3LTPA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltpA00
3IVUA 1OYBA 3TXVA 4MVAA 1IF2A 1KFLA 5EL1A 2YPIA 3G24A 2VENA 4UTTC 4C1KA 2WOQA 1F2JA 2FQIA 3UPWA 2C0AA 1YDVA 2D73A 4BFAA 1OF8A 5FI8A 4JDYA 4ZZ9A 3SZ8A 4JN6A 4CNNA 2I1OA 1OFDA 3HJZA 2E77A 4DO4A 1QPQA 3W7CA 3NPVA 4O1DA 2P1FA 3BPWA 1EPXA 3GXPA 4Z08A 3ABSA 3NL2A 3PS7A 1KFEA 1LRTA 3MP3A 3N14A 4ZQNA 3W86A 1VC4A 3LXCA 2ISWA 1ZALA 3EKZA 3FS2A 2GQAA 1G4EA 4JS3A 1GVSA 1VHCA 3NQEA 4UXDA 3T78A 3W84A 3C61A 3A5VA 1JUEA 4OBTA 3RU6A 3CLMA 3THQA 1WOBA 4O50A 3W7LA 5LSMA 4Y8FA 1VLWA 1K8ZA 1TTIA 2Q3OA 1VLIA 1XUZA 4WZHA 4IQLA 2QJHA 1QOPA 3OIXA 1B3OA 1RZMA 4KFNA 1J4EA 4IMDA 3GDTA 3N2MA 3NQ8A 2P0OA 2ZFAA 1L2UA 1PCWA 3IGUA 5FEPA 5A8GA 3LHZA 3Q37A 1GZGA 4MY1A 4WXZA 1EP1A 1S5VA 4QITA 4M6QA 2F7FA 3GAYA 2Y70A 4FEZA 3TUUA 1YXDA 1IXNA 4MY8A 4BWLC 3KVLA 2E6AA 3LV6A 2NXIA 3DGRA 2EGZA 1W54A 2HMCA 5DLCA 4LRSA 2VFFA 3UQNA 4BI7A 4ML9A 4O12A 1JULA 5A5WA 1M6JA 2OZ0A 4XUGA 5H2ZA 3NQVA 4MYAA 4AF0B 3STCA 4LC6A 1H7OA 5G5IA 4GXMA 3I65A 1TRDA 4O1CA 1T8XA 3W7IA 1A5AA 3PG9A 3PF3A 3L21A 1XKYA 2X2GA 3TU9A 1H7NA 4AMAA 4WQ6A 3DI0A 1SO4A 5AHEA 5CPMA 5HQEA 3O8AA 5D04C 1HO1A 1ALDA 3SSJA 3DKJA 8TIMA 1OYCA 3M43A 1GT8A 1VYSX 2Y85A 4ICNA 3HIJA 2C16A 4NNBA 1QR7A 4K6AA 2ZCGA 3GVGA 2ZRYA 1H7WA 4UTWC 5CZ0A 3FLUA 3NVTA 3G8EA 2A7RA 2R91A 3P5ZA 4EF9A 5LGZA 4CCCA 3MMTA 1PE1A 1SO3A 4S2CA 3MYOA 5DBUA 3UZJA 3S1VA 3P62A 4M7TA 1N55A 1TJRA 2ZZ2A 3C6CA 4IMFA 5G2HA 4HIBA 3SI9A 3TC6A 3WJYA 5E93A 6TIMA 2VEKA 4AWTA 3LCHA 3KAOA 3DHFA 1H5YA 3ZWTA 5I3HA 2PRLA 4Y9AA 3HGSA 3IGXA 3N19B 2A5HA 1JRBA 4DBDA 4OT7A 1H1ZA 3WK1A 3CPRA 2DORA 4EWND 3SFKA 2TYSA 1TRIA 2QF7A 2NZLA 4GBUA 4UR8A 4GFSA 1GYLA 1UB3A 2H3BA 3QMTA 3S1WA 3EXTA 1B4EA 1XUUA 1K03A 1C9DA 1Q45A 2TSYA 4MFEA 4MZ8A 1KM4A 5BMWA 1W5MA 1MXSA 4QM1A 2DJXA 4IXHA 4WY0A 3W7PA 1VYRA 5D2TA 3ATYA 3W7JA 1I45A 5HWJA 1JUBA 5HR7A 5D33A 1O94A 1KBIA 1OF6A 2HSAA 1IXPA 4EVZA 4RR4A 4NT0A 1OFQA 1H7RA 4M6PA 5D2WA 3C2RA 4A29A 3P5YA 1RQHA 4A22A 5FEZA 3UPBA 3R89A 2ZA1A 4XQ6A 1B9BA 2VC6A 3EWWA 3S5NA 1P0NA 1WA3A 1KFKA 1KV8A 1CX9A 4KWVA 2YDAA 1PIIA 1K3UA 3F4WA 1VHNA 2FB2A 4R53A 3W88A 3W7OA 3EX3A 3PR2A 3W74A 2J9YA 3MUXA 1FDZA 1I8JA 2BXVA 3S9YA 1KM6A 2ABAA 4Z0SA 2ATSA 3BW2A 4MOZA 5HJLA 1N7KA 2X1TA 3HB9A 1T0OA 3INPA 4ADTA 4UMBA 2QDGA 5HUOA 5KINA 3SGZA 5EMUA 4JTKA 1SU5A 3G3MA 5AHIA 4MZYA 5IBXA 3G1VA 5LNUA 3IVSA 5AHMA 3F1QA 4O0ZA 3E0IA 3P8JA 3I7QA 3BVJA 3TK7A 1F05A 1GVQA 2ZBTA 2ZYFA 3EWYA 3IIZA 2FPYA 4UFMA 3N3MA 4OE7A 3TR2A 3CEPA 4N4QA 1TMHA 3PBVA 4LVBA 3PG8A 5D2YA 4KFPA 3BW3A 1Y0EA 4PL1A 1JR1A 4UMAA 2BLEA 1Z44A 3A24A 1VCFA 2ZZ3A 5K9XA 2NX3A 1H50A 4S1FA 4X3ZA 5TBOA 3QEZA 2WNQA 3W2KA 1PHWA 2F84A 3IIXA 2WSRA 1DOSA 1RVGA 3W73A 2QCDB 3GXNA 4PH6A 4ZMGA 1G6CA 4GRSA 3TSMA 1BTMA 2NWRA 3BLIA 1F74A 4UTUA 1PS9A 5AHNA 4FF7A 3NQCA 4WJEA 3Q2DA 3PUEA 3QSRA 4ADSA 2V81A 1GTHA 1JVNA 1SZGA 5G4EA 1L6SA 1W3NA 1AL8A 4FXRA 4A2SA 4GJ1A 1LRQA 2QEZA 4PL2A 2AQWA 3BG5A 1LBMA 2V5BA 4ALDA 3L5AA 1TPH1 2IQTA 3L5LA 1H62A 3W22A 4FX8A 3KHJA 5C5YA 4JR5A 1KV5A 1AK5A 3BARA 3BG9A 5DXXA 4YMZA 5HWMA 3N34A 3QH2A 4QSHA 3IIOA 4QNEA 3W7DA 4JY9A 4O13A 4UMCA 4LV9A 1R2SA 4DF2A 3U8GA 2CFFA 3K30A 4YXGA 3PVFA 3LCWA 1X7FA 5LGXA 4O52A 5IM51 2FLIA 3ANYA 1TPDA 1TSIA 1YTKA 1R2TA 2GPTA 2LLEA 4NZJA 2GJNA 4AF0A 2H90A 2WO5A 3BW4A 2PE4A 1DHPA 2J88A 4Q32A 1TPVA 1PVNA 1JCXA 1UASA 1YADA 3NPXA 2QR6A 1LLWA 5CPOA 1G7VA 2WPBA 4RKAA 4EOUA 3LTSA 1YYAA 3ABRA 4O11A 2WSYA 4IMEA 5K4ZA 3UNDA 1TCDA 2X1RA 3QZEA 2C18A 3YPIA 3GZ3A 1EX5A 1OX4B 4E0CA 3S5OA 2R94A 1B4KA 3GKFA 1G4TA 3W7NA 1OJXA 4O18A 1VZWA 3ELFA 4PA8A 4FX7A 4MJMA 2NX9A 4UUIA 3W1PA 3LHTA 1KLYA 4XTDA 3W2NA 2JKAA 3RNDA 1EB3A 1TV5A 4HPJA 4Y6GA 1FCBA 4Z1AA 3O05A 2QUVA 1I2NA 2YW3A 1HO4A 2PRHA 4O4WA 4OGZA 3WK0A 2Q8ZA 1D3HA 3C4UA 5LNVA 2G97A 1VGAA 5C54A 3W1LA 3W1RA 1FDJA 3RLUA 3C2OA 2CLLA 1L6YA 3RF9A 5HUPA 2ZZ7A 3TAKA 1GVRA 3PB2A 4MZ1A 3NPUA 2QCFA 2XFWA 5AB3A 4NXSA 2WSQA 3OBKA 4R34A 3TCEA 3W1QA 1G4PA 4HKPA 5CSSA 4IXXA 1K02A 3LX9A 5D32A 2H8XA 3W7KA 2VEIA 5F4SA 1AMKA 3DBPA 4CCDA 3M7WA 3NO5A 4M5PA 3GX9A 1W5QA 3HG5A 1FWRA 4WD0A 5AYYA 2ZZ1A 3CWNA 2P10A 1OK6A 1RR2A 1MEWA 4KKXA 2X1SA 4ZQPA 4X9SA 1H60A 3TMQA 3EWBX 1ZNNA 2QAPA 1JCMP 5FEXA 3CC1A 5HR6A 1AW2A 2E5DA 2CLFA 2CLOA 1ICQA 3I7SA 4FNTA 3G1AA 4O8RA 4I9AA 3ABOA 1Q6OA 3HGRA 4OV9A 3H54A 3L9CA 4P2VA 1OVDA 3TJXA 3BGGA 1Q3NA 1TPUA 3VE7A 4RZ4A 3JS3A 3B03A 3DU0A 2E1DA 1MEIA 3STFA 1TB3A 2FPTA 4LNYA 4FNQA 1AW5A 3TV8A 1A5SA 3M5ZA 1H63A 3NQ2A 3PBYA 5DCEA 2KZHA 3HOJA 2A0NA 2YX0A 1FWTA 3PUOA 2NWSA 4IX0A 2QCGA 4NNCA 3LHWA 1M7PA 4MJZA 2RDWA 3P74A 4NJIA 1QO5A 2QCEA 1W5OA 3KVJA 3SIZA 4NJHA 4K8EA 1SW7A 1H7PA 4JTEA 1CI1A 5TQLA 4NU7A 1O60A 4RXGA 3UWVA 2YFOA 2A21A 1PL9A 4UTTA 3QF0A 2ZTJA 3ZWSA 3GB6A 1SUXA 3M5XA 4HNUA 1S3HA 1OFEA 3EWXA 1JUKA 4DBEA 4DF1A 3P7YA 4ZQRA 4Y90A 4NXKA 2V2DA 1ICSA 2DJLA 2QCDA 4JTJA 3W7MA 4QAIA 3G0SA 3A5FA 1KBJA 1W5PA 4UFIA 4LU0A 2B7QA 2QCHA 4JTTA 4WUIA 4N9BA 2X1UA 2R14A 1XL9A 3HPZA 2ATMA 1KFJA 1O4UA 2QDHA 2Y62A 1VJIA 2VOMA 1ZENA 1SZFA 4XBKA 