3LTPA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltpA00
4ZQRA 4AF0B 1KFBA 3FJ6A 3P84A 1OYCA 1FUYA 1W5MA 3TSDA 3T78A 1GVFA 2A7NA 2QAPA 3K30A 1TV5A 3MBFA 4AB4A 1TO3A 3M1ZA 3IVSA 4PH6A 3ABSA 3HMJG 1TPVA 3W23A 1OFRA 2BTMA 3ZS4A 3BK0A 3STEA 4O52A 2HMCA 2NX1A 1QR7A 3KX6A 1JCNA 2WPBA 2NV1A 3ANYA 4FNQA 3P8JA 3LCXA 3WJXA 4RKAA 2QJGA 1XBVA 4C1KA 1PCKA 2RDUA 4Q33A 3NQ2A 3G0XA 5CPNA 3BV4A 5KITA 2PE4A 4DO6A 2TMDA 1ALDA 1OX6A 2J88A 1GVSA 2V2HA 3TC7A 3W1LA 4NT0A 1G4EA 1SZEA 1O4UA 3A24A 1QAPA 4LVFA 1C29A 1I2RA 3I65A 1QOQA 4IWWA 3MJYA 1ZJIA 2J6XA 1JUKA 3W71A 4ADTA 2BLEA 4M6VA 1LOLA 4Z1AA 1Q6LA 2CU0A 4JY8A 2V30A 3TJXA 1VZWA 4XKYA 4K37A 2QEZA 3QQ0A 5F2MA 4UMAA 1L6WA 3QSRA 1TJRA 1I2NA 1J5TA 3UY7A 2C16A 1ME9A 5HWNA 5LNSA 5FEPA 2ZFAA 1VH7A 2A6LA 4UTJA 3IGXA 3SY5A 4DO5A 1K03A 4FNRA 4O50A 3UZ5A 1AK5A 1MEHA 2IQTA 3CEPA 1VC4A 1MSSA 5E93A 3GZ3A 3OHIA 5LGZA 4Y96A 1XL9A 2C19A 3QSTA 3CHVA 2A4AA 3DFPA 1OFBA 3DI1A 3LRLA 1JCLA 3P74A 3NL5A 1KM5A 5IBXA 2UV8G 4NQ1A 2BWGA 4U28A 5LHEA 2AGKA 4IOTA 1QPRA 4CQ9A 3TH6A 4QIUA 2Z0IA 3NQCA 4XTIA 5HJLA 3TJLA 2ZA1A 3TC6A 1TMHA 5G1YA 2E5BA 4UTIA 1W3TA 3WK2A 3W7LA 5D2TA 2O7QA 2NUXA 2OJPA 5F1VA 3W9ZA 5U7SA 1T8XA 4BWLC 3EWZA 1TIMA 2NXHA 3C3NA 1OJXA 1F5ZA 2JGQA 4CLMA 4ZL1A 2XFWA 1XC4A 3W22A 3TW6A 4A2SA 1NVMA 3NQ7A 3I6RA 5E1QA 3OA3A 4MY9A 1WBJA 4GUIA 1DJNA 1H7OA 4O1BA 2QCCA 3GDKA 1WOBA 4XBSA 3DI0A 3GDRA 1QO5A 3KRZA 2ISSA 3NPVA 6ALDA 3W2JA 3L0GA 1AMKA 3B8DA 1HTIA 1PV8A 2WOQA 3NQ8A 2OT0A 1H50A 3LBMA 4TMCA 2FB2A 2QUTA 1EP2A 1N8FA 4O1CA 2J9XA 3N2XA 5LKYA 3D0CA 4C1LA 3M5VA 3N3MA 2RFGA 3C4UA 1SSGA 3PVFA 3TDFA 1KM2A 3W2NA 2OX1A 3GB6A 1T0OA 1VPXA 4AWSA 5D2VA 3LBCA 3HQ1A 1XFBA 3MO7A 1RVGA 3NQGA 1QMLA 4MYXA 3PUEA 3HIJA 4UMBA 1RQBA 3P67A 4BFAA 3L66A 2KZHA 3FJLA 1X1ZA 2PRLA 4UTMA 3HPZA 3KVMA 3O05A 1FQ0A 4WY0A 3WK1A 3BPWA 4DELA 1PE1A 3C52A 4MFDA 2YX0A 1ML1A 1SU5A 3VFLA 3FS2A 5F2LA 2C0AA 4GE8A 5DY3A 3KVKA 3MI3A 3W1QA 3IVUA 5AFDA 5AYYA 1L2UA 5AYXA 2ZRUA 1FCVA 4UTKA 4E38A 3LM7A 1A53A 5HMSA 3EB2A 2A7RA 3KHJA 4K38A 1ZALA 2LLEA 3B06A 2VENA 1XDLA 3E0IA 5BRBA 1VQTA 2DZXA 3T4CA 1LP6A 3EWYA 5DCDA 2WV8A 4GUJA 4JX4A 4K7VA 2CFFA 2V5BA 1IIGA 4O4VA 3GK0A 4JD4A 3NQDA 4E2DA 3W3OA 2DORA 3BG5A 4LVGA 1UJPA 1FWNA 1O95A 3ABQA 3CT7A 4UFMA 3S0CA 1UASA 5CZSA 3N19B 5K4XA 3CM4A 4A2RA 2ATSA 4FF7A 5AHLA 1VLIA 2RKXA 3S1XA 5F2GA 1A5SA 3MMTA 2BSLA 1F6KA 4RCXA 3BLEA 1IGSA 2H90A 1TTQA 3N14A 3PF3A 3UWUA 2DZVA 4DO4A 5D33A 2NUWA 1LYXA 1EUNA 3UWVA 1XKYA 3QH2A 4JIPA 2V9DA 3G1SA 2B7PA 4ZVJA 1SSDA 3EX6A 2QCDB 3G8RA 1EUAA 2CLEA 2DZUA 4KWVA 5U4NA 3LXCA 3HO8A 1AW2A 3F03K 4JYFA 2WNZA 4NXKA 1JCJA 3G1DA 3C56A 3MYPA 4PEKA 5C5YA 3HBLA 1W31A 4MZYA 4ADSA 1XCFA 1O5KA 5CPOA 1LORA 4JIQA 3N9RA 3C0JA 3WJSA 3TFXA 1RQHA 3S42A 3R13A 4IJBA 4GRSA 1PIIA 3W7QA 4ZZ9A 3MHGA 1L6YA 4NJGA 3EWXA 4UFKA 4FX7A 3QM3A 2DJXA 1OFQA 3QF0A 1TPH1 2E6AA 4JDBA 4NJJA 3W73A 2VFIA 4RK8A 1F74A 2QCFA 3L9CA 3CU2A 3RNDA 2PURA 5G4WA 4BI5A 4ONVA 3NZ1A 1K7EA 3V75A 1MEWA 4GJ1A 4OT7A 4M5PA 3DFOA 4X9SA 2V0TA 3GKFA 1TTPA 3PSVA 2VEMA 2DZSA 4O28A 4HNVA 3EX4A 1Y0EA 3M16A 3GXNA 5G2WA 2FPYA 3RLVA 4WUIA 1B57A 1QDSA 4IPIA 3TA6A 3TX9A 3SJ3A 3O6CA 1GVQA 2Y7DA 3EXTA 2ZRYA 3HG2A 5FF2A 2WNQA 4UR8A 3M41A 4ZQOA 5BMWA 2GVGA 4AHOA 4MJMA 1TRDA 2VFFA 2ISVA 3S1WA 3QJAA 5D2YA 2ATMA 1OVDA 1TQXA 4D2JA 5BOOA 5G1TA 4JTHA 3SW6A 3F4WA 2RDWA 5T26A 1YTDA 1PS9A 4J9JA 3NNTA 3LCHA 3FIGA 4K8EA 1SFJA 3C2EA 1Z48A 1H1ZA 1VYRA 1WYIA 1QPNA 2VELA 3IGUA 4LNYA 2F84A 2JKPA 1H63A 1R2RA 4JTKA 3O8AA 1JUEA 3M47A 4CNPA 1NFBA 1IIHA 4P2VA 2Y89A 4A3UA 3LHYA 4Y90A 5AC6A 1FDJA 4RZ6A 2QCLA 5D30A 4JTUA 3USBA 2X16A 3PB0A 2GVLA 4LUIA 3UWYA 4M6PA 4N02A 3B0UX 5K7JA 1NEYA 5E0KA 3PAJA 2A21A 4CCDA 2E5CA 1KBJA 3S5YA 2AAMA 1LLZA 3O16A 3HB9A 4LRTA 3TV8A 3BVJA 3O06A 4UC5A 4N9EA 1ONRA 2TPSA 3W7RA 