 2F2KA 3MO7A 3FSUA 1BXCA 2A0NA 5DXXA 4FK9A 1S46A 4C6MA 5RUBA 1EYEA 2XVGA 1UZDA 1X6UA 5KTLA 4B5SA 3D6NA 4O1BA 4HOZA 4RL3A 4QS5A 3H2NA 4JX4A 1PCWA 1O68A 3OZPA 5DT5A 1ZP3A 2NXHA 4HHPA 2C3ZA 2DEPA 4IGMA 1M5WA 3UP8A 3JZEA 2IUZA 3WBAA 1ZP4A 2WMJA 3TOYA 2PE4A 2ZDSA 4O18A 4DWSA 2GWNA 5JIWA 1W3NA 3W00A 1EJWC 3APGA 1QWKA 3GH7A 3GXNA 3N04A 1F6PA 2HSAA 1CT5A 4GLEA 2YXOA 3I7RA 1XDMA 3LN3A 4W5ZA 4W9TA 1KXQA 3E49A 1ZJIA 1XH2A 1KCXA 1UUMA 2HBXA 4W87A 3QZ6A 1J0ZA 3F5LA 3GRIA 1Q6OA 3QOKA 4MMWA 1EKOA 3L0NA 4DVOA 4E2DA 3W02A 1WBHA 3ZOAA 3CV6A 4N42A 1CXHA 1XBVA 3LRLA 4AWTA 2VCBA 3PZIA 2IPGA 1WYIA 5DQPA 2D20A 2WV8A 1QNSA 3W73A 2ZRVA 4LYKA 1US0A 3I7QA 4A05A 4UOJA 4A8IA 1YTEA 3WDQA 4ZR8A 4O28A 3TTOA 1O94A 3TW6A 1EOMA 2WC3A 1K7XA 3N11A 3P67A 3N4FA 4B2DD 3EMZA 1F9CA 4O4WA 4IHCA 1Z69A 4XTDA 5BMXA 4O8AA 3CTLA 3A6OA 5KITA 1PJ9A 4DWSB 4L9XA 3P14A 1TX2A 4PL1A 4QTGA 3ABRA 4WIWA 1F3WA 5I3DA 2PDXA 3KDOA 2V3GA 3AHTA 1TR9A 4LF2A 1M41A 4RDWA 4K38A 3P8IA 4FA3A 1RH9A 1Q6GA 3VMNA 2CNCA 2PC8A 1M3UA 3EKZA 5DXYA 1OSEA 3ARQA 4GYPC 2OPJA 3SR7A 1C93A 1KGWA 4ZFCA 1KFLA 2C6QA 2I5QA 2HJPA 2W63A 3C0QA 3WBXA 1JZ6A 3KVKA 4XZLX 1IE7C 3SJ3A 1HNYA 3BV7A 4DJDD 1ZGDA 4IMEA 3W81A 4IP5A 2V2CA 2VGGA 2HEJA 1DWIM 3V16A 1G9HA 2OZ0A 1LOSA 3GUGA 3NPUA 3KCJA 4GIYA 1F3EA 3EOOA 3NQVA 4R53A 4RR4A 2Q3RA 3CWHA 3GDLA 1JL8A 4NILA 1WB0A 2PZNA 4QE1A 4YHEA 2DZPA 4BJHA 3NZRA 2E0PA 1KWGA 4PTMA 3WF2A 4JHOA 5EMMA 3V18A 4US6A 2YJQA 5LNUA 3OZMA 2XIBA 4LW7A 4H9UA 1LM1A 4JTEA 2FZ8A 4JTHA 1RLCL 4F4RA 2E25A 2V82A 1DPMA 4XAYA 1Y65A 1LWJA 1EX5A 4NF7A 2V3DA 4LBSA 5CCZA 4I8YA 1KBLA 3LMYA 3EX3A 1XQKA 4M3PA 4E4UA 3H2FA 3AO0A 3VC6A 4ZQMA 1E6NA 4J28A 4NHVA 5SWUA 3GH4A 1TPB1 1QNVA 4CN1A 4H9YA 3S2LA 1RP8A 4R9OA 2ZICA 3QTGA 3N12A 4H6EA 4JD4A 3YPIA 4HK7A 4K36A 4M5PA 3N18A 2OOFA 1TWDA 3ENLA 4P7RA 4MKSA 3EEZA 2VC5A 1SZRA 3QEZA 1QW9A 1BF6A 4FALA 1YPXA 3C8FA 2F8QA 4E2BA 4OQVA 3CIWA 3QGAC 1TPDA 4GO8A 3VKAA 1I75A 4AZCB 1GQNA 4HPXA 2XN0A 2Z1SA 3LM7A 1SUXA 3CH0A 2H3DA 2HZGA 4S2BA 1HO4A 2C8NA 1RR2A 1IR1A 1JIBA 2YOCA 5M5DA 3LSCA 1TWZA 4AD0A 2YSWA 3OGSA 1UBSA 5FCZA 1N7KA 1QI5A 3H22A 3E5PA 3OHIA 5D9MA 1I2RA 3LLDA 3VD9A 4R7WA 3RRXA 2NX3A 2WVVA 3UJRA 4AZIA 4FR6A 4M1RA 1FWGC 3FK4A 3QYQA 5C54A 3BICA 4RV3A 1TVNA 4XKYB 1DJZA 1DWGM 4OE7A 2ISDA 4CQCA 2C7FA 2EG8A 4QG6A 4FNPA 1JCMP 3EX2A 1NFPA 3HG5A 4EAMA 3B04A 1H0IA 3G22A 5CSRA 5CPSA 2WQDA 2OXNA 1J2BA 2GVJA 2B0MA 5FSEC 1FXQA 3WNOA 1KGXA 2W61A 