4IX2A 1KM5A 5AHFA 2YSWA 1N8FA 1MZHA 2FIQA 4K39A 4AHOA 1QWGA 3CT7A 3E12A 7TIMA 1SSDA 1ZAIA 1YTEA 2OMAA 4M6VA 2G5WA 1ADOA 3UY7A 1U5JA 3V1PA 4JYEA 4LS0A 4D2JA 1PV8A 1TQJA 3EB2A 1LM1A 2Z6JA 4FNSA 3MYPA 1F76A 1RQBA 5K4XA 4CNOA 3B04A 4FNRA 2C15A 2EAWA 3S5YA 3CIXA 3PBWA 5BRBA 3G0XA 1OHLA 3OA3A 1W1ZA 3W1NA 1G4SA 3OEXA 3C52A 4N6EA 5J5RA 1SW3A 3W70A 1QAPA 1ZAJA 3G22A 2OCZA 3C2VA 2G95A 3Q94A 3UY8A 1WDWA 4YL2A 3NAVA 4BWLA 4YLWA 4TX9A 1VR6A 5C6MA 1G69A 2W79A 5K9DA 4ONVA 4UNKA 3O16A 3S42A 1XM3A 2XN1A 1A5CA 2CLIA 3NEVA 5G1TA 4RCXA 1PHQA 4IOTA 2CZ5A 1ZCOA 1GWJA 3A23A 2DU2A 4FO4A 3LTYA 1O5XA 1P0KA 1ICPA 3G1YA 1DVJA 1L6WA 1AW1A 1M5WA 3CTLA 3W1MA 4YCOA 4DEFA 2PURA 5LHEA 2VEPA 3TAOA 5BW6A 3QW3A 2RHGA 4O1AA 3LV5A 2E09A 4JTIA 3W2UA 4KFOA 3G1FA 2EHHA 2Y7EA 3WJZA 5FF7A 5LHFA 1OX4A 1H7XA 2RDTA 1LOSA 1I4NA 2Y7FA 3P61A 1I2PA 2BX7A 5FESA 5MHBA 1NAL1 2WNZA 2ZRVA 3LRKA 5F4WA 4BK9A 3QSTA 4UFJA 5AFDA 5LZLA 2A4AA 4E2BA 2Y7GA 4PFMA 2PC4A 3LHYA 4JY8A 3LRLA 5TIMA 1TO3A 1MO0A 2B4GA 4UTWA 1OFPA 3NQGA 3TW7A 3BLFA 1XDMA 4AXKA 2CLKA 3SJ3A 3G0UA 3BG3A 1OFAA 5DXYA 3UWYA 5HWNA 3LGEA 3NOEA 1WBHA 3L66A 5C2XA 1FWNA 1ZAHA 3O07A 1T96A 1ME9A 2DZWA 5KTLA 2W0UA 5I3JA 3M16A 4NJJA 3P82A 1R2RA 4N02A 3E96A 3GDKA 4JTHA 5F2IA 3G3DA 1SPQA 4IPIA 1YLVA 2Q3RA 2ZZ6A 1XFBA 3V75A 4LVDA 3PSWA 3G1DA 4MYXA 1IIGA 4QJ1A 3VKJA 3W76A 4O57A 3W7RA 2E6DA 1TV7A 1ZFJA 3OG3A 3O63A 1I2QA 1F7BA 4N9EA 3W3OA 1FUYA 4TIMA 1TTQA 4NVTA 4WXYA 3ZS4A 2OT0A 5C55A 3EX2A 3GLCA 3DI1A 3W2JA 4H4IA 3MJYA 3MP5A 5AC8A 3W23A 4JXCA 1YDNA 3S1XA 4XWUA 2NLIA 4YCPA 3IV3A 5DCDA 3NL3A 2VFDA 3LM7A 3TA6A 4K8HA 2GJLA 1XBYA 3NQ6A 3LI1A 3KRUA 5K3VA 3CU2A 1KM1A 3W87A 2J24A 4AWUA 1VPXA 2Y89A 2JGYA 3QC3A 3LHUA 3TFCA 2JGQA 4ADUA 1TYGA 3BO9A 1V5XA 1NF7A 2C13A 3FA5A 2E5BA 3DFPA 4JTUA 4X2RA 1X1ZA 4DO5A 3DENA 1JCJA 5D2VA 3CWOX 5L6UA 2TRSA 3EWUA 1EUAA 3RLVA 2ZRXA 1KM0A 1EWDA 4RZ5A 4ZQCA 4E2DA 4GUGA 1LBLA 1F6PA 2HS6A 4CQ9A 1BWKA 1Q6RA 3FEMA 3O15A 3MHUA 3W1AA 4UTJA 1IXOA 3STGA 1VS1A 3MI2A 1E51A 4RV8A 2X16A 2ALDA 3P67A 4L4MA 1OG0A 5HINA 4HSNA 4LUJA 1C8VA 2A7PA 5FEWA 4EIVA 4GUIA 3STEA 1H1YA 4EF8A 3L0KA 4Q4KA 4AHQA 3MP4A 1YPIA 2WV8A 1WQ5A 4HNNA 3RFAA 4JX6A 4DO6A 3R2GA 3KRSA 4NJKA 1SZNA 3PAJA 1GG0A 5K9CA 4BF9A 1K7XA 2FFCA 2BZNA 3T40A 4N9CA 5GVJA 4CQAA 5KSWA 3GIYA 3R12A 1HG3A 1W56A 3L68A 4O53A 5I3KA 1TIMA 2V9DA 3NPWA 5F4XA 5AC6A 4A3UA 2Y63A 2OT1A 3LLDA 2ZQ0A 2JKEA 3P60A 5AN7A 2DZXA 3FJLA 4X22A 1NFBA 3LBCA 3PC0A 3NDOA 3VI2A 3KFTA 5AC7A 1XC4A 1K8XA 1ZY9A 4K37A 3JRKA 4DF0A 1FWWA 2OJPA 3A9IA 4ORMA 3SR7A 3VNDA 3T44A 1QPOA 1VH7A 1KFBA 1W3TA 2I9EA 3UWQA 1DQXA 3VCRA 3E49A 1WX0A 3TJLA 1T99A 4FHAA 5D09A 1TPWA 1XBVA 1YPFA 3QW4B 4QIUA 2GVGA 4HT3A 3EX4A 5DY2A 1WAUA 5SWUA 4UTHA 3L0GA 1TQXA 3MI6A 3EX1A 3S5ZA 4Z1CA 3LB0A 3N9RA 3W07A 3WK2A 1GPWA 2UV8G 4E38A 3O1NA 2ISSA 1B57A 4CNPA 4OQVA 5U4NA 2AAMA 4LWWA 3NL6A 4RK8A 4O19A 1ML1A 4O14A 2E6YA 3W85A 4JYFA 1GG1A 2B0MA 3U6WA 1Q6QA 5FF4A 2QCCA 3A21A 4MKNA 4NUWA 5E1QA 1LORA 1TV8A 4AVFA 4NX0A 3TNOA 2YGYA 3OHIA 5G2WA 3EEGA 4B5NA 2E5CA 3MW7A 4P61A 4O17A 2BWGA 4N2YA 5DY3A 3W7HA 4AHPA 3HGJA 4I7VA 1P4CA 2A6NA 2AGKA 3L5MA 1NF0A 3WJWA 2V2CA 1RQEA 1KA9F 1LLZA 4LTSA 4ORIA 2GOUA 1TPC1 3C0JA 3TC7A 3BV4A 3M5VA 4DXVA 2ZZ5A 1P1XA 3PB0A 1FX6A 1SO6A 3M6YA 3O6CA 3PY2A 1QO2A 4O0KA 4ZL1A 2YYUA 4UTIA 5G2IA 4IUOA 4H6KA 4WY0F 1WYIA 1TPFA 3NQDA 1NEYA 4GE8A 3FKRA 1OX5A 1VQTA 3M5YA 1UUOA 2C6QA 3QJAA 4JX5A 3QM3A 3GNDA 4WOQA 1KTNA 2ISVA 4IMGA 3DFOA 4MIMA 3NA8A 4RZ6A 4N4PA 3TSDA 3IGSA 3B05A 2A7NA 4XTIA 1DL3A 2C14A 3AJXA 3M1ZA 1EIXA 3P81A 1JCLA 3KVKA 5J5DA 4NZFA 1SZEA 2NUWA 1FXPA 3QFEA 3TQKA 4LC8A 4LOCA 3WJXA 4UTLA 5D38A 2NXGA 5KMYA 2EKCA 1J2WA 1QCWA 2VKZG 2A2IA 1IXQA 1QMLA 4MLJA 4UFLA 3MI3A 3T4CA 4O4VA 3MWAA 5EKYA 5K7JA 1JQXA 2JBMA 4FIRA 3SGUA 1EP2A 2HTMA 4IWWA 1W31A 5D2XA 3G18A 5KZDA 4BR1A 2NXHA 1D3GA 3BK0A 1JCNA 1G67A 3A22A 2H3DA 3N9SA 4PODA 3TQ0A 3NYZA 4LVAA 3GYEA 2HS8A 4HNTA 2VEMA 4J9JA 4JYDA 1R30A 2CZFA 3PUDA 5EY5A 5BOOA 1IIHA 5K2ZA 1J5TA 2X30A 3U2OA 1EWEA 3DHDA 1TPEA 3SY5A 3EXRA 2BSLA 1ME8A 4UC5A 4L4LA 1VCGA 1DKWA 4NQ1A 1MSSA 2ZRUA 3G1XA 4LVFA 1JCYA 3QMSA 3TSBA 1W37A 4FXSA 1QDSA 2V5LA 4GWEA 4QNWA 5F2LA 4JTSA 2DZTA 2GQ9A 3G8RA 3DZ1A 4O15A 4O1BA 4RLIA 4HN4A 2GVJA 1DJQA 3EWZA 3L67A 2VXNA 1DQWA 3C3NA 1FCQA 5F1UA 3ZFHA 3CB8A 2RFGA 2CLMA 3KVMA 2QJGA 4BI6A 3UWZA 2Z2UA 4RX0A 2QUUA 1KFCA 5AYXA 1TTPA 2QCLA 5CZTA 4C1LA 1FCVA 4QISA 2CW6A 3CIWA 4N6FA 3W2MA 3C56A 4LW7A 3CQ0A 4RJEA 3CEUA 3HG2A 3KX6A 4Z1DA 4K7YA 4Q33A 2XN0A 2PRMA 3PWAA 4OV4A 1ZHAA 3C2FA 5F1VA 5BNKA 2ZRZA 1XXXA 2C3ZA 2I14A 4LVGA 4MFDA 1A5BA 3AO0A 4U28A 3S1UA 5D02A 3H53A 4JICA 3P80A 4R7JA 3LI0A 2NUYA 5D30A 4U4MA 1K7FA 2Z1BA 2A6LA 5FF3A 3FJ6A 3L65A 1GTEA 4FX6M 1LTDA 2DZPA 1VCVA 4JEQA 1L9WA 3DKLA 1EEPA 1FY6A 3MBFA 3JR2A 4GUJA 2PCQA 1FQ0A 5D03A 1YTDA 3H55A 4XKYB 1A50A 3NZRA 3L2IA 4LS2A 2DZSA 3SW6A 2QJIA 1SQ7A 3IIPA 1UUMA 2CLEA 1LOQA 4PEKA 3W1XA 2JKPA 3MBDA 2WQPA 1F6KA 1YXYA 3E9AA 4WX2A 3B4UA 5F2MA 3QMRA 3I68A 1XBZA 3MO7A 3QRHA 4ZVJA 3B0UX 