1W5OA 2C15A 1V7YA 4O18A 3P5ZA 4JTEA 5C54A 1XBZA 3W2UA 4DF1A 4IMFA 4XWUA 1EX5A 2X1TA 4HPXA 3NAVA 2CZ5A 2C6QA 3KVLA 1F7BA 3TQ0A 4JYEA 1F6PA 4I7WA 1LBFA 1K8XA 2CLKA 5D2WA 1G67A 2WSYA 2YW3A 2QR6A 3ABRA 4JICA 1TTJA 4NX0A 3GDTA 1B3OA 4O0KA 1LRTA 1GQNA 3RF9A 5ABTA 1OX5A 1ICPA 3IIXA 3VE9A 5IBXC 3LGEA 1H7WA 3M0ZA 1UB3A 3H55A 3RU6A 2ZZ4A 3P8IA 3EXRA 3PG8A 1M7PA 3BW2A 3V1PA 3GX9A 4RZ4A 1BEUA 3M5YA 1YYAA 3Q58A 4GBUA 1U5JA 4CQAA 1OF8A 3DAQA 1QO2A 1DL3A 3C6CA 4A29A 1NSJA 3DZ1A 4DBDA 4S2CA 5F4XA 3LHWA 1UUMA 1TPB1 4PA8A 5HQEA 3MHFA 3CWOX 1VHCA 4QSHA 3CLMA 4TO8A 4HNTA 1EP1A 3QPZA 3TIMA 1ZAIA 2VEIA 4NZJA 3QZEA 4X22A 3STGA 5EY5A 3LTSA 4IGHA 2FTPA 1I8JA 1TPUA 1T99A 2QDHA 4MLRA 3W7GA 3QW4B 4DXVA 3TQKA 3W7PA 1YLVA 3SR7A 3B04A 1P4CA 3CC1A 4FXSA 4R33A 4WX2A 4LWWA 4O1AA 1OX4A 1UUOA 2VC6A 4DBEA 1F76A 3EKZA 1YDNA 3TFCA 3NZRA 3S1UA 3EX3A 2TSYA 3I7RA 1GOXA 1I45A 4JYDA 4RJEA 3G1XA 3MUXA 4N9BA 3NA8A 3GXPA 3VKJA 3A5FA 1KV8A 1MXSA 4OV9A 1QWGA 1KTBA 4H6KA 1ICSA 1F73A 3P81A 2Y85A 1P1XA 2G95A 4EWND 4CNNA 1XBYA 3UPWA 2Q8LA 2QKFA 1QCWA 4POCA 5CZTA 4YLWA 1JCMP 4IQLA 3HOJA 4MOZA 3HF3A 2B7NA 3IVTA 3PUOA 3LLFA 1W37A 4ZMGA 5L6UA 4DPQA 3KOFA 4FEZA 4UFIA 3PSWA 4UTUA 2ZDRA 2BZNA 4RX0A 2H8XA 3JR2A 2HS6A 1DORA 1KLYA 5LHFA 4LVAA 2QCMA 3LV6A 2EHHA 1FDYA 4GUHA 3WK0A 3W7EA 4WZHA 1WA3A 3LRKA 4K8HA 1BTMA 3QMRA 1NF7A 2HS8A 3W84A 4P61A 5EMUA 3EX2A 1SZFA 3SECA 2R14A 2CLIA 4FIQA 3C2OA 1LM1A 4JTIA 3UY8A 3P60A 1CW2A 3A22A 2FFCA 4MZ1A 1R46A 1F05A 4NVTA 1G7UA 1TCDA 3W1RA 2FIQA 3PBWA 1MO0A 1G69A 3T7VA 3DKLA 3NO5A 1YXCA 4Z08A 1TV8A 3C2FA 3JRKA 2YDAA 2QCNA 2V5LA 3ATYA 5LZLA 3UPBA 1NAL1 4KFOA 1TTIA 3W1PA 2VXNA 4HPJA 1ZHAA 4JTGA 3PBYA 3W07A 1R2TA 2A0NA 1SFLA 2ZTJA 4H4IA 4O12A 4HNNA 5BMXA 2QCEA 1W5PA 2PRMA 2B0MA 1XM3A 3Q2DA 1A5CA 3W74A 4AF0A 4TX9A 3EX1A 5BW6A 1AW1A 5K9CA 5H2ZA 4Q32A 2FJKA 1KM1A 5HULA 1YXDA 3WK3A 1K7XA 3LXBA 5D38A 1XXXA 1SZGA 3PBVA 3EWBX 1I2QA 1OK4A 1B9BA 5I3KA 5HWMA 3H54A 3L5MA 4ZQMA 4K39A 4Y6GA 1GTEA 4Y8FA 3QEZA 5I3JA 3CPRA 3MI2A 1UBSA 3HG4A 4PCFA 2E1DA 3NPWA 2ZBTA 1W54A 3P61A 5LNVA 3FLUA 3UXAA 1TB3A 3L0NA 3LV5A 1OHLA 3STCA 1WQ5A 4LW7A 2C3ZA 4HSOA 1Q3NA 2NX3A 2ISWA 3LRMA 4RR4A 4A22A 4LV4A 3LB0A 1SO5A 3FKKA 1K7FA 4I7VA 3PG9A 2ZRXA 3W7JA 1G6CA 1XUUA 1N7KA 1W8SA 2ZZ6A 3PM6A 5FEWA 5F1UA 3O63A 4QISA 3IRDA 3QMTA 1JQVA 1VCVA 3I7QA 1Q6QA 2WJZA 2QCHA 3TW7A 1GTHA 1JRCA 1D9EA 3EKLA 3TMLA 3JS3A 4N9CA 4Z1BA 3S9YA 3CIXA 3O15A 4QAIA 2GOUA 5AHMA 1TQJA 2QCGA 5G2HA 1RD5A 3L5LA 4JS3A 1M5WA 2C18A 3L65A 1KTCA 2E6FA 3LCFA 4OBTA 1GEQA 2RH9A 1B4KA 3BGJA 5H91A 5A5WA 2VFHA 3NPUA 5F4WA 5D09A 2TRSA 3RLUA 2E6YA 4YXGA 4MFEA 5I3HA 5L9FA 1JCXA 1C8VA 2J27A 3NM3A 1N55A 2ZA2A 3THQA 3AO0A 3TKFA 2VKZG 4H3DA 1AL8A 4UNLA 3VE7A 5CG7A 2C13A 1RR2A 1HO4A 2G97A 3NGJA 3W7KA 4EF9A 2H8ZA 3QYQA 4IMGA 2P1FA 4K6AA 1RV8A 2CWNA 1IF2A 4E2BA 3CQ0A 3WJYA 5GVJA 5AN7A 2FDSA 3W1MA 3DGRA 1JQXA 5G5IA 2Y6ZA 1OFPA 5FESA 4N2YA 3TR2A 1ZFJA 1OX4B 3MP4A 2DP3A 3M44A 3PUDA 3MWAA 5AHEA 3TE9A 3HGRA 4WXZA 3DHFA 2GJNA 3A9IA 3NQFA 1EIXA 2NUYA 3HGJA 1AW5A 5CSSA 2GVJA 1KM6A 3DHDA 4PODA 1HL2A 4NXSA 1H51A 1H7NA 1O5XA 4R53A 3BARA 3LHTA 5F2IA 1Q6OA 1G4PA 3G1FA 3S6DA 2CW6A 1X1OA 2ZCGA 1H7PA 1CX9A 2J9ZA 2OMAA 2W6RA 4N4QA 3GNDA 3LCGA 1RPXA 1SZNA 4O16A 3BG9A 4HHPA 5SWUA 2VFEA 3H53A 3L21A 1TSIA 1X6UA 2Q3RA 3O6YX 1HUVA 2YFOA 4JX5A 3NQAA 1GG0A 4GWEA 2WQPA 4Z0JA 3P7YA 3N73A 2GJLA 4R34A 3ZWSA 4HT3A 1FXQA 3CTLA 4LVBA 2EKCA 2V82A 1WDWA 5AHIA 1YTEA 3NR0A 2PCQA 5TQLA 3GDMA 3W86A 4WOZA 1DV7A 4O8RA 1FWRA 2E68A 3EWWA 3FYOA 3QQ1A 4DF0A 3W1XA 1TPEA 1KFJA 1I4NA 3TXVA 1AG1O 4JTTA 2ZQ0A 5LNRA 3RMJA 1X7FA 4JEQA 4HSNA 1OG0A 3SFKA 4O19A 3R12A 2C14A 3KFTA 4HKPA 4UFJA 3ELFA 5CGQA 1TJPA 5AOUA 1EWDA 4O0ZA 2Y61A 5FF4A 4Y9AA 4O57A 3THAA 3O07A 3PWAA 4NU7A 4NJKA 1JUBA 1PHQA 2YCEA 3EEGA 3W7MA 3BLIA 