1R8LA 3MUAA 1WUFA 1W5MA 1NOWA 5D05A 3VU2A 1UD3A 1V6VA 2P88A 4MZ8A 3ZR6A 3SUUA 1OYBA 5BNKA 1WAWA 1U1UA 2CLKA 4JEJA 3DFYA 3D47A 2Q01A 3ITTA 3WQWA 2YPIA 4ZBCA 2E5CA 3FKRA 1UWQA 1QUMA 2FQIA 2WBGA 2VFIA 1A5AA 4WOZA 3GZ3A 4RE4A 2GVEA 3QMRA 4R34A 4MYXA 2B7NA 2HK0A 2QMJA 2EPKX 4X3ZA 3OEXA 3NOEA 1C8VA 4YWIA 1ADDA 3UPBA 2WVVB 2IKHA 1JFXA 1O1HA 3SSZA 2ZUNA 3GM8A 5DF0A 3UR5A 1U30A 3GDKA 1YDVA 3D0CA 1SQ7A 1O5RA 3TIMA 4Y8FA 5CBIA 4JYEA 4ORIA 2IKIA 2QJHA 1DJWA 4HNVA 2JIWA 5J5DA 2AKMA 2PD5A 3RMJA 3RU6A 9XIAA 4NZJA 1HZYA 2JFEX 2PGWA 3LPOA 4V28A 2YLAA 2X09A 3TN6A 2VJXA 1W8GA 3CHEA 3Q2DA 4U2YA 1SO6A 3QPYA 2J77A 3TN5A 4HYRA 3T8LA 1E9YB 1XYZA 1TV3A 2WZTA 4OBSA 3T0AA 4C7DA 3E0VA 1NDYA 5G4HC 5EMKA 1LL7A 4TX6A 1Q66A 3FAWA 1FHDA 1EUNA 4K7VA 3HIJA 1R3QA 1YDNA 4V15A 3BUVA 4DNMA 3MUIA 1XLAA 4H9VA 1YNYA 2BHYA 1GHSA 3DHUA 3W1MA 2OWCA 1FP9A 2FVKA 4GFIA 1V5XA 1JF5A 5J04A 2J78A 2VGBA 2GQAA 1LRQA 3M4HA 3W24A 5I79A 1EWDA 1PX8A 1PKYA 3AIRA 3DFOA 3NDZA 2J9ZA 1DWJM 1K6WA 2BX7A 4JGDA 3VCNA 4IM4A 3TAKA 1UH2A 3ZJ8A 3DZ1A 3GG8A 5C2CA 5A8NA 4E5TA 3GE7A 4PMOA 3W53A 1JAEA 2YXGA 1KM4A 3N3TA 1ONEA 2BZNA 2VR5A 5F2GA 3MI2A 2QPSA 1ZAJA 1RQBA 2O55A 2V8ZA 3S0CA 2QCCA 2Q09A 2BNJA 3TC7A 1A49A 3LZ5A 3MV11 4GQBA 1OX5A 3M07A 1QK0A 3L21A 1JPIA 1YEYA 4O0QA 1ZB5A 5JIPA 3QR3A 3CPUA 4IT1A 1G5AA 4MYAA 2WSKA 4DJFA 1Y5VA 4HSHA 4HOXA 3MB9A 4M19A 4GA8A 2VL4A 1YXDA 1SW0A 1TIWA 4AD2A 4XAFA 3L66A 3WMCA 2WXDM 3MA8A 4IJCA 2W91A 2X41A 3LNMA 4C6DA 3HMJG 4LH8A 1F05A 3DYOA 5F4XA 2E5DA 3GHRA 1QXLA 4GIRA 1IEXA 3K30A 2ACSA 2Z28A 4MDPA 4IJBA 2C71A 3MCMA 2G41A 1B2YA 1LF1A 4ATWA 3MV01 2XIIA 4ATLA 3R43A 2QCHA 4YN5A 2VC7A 3AS3A 4IOTA 2PTXA 3TYUA 2DPEA 2PRMA 4E4PA 4E8DA 5I09A 1RCXB 1PKNA 3M64A 3E2VA 2P8CA 3IVUA 4FOUA 2J6XA 1SVDA 1BG4A 2CHOA 3W2UA 2PDMA 1YNPA 2YL8A 4X2RA 4NRSA 4N2YA 4X61A 1VYRA 4JXCA 4ZSTA 4IPIA 2VDHA 3W1UA 3AC0A 3SGZA 2GWGA 1O1ZA 3M41A 2A7RA 4N9CA 2CWNA 4GUGA 4NY2A 2XM2A 4LVFA 2ZE3A 3BCDA 3SCWA 3ANUA 3A22A 4H8NA 3OHMB 1JYVA 1KFJA 2J8TA 2YDSA 1ADSA 4H19A 3UNDA 5FEXA 1UKPA 1H61A 4Q8QA 3TTYA 1CX9A 5BXRA 5I06A 3C6CA 2EPOA 2WNZA 1JZ2A 5I5RA 4YL2A 1N8WA 3DKJA 2GFTA 1KTBA 2IQDA 3GY1A 4ZEPA 1K8XA 5JH1A 2EKGA 4QAIA 1OX4A 2IPWA 4O16A 4CD6A 3NQ7A 2WANA 2HQAA 2H8XA 1PIGA 1KTCA 3BLFA 3RAOA 2P53A 2E9BA 2YL6A 3VIPA 1S3TC 2PDNA 1FHVA 4EWND 2Z1KA 4NKCA 1QPNA 3S47A 4F0SA 3WSUA 4W85A 1ZBVA 2XGIA 5C71A 2FHBA 2CCRA 1H7PA 1DQUA 3CMGA 3PZOA 4L4LA 4QSFA 3PULA 3IV3A 3WQFA