4AH7A 3HG3A 1K7EA 3WJSA 1KM2A 1LZOA 3KOFA 4UTMA 3HPSA 5FF2A 3W71A 4BI5A 1XBXA 3LRMA 2ZA3A 4M7SA 3TW6A 4HPXA 3B0PA 3HMJG 3NQFA 2YW4A 2ZTKA 1TPB1 2QAFA 3TX9A 3UXDA 1BWLA 3MHFA 4DQWA 1FXQA 2O7SA 1ONRA 4JTGA 4JDBA 4UTKA 4R33A 1FDYA 1LYXA 4GUHA 3W7EA 1Z48A 3NGJA 2R8WA 1ME7A 4LV4A 3HPXA 4FNPA 1DBTA 3IVTA 5EYWA 5AYZA 2RKXA 1SFJA 3WK3A 1QPNA 1Z41A 1IGSA 2YXGA 2J6XA 2CLHA 4IGHA 3LDVA 1U83A 5HNRA 2GVLA 3P8IA 1X8FA 3F4NA 3ZR4A 3R8RA 3LCFA 1DJNA 3R5EA 3G1HA 1TJPA 3NNTA 3VFLA 4TR9A 1RPXA 3QPYA 1LP6A 2G96A 2Y88A 3DFNA 4MLRA 3W1TA 1LROA 2TPSA 2J9ZA 1HTIA 2Q8LA 3RMJA 2YZRA 3I7RA 4ZQMA 3HG4A 5CKSA 2FDSA 3DFSA 2NUXA 3EXSA 4N9DA 4IPJA 1HFBA 3ABQA 4PTNA 2B7NA 5D37A 1QPRA 1X6UA 2FB3A 4TMCA 3FFSA 3O06A 4W9TA 1JJKA 3NR0A 2QUTA 1KW1A 2H8ZA 3LXAA 1EUNA 4LY8A 3CHVA 2B7OA 1NSJA 3MHGA 3PULA 2Y7DA 4NJGA 3NXFA 3M41A 5G4WA 3CM4A 2ZDRA 2EF9A 1O95A 5LNWA 5T26A 4OHQA 1SSGA 3GAKA 3C2EA 1TTJA 2BTMA 4LUIA 1W3IA 1GEQA 2QCNA 1GJPA 4H3DA 4HSOA 4K36A 3GDMA 1D9EA 1OABA 3M9YA 4A21A 1LDCA 3G1SA 1TREA 4JGDA 2J27A 2RH9A 3FKKA 3HF3A 4IMCA 4O10A 4TMBA 5IBXC 5CZJA 3TROA 3ATZA 3GDRA 4O54A 1GVFA 2V82A 1W5NA 2E68A 5ABTA 3SECA 2Y6ZA 3LHVA 5G1YA 3S6DA 1OFOA 3F03K 5CSRA 3T55A 5AHLA 5DCBA 1YDOA 3WFAA 5CPNA 3UWWA 5I3FA 3HBLA 2C19A 3B8DA 1THFD 1SR9A 3KXQA 5EPDA 1RV8A 1JRCA 2NX1A 3LCIA 3S8HA 3UD6A 1R46A 1OFBA 5HULA 1W0MA 3DFTA 3TQVA 5F2GA 5I3IA 3OVRA 4NX5A 3KRZA 3QPZA 3EX6A 1NVMA 3D0CA 3FYPA 4JNMA 5KZEA 5EA9A 4LRTA 1FWSA 4GNJA 2CU0A 2ZA2A 4GC4A 3M44A 1OFRA 1S5WA 3W72A 4MY9A 3W7GA 2Z6IA 2WJZA 4XZ9A 1RD5A 4CQ8A 4HNVA 3HO8A 4WOZA 2H6RA 3M0ZA 4UR7A 3TKFA 4TO8A 3B06A 2CZDA 3W83A 3NL5A 2DZUA 3NM3A 3LCXA 3NQMA 2YFNA 4Y96A 3RK8A 3W7QA 1KTCA 1Z42A 3TDFA 3IIVA 4Z0JA 3TE9A 3TXZA 4NNAA 1XDLA 3OVQA 5CPLA 3FIGA 4JIQA 3LLFA 1W8SA 3GR7A 1S5TA 2QCMA 1A53A 1M7OA 3GXTA 3IRDA 1K8YA 1SFLA 4G1KA 1F5ZA 2YYTA 2VFIA 2VFHA 5DBTA 2O7QA 3TH6A 1LRNA 4Z1BA 1MEHA 3LXBA 3GK0A 1AG1O 5DN1A 2QKFA 6ALDA 2A85A 3LCLA 1WV2A 3LERA 4XKYA 2W6RA 5EBUA 3NQ7A 4DPPA 3UZ5A 4JX4A 3LTPA 1WXJA 1DORA 3USBA 1KTBA 5FF0A 2DP3A 2NV2A 3M47A 2Y61A 1H61A 3TFXA 1XI3A 3PM6A 4OWGA 1QOQA 1C29A 1I2OA 5U7SA 1VYPX 2RDUA 1FBAA 4FIQA 4JTFA 1GVOA 3W75A 5HMSA 1BEUA 4I7WA 5BMXA 4FNUA 4LS1A 5CGQA 5I3GA 2CZEA 2VFGA 4PCFA 3PBUA 5L9FA 4QQ3A 3QYQA 2YR1A 2V0TA 1O5KA 1H51A 5AOUA 2TMDA 2FJKA 1P5BA 1OYAA 3OVPA 1GQNA 2V30A 4HHPA 3W6YA 3W2LA 3N2XA 4JD4A 3S0CA 5CG7A 1AL7A 3Q58A 3R13A 2EPHA 4OU1A 4M19A 4S2BA 1LBFA 2J9XA 3E02A 1I2RA 4CCEA 1SO5A 1QFEA 3HGOA 3THAA 3NZ1A 1LOLA 4UIOA 3UXAA 3N73A 5LNSA 1GYNA 4AWSA 1LCOA 3PSVA 2FTPA 1X1OA 4TU1A 3DAQA 4GUFA 1F73A 1KLZA 1GOXA 4DPQA 1EA0A 1CW2A 4DELA 3BGJA 3BLEA 4UCGA 4LT9A 1HUVA 4A2RA 1BKSA 1Q6LA 2ZZ4A 3GKAA 4I7UA 3C8FA 2A1YA 4MPQA 3LOTA 3LCGA 4UFKA 1XCFA 4CLMA 1QNVA 1ZJIA 4POCA 3W1UA 4YWIA 2B7PA 3DFQA 3HQ1A 5KZMA 1YXCA 3NM1A 4FB7A 2DZVA 2WNNA 2Z0IA 4RXFA 1UBSA 5CZSA 4WY0B 3NG3A 3B0VC 3TMLA 1EP3A 4AB4A 2V2HA 3LBMA 3FOKA 3I6RA 4O16A 2V8ZA 3GNNA 3O6YX 2FPVA 2VELA 3EKLA 5E0KA 1WBJA 3NQAA 4JTLA 5LKYA 3VE9A 2ABBA 3QQ1A 5KITA 3GDLA 3GR8A 5D05A 1FCUA 4UNLA 1V7YA 1VRDA 5H91A 3UWUA 3W9ZA 3FYOA 1JQVA 2ZRWA 4O28A 3UYCA 2E6FA 5LNRA 5DELA 4AAJA 1OX6A 4JIPA 2VFEA 1HL2A 1DV7A 1UJPA 3IEBA 1KM3A 2GQ8A 4K38A 2NV1A 1R47A 4MUZA 1SW0A 4K7VA 4IJBA 3TIMA 2GUUA 2CWNA 4XBSA 4PC8A 4ZQOA 3O6DA 3P84A 3QQ0A 4AEOA 2OX1A 2JK2A 3DH7A 2YCEA 4KWWA 1PCKA 3L0NA 4UFHA 3T7VA 1UCWA 2C1HA 2XN2A 1G7UA 3DXIA 1OK4A 2WKJA 1WOAA
chains in the Genus database with same CATH superfamily
4H2HA 2OO6A 5EL1A 2YPIA 1F2JA 4BFAA 1YDVA 4JFWA 4J3SA 4JDYA 5EBAA 2OZ8A 3QC0A 4JN6A 2QHAA 4CNNA 4MAZA 5HMFA 2E77A 1I9CB 2VRKA 2XHYA 3QKZA 3VCCA 2VCBA 1W9PA 1JGMA 3NSNA 1LL4A 3DGBA 1B3WA 3MP3A 1QNSA 5J8LA 3ARUA 3OZOA 3ZVHA 1E6RA 1ZALA 3EKZA 5CBBA 4YPJA 3N4FA 4YHEA 5DRIA 3VA8A 3VNMA 4UXDA 1A4LA 3ZJ7A 3A5VA 1CXIA 4QE1A 5LSMA 5C9ZA 1VLWA 3OJGA 2DZAA 3G1RA 4L56A 2AQOA 4H9XA 5CAKA 2QJHA 3BL3A 1B3OA 4G56A 2XU2A 1QJWA 3NQ8A 2P0OA 2ZFAA 3NGFA 3IGUA 2QIWA 4D8ZA 1EP1A 1S5VA 3QGKC 4WHBA 4UQDA 1XISA 3TUUA 1E5NA 2C1GA 4XAYA 2VX6A 4Q8VA 1IQ8A 2VFFA 3UQNA 1QHPA 1HF6A 4O12A 5A5WA 3T0CA 4XUGA 2PFHA 4MYAA 5CSUA 3STCA 1BXNA 3VNLA 3I65A 3WENA 3AU2A 5DMYA 2ZUVA 1T8XA 5JVLA 3BMWA 3KP1A 3PF3A 1TA3A 1H7NA 4WQ6A 3FXGA 1SO4A 5HQEA 2E7FA 4L80A 2E0PA 3DKJA 2QIIA 3M43A 1VYSX 2CBUA 1JXKA 2A3BA 4NNBA 2DUXA 4MB1A 3AIRA 3GTNA 4P8WA 3AXIA 2GZXA 3W25A 3GTFA 5LGZA 3DX5A 2R6OA 1PE1A 4S2CA 3UZJA 1W32A 1N55A 3M0VA 1E1EA 3GU9A 1Q8JA 4NG3A 2VRQA 2PRLA 2PDWA 1JRBA 1LL6A 3H2MA 4MKSA 3CPRA 2DORA 3WF2A 4EWND 1I1XA 3ARQA 5I23A 1HL9A 3EMCA 2W66A 4WSHA 1MDLA 4UR8A 1X6NA 1KWGA 4ZFCA 3EXTA 1LQAA 4Y9OA 2TSYA 4MFEA 3E2RA 1G0CA 1OZQA 2DJXA 3W7JA 5A6LA 5HR7A 5D33A 2QZRA 1OF6A 4HVXA 1GORA 4YU1A 2FGBA 4EVZA 4GQBA 4N0RA 1OFQA 1P1MA 4W7WA 2BY2A 4A29A 3P5YA 3UPBA 2ZA1A 4LQ1A 4G7EA 1B9BA 1A5LC 3ANVA 4IFKA 5I09A 4OIFA 1EOMA 1NWTA 4HMCA 1PIIA 3F4WA 2PUZA 1Z69A 3W7OA 1OY0A 2J9YA 3MUXA 2BXVA 3FW6A 1QI0A 2ABAA 1XLBA 1ONEA 1XRSA 2X1TA 1E6NA 4XSMA 4DJFA 2QV4A 1WP6A 2PDKA 1R38A 3WBWA 4JTKA 3RILA 3G1VA 