5D37A 4AWTA 3LHUA 1PVNA 1TRIA 1YDVA 1ICQA 1FY6A 1KM3A 4MUZA 5MHBA 1VGAA 3N2MA 3Q94A 4N6EA 4UR7A 5D04C 3FFSA 1KFEA 4XTDA 3B0VC 3MW7A 1W3IA 3OBKA 3TQVA 1LRQA 4L4MA 2Y70A 2I1OA 1G4SA 1Z44A 3INPA 3IEBA 3GYEA 3B4UA 1WAUA 2Q3OA 4EF8A 4IMDA 1LLWA 2NV2A 5K3VA 4GC4A 2W0UA 4QITA 1DBTA 2X1RA 4NUWA 2YW4A 4ZQNA 1E51A 4U4MA 4QNEA 1H61A 4ZQPA 3UZJA 3M5ZA 3W7IA 7TIMA 3AJXA 2EF9A 3S5OA 3W1NA 5LSMA 1VJIA 2NWRA 3TAOA 1H1YA 1DKWA 1KM4A 1OYBA 2ZZ1A 1SUXA 1CI1A 2QDGA 4OE7A 2DZWA 4KFNA 2Y7FA 4GNJA 4A21A 2CLOA 1W0MA 4NNCA 1XDMA 3R2GA 4O15A 5DN1A 2JBMA 5DCBA 3MP3A 3LHZA 1JCYA 1S5TA 3L2IA 3W7CA 2Y7EA 1HG3A 4DPPA 2DZTA 1PL9A 1IXPA 3R5EA 4CCCA 1TPWA 5D03A 3UYCA 3T44A 3M43A 4AAJA 5AC7A 3BO9A 3T55A 2FLIA 1W3NA 3E9AA 4FO4A 1OABA 1A5AA 4LC6A 3ZR4A 2GPTA 2C1HA 2ALDA 4PL1A 1RZMA 2R8WA 3MYOA 2TYSA 1X8FA 2A7PA 5CKSA 2OT1A 1EP3A 2P0OA 4BWLA 1LBMA 5KTLA 3QC3A 3GKAA 4WJEA 2DU2A 3QW3A 3G22A 3HJZA 4FX8A 4XKYB 2JGYA 2V2CA 3M6YA 4KFPA 5HUPA 2NLIA 1EWEA 4AHQA 3UNDA 3NPXA 2E77A 4QQ3A 5IM51 5DCEA 2D73A 5J5DA 1FCQA 5KMYA 2YPIA 1K8ZA 2BX7A 3TUUA 2YGYA 1R2SA 3FA5A 1O60A 4Q4KA 3R8RA 2GQ8A 4NJIA 3GIYA 1BWLA 4PFMA 3LCIA 3DFSA 5G2IA 1D3GA 1P0KA 1D3HA 4S1FA 4IXHA 4O11A 1K3UA 1KTNA 4ADUA 4OGZA 3W1AA 2CLLA 4LTSA 2DZPA 2X30A 4XBKA 2A5HA 3R89A 2FPTA 4WXYA 5DXXA 4AMAA 3L0KA 4HN4A 2A85A 3UWWA 3LDVA 4K7YA 4UMCA 1S3HA 5HR7A 1SW3A 1K02A 2XN2A 4B5NA 4WD0A 1WBHA 3PB2A 4RLIA 1K8YA 2YFNA 3G3DA 3W83A 1ZAHA 2Z6IA 3T40A 2B7OA 3W7OA 1LTDA 2HSAA 1DQXA 3NDOA 3SGZA 3L5AA 3LOTA 1XBXA 3TK7A 3NL3A 3GDLA 2JKEA 4RZ5A 4YWIA 4FNUA 3ATZA 2X1SA 3PBUA 5D2XA 1THFD 2P10A 2G96A 5G4EA 4UUIA 3KAOA 2YXGA 1ZY9A 1TREA 4FXRA 3B0PA 3QPYA 5LNWA 5EA9A 4O10A 5KZDA 3OVPA 3W2LA 1VS1A 1LRNA 3I7SA 4FB7A 4S2BA 1DHPA 2QJHA 3OEXA 1LOQA 5EBUA 3DENA 4OU1A 3U2OA 2H3BA 4QM1A 5EYWA 3W6YA 4IUOA 3UXDA 1YADA 5DELA 4DEFA 1KFKA 4O14A 4XUGA 1S5VA 4LS2A 3NOEA 4M19A 4OQVA 3LXAA 1GVRA 1ADOA 4XZ9A 1I2OA 3QRHA 1KV5A 1JR1A 2WO5A 4LS0A 2QUVA 1A50A 3DU0A 3BG3A 3UWZA 3NM1A 1LOSA 2VFDA 4PTNA 3B03A 4BR1A 2WKJA 4KKXA 1FWTA 4GUFA 3ZFHA 4UFLA 2F7FA 1H60A 2EAWA 4HIBA 1J4EA 1VCFA 3UD6A 4BK9A 3E12A 3NQEA 1VCGA 4UTTC 2ZYFA 5CPMA 1VLWA 1DQWA 5FF3A 5AB3A 2GQAA 3LCWA 3TNOA 3A5VA 4MZ8A 3F1QA 3PY2A 3SIZA 1TPC1 5LGXA 3U8GA 1KBIA 3GR7A 2CZDA 3U6WA 1H62A 4UTWA 1EA0A 1GT8A 2Y63A 4MLJA 1WXJA 2QUUA 2QCDA 5D32A 3WJZA 2CZFA 3W2KA 5FF7A 4FNSA 3A23A 4UCGA 3CEUA 3I68A 3CIWA 5DBUA 1VHNA 1VR6A 2X2GA 4LC8A 4MY8A 1OFOA 3E02A 2VEKA 1ZAJA 3KXQA 2A6NA 4JN6A 1IXOA 5DXYA 1VYSX 4UFHA 1OFEA 1HFBA 3LERA 3G3MA 3IIZA 3LTYA 3LI0A 2Y62A 1FBAA 4EOUA 4NJHA 3NQVA 4YMZA 3EWUA 4Z1DA 3KRUA 1ME7A 3P82A 2AQWA 3N34A 2HTMA 1FX6A 4K36A 1YPFA 1ZNNA 3PC0A 4O13A 2NWSA 5KSWA 1QPOA 2ZTKA 5EL1A 2OCZA 3CB8A 4UTWC 1WX0A 4AXKA 4TR9A 4EVZA 1FXPA 3G18A 4ZQCA 2RHGA 2I14A 1HO1A 4JGDA 4MVAA 1GYNA 3GAKA 3P62A 4UIOA 4YCOA 3VCRA 5DBTA 4AH7A 3IV3A 2Z2UA 4OV4A 4JDYA 1FDZA 3G1AA 1SR9A 1M7OA 1C9DA 1KFCA 3HG5A 3NXFA 2WSQA 2QJIA 3P5YA 4FIRA 3LLDA 1Z41A 3PR2A 1QOPA 5DY2A 5EPDA 3TMQA 2G5WA 2ZZ5A 1PHWA 4IMCA 2YYTA 4AEOA 1MEIA 1WOAA 2VFGA 3LX9A 1OF6A 3DFQA 5FI8A 4ALDA 1RQEA 4UTTA 1G7VA 3TROA 3G24A 3B05A 3G0UA 3M7WA 5A8GA 3NL6A 4I7UA 1L6SA 3W70A 3TSBA 5C6MA 1GWJA 1MZHA 4UNKA 4IX0A 3S5ZA 2E6DA 1DJQA 3L68A 2NXGA 1LCOA 1JJKA 4UTLA 3ZWTA 4MKNA 2Y88A 1LZOA 1QPQA 4N4PA 4LY8A 2GQ9A 4M6QA 4FX6M 5D05A 1YDOA 3W7NA 3NQMA 1ZCOA 3PULA 4EIVA 1KW1A 2VEPA 1KLZA 3GXTA 4JTJA 4PL2A 5DLCA 4E0CA 5I3FA 2E5DA 5J5RA 3MI6A 5AHNA 1PCWA 4IXXA 3C2RA 1M6JA 1EB3A 4GXMA 3KRSA 3W1TA 1U83A 2I9EA 4BF9A 1DVJA 2YR1A 3OIXA 3IIVA 3UQNA 1TPDA 2FB3A 3DFNA 4NNAA 3LI1A 3E96A 1TV7A 2XN0A 2R91A 1GG1A 2R94A 4WY0B 1GYLA 1O94A 4JR5A 4CCEA 4PC8A 2CZEA 3SI9A 2YZRA 3A21A 5TIMA 1KM0A 1P0NA 1TPFA 3OG3A 1KFLA 3MP5A 3G8EA 1DOSA 1SO4A 2EGZA 3FKRA 3BLFA 1W56A 5I3IA 2E09A 2DJLA 1KA9F 1QNVA 