3IVSA 5AHMA 4CVUA 2ZDSA 4Q6XA 3E0IA 1LG2A 2NQ5A 2D1ZA 1F05A 1GVQA 2ZBTA 2J47A 4JFVA 3GWQA 4D6IA 1UJQA 3GBDA 4RPQA 3TR2A 4N4QA 4LVBA 1J0KA 1Q4NX 4KFPA 3BW3A 1Y0EA 1EC8A 3Q67A 3RO8A 3QQWA 1Z44A 2V3EA 3LK6A 5TBOA 4X3ZA 3TP4A 3QEZA 2WNQA 3W2KA 4EXBA 1UP0A 2F84A 2Z00A 3W73A 4NYYA 1G6CA 4GFIA 4S3FA 1F74A 3A4WA 4FF7A 3NQCA 3OO2A 1MW1A 4ADSA 2MUCA 2PF0A 3P93A 1JVNA 5G4EA 4JKMA 1QUMA 4FXRA 4IPPA 3ALGA 4GJ1A 3KTSA 2QEZA 3FA3A 4PL2A 1LBMA 2ZIDA 1TPH1 1H62A 3W22A 4FX8A 1GOKA 2G3MA 3TLLA 4B16A 5IXEA 1KV5A 3BG9A 2WBGA 3QH2A 1W1IE 4JY9A 1W3LA 3BSMA 1R2SA 5FL1A 3U9IA 4OFCA 3K30A 4Y7EA 3N2CA 4DBSA 5FJJA 4IQEA 1CB2A 5H6HA 5A6AA 2Y2WA 1YMYA 4DN1A 1CGUA 2XVLA 3EA1A 3ANYA 1TSIA 1BG9A 2H90A 3BW4A 3VKDA 2P3EA 3KBMA 4PRRA 2REQA 2PU1A 3E0FA 3LPOA 3UZYA 4LF2A 4GNVA 1QK0A 2QR6A 1IR1A 4DLMA 4PMRA 2WPBA 3ANUA 3CMFA 3GY1A 4EOUA 2HVMA 1YYAA 4YTUA 3ABRA 1XRVA 2ODOA 4O11A 3TYZA 4QTGA 4EPBC 3PNZA 4TOQA 1J6OA 2Y24A 2C18A 4JL2A 1OX4B 3K5XA 3N6HA 5EFFA 2R94A 3R11A 1S38A 1KXVA 4HA1A 2FGZA 2OXNA 3GKFA 4H7VA 4Y9PA 3UR7A 1AJZA 4WDWA 1KGUA 1L6FA 2XVKA 3ELFA 4HA3A 4FX7A 4PA8A 2NX9A 3XIMA 2MNRA 1KLYA 1NTHA 2J66A 3UCCA 1EB3A 4LNCA 1OQFA 2DH2A 4HPJA 4Y6GA 4FZIA 3ZO9A 4GKTA 3SEPA 3DFHA 3HJEA 1NARA 2QUVA 5HA7A 1HO4A 2PRHA 4MNJA 4OGZA 4YVXA 3WK0A 2Q8ZA 2G97A 4XZBA 3W1LA 1UD5A 1E4LA 4UNIA 2P8CA 3C2OA 1AMYA 3V36A 3BQ6A 1UD6A 1VEPA 2VOTA 2HISA 2ZZ7A 3TAKA 1XH2A 4PFHA 3PZOA 5AB3A 1E4MM 4HKPA 1RBLA 2GJPA 4J3UA 5CSSA 4Y2WA 1BSIA 3PPCA 2OYMA 3W7KA 1FOBA 2FDMA 4W85A 1AMKA 4CCDA 2PWVA 4UCFA 3UR8A 4M5PA 2INFA 4CD6A 2PLMA 4WD0A 2ZZ1A 3HV8A 1OK6A 3SBFA 2QAPA 4FLQA 4S3GA 4KMQA 4LBUA 5EU9A 4IGNA 3C8NA 1YE4A 2BVTA 2GWGA 1ICQA 1VFTA 5M1TA 4C90A 4RW5A 4FNTA 2BVYA 3ABOA 4WDUA 1D8CA 3HGRA 3S1GA 2H9AA 4P2VA 4PE8A 1VJSA 1Q3NA 2X40A 3ARTA 2BDQA 3B03A 4Q8UA 4U5IA 4GACA 3VKBA 1MVYA 2R1PA 1H63A 1IT8A 2WCSA 4L7ZA 5DCEA 3HOJA 4Z2LA 1FFQA 2A0NA 4DLFA 3AMGA 3PUOA 1E4IA 4OJYA 4PMNA 1REQA 1M7PA 4QFUA 2ZADA 3OTRA 1QO5A 3S9ZA 1E6ZA 3HQOA 3BAKA 3KVJA 1GUVA 1XH1A 4K8EA 1H7PA 2VTFA 3CQJA 4AY1A 3EKGA 3KCJA 1J01A 1S3HA 1JUKA 4MDOA 3CTTA 3Q4DA 4GI4A 4LUSB 4NXKA 4M0XA 1XLAA 3GXFA 3SM0A 1IZKA 1ICSA 2J4GA 3B0YA 4QAIA 1KBJA 1E72M 1W5PA 2O55A 2VGIA 3H70A 4KERA 1CGXA 3R8HA 2DT3A 1O4UA 2Y62A 2VOMA 4M3PA 4IX2A 1KM5A 5I06A 2YSWA 3U4FA 1CGYA 4AHOA 1TWWA 3CT7A 3E12A 3HFYA 7TIMA 1SSDA 4F0KA 4Q3MA 1XR2A 2OMAA 4M6VA 2UY4A 1ADOA 4LUTB 1U5JA 4JYEA 4D2JA 3WKZA 1TQJA 3ENLA 3EB2A 1TUFA 4B3KA 2YIHA 5K4XA 1RQBA 4CNOA 3B04A 4HMEA 1UA7A 2EAWA 3OZPA 3L4TA 5BRBA 3G0XA 4F2UA 1W1ZA 3RGTA 3WSUA 2E1WA 3BQ5A 2BHUA 1SW3A 3W70A 1ZAJA 1CLKA 4TQTA 4GLEA 2OCZA 3C2VA 4I8YA 1S5MA 4YL2A 4I9TA 4RW3A 1YPXA 2W79A 5K9DA 1OIMA 2VC9A 4ONVA 4ACZB 4W87A 3ME3A 3O16A 3S42A 3C3UA 1MUMA 3VINA 1ZS2A 1ZCOA 5BOFA 2I57A 2XSBA 1QPKA 3MMDA 1L6WA 3RR1A 2D2HA 4DJDD 5BW6A 4C6FA 5DX7A 4O1AA 3HFTA 1F9CA 4KFOA 1VIZA 2EHHA 2Y7EA 2BG5A 3G1FA 1CXFA 2D0GA 1QRQA 1I4NA 5H8PA 1O1ZA 4CCZA 1RCXB 5I78A 1NOWA 3DESA 4U31A 1XJBA 4Z2JA 5LZLA 1EF2A 1MO0A 2DGAA 2B4GA 3DC8A 4W7UA 2E8YA 1XLEA 1X97A 2CLKA 4AEFA 5HWNA 1GW9A 3RUBL 2ZUMA 1ME9A 5KTLA 2W0UA 3RXZA 3P82A 1JEZA 3LS9A 3PZGA 3GDKA 4MNMA 3ISIX 1EXBA 5C71A 3AYTA 5E09A 2GL5A 3N04A 2R82A 4U33A 4O57A 2E6DA 2VMFA 1TV7A 3OW1A 3VIHA 5JIWA 1PEZA 3NO1A 1FUYA 3OGVA 1BPLB 1M53A 3SGGA 4IIDA 4NVTA 5JBDA 5C55A 1Q4WA 3EX2A 3GLCA 3DI1A 3W2JA 4HHHA 2I9UA 1EC7A 5AC8A 3DBNA 2VURA 1IEIA 3WF3A 4TTUA 3LZ5A 3TYCA 5HK4A 2XGBA 2XJ7A 2QDEA 1CLXA 2NLIA 4K8HA 2QT3A 3SY1A 4GVHA 5K3VA 1YDYA 3PZ9A 1PO9A 4L6HA 3QV6A 9XIMA 4NAEB 2J24A 2Y89A 4PCSA 4QLJA 3SURA 2WVVA 3EDFA 3LHUA 2C91A 3S46A 2JGQA 2CKSA 1S39A 1V5XA 3ITVA 4D6DA 2YA2A 2W27A 1UR0A 3DFPA 1NH6A 4D6FA 2CXEA 3DENA 4DO5A 5D2VA 1NELA 4RZ5A 4E2DA 1LBLA 2YKKA 1J6PA 2POZA 3KBWA 5BRQA 3FEMA 2FZBA 3MHUA 4DVOA 1IXOA 5I2UA 1R3QA 3STGA 1V6XA 2X16A 1OG0A 5H1WA 4IFOA 3EPMA 1KWKA 1CGVA 5FEWA 4GUIA 2F8QA 4DAIA 1OT1A 3MV01 1Z3NA 1FWDC 3MP4A 3TYEA 1WQ5A 3EOEA 4HNNA 2VM8A 3DEQA 3UG4A 7ODCA 5GVJA 4CQAA 5KSWA 4IM4A 1J79A 5T9BG 3QGVA 1W9XA 1DWAM 2J25A 4AYGA 1HG3A 4N42A 5F4XA 4A3UA 4JIHA 2WXDM 2Y63A 3P60A 2OLSA 1QASA 3FJLA 3WO8A 2IPWA 3PC0A 3WIJA 3NDYA 1ZY9A 1TZZA 4K37A 3A9IA 3CV7A 3SR7A 3T44A 3GNXA 3S2JA 4L9XA 1KFBA 4NY2A 4RDWA 1XG3A 3TJLA 1ZSXA 1U30A 3FGCB 3CL7A 3QW4B 1K9EA 4WGHA 2F6UA 3DYPA 2DQWA 4UTHA 5GJNA 4I5RA 2JE8A 4I5XA 3DOPA 3N9RA 1X7IA 1E73M 3N13A 5C2CA 4L1GA 1WZLA 1ONXA 1JPDX 3N18A 2ISSA 5F7UA 4CNPA 2WMKA 4V2XA 4HMDA 3WEMA 1ISZA 1WDSA 4RK8A 4O19A 3PUGA 1VFOA 4O14A 2E6YA 2RGMA 3W85A 4GJJA 2O9PA 4NUWA 1XYFA 4P7LA 5E1QA 5B7YA 4MWAB 2R9RA 5CPTA 2YGYA 3OHIA 1UKPA 5G2WA 3EEGA 3DERA 4B5NA 3I10A 1VBRA 1NFPA 4R7OA 1JF5A 4O17A 2BWGA 3GR4A 3VIJA 3I4EA 4QDMA 4AHPA 4IG2B 1V77A 1HIZA 2AGKA 2V2CA 1RQEA 4BQ3A 4L4PA 1S2TA 1UR1A 2GOUA 3BV4A 7CGTA 4IICA 4PEEA 5MKGA 1LUCB 4DXVA 2GGHA 3SCWA 3M6YA 1UH4A 2ZOXA 1TR9A 4XVDA 4O0KA 2YYUA 2Q09A 1TELA 5C9XA 3LQGA 1JYWA 1W2VA 1E15A 2R24A 2JQXA 1IT7A 1EC9A 2QUNA 7REQA 4IPLA 4I6VA 1OB0A 3S2LA 3RCNA 1V6YA 5CSYA 3AJXA 2GGGA 3M1ZA 3QTPA 3BLDA 