1IXNA 1XI3A 4X3ZA 4AVFA 4JY9A 1JRBA 2QAFA 4WY0F 1R30A 3QFEA 4O54A 3M9YA 1T96A 1P5BA 2FPVA 3GR8A 2Z6JA 5CZ0A 3Q37A 2VOMA 5FF0A 2A1YA 1YTKA 3NVTA 3TSMA 3GLCA 3HG3A 3GNNA 2FQIA 3ABOA 4FHAA 2JKAA 3TXZA 2ZRWA 4LVDA 5FEXA 2ZZ2A 1YPIA 4IPJA 3FEMA 2NX9A 3QMSA 1H7RA 1A5BA 5KINA 3W88A 1SW0A 5HWJA 1SQ7A 3IGSA 4FNPA 4ICNA 3N9SA 2PRHA 2NZLA 3LTPA 4UTHA 3SZ8A 1G4TA 2V8ZA 3MBDA 4AHPA 2V2DA 3HPSA 6TIMA 3HPXA 4YL2A 3NG3A 5KZEA 1GJPA 3PS7A 3O6DA 1V5XA 4FNTA 4RXFA 1F2JA 4OWGA 2YYUA 2ABAA 4O17A 2NXIA 3M5XA 3NEVA 5HINA 3EXSA 4M7SA 3W2MA 3S1VA 2ABBA 1FCUA 4ORMA 4XQ6A 3DFTA 4JX6A 4Z1CA 1ME8A 2Y7GA 4L4LA 1IXQA 5EKYA 1FWSA 3HGSA 2CLFA 5HR6A 4LS1A 5BNKA 4O1DA 3L67A 4LUJA 3IIPA 3WFAA 3W72A 4JTFA 3BGGA 1OYAA 5CPLA 3O1NA 5C2XA 4TMBA 4HNUA 2B4GA 3FOKA 1LDCA 3C8FA 3YPIA 5CSRA 1SW7A 1SO6A 4LV9A 3BW4A 3CWNA 4BI6A 1ZENA 1I2PA 4M7TA 4MYAA 1OFDA 4QNWA 2ZZ7A 5FEZA 1EEPA 2J24A 1R47A 3OVRA 1VYPX 4N6FA 4NNBA 3STFA 1B4EA 1JVNA 3F4NA 4MPQA 5HUOA 3G0SA 3MHUA 2V81A 4GUGA 2J9YA 4LT9A 4X2RA 4LOCA 5AHFA 4MJZA 4IMEA 5KZMA 4ML9A 2W79A 2X1UA 5TBOA 3W85A 1J2WA 4QJ1A 2RDTA 1W5NA 5LNUA 1H7XA 2JK2A 2ZRVA 5K4ZA 1XUZA 1W5QA 4AWUA 2ZZ3A 3NQ6A 2O7SA 3DH7A 3TCEA 4GFSA 4MY1A 5I3GA 1GZGA 4DQWA 1NF0A 3GAYA 3KVJA 5AYZA 1OK6A 5AC8A 2ZA3A 5K9XA 4JNMA 4MIMA 3UWQA 2ZRZA 3LHVA 3SSJA 8TIMA 4TU1A 4G1KA 3RK8A 3OVQA 4N9DA 5K2ZA 3W7HA 3S5NA 1YXYA 1SO3A 2QF7A 2GUUA 3P80A 4WOQA 3E49A 4ORIA 4RXGA 4NX5A 3FYPA 4DF2A 4UXDA 2Z1BA 4W9TA 4I9AA 4NZFA 1H5YA 4KWWA 3W1UA 3RFAA 3TU9A 4R7JA 2XN1A 2EPHA 3C61A 4CNOA 4CQ8A 2BXVA 5C55A 1LROA 4Z0SA 3VNDA 4RV8A 1Q6RA 1AL7A 1VRDA 4TIMA 1QFEA 1BKSA 3GVGA 3IIOA 1Z42A 4O4WA 3WJWA 3W75A 3S8HA 4WQ6A 4JTLA 1FCBA 1GVOA 5F4SA 3DKJA 5CZJA 3BW3A 1JULA 4BI7A 3HGOA 1W1ZA 2CLMA 4JTSA 3DBPA 1SPQA 3TAKA 2OZ0A 3NYZA 3LCLA 3G1VA 3NL2A 5K9DA 2WSRA 1BWKA 3W7DA 4JXCA 2WNNA 4IX2A 1LBLA 2PC4A 3C2VA 4OHQA 3DXIA 2YSWA 1FWWA 1EPXA 4O53A 5HNRA 2CLHA 3W87A 2H3DA 2B7QA 1UCWA 3W76A 1OFAA 4LRSA 4YCPA 1GPWA 2H6RA 3G1YA 3VI2A 2Q8ZA 5D02A 1Q45A 4LU0A 1WV2A 3SGUA 3G1HA 1S5WA 1TYGA 1L9WA 2A2IA
chains in the Genus database with same CATH superfamily
1NOWA 4H2CA 1DP0A 2Z27A 2C8NA 4IH3A 3VA8A 2FHCA 5A8NA 2A7NA 2QAPA 2WKLA 1UWTA 4AB4A 1TO3A 1Z7AA 1QI5A 1J12A 3WH8A 4AISA 2WPBA 3ANYA 2GVEA 1PDZA 1YEYA 3SRDA 1VFFA 1PCKA 5BROA 3NQ2A 2REQB 1M65A 3BV4A 2TMDA 4C6IA 3TC7A 3RRAA 1O4UA 4I5XA 1QAPA 3FSUA 1AZ2A 1CB7B 2BVYA 3IS4A 1QOQA 4H04A 2J6XA 1JZ8A 3JU2A 4PEEA 1SR0A 4Z1AA 1QNRA 2V30A 3T07A 1CBGA 3VIMA 3PZIA 4DY1A 5ABEA 3M0KA 5HWNA 5FEPA 3UWEA 1BVNP 1R38A 4B91A 4MAZA 1WDPA 3A47A 3SY5A 1GQJA 4DO5A 4B2DD 1AK5A 3AS1A 1W1VA 2D2JA 3E0FA 3GZ3A 1V0MA 4ZA0A 4Y96A 1XL9A 1EJRC 3CHVA 2A4AA 3DI1A 1OFBA 2KAUC 1V02A 1JCLA 3P74A 3B8UA 3ZJ7A 4F8XA 2UV8G 3KCLA 1TWDA 2BWGA 4BEUA 2I17A 1XYMA 3TH6A 4QIUA 2Z0IA 1PPIA 4ZXOA 5HJLA 3ARWA 2ZA1A 2ZX8A 3TC6A 1HQTA 4IPLA 2IPFA 1QHZA 1TJ2A 3HFYA 1QK2A 1VPYA 1SJDA 2VO5A 2WMIB 3W9ZA 2IS7A 2HWGA 2VURA 3EAUA 2XH7A 3WSUA 2V5CA 2ON3A 2I9UA 1Y5WA 3C3NA 1F5ZA 4ZL1A 1V02E 5GJNA 4A2SA 3TW6A 5E1QA 4B5TA 1E3XA 4GUIA 2HV5A 1H7OA 2R1MA 3WN6A 3TTSA 1ZB5A 4XBSA 2PGWA 3DI0A 4G1NA 5CEWA 1ISZA 4LUSA 2FZNA 3NPVA 3W2JA 4U10A 3B8TA 1TE6A 3VKDA 2PWFA 1CNVA 3AHZA 3N4EA 3AZTA 4PMNA 2GZXA 3F2CA 3PAOA 2ZX9A 1Q4WA 2OB3A 2IUZA 4FZIA 3V1HA 1RCOB 3D0CA 2RFGA 3M64A 1SSGA 3PVFA 3TDFA 2GSJA 3CGTA 3SIMA 2XIMA 1M41A 5E9XA 3OGRA 3AIWA 3LBCA 3MO7A 3EMCA 5JVLA 1RY0A 3FW6A 2JIWA 4PMJA 1ITQA 1R6WA 3P67A 3DG6A 2KZHA 3O6AA 3LGDA 3O05A 3VD7A 5AVNA 2PLKA 4DLFA 4WY0A 1JYVA 3BPWA 1KXTA 4MFDA 3FS2A 4M24A 2PCEA 1TIWA 3GY1A 2A3CA 3WEOA 5DY3A 3KVKA 3PUGA 4YTUA 1AZ1A 3Q67A 1L2UA 4L4PA 1XV8A 3FY1A 1BGGA 2CZVA 2X0HA 4K2SA 5KEZA 1NTHA 1A53A 1W6TA 5HMSA 2OG9A 3KHJA 3A13A 5BRBA 1CIUA 8CGTA 3WNNA 4K1WA 1RVKA 3UERA 5DCDA 3ZLHA 4F0LA 4JX4A 4GQ0A 4WLCA 1E5JA 3CQIA 