5A6TC 4AU0A 8XIAA 1JCLA 2POTA 3V18A 1EYEA 2VCCA 4RE0A 3QFEA 4HU4A 4MDPA 4D8LA 2WB5A 3B4YA 4M56A 4GZIA 5CQ1A 3WELA 5D38A 2EKCA 1J2WA 1QCWA 2BODX 2VKZG 2A2IA 1IXQA 3T2PA 4AIEA 4UFLA 2HDJA 4O4VA 4D6EA 5EKYA 1QOXA 5D2XA 5KZDA 2H3DA 3N9SA 2UZ9A 4KEMA 5CGMA 4IHCA 1EEXA 4HNTA 4J9JA 2CZFA 4I3GA 3WUFA 5K2ZA 3WLNA 1TPEA 5CCZA 4LX4A 2VX5A 3EXRA 4L4LA 1RALA 1W37A 2V5LA 4GWEA 3H4WA 4QNWA 5F2LA 1GJWA 4CD5A 3F2CA 2YCJA 3G8RA 4HN4A 2GVJA 2QVHA 3MUIA 2VXNA 1DQWA 1QNOA 3CB8A 4BI6A 3BJFA 2AL2A 3UWZA 2YXOA 2E67A 3QBUA 1VBUA 2PWUA 2DW6A 5CZTA 1FCVA 2FGLA 4QISA 2HV5A 4N6FA 3CQ0A 1SJBA 4Z1DA 4OV4A 5F1VA 4LBRA 5BNKA 2ZRZA 3TZFA 4MFDA 4U28A 3S1UA 1Y5WA 4JICA 4H9YA 3P80A 3LI0A 4U4MA 2Z1BA 2CBVA 1YW1A 2INEA 3POHA 3MQTA 4FX6M 3AOFA 1O68A 2E28A 5I77A 4JEQA 3LU2A 4NZ1A 1FY6A 3MBFA 1FWBC 2PCQA 1H0IA 4GQGA 2XGZA 1MQPA 3FCPA 3AXMA 3NZRA 3L2IA 2QJIA 1P48A 1SQ7A 4AXNA 1O5RA 3FX4A 4PMYA 1GOOA 2QULA 1HJVA 4IQJA 1RY8A 2VYOA 1JZ7A 2WQPA 4FMVA 1YXYA 4WX2A 5JH2A 1ZLPA 3RJYA 3I68A 4RV3A 1TFVA 4AH7A 3HG3A 1PIFA 1LZOA 4OUIA 1LWJA 5DO8A 5FF2A 4QQUA 2YL5A 1EZ2A 3AHTA 2I5QA 3HMJG 3LY0A 2OB3A 3LUTA 3TX9A 1P7TB 3MHFA 3WLQA 3OBAA 4QGCA 1ONRA 4FOKA 1TZ7A 4JTGA 3EWCA 4FSAA 1LYXA 1O12A 3W7EA 3CB3A 2R8WA 2ZWYA 3TTEA 4LV4A 3CZKA 2GLKA 4DJED 3WK3A 1JD7A 4LB4A 3WMCA 2CLHA 4IGHA 2GVLA 2BOFX 3PN8A 4V27A 4Q8PA 2WLYA 1WPCA 2G96A 3WBXA 2PWFA 4QAWA 3T0AA 1HTIA 2ZUWA 2E9LA 3UR5A 1W6TA 1D7FA 4GYFA 4ZQMA 2FDSA 3SJNA 1UZHA 4ASTA 1UD2A 1JZ6A 5D37A 1GONA 2JEPA 3K8KA 1LJYA 4TMCA 3B9OA 3O06A 4W9TA 1JJKA 3NR0A 3IJQA 3EWDA 4K2SA 3LXAA 1NSJA 2Y8UA 3MHGA 3PULA 5GNXA 3NXFA 3M41A 1B3XA 3CM4A 3K1GA 2ZDRA 5LNWA 3F4CA 1YNYA 4UQAA 4JHMA 3GAKA 2PGWA 2PDPA 1TTJA 2PP1A 2BTMA 1W3IA 4ZGYA 1F4AA 4ZCWA 2CBJA 4MKVA 2D23A 3GDMA 4KIEA 4MHBA 2PLJA 2J27A 4O10A 4LB3A 4WSJA 1SMDA 2GDQA 1EYWA 4AQLA 1J9YA 3O2LA 4JN8A 1EH9A 3AHYA 2VZUA 3CV1A 2DV0A 4BEQA 2E68A 2CPUA 4CGTA 1QWKA 3S6DA 5FSEC 1OFOA 4B5SA 4MPKA 1Z32X 5CSRA 3WH5A 1XIHA 1YDOA 4UQBA 3WFAA 5CPNA 3QR1A 4XO6A 3HBLA 5PTDA 1QBAA 2OZ3A 4BCEA 3KXQA 5EPDA 3WQWA 4M82A 1ZZMA 3AJ7A 1W1VA 5I3IA 3OVRA 3ZVHB 2GYIA 1KB3A 3K1DA 4ATLA 4I5UA 4L9ZA 1FWSA 4GC4A 2CHOA 3W72A 3W7GA 4Z42C 3FEQA 1RD5A 2GGIA 4CQ8A 4PB4A 1QI4A 4A3YA 2YLLA 3BOXA 1IZJA 3GFZA 2WJDA 4WKAA 4WOZA 2H6RA 4NHVA 4TO8A 1XRTA 3VZXA 1V6TA 4B9ZA 1Z42A 3TDFA 2QJNA 3TC3A 2ZXAA 3TE9A 3TXZA 3OVQA 1C92A 3OLIA 3RIKA 3DIPA 1A0CA 3T6CA 3K8MA 1A53A 1M7OA 3GXTA 3LMYA 1K8YA 2X0YA 4PTWA 2D0FA 3OYZA 4Z1YA 2OQLA 3L4VA 2VFIA 3GTXA 5IHSA 1V3KA 3AIVA 2DT1A 1ADSA 4PTMA 1P6WA 3QKEA 1TIWA 2HCVA 2PDBA 2QKFA 2ACSA 1S2CA 1EJXC 3LERA 2Z1WA 3ECQA 5IHRA 1OC7A 3NQ7A 4DPPA 1K70A 1N2VA 3LTPA 1KTBA 4TV5A 1PYMA 1TA3B 1TMQA 1XI3A 2PMQA 5A6MA 2HROA 3G6MA 1PX4A 3OPSA 3PM6A 3PNUA 3CV6A 3E5PA 3GM8A 1V03A 1XIMA 3I3EA 4JTFA 4MNLA 4UB9A 4JBRA 1MFVA 2PU0A 4I7WA 5BMXA 2D2JA 3WEOA 3BAWA 1KD0A 2G4JA 3CV2A 1DEDA 4QQ3A 2YL8A 2HBXA 1O5KA 1XLMA 2FJKA 4A05A 2FVKA 1R3RA 3GFXA 4HHPA 3S0CA 3SRHA 2NQJA 1FH8A 4DIAA 3BMXA 1ZBKA 1XIGA 1E3ZA 4F0RA 4QR6A 3R4IA 4HA4A 3GHSA 4CVWA 3UXAA 2FHBA 4KETA 1JZ5A 4ERAA 1RUSA 4DWSC 1UPMB 1X1OA 3AS2A 4N7QA 3GQYA 3ZT5A 4GZJA 2XM1A 3VDCA 1JCTA 1GOQA 4HPGA 3NYDA 4DELA 1WUEA 3BGJA 4ZB2A 3O3RA 1XLHA 1H49A 4LT9A 1ISXA 1RHCA 2BOEX 3L4ZA 3VIOA 4ATWA 2OELA 5AZ1A 1AQHA 1I1WA 5KZMA 3WLKX 2IKGA 4H8HA 4PB5A 3W24A 2V2HA 3E5BA 3FOKA 2V8ZA 3SRKA 2X1IA 4WR3A 1WBJA 2ZX8A 2JIEA 4JTLA 2PB1A 5JIPA 1CECA 3GR8A 3GNOA 2WMJA 1C7TA 4G7EB 1NOUA 3UYCA 4O28A 2V38A 4W8AA 4IFKB 4WVXA 4E3TA 1PB0A 4JIPA 4GI9A 4IP4A 3RJXA 2AQVA 1KXHA 1CZ1A 1KM3A 3FY1A 1RK6A 1ZU8A 2NV1A 4LXFA 2CITA 4JTCA 2XG9A 3QY7A 3GC4A 3TIMA 4PC8A 4ZQOA 2G4FA 3P84A 3K13A 4LUYA 3AHZA 4QSFA 2OX1A 5M2FX 1JI1A 1KRBC 3KRBA 3B40A 4D9PA 3DXIA 5TAOA 2WMIA 2WKJA 3L4WA 4JCLA 1OYBA 3S4TA 3TXVA 1D7KA 3AYRA 3BE7A 3WLMA 1I0BA 4UTTC 1WZAA 3D3AA 1NDVA 2FQIA 3UPWA 1IHIA 2BOGX 5FI8A 4H9MA 1CWYA 1LF1A 4BEUA 1XRFA 5DRCA 4C60A 4DO4A 1QPQA 3TR9A 1PX3A 3GIPA 3BPWA 4ZSTA 3GXPA 2D20A 1HVXA 3NL2A 3PS7A 2PLCA 2YA0A 1M68A 3PAOA 1B54A 4CN4A 1BQGA 5CC7A 3BGAA 2EG6A 1PAMA 1GVSA 1VHCA 1Z7AA 1YRRA 3W84A 4OBTA 5EMLA 1WOBA 2DQXA 3UVAA 2AAAA 4Y8FA 2P0IA 4IL2A 1TTIA 4WZHA 4XVEA 2DEPA 3OIXA 3N2MA 4PTVA 4M51A 3WMBA 4V1XA 2G3IA 4C7GA 1PCWA 5FEPA 3BSGA 1N8WA 4MY1A 4S3JA 2F7FA 4D6JA 4JTQA 3RPTA 3GTIA 3OODA 4FA3A 4MY8A 1EFZA 4OOUA 4Q4QA 4QP0A 3LV6A 4PBGA 1QW8A 3UF9A 1HJSA 3BOLA 1CGWA 2OZ0A 4Z2KA 3T1GA 5H2ZA 3NQVA 4YTTA 4BQ5A 5G5IA 4GXMA 1IZCA 4O1CA 3W7IA 2REQB 4M6UA 2PODA 4AMAA 3T0DA 1M7XA 3DI0A 5BXSA 3O8AA 5D04C 1UP3A 3S6OA 1ALDA 2R1MA 4J2MA 8TIMA 3RITA 3BV7A 4Q4PA 1OYCA 3UXIA 1Z6KA 3SUWA 1GT8A 4KW2A 3HIJA 1TVNA 2C16A 4PBEA 4K6AA 2QUMA 3KOZA 4H8UA 2PWDA 2J78A 2ZRYA 1NQKA 3MCNA 1BD0A 1MUWA 2X0SA 3KL3A 3N11A 3AWOA 3FLUA 3NVTA 3MSGA 2A7RA 4R9XA 3P5ZA 1Z9AA 4EF9A 5BXRA 1AA1B 4E4FA 5A94A 5HNUA 3S1VA 4M7TA 1TJRA 4DY1A 4IMFA 5G2HA 3SI9A 1P0DA 6TIMA 3B8UA 3CPUA 4E4PA 3KAOA 2XZ9A 3RPMA 3OQEA 4J7RA 3WLHA 3ZWTA 5I3HA 4Y9AA 1CB7B 3HGSA 3IGXA 3N19B 1DTUA 2A5HA 3FAWA 3LPPA 3UCQA 1HKJA 2DT0A 3THCA 4AFYA 3ONCA 1F3XA 1TCMA 5MF5A 1B9ZA 2IPGA 2NZLA 5CH9A 4JTAA 1GYLA 4H2CA 3T08A 3QMTA 3S1WA 3CASA 1ZGDA 2RJGA 1V3HA 2AL1A 2DVTA 3PK7A 1Q45A 4MZ8A 1DE5A 1UROA 2IXUA 4QM1A 5D2TA 4ICMA 4FP1A 2HZGA 1UHVA 4AISA 1KGWA 3H2OA 5HWJA 3FV9A 1HT6A 1KBIA 2QV5A 3BMVA 1KC7A 1J0YA 2HSAA 5A6KA 1IXPA 4KWUA 4RR4A 2OTDA 3WNOA 4WJ8A 5D2WA 4P7RA 2YBVA 1RQHA 1A47A 5FEZA 3R89A 1Q66A 4QHRA 4XQ6A 4V15A 2VC6A 3EWWA 4KEZA 3AIWA 3KWSA 3TOYA 4C6OA 3V7PA 4DUXA 3AXXA 2H9AB 1K3UA 1VHNA 3M0XA 4HZ8A 2V69A 1EKOA 2CEQA 2V67A 4LAMA 2Z4GA 1FDZA 1I8JA 1QW9A 4RE4A 4Z0SA 1VBHA 2ATSA 4MOZA 1ECQA 2EJ1A 1HVQA 3VK5A 3RYSA 3SY8A 4UMBA 4EWJA 1EIBA 1A5UA 4X0VA 5EMUA 2BMBA 5AHIA 4FAMA 5LNUA 3WG6A 5ABGA 1HJQA 1REQB 1KBBA 2IPJA 3SN1A 3I7QA 3TK7A 2WKLA 3EWYA 3IIZA 1OG6A 2FPYA 2W61A 4OE7A 2XWEA 4GYPC 3PG8A 5D2YA 2WHJA 2DDXA 4PL1A 2FYMA 4KCVA 1RA0A 2V3FA 2CHNA 3A24A 2IMRA 1VCFA 5K9XA 4HTYA 1RH9A 3WH8A 1TJ1A 3JW7A 3P0XA 4KCTA 3IIXA 4HTBA 1B2YA 4KWOA 3BLIA 4R5EA 3GIQA 2BASA 2EO7A 4WJEA 1C3FA 3Q2DA 2WNWA 1UZDA 2PTZA 3ZT7A 1L6SA 1W3NA 3EBVA 1XLIA 1LRQA 2AQWA 3BG5A 1I75A 3V5CA 2V5BA 3TOPA 1BHGA 3BZGA 1U5HA 3QV9A 2D3NA 1TE1A 3IIOA 3W7DA 3B9EA 4O13A 4GHRA 4UMCA 3WNNA 4LV9A 4B3ZA 2PDLA 1XD1A 4GIYA 2PGFA 3U8GA 1N82A 3QTGA 4YXGA 3PVFA 4U3AA 3R94A 5FJRA 1X7FA 5LGXA 1NWRA 4AZBA 4O52A 5IM51 1GW1A 1YKWA 1JIBA 1OM0A 1LWIA 4OOZA 1YTKA 2GPTA 3PWGA 2RGLA 4C1NA 4KEVA 2PE4A 1E6SM 1AUSL 4A35A 4HP5A 1TUXA 1HKIA 4EANA 4GD0A 1UASA 1SMAA 4RKAA 2WSYA 4R7WA 3ZR5A 4HYVA 4J3WA 1TCDA 1UWTA 3KZPA 5A1AA 2OQYA 1EX5A 3CLWA 4E0CA 1T6MA 2VDHA 5A6SA 3BZJA 1B4KA 3W26A 2PS2A 2V3DA 1DJXA 5CC3A 3URQA 4V33A 3W2NA 3F4VA 1JXJA 1VPYA 3GUWA 1E1CA 4JQ1A 2W92A 1WKFA 4MNKA 1I2NA 5A8PA 4PMUA 4YS1A 4F4RA 4C6CA 1UYQA 3DG7A 4AVOA 3DECA 3W1RA 3W81A 1FDJA 1RAKA 2DSZA 3RLUA 4U5KA 2CLLA 4I8DA 1EO5A 1L6YA 3RF9A 4XB3A 4OVXA 5BWAA 4DWSA 4US6A 3F5JA 1GVRA 2WC4A 3NPUA 2QCFA 1XLJA 2OGJA 2WSQA 3OBKA 4R34A 1RXOB 3RMEA 2EPOA 3W1QA 3SUUA 1G4PA 3H6OA 1XYMA 3G77A 3SO7A 8XIMA 1YX1A 4ZA0A 2P88A 4G9PA 2YOCA 3T4WA 3TYBA 3M0YA 3M7WA 3NO5A 1WKDA 3QHOA 4F9DA 3GX9A 1PKMA 1OEPA 4CD4A 3HG5A 1XYLA 3VAVA 3CWNA 2W5FA 2C8NA 4ZOBA 1RR2A 3ARSA 4ZQPA 2ZXDA 1GQJA 4Q7NA 4X9SA 1GYMA 1X98A 4LH8A 1FP8A 1JCMP 1R3TA 1NDZA 1OWQA 3AMKA 2WM1A 3G1AA 1Q6OA 2GVYA 4L5ZA 3ZLFA 1XINA 4HMNA 2WVVB 4GH3A 4QEEA 4JL1A 3BGGA 1JL8A 3TW9A 3VE7A 4RZ4A 1HNYA 1NWSA 3JS3A 3DU0A 2E1DA 3STFA 4HZ6A 5GNYA 3CT2A 5M3WA 1A5SA 3M5ZA 4NASA 4O1EA 2F6KA 2BXZA 2X7WA 4HU3A 1PSCA 2ZUSA 2OODA 4IX0A 3H2CA 2ACQA 3LHWA 3IANA 5HDRA 3PTQA 4GY7A 3LNPA 3QY8A 1VP5A 1CTNA 3KCLA 3P74A 3GC5A 3EA3A 4EPDC 4YTRA 1W5OA 5HMEA 1UW9A 3ABXA 1DIKA 4NJHA 3IV8A 3H7UA 1HW6A 2ZUNA 4JTEA 1CI1A 4JNYA 3N29A 2A21A 1PL9A 4UTTA 3QF0A 3ZWSA 2VZOA 3M5XA 1OFEA 2V6AA 3CS2A 1BKHA 4RDZA 1R85A 5HQLA 3FJNA 2W9MA 3VVGA 2DJLA 4F8XA 1FH7A 1F07A 1X8CA 2ESCA 2FZ9A 3G0SA 3A5FA 3M46A 4UFIA 4JTTA 4HOXA 2X1UA 3WCZA 1TMLA 2R14A 1R8LA 3URNA 1V3LA 3B8WA 3RCMA 4ZE4A 3LD5A 4F48A 1HN1A 1SZFA 5AHFA 3TJ4A 1PZ2A 4K39A 4ZFMA 1V51A 2J7HA 3ARRA 3PZNA 5FIPA 4M1BA 4Q4OA 1NWUA 5GPRA 3L23A 3DCPA 4FOJA 1YTEA 4QDWA 2G5WA 3VILA 3UY7A 4AD4A 4LS0A 4FOUA 4ZXOA 2XM2A 3UNTA 1VFLA 3EOUA 1F61A 4W8BA 1LM1A 2Z6JA 2IW0A 3MYPA 1F76A 4LGXA 4UQEA 4AZHA 3S5YA 4ENLA 3PBWA 4JZ5A 1J11A 5TNVA 1C8YA 4AWEA 4N6EA 4XAFA 3HM7A 5J5RA 2CETA 3WQVA 3EOOA 1FVPA 1QAPA 3VPLA 2CLPA 3FHQA 1V08A 3UY8A 2L5HA 1B3ZA 3Q45A 4DXXA 1ITCA 1XH0A 5CC6A 1OADA 1XM3A 4IGMA 3VGHA 4RCXA 4IOTA 4WRHA 1PTGA 2DU2A 1B5TA 1TV2A 3LTYA 3NO3A 1O5XA 1W1B1 3WQPA 3ZLHA 4W4QA 1DVJA 1AW1A 4AZGA 5LHEA 3TAOA 2OYKA 2RHGA 4WKHA 3W2UA 3VD4A 5LXXA 4HCLA 5FF7A 2ISDA 5REQA 3P61A 3UA3A 2BX7A 5MHBA 4CQDA 5I79A 1KBKA 1XC6A 1JYVA 2QJJA 4WGXA 3A3WA 3LBOA 2A4AA 3PJTA 2Y7GA 2PC4A 4JY8A 3TN6A 1J10A 1AH0A 2PTXA 3E2SA 1OFPA 1PBGA 5MKGB 3T2QA 1MFUA 1XDMA 4ZR8A 3SJ3A 2NSXA 2QS8A 2VUYA 5DXYA 3UWYA 4ATDA 3IUDA 4L65A 3NOEA 3WUEA 3FVDA 4GBDA 1WXYA 1R9XA 5I3JA 3M16A 4AG0A 5E5CA 1HQTA 2PP3A 1R2RA 3CK5A 3S9IA 7REQB 3E96A 1G94A 1M65A 5F2IA 3G3DA 1SPQA 4IPIA 1YLVA 2OKTA 2ZZ6A 1EPVA 4WDXA 1V0NA 3VKJA 1R7OA 3AAMA 4QJ5B 4BF7A 3AISA 3WLLA 1WE5A 3WNPA 3O63A 4KQNA 4N9EA 1NP2A 4INFA 4K3ZA 4TIMA 1TTQA 1PKLA 1UR2A 2PZNA 5D9PA 1K9FA 1HGYA 3MJYA 3MP5A 4ES4A 2IKHA 7XIMA 3V4BA 3W23A 3VX1A 1AJ0A 4XWUA 1F3WA 2GJXA 4YCPA 3NL3A 2VFDA 3LM7A 3D6NA 1QI2A 2GJLA 5EMYA 4JFSA 1XBYA 3LI1A 3KRUA 3CU2A 3EAUA 3WUBA 1UKOA 1GQKA 1DJIA 1QATA 3BLLA 3PWIA 1T7LA 2JGYA 1MUCA 3VIKA 5HPCA 5I03A 1TYGA 2VR2A 4PUUA 4GZ7A 1IT0A 2C13A 2E5BA 1AH3A 4FXJA 4X2RA 5BYWA 1X1ZA 1JCJA 3T81A 5CAHA 3KDOA 2Z7KA 2ZRXA 4AZ5A 3U48A 4GJIA 2Y5JA 3QZ6A 5LIWX 1CYGA 3O15A 1DE6A 2FKPA 2C7FA 4RPPA 1VS1A 1E51A 4L4MA 4PCTA 1M3UA 4HK7A 2AL2B 3WEZA 3L12A 4RL3A 3MSDA 1DJWA 3L0KA 1YQ2A 4AHQA 2GUBA 3VM5A 1YPIA 3WH6A 3RFAA 1XPGA 4GYPA 1XSKA 2VRJA 4NJKA 3PAJA 4P7OA 3MVTA 1K7XA 2FFCA 3OLDA 3T40A 1B0IA 1EDTA 2FVLA 4N9CA 4LEFA 1S2UA 1C91A 3VZYA 1EJRC 3GIYA 5A95A 3R12A 3AQUA 1GZ1A 3EA2A 2BGQA 2VD8A 4NRRA 2WVUA 2XIIA 2F38A 3L68A 3HZ3A 5I3KA 2V9DA 4DYEA 3WD2A 2ZQ0A 2JKEA 1GGOA 2DZXA 1NFBA 