1Q7MA 4N42A 3GK0A 4E2DA 2FTWA 1FWNA 1O95A 4WJXA 3S0CA 4MJ4A 2PWEA 2OSWA 5K4XA 3CM4A 1S2CA 4A2RA 4FF7A 1EL3A 1VLIA 3GM8A 2YCIX 4IIEA 4GCAA 3PF3A 3RPTA 1EXBA 2Y2WA 1UWAA 4DO4A 4B5UA 1P7TA 4YNGA 2VHLA 2J7DA 4BQ5A 3ITVA 1SSDA 4KWVA 3HO8A 3F03K 4B3ZA 2QPSA 4PEKA 2VDIA 3N2TA 1W31A 1Z89A 4MZYA 2PWHA 1XCFA 3S2NA 3CMFA 3AIBA 1O5KA 4PMYA 5FAJA 3TFXA 3S42A 4AEEA 3SUVA 3EWXA 3UVAA 3I6EA 3IUIA 1RALA 2E9LA 2VYOA 1YDYA 3QF0A 1TPH1 1A5NC 4JDBA 2QCFA 4Q4SA 2PDHA 5I79A 3RNDA 3RRXA 2O56A 4MAVA 1J96A 4ONVA 2FHBA 5FJJA 1MEWA 3DOPA 3M0VA 5FJRA 4AG0A 2ACUA 3I3BA 1IR1A 1VKFA 3HQPA 3UZWA 4CU8A 3E0WA 3M16A 3MKCA 2QPUA 4E2OA 2PWDA 3RLVA 2FVLA 1BSLA 3WIJA 5C9ZA 1C92A 1UMLA 2A79A 1Q2RA 3A3XA 4XAZA 2Y7DA 2VP8A 1X6NA 1B3ZA 3KZPA 2GVGA 3FSTA 4MJMA 1TRDA 1JNDA 3AHYA 1PYMA 4D2JA 4JTHA 2RDWA 5H1WA 4H7VA 4HNOA 4K8EA 1ITCA 1N8WA 1XYBA 1H1ZA 1WYIA 3AU6A 1E72M 1XLJA 1VFOA 4O1FA 4ZO8A 3O8AA 4C91A 4UB9A 2Y89A 2UWFA 2PLMA 3LHYA 5HNUA 3VM7A 4JTUA 5JBEA 5AZ0A 1UC5A 2IKIA 1FWJC 4N02A 3B0UX 5K7JA 3VOIA 5E0KA 3PAJA 4Q7BA 3WLLA 1DIOA 1XH1A 4CCDA 4F40A 4NAEA 3WQ6A 1R3WA 1KBJA 3VIJA 4QSFA 1DWJM 5H8MA 1G0CA 3O06A 4N9EA 2OR2A 2TPSA 1W5OA 4AZ7A 3T0BA 3ZT7A 2C15A 5I06A 1CT5A 5CBBA 3H2EA 1YQ2A 4ICCX 4HPXA 2WPGA 5IDZA 3GW0A 3KVLA 3TQ0A 4JYEA 1C7SA 3FHQA 3ZLFA 2CLKA 2WSYA 1ADSA 2QR6A 1TTJA 1S2UA 3GDTA 3OOQA 1B3OA 1QW9A 4O0KA 2BY3A 2CKRA 4OFCA 3IIXA 3VE9A 3S9IA 1WP6A 2V69A 1YIXA 4HCLA 1HL9A 4J3SA 3RU6A 3P8IA 5LIXX 4RZ4A 1KR0A 3GVQA 3M5YA 4NILA 3Q58A 2XGIA 3U48A 2VC5A 1QO2A 4DJFC 1HKVA 3W37A 3FA4A 3KL3A 4NP7A 3S46A 1UUMA 4KCUA 4G9PA 2Q02A 5HQEA 1VHCA 4NYYA 1PTDA 4P7LA 1EP1A 4NAFB 4GY1A 3QPZA 3TIMA 1ZAIA 2QZRA 2VC7A 1QT1A 3QZEA 2OEJA 1KWKA 1Q6FA 3W6MA 1T99A 2QDHA 2QLYA 3W7PA 3CAQA 5HMFA 1YLVA 3T0AA 4DZ5A 3WF1A 4Y7EA 4DBEA 4IIDA 1VFSA 1F76A 5AY7A 3NZRA 1V3JA 4XZBA 1CWYA 3EX3A 3Q4DA 4JYDA 4MKVA 1M03A 1UWUA 3NA8A 3GXPA 4IIHA 3N15A 5PTDA 1RSCA 1KTBA 3WH6A 4EWND 1P1XA 2QKFA 2NQ5A 1QCWA 4MNJA 2DUXA 3CZJA 3HOJA 4REQB 1CZ1A 4QJ5B 3GFXA 2B7NA 3AMKA 3LLFA 1W37A 1MVYA 2OWXA 2B31A 2PF8A 3VYLA 1FHDA 4CNTA 2BZNA 4RX0A 1UP2A 6CGTA 3JR2A 3FV9A 1DORA 4ATLA 3OBAA 5CC3A 3TLLA 1MW2A 1WZAA 4FSAA 4W7VA 1Q85A 1SJAA 2VI0A 1E6ZA 5DF0A 4YPJA 4RPQA 3KDNA 3LY0A 3U4AA 4CQBA 3QMRA 3VILA 3EX2A 3ECQA 1FOBA 1SZFA 1XLAA 3QOMA 1J18A 5IDIA 3P60A 5GNXA 2WMHA 4XSMA 2FFCA 4MZ1A 1R9YA 5LA1A 4FLQA 4NVTA 1E0VA 4XG1A 1TCDA 2FIQA 3PBWA 2R24A 1G69A 3T7VA 1OIFA 2I16A 1FFRA 3NO5A 3W02A 2DT3A 2YDAA 3BJFA 1IWAA 4DVOA 4B92A 4S3FA 1IE7C 2FVMA 5LZLA 1NAL1 3W1PA 1XD0A 4HPJA 1ZHAA 2A3BA 3ITYA 3PBYA 1IGWA 2A0NA 1NQ6A 5C2GA 4O12A 5BMXA 3MWCA 4KEVA 3KM8A 2YXOA 4L1WA 2QCEA 1GZJA 1EDGA 1Q6DA 4QG6A 2PTYA 4AF0A 2XIOA 2FJKA 1KM1A 5HULA 1E6QM 4Z17A 1K7XA 5D38A 3PBVA 2DPEA 2R1NA 1OK4A 4I9MA 3VD9A 3H54A 7ODCA 1KGXA 1EZWA 3QEZA 4B9ZA 3CPRA 3WLMA 4RW3A 1UBSA 1J6OA 1R3YA 1XF0A 1NARA 1Y8BA 2ZBTA 3CASA 4M1RA 5D8ZA 3GTNA 1TB3A 1BXNA 3ORWA 1OHLA 1Z3NA 3VTRA 4LW7A 4CEXC 4GJIA 4HSOA 1W3KA 4QHRA 3R58A 2E28A 4RR4A 2XH4A 4W89A 5E09A 4CQCA 1AQ0A 3RCMA 3W7JA 4PFHA 1G6CA 4OUEA 4HB7A 4PMUA 3FNDA 5F1UA 3O63A 3UZYA 4ZOBA 4PSPA 2WJZA 4L1GA 1X38A 2P8CA 2QJJA 2J7FA 3TW7A 1OD8A 4Q8WA 3PNZA 5BXTA 3TMLA 2OOFA 3CIXA 3O15A 1LG2A 2C18A 5LIKX 3ES8A 1DXFA 2E6FA 1GEQA 4Q22A 3AHTA 2QS8A 1B4KA 3QZAA 2HEJA 1XJBA 5H91A 5A5WA 2HROA 2GGGA 3NZQA 2E6YA 3JUGA 5BU9A 1JGIA 4MFEA 5I3HA 2VM8A 1C8VA 3EA2A 4J2MA 3WNMA 3THQA 3P14A 1CXFA 4EPEC 4PZVA 3VE7A 1JFHA 2XPKA 1H3GA 1LWHA 5HJXA 4EF9A 2J77A 3WEMA 3MC5A 2Q09A 4IMGA 4KEUA 3QV8A 4K6AA 4YVVA 1RV8A 4E2BA 5DO8A 4IJRA 1UWSA 3CQ0A 3SGGA 3SRHA 2FDSA 3MUAA 2E67A 1YW1A 3DGRA 2XYLA 2Y6ZA 1ZFJA 3GH4A 4F0SA 1TX0A 4MB5A 1RAKA 1XH0A 2PZNA 3TE9A 3WQ4A 3GG0A 3PBMA 3THDA 2VGGA 3HU7A 3S3GA 1AW5A 1QHPA 1KM6A 3FAXA 3DHDA 4L9YA 4QCFA 2OXNA 3EYPA 5HAOA 6REQA 4JL2A 3G1FA 