3KFTA 5AC7A 2XTKA 1G5AA 3VYLA 4U10A 4X60A 4K68A 3JRKA 1FWWA 3VNDA 4ORMA 4S3KA 1J2BA 4BQ4A 2WCAA 2HK0A 2PP0A 1WX0A 3E49A 1T99A 4JOMA 3WDQA 4FHAA 1JAEA 5D09A 1TPWA 1XBVA 4QIUA 1XYAA 4AY7A 5DY2A 1FTXA 5SWUA 5ECVA 1UA3A 3L0GA 3EX1A 3S5ZA 5A2CA 3LB0A 2G41A 3W07A 3RX3A 1GPWA 4OECA 4E38A 3LA4A 2A3LA 2O0TA 4NILA 3SQMA 1OINA 1C7SA 4OQVA 1IYXA 1VENA 1PIGA 1IGWA 2QMJA 4LWWA 4CU6A 4EPKA 4PUNA 2ZE0A 2HRWA 1E40A 4JYFA 2B0MA 4J35A 3U6WA 5EMKA 4LAZA 3APTA 4LYKA 2QCCA 4MKNA 1LORA 1TV8A 4AVFA 4NX0A 1FFRA 1SFTA 2PTYA 4HN8A 3K46A 6PTDA 4EPEC 4HCDA 3LGGA 5HXMA 1TWZA 1ONWA 3PTKA 4DI9A 3S2CA 4H8VA 1JNDA 5M17A 1UH2A 3NFUA 1NF0A 3WJWA 3BTNA 4LYQA 1LLZA 4LTSA 4ORIA 2WSKA 1UUQA 3TNBA 2ADAA 4NYUA 2ZZ5A 1P1XA 1K1DA 1PZ0A 4PUKA 2D2GA 5FJTA 1TX2A 3CBWA 3UEQA 3IUIA 3PY2A 3MVIA 1QO2A 1QNPA 4CD8A 4GH1A 3OOQA 4F0MA 5G2IA 4IUOA 4H6KA 1R3VA 2W91A 3N15A 2DIJA 1OX5A 2I7GA 3M5YA 1UUOA 2P50A 3MPGA 1XIFA 3EPNA 3QJAA 3DYMA 1GEHA 3QM3A 2VP8A 3H22A 3CH0A 1TV4A 9RUBA 1QBBA 4MIMA 3NA8A 1WKEA 3TSDA 3UYIA 1B1YA 3TTQA 3B05A 2GWNA 1TVLA 2DVXA 2PZ0A 2J7DA 4NZFA 1ZL1A 2WYSA 2BGSA 4UTLA 1U2YA 3AI0A 3N6QA 4KGLA 5KMYA 4GINA 4IIEA 4FK9A 3T4CA 4XAGA 4JIRA 2BP1A 5K7JA 2Z7GA 1Y5XA 2HVNA 3BJSA 1R3SA 4BR1A 4MMWA 3NZQA 4P7QA 4S3BA 2Z29A 3TQ0A 3NYZA 4GYKA 3GYEA 3P2VA 2ASHA 4GXPA 2HS8A 3S3GA 4AY8A 4Q4RA 4JYDA 3UPMA 3E6EA 5BOOA 1J5TA 2PDUA 3SRFA 1V02E 1ISYA 2WK2A 2G8ZA 2HEJA 3QOKA 4QG8A 1WDQA 4LYRA 1HXJA 2G3JA 2PI6A 4UC5A 1DKWA 3ITXA 2IUZA 1MSSA 3G1XA 3R10A 3QMSA 4PUWA 1IWBA 5JMUA 2ZUUA 3C5QA 3SN0A 1UBPC 2YCLA 2DZTA 4OUEA 1E4NA 1GNXA 1KXQA 5FA5A 5C7HA 1F3EA 3ZVIA 4X9YA 2VGFA 4NSBA 5AC5A 2PDIA 3C3NA 4IZGA 2RFGA 2CLMA 3KVMA 4DAFA 4JEJA 2Z2UA 4XX6A 2J79A 4RX0A 2QUUA 1GPFA 5AYXA 3VFCA 1W3JA 1TTPA 1NOFA 2QCLA 4LCSA 1VF8A 4M81A 2B31A 2XYLA 2UY3A 3JU2A 4K7YA 4Q33A 2PRMA 4EX4A 3PWAA 1ZHAA 3C2FA 1U5VA 4Q6JA 2I14A 1XSJA 3M0KA 4LVGA 1A5BA 4PTDA 5D02A 4F0SA 3H53A 7A3HA 3RRXA 1NDYA 3FSTA 5B7ZA 2NUYA 2O9TA 2A6LA 5FF3A 3IAQA 2BNJA 3L65A 2DZPA 3H7RA 3VGBA 2BHZA 1L9WA 1JFXA 3DKLA 4TVCA 3JR2A 4GUJA 5D03A 4GQ0A 5DT7A 4CQCA 3B3DA 4AEEA 5EMJA 4ROPA 4GISA 4ZOAA 2DZSA 5M5DA 3PHAA 1UUMA 1ZJHA 3SDOA 1C93A 1WAWA 1F6KA 5J04A 3MCOA 3E9AA 4UQ9A 2VVNA 1SM9A 1XIDA 2P3ZA 4GVIA 1XYBA 1XBZA 3H2FA 5TD4A 3WDPP 4C6QA 3I4KA 3VUSA 1H4PA 1XQKA 3QRHA 3B0UX 3QVQA 3SAZA 1Y7VA 1V3MA 1K7EA 3KOFA 4UTMA 1D2KA 2NVAA 4GI6A 2ZA3A 2O92A 4HPXA 3B0PA 3T05A 1MDRA 2ZTKA 3WQ8A 1TPB1 4LYPA 1UWSA 4YWSA 1BWLA 4I9MA 3GVRA 4GIAA 2CIPA 1JI2A 2J8TA 1AVAA 4R33A 3V3WA 1FDYA 2PGEA 4XD4A 1CENA 3NGJA 1KKOA 1VFMA 3D47A 2D69A 4NRSA 1PWMA 2O4MA 2RKXA 1Z41A 2XH0A 1IGSA 4XUYA 2WZEA 2BB0A 3ZXWA 3P8IA 4F2TA 5IDZA 1X8FA 3F4NA 4C91A 3NNTA 3PZTA 3U57A 4Q8MA 1LP6A 3GG8A 2CERA 1LROA 1H09A 4A3QA 1ODZA 4S3EA 2J9ZA 5CBJA 4BA0A 1OT2A 3I7RA 4IIBA 4YYCA 5CKSA 1MXGA 4ZXLA 3EXSA 4N9DA 3DC0A 3AZSA 4IPJA 3G2GA 5JBFA 4PTNA 4CD7A 2B7NA 1JYXA 2FB3A 4AZIA 2YA1A 2NV9A 1W9UA 3N2OA 4LY8A 4ZODA 3EEZA 2B7OA 3AZTA 4NI8A 3CUZA 5E9AA 2YXXA 4U3CA 1O95A 4AD0A 5T26A 3A4AA 3RLGA 3C2EA 4LUIA 1EGMA 2V3GA 4K36A 3H8AA 4HB7A 1D9EA 1OABA 4A21A 1LDCA 3CHCA 3UESA 4GX8A 4JGDA 3SRDA 2RH9A 3OQ8A 4CQBA 3WLJA 3WDRA 3ITOA 2JF6A 2INZA 1JAKA 2F6XA 2OSWA 1OGGA 3N2BA 3EOLA 5CJMA 1OGBA 2WHLA 1AQMA 2XINA 3CAVA 2WMIB 1W5NA 4PCPA 1DJHA 3SECA 3WF4A 3VMNA 1AFSA 2QXWA 1E6QM 2AOSA 4J3TA 3QY6A 3KBSA 5DCBA 2W62A 3A3XA 1J0HA 4Q4MA 3P6LA 4QCEA 2FJUB 3MB9A 3KUMA 1AJ2A 1SR9A 3S47A 1CPUA 4EXQA 3IGHX 2AKMA 4A8RA 3GUGA 4F66A 3UD6A 5HULA 3DFTA 5F2GA 2ZC8A 3KRZA 1GQIA 3ES7A 5KZEA 1LG1A 1MRQA 4A3HA 4ERGA 4XZ9A 2WJZA 3MMWA 1BFNA 4BHYA 3LQLA 2HE8A 4UR7A 1JDFA 1EDQA 3KLLA 3E1F1 4C6IA 2VGBA 3QLDA 4Y9MA 4JQ3A 3NL5A 3NM3A 4Y96A 3LCXA 3GD6A 1B30A 4LSBA 1TWDA 1WUFA 4L64A 1XCXA 3W00A 4Z0JA 3T42A 2VT0A 5CPLA 3FIGA 3EDJA 1BXBA 2QCMA 4EACA 1Z8AA 3BCFA 2YYTA 2XWDA 1OGSA 4A8IA 3KDNA 4E2VA 3V5FA 2O7QA 3TH6A 4A6GA 1EGZA 3LG3A 1J0IA 4Z1BA 1W2PA 3IS4A 4Z17A 9CGTA 2DZBA 3MMUA 4XIMA 3MUCA 3RPDA 1JDEA 6XIMA 4JQ4A 1US2A 6ALDA 3E74A 1WV2A 4JX4A 1WXJA 2V5KA 4RNJA 5GNZA 3USBA 2DP3A 5I5RA 3WQDA 4WEVX 1LLOA 3KLKA 1H61A 3TFXA 2PLKA 3UG8A 3HU7A 5FJUA 1C29A 1KQZA 4B2DD 4ZTXA 1TE6A 1I2OA 4AZ6A 2UY2A 4FIQA 4AX6A 3TVAA 4TVUA 1QT1A 2I56A 1LQ0A 4FNUA 4W5ZA 3PZUA 4LS1A 5GJPA 2I17A 4KPLA 4H1ZA 1SZRA 4FF5A 3VD9A 2D3LA 5LIXX 1XQLA 1RPKA 1K9DA 3MDUA 2V0TA 5AOUA 5JQ9A 1VB9A 1P5BA 4M8UA 1OYAA 3T9PA 3VD5A 4RDVA 1GQNA 4PMQA 2NVCA 3N2XA 3CUJA 1PDYA 1AL7A 3Q58A 2FZNA 2EPHA 4S2BA 5C0QA 1WXZA 2OO0A 1HKMA 1QFEA 2Y8KA 3NZ1A 1LOLA 4US5A 1GYNA 4DX3A 1UC4A 3H12A 3LEPA 4DPQA 4AIBA 1CW2A 3HPAA 4L4OA 3BLEA 3V5OA 4A2RA 1WDPA 1XSIA 2ZZ4A 3GKAA 4I7UA 3C8FA 5A8QA 3LOTA 2OPJA 1W1PA 3CXOA 4UFKA 4DB7A 3GHTA 4NAFA 3CUIA 1K4HA 4GQQA 3W1UA 4YWIA 1RD6A 3HQ1A 2B7PA 1T8QA 1EJ7L 3GZAA 1PPIA 1YXCA 3NM1A 2BXYA 3B0VC 3TMLA 4BY3A 2VJXA 2OKOA 3FHAA 3O7UA 3O6YX 4LAUA 2FPVA 2VELA 1XV8A 3EKLA 3B8TA 3WNMA 4JKKA 3VNIA 3NQAA 4R88A 2ABBA 8CGTA 3QQ1A 4MM1A 4KCWA 4UNLA 1VRDA 4GPNA 4E4UA 1JQVA 3UWEA 3QR3A 1VFSA 1IEWA 1OX6A 3UXLA 4HSHA 3H2NA 1GK8A 2DSVA 