5A3HA 2X7VA 3S6DA 2ZCGA 1H7PA 3H4WA 4TV5A 5I5RA 1RPXA 1J0JA 3L21A 1UIPA 4ZTYA 1TSIA 2AGTA 3IAPA 4TTGA 4RUBA 3CLWA 4JX5A 1EJ7L 2WQPA 1XH2A 3P7YA 1WKYA 3VD4A 1TMLA 3SRFA 4H9MA 4Q7IA 4GD0A 2GDVA 1U30A 3TWAA 2PWVA 4JFSA 1WUFA 3CV2A 1CB2A 3XISA 1TZ9A 4O8RA 3ARSA 2I5IA 3FYOA 4DF0A 1LT8A 4IQEA 1R3RA 3K8KA 4WKHA 3AU2A 2P76A 2BXYA 1KFJA 3TXVA 1DIEA 4JTTA 2J4GA 5LNRA 3RMJA 1ECEA 1X7FA 1IZCA 1O5RA 4JEQA 3L4UA 2PSNA 2VZTA 3H26A 5E9AA 3WMCA 4FP1A 1ITXA 4F2BA 4HKPA 1PWLA 5CGQA 1TJPA 2GDUA 1CGYA 1UR0A 4IGNA 5FF4A 3CQHA 4RDWA 3THAA 3T0TA 5FL1A 2D0HA 4OJYA 1E0XA 5TF0A 3BLIA 2G3MA 4JQ2A 4GX8A 4B90A 1ICQA 4MUZA 4M80A 5MHBA 3CAKA 4N6EA 1DJYA 3KTXA 3F2DA 4DWSC 2DIEA 2Y70A 3S83A 4LSBA 4GQBA 1A5MC 4EPBC 1D8CA 3B4UA 3G6MA 1WAUA 1EA9C 4IMDA 1GHSA 4CUCA 5K3VA 4GC4A 6ENLA 2Z00A 4NUWA 2DDXA 3ARPA 1PSCA 4KETA 1XIGA 4U4MA 1H61A 1IWBA 1VB9A 4HZ6A 2V68A 3S5OA 3IAQA 4I9TA 4PB5A 2QUNA 1S2WA 4ZTXA 1O6IA 1OYBA 4X0VA 3U57A 6XIMA 2VX6A 1CI1A 1PDYA 3GNPA 3EB3A 4A21A 2CBUA 5HJYA 5E70A 3BOXA 4AMCA 1W0MA 1XDMA 3R2GA 4F2UA 5CJ5A 5DCBA 1HJVA 3S2JA 3BLOA 3MCNA 5H6HA 4DPPA 1PL9A 4XD3A 4J1OA 1V4YA 3UG3A 1BYDA 3BO9A 5B80A 3A3HA 3QR0A 3R79A 2VX7A 4PRRA 2AOSA 5M5DA 4WGHA 1V6UA 4OUIA 4NYUA 2TYSA 1X8FA 1U2YA 1UC4A 1MFVA 4ZFMA 4R88A 5KTLA 1VFTA 1TKKA 3QC3A 3GKAA 3MZ2A 2DU2A 3L4WA 1EJUC 3HJZA 4FX8A 2YDSA 2OQYA 2NLIA 3C3UA 1V6XA 3IJLA 5IM51 3WQOA 5DCEA 2W4XA 4IL0A 1NOFA 1QOXA 5KMYA 2D0GA 1K8ZA 2BX7A 3TUUA 2YGYA 4GZIA 1RD6A 1O60A 3R8RA 3THUA 1VBJA 3AZSA 4AYGA 2WW5A 2D3NA 3DFSA 1TG7A 4UTFA 5JBDA 1P0KA 2XM2A 2DVUA 1K3UA 4UQDA 4ADUA 2GGEA 5FJPA 4FK9A 2FGZA 1TA3B 4PMRA 4C6KA 3UWWA 3MSYA 2QPXA 5HR7A 1D2KA 1QNQA 3OZMA 3OG2A 1QW8A 4Y8EA 3KOZA 1A49A 1U22A 1I1WA 3HTWA 4JQ4A 1K8YA 3G3DA 1B3XA 3W83A 4RNIA 2B7OA 1GUVA 2AKMA 3T2PA 1GYMA 4ZB2A 3TK7A 3NL3A 3GDLA 2HISA 4QXIA 2X1SA 1GGOA 5E6YA 3PBUA 5D2XA 1THFD 3HFTA 4XO6A 2OKTA 3EEZA 4UUIA 2YXGA 4FXRA 2CITA 3QPYA 2POTA 3SN1A 3OVPA 3DG7A 1VS1A 5XIMA 4S2BA 1DHPA 5BYWA 2QJHA 1LOQA 4G7EA 3QZ6A 3WBYA 3DENA 1PJ9A 4ZO9A 4BF5A 3U2CA 4EAMA 2C79A 2H3BA 5EYWA 4AZ6A 3AIEA 3CUFA 5DELA 1KFKA 4AUBA 4XUGA 2VR5A 2AQVA 3CXOA 2NT0A 4XZWA 2W9MA 1NWUA 3QR3A 4OQVA 1GVRA 4GZEA 4WF7A 1PX3A 1ZUAX 1JR1A 3N2BA 4LS0A 1GONA 5HPCA 2QUVA 4L1XA 4KGLA 1LQ0A 3S6TA 2QIWA 1RA5A 2VFDA 3STPA 4BR1A 1FWTA 4Y9MA 3WDQA 4US6A 4ZOEA 2F7FA 3BWWA 4DN1A 3PPGA 4A3QA 3RPDA 4BK9A 3NQEA 8RUCA 5CPMA 1VLWA 1DQWA 1P1MA 4A6GA 3TNOA 3SIZA 3UT0A 3GR7A 2CZDA 3WNLA 3WKZA 1ZP4A 4MLJA 3AIQA 2OEKA 3IJ9A 2QUUA 2QCDA 2CZFA 4B15A 1HKMA 3CZGA 4DBUA 4US5D 5HMEA 4JFVA 4UCGA 3A3WA 4GXPA 3S5SA 3CIWA 3IPWA 1VHNA 1KD0A 1OFOA 3B0XA 3E02A 1ZAJA 3U4FA 4AD4A 4NIRA 4UFHA 4OKDA 1OFEA 3LERA 3LTYA 4GHRA 2Y62A 3CO4A 4NJHA 3NQVA 1XIHA 1FH8A 3EWUA 1KBBA 1JZ6A 1B3WA 1MZRA 4LUTA 4LF1A 2HTMA 1JZ3A 2FVKA 4AW7A 1ZNNA 2NWSA 1QPOA 3CZLA 1E4NA 5IFPA 1WX0A 5A69A 1V6YA 2RHGA 4XAPA 4R9OA 4UIOA 1KQYA 2IKJA 4YCOA 1TV3A 1REQA 4CEUC 1AMYA 4IUGA 2WSKA 3MO4A 3PN8A 4J2PA 3WQEA 4LFYA 2XGZA 3HG5A 3O0KA 1PTGA 3TJ4A 1GOWA 2I57A 4HMNA 4UR9A 1QOPA 3EMZA 3RLGA 1XYCA 5DY2A 5EPDA 2G5WA 3I4EA 1TVNA 4AEOA 1JPKA 2GJXB 2R9RA 1MXDA 4D6GA 4B4FA 3LX9A 1OF6A 1GOQA 1RQEA 4XB3A 4CU6A 3BV7A 3BANA 4GXWA 3UBPC 4TOQA 1L6SA 3W70A 4US5A 4UNKA 4IX0A 3PANA 2BGNE 4OOUA 1JJKA 2G4FA 4C65A 3LYEA 1TMQA 4HMCA 3ZWTA 5A8MA 2O4QA 3DN5A 5T91A 2Y88A 1VJSA 4LB4A 4M6QA 3W7NA 1YDOA 1W8GA 5MF5A 1KW1A 3V36A 3GXTA 4PL2A 5GPRA 4AQLA 3T6CA 3VNJA 5J5RA 3MI6A 5AHNA 1PEZA 3UYIA 2FH8A 1CECA 4Q8OA 2D2OA 3DC0A 1MNSA 3H4GA 4L5ZA 3UQNA 1TPDA 2FB3A 4A05A 3ME3A 4IFRA 4F0MA 4QJ3B 5D9NA 3E96A 2R94A 4PCPA 4LPCA 3S1GA 4WSJA 4S23A 2CZEA 3SI9A 5TIMA 1TPFA 2RAGA 5DRIA 4NF7A 1SO4A 1WKFA 1JYWA 4YYCA 2DJLA 4PMDA 1KA9F 1QNVA 1XI3A 4X3ZA 4AVFA 4JY9A 2QAFA 3ARXA 1EGMA 1T96A 1P5BA 2FPVA 4GLEA 5FF0A 3NVTA 4O1EA 4EE9A 4AX6A 5ABFA 4GI8A 3BZGA 3ABOA 4H19A 1UOZA 1JFXA 1D7FA 5FEXA 1R86A 1YPIA 2HXUA 4FXJA 1Q8AA 3FEMA 3QMSA 1H7RA 1NELA 5KINA 3PJXA 3W88A 3KDOA 1SQ7A 4EAYA 2E9BA 2PDCA 1EKOA 3GTFA 4FNPA 3QTPA 3N9SA 1CCWB 1OGBA 1RXOB 3SB0A 2Z1WA 1NWRA 1Q5MA 4AHPA 1O7AA 3TZNA 5EB8A 5T9CE 3JW7A 1V5XA 2QNEA 2EG6A 3AOFA 5C2CA 3REQB 1F2JA 2QULA 2VZUA 3QTGA 3SADA 2HPIA 2YYUA 1S2VA 4O17A 2NXIA 4C6FA 3NEVA 3EBVA 1UHVA 3N11A 3S1VA 2IQDA 4ATWA 2ZX5A 3KLLA 4GX9A 2XIIA 4B5WA 3UXKA 4CN1A 2Y7GA 1IXQA 5CC5A 1C8YA 2UY4A 3B9AA 5HR6A 2Z1KA 4LS1A 5BZAA 3T05A 1OM0A 1AJ0A 3KRBA 2F38A 4XIMA 3GHRA 1W91A 1YE6A 4I90A 1XLFA 2Y5JA 3YPIA 4ZB5A 4DI9A 5CSRA 3UVIA 4IFOA 1KGUA 4LV9A 2REQA 3BW4A 3WBEA 3CWNA 4AXNA 4M7TA 4GIEA 3QHMA 4C6DA 2ZZ7A 1QBBA 5DT7A 2J24A 1R47A 3OLIA 1QNPA 1V8EA 3RITA 1PUDA 3CHFA 5CGMA 2GDQA 4N6FA 3PJTA 2OO0A 1JVNA 3CAVA 4W93A 1E55A 4WCJA 3P0XA 4GC3A 4LT9A 4LOCA 5AHFA 2DVXA 5CAKA 4E8DA 1E1CA 1J2WA 3IJ7A 1BTCA 1YBQB 1W5QA 3DH7A 4MY1A 1GZGA 3I6TA 5D9OA 4L65A 3GAYA 3KVJA 5AYZA 4OECA 1OK6A 5AC8A 1BPLB 1G01A 2ZA3A 8TIMA 1BD0A 1HNYA 3GDBA 2JF7A 3A4XA 3EOLA 4B2DA 1FP8A 2PDGA 3MSRA 2ZX7A 4WDUA 3S5NA 3GBEA 4HHHA 2PA6A 5I00A 1SZRA 2F61A 5CG0A 4GFIA 4NX5A 2QHAA 2QJNA 1FH7A 3ZVIA 1IZJA 4HZ7A 1H5YA 2Q01A 2EPHA 2PODA 3WH9A 2BXVA 1MMFA 1PKNA 3GNXA 1KFWA 3WDPP 1VIWA 3BAIA 3AXIA 3IIOA 3WQ8A 4M0XA 4KH2A 4MM1A 2OYLA 3POCA 2JF6A 3V18A 2WB5A 1XSIA 7REQA 2XFYA 4K8GA 4BI7A 5C9XA 3NVDA 1A5UA 2CLMA 2GJPA 1OT1A 3TAKA 1SYTA 4ERGA 4ZO6A 5K9DA 1BWKA 3W7DA 3OGVA 1LBLA 4PSRA 4OHQA 2PC4A 1XRVA 4CD4A 3DXIA 2YSWA 3UG8A 4KRTA 1QWKA 4QTGA 3W76A 1UD5A 4GGHA 2WCAA 4GNKB 3G1YA 1NDZA 3KWSA 5J04A 1WV2A 3SGUA 1TYGA 4XUYA 2V5DA 2WZMA 1R9XA 3TSDA 1PZ2A 1H41A 3K30A 1X1NA 1WDDA 1XYFA 1XIEA 4LAUA 5LIYX 1TPVA 3ZS4A 1CGVA 3VDHA 3GBDA 4S3AA 4BKNA 9XIMA 2NX1A 1HP4A 5RUBA 2NV1A 3GUGA 1HP5A 3CUIA 3LBOA 3WJXA 1XBVA 4C1KA 2WWCA 1HVQA 2RDUA 2QV5A 5CPNA 1M9HA 5KITA 2PE4A 2Z2AA 3EDJA 1OX6A 2WVUA 2J88A 1GVSA 4JPGA 3K1GA 3L2LA 1GPFA 1C29A 3I65A 3QKZA 2DGAA 2R1PA 4JFTA 1ZBKA 3W71A 4ADTA 3N2OA 4M6VA 2C71A 4E3TA 2CU0A 4L9ZA 2QEZA 5F2MA 3M0XA 3VZXA 1L6WA 1LQ2A 1TJRA 3GNRA 2XH0A 4Z2GA 5LNSA 1R87A 3PJUA 4UTJA 3IGXA 3R94A 4FNRA 4O50A 3MKVA 4D71A 2YA0A 2PGEA 3BICA 3ZQ9A 3WDJA 1S1PA 1MSSA 5E93A 3QY8A 3HPAA 3OHIA 2VZOA 3E3HA 2XVPA 7A3HA 1QPKA 2C19A 1OSEA 1GJWA 3DFPA 1RA0A 3LRLA 1DE5A 3NL5A 1KM5A 2WXDM 4U28A 4GBDA 5LHEA 4IOTA 7XIMA 1QPRA 3WUFA 5IRPA 1PXGA 3NQCA 1POKA 1VJZA 4RE3A 3TJLA 2BGSA 1J6PA 1HIZA 5G1YA 1W3TA 3NWRA 5D2TA 4IFKB 3IARA 4H8VA 3BZJA 5CPSA 2AMGA 5I2UA 1IEXA 1E6NA 4EPKA 3BOLA 2XUCA 3VO0A 4GKTA 1PIFA 3OA5A 3WO8A 2XFWA 2PGRA 1UH3A 1NVMA 3NQ7A 3GXMA 4PTMA 1SM9A 2WZHA 4O1BA 2PU1A 3AJ7A 3GQYA 5BXSA 1WOBA 1RCXB 3RMEA 5A6LA 3ZOAA 5A8OA 3E2VA 6ALDA 4M1BA 1AMKA 3VIFA 4LNCA 1HTIA 3ABZA 2CHNA 1UD4A 4JL1A 1H50A 1XLDA 2FB2A 1S2AA 1EP2A 4Q4RA 3DHUA 2BP1A 1JD9A 3SN0A 1SVDA 2J9XA 5JQ9A 1FKWA 1ISWA 2ZUUA 4OIFA 3M5VA 1J0IA 5B7YA 3GB6A 1T0OA 1EQCA 4GYJA 2VJXA 3NZGA 4WSHA 2X0YA 3HQ1A 1ZJBA 1V08A 1BYAA 1KRMA 1RVGA 3NQGA 3PUEA 2Z4GA 1DJHA 2IMRA 1RQBA 1TFVA 3S4TA 2PRLA 4UTMA 3KVMA 2V5JA 4CCZA 3W28A 4KCTA 4Y9PA 4MF4A 2YX0A 1ML1A 3VFLA 4JQ1A 3AHVA 3W1QA 3EB4A 3AICA 2VRQA 1FCVA 4E38A 1QNOA 4W4QA 4MJ2A 2A7RA 3RXZA 1Y5XA 5CQ1A 1M7XA 4MKSA 3TW9A 2FH6A 3E0IA 2FZ9A 2PEVA 2DZXA 2PTWA 3GC5A 3T4CA 4W5UA 5A6MA 4V28A 3KTCA 2ZE3A 2VEFA 2XIBA 3WDRA 4JD4A 2YCJA 3W3OA 4LVGA 4GGBA 4IIBA 3E2RA 5CZSA 2NSXA 3OW1A 3G6LA 4W8BA 3WX7A 2ATSA 5AHLA 4DBSA 5F2GA 1A5SA 3MMTA 2ZUWA 3BLEA 4L61A 1TTQA 3IJ6A 2OO6A 3UWUA 1Q66A 1UD3A 2DZVA 4WIWA 3PZTA 5D33A 1EUNA 3QH2A 3UJEA 3G1SA 1PZ1A 3WLQA 5E6ZA 3EX6A 2QCDB 1W3HA 1TVLA 1EUAA 2CLEA 3G8RA 4JYFA 3PTKA 1S5NA 4HA0A 2ACQA 3W82A 1US0A 3CZEA 4ADSA 1WDQA 4GY0A 3NEHA 2QIIA 5E0FA 5CPOA 1OQFA 1P6WA 4NKCA 4MWAA 4AZHA 4BS0A 5CLWA 3MHGA 1A5OC 5I09A 