1R47A 4HQVA 3GRIA 5D8ZA 3R25A 4CU7A 3OA5A 4EAMA 5I24A 4F40A 2GUUA 2CWNA 5FJPA 3RRAA 3O6DA 4Q8QA 3QQ0A 4AEOA 3DH7A 2YCEA 1PCKA 3L0NA 3T7VA 1UCWA 3A9BA 4TXEA 2GJRA 4YIWA 1XD0A 1NAL1 4HSOA 3IVUA 3GG1A 3VOGA 2GUYA 4B9YA 1IF2A 1KFLA 3SQLA 2VENA 4C1KA 2C0AA 1K77A 3GVQA 3U7VA 4Z2IA 3W29A 5A6JA 4ZZ9A 3WBYA 1DHKA 2I1OA 2G0WA 1OFDA 3UZXA 2IQ0A 5GJMA 1P6CA 1A3WA 3W7CA 4IJRA 4Q7IA 3NPVA 1H3GA 4G8TA 4GNKB 4Z08A 3ABSA 1FP9A 3EB4A 4GG9A 1V8EA 3CHEA 3N14A 4S38A 4ZQNA 1VC4A 3SCUA 1DWIM 2ISWA 2TAAA 2GQAA 1OD8A 1G4EA 3NZGA 2PDXA 4MTVA 4W93A 3W38A 1JUEA 3NCOA 2G3NA 3AZRA 4XZHA 1VLIA 1XUZA 4IQLA 2FZMA 2Z1XA 3A6OA 4YTQA 4B3LA 1J4EA 3LMZA 4IMDA 3GE7A 4AUBA 1IWPA 3MT1A 2GGJA 1L2UA 4GY0A 3C86A 3GU1A 3H23A 3LHZA 3CUHA 1ZUAX 3Q37A 4U2YA 4IH3A 4PMVA 1GZGA 4GYJA 4QITA 4M6QA 3GAYA 2Y70A 4XD3A 1ZRQA 5I6SA 4FEZA 1IXNA 2CCRA 3KVLA 4GY1A 3VDAA 2E6AA 2NXIA 1UKSA 3DGRA 2EGZA 1W54A 2HMCA 5DLCA 1GJUA 4LRSA 6TAAA 1XX1A 2ACRA 1B90A 4ML9A 2V68A 1JULA 3BJTA 3HTWA 3PBGA 3K4AA 5FOOA 3MA8A 3ITLA 4LC6A 5A8NA 4IMAA 4C1NB 2ZWZA 3VOIA 4QXIA 3VNJA 1A5AA 3ZYZA 3IJDA 1R6WA 1UP2A 3L21A 1GHRA 1XKYA 2X2GA 4DI8A 1CNVA 1Q6EA 2UWFA 5LYRA 5I02A 1DXFA 5AHEA 5CPMA 2F2HA 1F6YA 2WVSA 3MV11 3F5LA 2DIEA 2QQ6A 1K8CA 1F3TA 4ICNA 1CXEA 4ACYA 4R85A 3ES8A 3WLRA 3WL1A 1U33A 2ZCGA 3GVGA 4JCMA 1J18A 2XH7A 4JQAA 2FHFA 3AMCA 1ZQ5A 5CZ0A 1UQYA 2CHRA 3G8EA 4G1NA 3XINA 1BGGA 4CCCA 2IKIA 2VC5A 3MMTA 5FD0A 1SO3A 4LCRA 4ZO9A 3M07A 3TYUA 2X05A 1E1CB 2ZZ2A 3TC6A 4HIBA 3LCHA 1KCXA 3DHFA 2BFGA 3UR2A 2E3ZA 4OT7A 3WLIA 1H1ZA 5AKQA 1UWUA 1XKJA 4AZCA 1Y65A 3GHRA 1DWHM 2TYSA 4IJCA 4ZB5A 3VNKA 3F2DA 4LCQA 4DWSB 2QF7A 5XIMA 1V0LA 4GBUA 1E71M 4HGXA 1UB3A 2XIBA 1B4EA 1XUUA 2OX4A 1S2VA 3M4HA 1KM4A 1W5MA 4AD5A 3KTCA 1MXSA 1TJ0A 4PZVA 4IXHA 4WY0A 3TTYA 1VYRA 3ATYA 2E25A 5IRPA 4B90A 1I45A 4RE3A 1Q6CA 2IQDA 1O94A 3W4RA 4UOZA 3AYSA 4QLKA 3QN3A 4NT0A 1H7RA 4A22A 1JGIA 3AYVA 2ZVRA 3WFLA 1XP3A 1GVEA 1P0NA 1WA3A 1KFKA 1JDDA 1CX9A 3UXKA 3SCRA 3L4UA 2YDAA 1X38A 1KCZA 1UD4A 2FB2A 2EEXA 3W88A 5GQBA 3PR2A 1QHOA 2ZE3A 2FH8A 3HURA 3S9YA 1KM6A 3BSHA 3HB9A 4ADTA 1JPIA 4Y9NA 1DJGA 5HUOA 5KINA 3VC5A 3SGZA 1SU5A 4C6BA 4MZYA 3OZMA 1AZ2A 1E0XA 3FK4A 4O0ZA 3TWBA 3CIVA 3BVJA 1MQRA 2ZYFA 2HWGA 3VOJA 4DM2A 3VIMA 4UFMA 3N3MA 1TMHA 1JFHA 4E8GA 1EZWA 2ZZ3A 1H50A 2OEKA 2Q8XA 4S1FA 1PHWA 1V3IA 4C7DA 4UZSA 2UBPC 1IV8A 1DOSA 2XIJA 2HNEA 3GXNA 4PH6A 5XIAA 4GRSA 2XFRA 1ZJAA 3TSMA 4P8XA 4XZMX 1IEQA 5AHNA 1E9ZB 3PUEA 3QSRA 1UKQA 5AZ0A 2PDHA 1PX8A 3WF0A 3ID7A 2I5IA 2C79A 1GTHA 1SZGA 4X0NA 1AL8A 1HKWA 4HYRA 2YBUA 3A3HA 4A2SA 1BVNP 1XWYA 1L2QA 1SR0A 3NQBA 3U5YA 2FFIA 2PTWA 3L5LA 2R1NA 3UCDA 3KHJA 5C5YA 4JR5A 1AK5A 4YMZA 4QSHA 2J7EA 2PCEA 1RLDA 3L2MA 1ENUA 4H7ZA 4MB5A 4AZ7A 4DF2A 3LCWA 2CESA 3R1ZA 5A3HA 2OG9A 2J77A 3CQIA 1JPHA 2FLIA 1V0KA 2D22A 3AIBA 4YHGA 1TPDA 1R2TA 2LLEA 4NZJA 2GJNA 4AF0A 3GDBA 1DJYA 2WJFA 3T07A 2J88A 5IFPA 2F61A 1KQYA 4CEXC 1TPVA 4W84A 3BOFA 1PDZA 4Q8NA 4PCNA 2Q6ZA 4NZ4A 1PVNA 1UR4A 2QDDA 1JCXA 5LIYX 1YADA 3NPXA 1JG9A 1LLWA 5CPOA 1G7VA 4MAVA 3LTSA 2WQDA 3TEVA 3WNKA 3BAIA 4IMEA 2VC7A 5K4ZA 2YDRA 3UNDA 2YL9A 3QZEA 3YPIA 5A2BA 3GZ3A 2GGEA 4GMEA 4GVFA 3S5OA 3ORWA 5REQB 3T8LA 3EDDA 4DNHA 3W7NA 3B8VA 5JXQA 4O18A 1FWGC 3W01A 3R6IA 1VZWA 2GQ3A 3QV8A 5AY7A 3VMPA 4MJMA 4UUIA 2J62A 4L61A 3LHTA 1R9YA 3GG0A 4XTDA 4GZEA 3RNDA 1V4YA 1GKQA 1TV5A 3CNYA 1FCBA 2HVOA 3NSMA 4C5ZA 1PKNA 4O4WA 1EA9C 4CKQA 2G3FA 2VEFA 3C4UA 2J13A 1ZP4A 1VGAA 2XSAA 3UJSA 3GW0A 1XIIA 1WKYA 5HANA 5HUPA 4B5VA 3W02A 5FCZA 1IEVA 2NQLA 1XLGA 2VEGA 1A80A 3WH7A 4LEQA 4NL1A 4ZOEA 3TCEA 3AHXA 3TLQA 3LX9A 5D32A 4REQA 4ML4A 1E43A 5F4SA 4H19A 3DBPA 1C8XA 4WDTA 1OBAA 4QX4A 1W5QA 5AYYA 2P10A 4D6HA 3THUA 4KKXA 3M0MA 1FA2A 1NFGA 3TMQA 3IARA 2GJXB 5FEXA 1IE7C 3CC1A 2OLHA 2E5DA 4DWSD 2CLFA 2CLOA 4R3UA 3O9NA 3AMDA 2FZ8A 3I7SA 1KNWA 1QI3A 4O8RA 4I9AA 3WD0A 4S3AA 2HXTA 4OV9A 3L9CA 1H0GA 1OVDA 3TJXA 3V35A 1Y5VA 3VO0A 4KRZA 4G7FA 1JD9A 1MEIA 1E0TA 2A3CA 2FPTA 1UWIA 1BYDA 2AMGA 1JDCA 2XSXA 1Q6DA 3NQ2A 4NF7A 3PBYA 2KZHA 7ENLA 4BF5A 1IWAA 2YX0A 4WK9A 2NWSA 2Z25A 4NJIA 2QCEA 2WSPA 4UOJA 3FJ4A 3SIZA 1S46A 1KKRA 2V5JA 1A5MC 5TQLA 4NU7A 4RXGA 2YFOA 4C6NA 4LALA 1BF2A 1SGJA 1SUXA 3EWXA 1VFFA 4P8UA 3P7YA 4IISA 4KBXA 4QBXA 2V2DA 4PUDA 4ZB0A 2QCDA 1H11A 4JTJA 2E40A 3W7MA 4LU0A 2B7QA 2QCHA 3IPWA 1YIXA 1XL9A 2XIMA 3HPZA 5BXTA 4OBRA 1KFJA 1JF6A 2QDHA 1N8FA 1MZHA 2FIQA 3KM8A 4QJ4B 1E3XA 3LPFA 1VD6A 1ZAIA 1DIDA 3EMZA 4J5NA 3V1PA 1PXGA 3BDKA 1H5VA 4QLLA 4RUBA 3WQ4A 1FKWA 3RR4A 3OEXA 1UWAA 3QLLA 3C52A 1KR0A 1U1HA 1C90A 3G22A 2Q02A 2R1KA 4XAPA 3SCPA 1WDWA 3VDHA 3PPGA 1XLDA 3AUJA 1BLIA 3NAVA 3EGJA 3V16A 3SQSA 1M41A 1VR6A 3CUGA 1Q65A 1BRLA 2XN1A 3ARZA 4AD3A 1JYNA 3FSUA 1HKKA 1PHQA 3UZWA 5LIUX 1GWJA 3A23A 2DSWA 1CLVA 4FO4A 4AX7A 3R8GA 2XVPA 1P0KA 3G1YA 1ICPA 3ZJKA 4JFTA 1YBQA 3FYYA 1M5WA 1NY1A 3CTLA 1L8NA 3W1MA 3ERPA 4GK8A 2VEPA 1BQCA 3A47A 3QW3A 1HP4A 3CGTA 2E09A 3HN3A 4JTIA 3MY9A 5LHFA 2RDTA 1DQUA 1YNPA 3UJFA 1LOSA 4W86A 3U0HA 3VOCA 5ABFA 3AFBA 1I2PA 5FESA 3WQGA 2WNZA