3VM5A 4ZSUA 2YB1A 1OIMA 1OBAA 1B1YA 1HKIA 4NJJA 3ANVA 2W27A 4JIHA 3L9CA 4IFKA 2PURA 5G4WA 1K7EA 3TWBA 4PR4A 3E38A 4R9XA 2PDMA 7ENLA 4OT7A 4X9SA 2V0TA 3VDCA 4ACZA 1U1JA 3EX4A 2BHZA 2AQOA 3GXNA 5G2WA 2W92A 1ISYA 1K9FA 2D2GA 2R82A 2G3IA 1QDSA 4IPIA 3TX9A 2GJXA 3SJ3A 1BYCA 2V3EA 1UYQA 1NDWA 3HG2A 5FF2A 3PTMA 4UR8A 3M41A 5BMWA 1EC9A 3DBNA 4JCMA 2MANA 1C8XA 2JALA 4J28A 1TQXA 5HXMA 2DFAA 2WVVB 3F4WA 4C6BA 5T26A 1B54A 1PS9A 4J9JA 3NNTA 3LCHA 3FIGA 4EP8C 3K13A 3HURA 4UQBA 1QPNA 4GABA 1XDJA 1EO7A 3Q45A 4JTKA 4QAWA 2EJAA 3VC6A 1K6AA 1EJTC 1NFBA 2H9AA 4P2VA 5CSUA 3B0YA 3COTA 3KZSA 5AC6A 4QG9A 1A0DA 2XSXA 4RZ6A 2QCLA 1KNWA 3USBA 3PB0A 4GK8A 3LPGA 1RK5A 3UWYA 5XIAA 4EXBA 4V1XA 1NEYA 4EPDC 1JAEA 5A6AA 5FIPA 1FRBA 5E5CA 2VL4A 2O9OA 1UKOA 1V3KA 5FD0A 3TV8A 3BVJA 4LYQA 3FN9A 1WNOA 3VMOA 1MQPA 3WBXA 4O18A 3P5ZA 5C54A 2EG8A 2XGBA 1EX5A 4IIGA 4RNJA 4XX6A 3QBUA 3NAVA 3EDKA 2CZ5A 2C6QA 1JG9A 4I7WA 1LBFA 3PP7A 4YU1A 5D2WA 1G67A 3M0HA 3MUZ1 4Q4MA 2YW3A 1MW0A 2QV4A 3VNMA 3TYEA 5C0QA 1LRTA 5CBJA 1ZL1A 3RF9A 1KQZA 2OX4A 1OX5A 3LGEA 2ONEA 3GC2A 3UR7A 3VX1A 2ZZ4A 3EXRA 3PG8A 3BW2A 1X97A 3GX9A 1BEUA 3U7VA 1YYAA 2WVTA 4CQAA 3H7VA 2VQUA 4W85A 3C6CA 3DZ1A 3CAWA 4DBDA 2YA2A 3LHWA 2XJ7A 4JOMA 3DHPA 4C6MA 1R5YA 1XD1A 1TPB1 4ATDA 3VOGA 4C6CA 4WJ8A 4F0HA 4H8HA 4LJ3A 3MHFA 1FWBC 4QSHA 3U0HA 1ITUA 2CXEA 1DE6A 4NZJA 4QG8A 1OINA 1AA1B 4X22A 5EY5A 1X96A 2FTPA 3V0TA 3W7GA 3B04A 1JPDX 2D69A 4R33A 4WX2A 4GVGA 4O1AA 1J0YA 4H9TA 5DRCA 4BJHA 4C6JA 3EKZA 4MGGA 2V63A 3TFCA 1Q7ZA 3I7RA 1AD4A 4KT2A 3ISIX 4QEEA 2GLKA 3G1XA 1ZU8A 4Z2IA 4NL1A 1REQB 4OV9A 3GHSA 3B97A 2Y85A 4HYVA 4MADA 1HJWA 2WZEA 3V7PA 4MOZA 3ARUA 2V3GA 3AXKA 3PUOA 2OELA 5L6UA 4ZO7A 1T8QA 2X1IA 3V5FA 1ZRQA 3VZZA 4FEZA 4DPQA 1CTNA 2ZDRA 4ZENA 3WQFA 2NSOA 3TN4A 1KLYA 5LA0A 5LHFA 4LVAA 2QCMA 3ZJ6A 3T4WA 3AMGA 4WZHA 3LRKA 4K8HA 3RGTA 3PWGA 3U5YA 2R14A 2CLIA 5A95A 1CW2A 1CENA 4AWEA 1R46A 1FWFC 2WHKA 1FVPA 1TV8A 4AIBA 3JRKA 4LGXA 2QCNA 2V5LA 4NZ4A 3RM9A 4LB3A 3ATYA 4IIFA 3NSNA 3N1AA 4JHMA 2HNEA 5DFAA 1HJSA 4JTGA 3W07A 1R2TA 1QTWA 3EKGA 3N18A 1VRXA 1NP2A 3O7UA 2VCAA 2Z1XA 3HJEA 1XM3A 3Q2DA 4UCFA 4TX9A 1AW1A 5H2ZA 4Q32A 3WK3A 3LXBA 1OZQA 1BVWA 1J01A 1I2QA 3EWBX 5DT5A 4W8LA 1JXJA 3JZUA 4Y6GA 1GTEA 4OZOA 2Z7KA 1LUCB 4CNSA 5I3JA 4HSHA 4PCFA 4B5XA 4H8UA 5IOBA 4P7RA 2ISFA 1W54A 5EU9A 1LJYA 1P0BA 1YHTA 3FK4A 3FLUA 1MUCA 3OLEA 1DWAM 3DFYA 3UXAA 4ML4A 3L0NA 1A0CA 3WQDA 4DXKA 1QI3A 1E6PA 1EF2A 2INZA 4L80A 3V4BA 3LRMA 3CUJA 3K4DA 3ZM8A 3HZ3A 1SO5A 1K7FA 5CSYA 1LG1A 2HJPA 4C6LA 3CB3A 1N7KA 2ZZ6A 3PM6A 2JEPA 1JQVA 1VCVA 3I7QA 1Q6QA 3GWQA 1GTHA 2HQAA 4B3LA 5AECA 5I24A 1PX4A 1IEQA 3SEPA 2ACRA 4QAIA 2VT0A 2GOUA 1TQJA 2QCGA 3CHDA 3L5LA 3CUGA 3L65A 2E4TA 2RH9A 3H2MA 2X2YA 3BGJA 2FMOA 3NPUA 2VTFA 2TRSA 1QW7A 3AALA 3GYCA 4A3YA 4FS9A 4AD3A 5L9FA 4E2VA 2ZA2A 1EFZA 2WHLA 5IXEA 2VKZG 4I3GA 2YKKA 4H3DA 1W9PA 1RR2A 2G97A 1U5HA 4XIAA 2H8ZA 2BVDA 1NP0A 1H5VA 1GK8A 2CWNA 1IF2A 1EDQA 4JZ5A 1ONXA 1EBHA 1FH9A 4UQ9A 1EJXC 4MSSA 1KBLA 3TR2A 1ELSA 3MP4A 1EEXA 2BY1A 3MWAA 3W01A 3HGRA 1UR1A 4ZSTA 3NQFA 4PTXA 4A3HA 1EIXA 4F9DA 4BHYA 3HV9A 3TONA 2PDKA 4CD6A 1PKYA 1HL2A 1O5XA 3DFHA 1IEIA 4R53A 3J7HA 1XLCA 3G5EA 1Q6OA 3EPMA 4EXQA 2QF8A 2CW6A 2YCKX 2J66A 3VKBA 4BF7A 1CX9A 1W1YA 3FVDA 3BAJA 4KWSA 4N4QA 4HHMA 3BG9A 4LANA 1X6UA 3WENA 2J7HA 2WLYA 3TYZA 1HUVA 2PWGA 2VVNA 1E1EA 4GWEA 4Z0JA 2NQJA 2ADAA 2GJLA 3BL3A 3UR8A 4HT3A 1FXQA 4IL2A 2EKCA 5AHIA 1SJBA 3GDMA 5A6TC 3W86A 4WOZA 3QGKC 3QGVA 1FWRA 1X39A 1Q7QA 3M4HA 1YNPA 1Q6GA 9RUBA 1TPEA 2FZBA 1V51A 3AZRA 5ECUA 4HSNA 3SFKA 2EO7A 2C91A 3R12A 5BWFA 2C14A 4DJDC 3QHOA 2W5FA 4PE8A 3T09A 3ELFA 4RDVA 2VMFA 2G37A 3VXGA 4O0ZA 2EKGA 2Y61A 1FTXA 4GYKA 3WEZA 3NTYA 1TJ1A 3UEQA 1JI1A 4WGXA 5C70A 4YVPA 3BH4A 4NJKA 4DWSB 2VGFA 5AYBA 1BFNA 3EEGA 3W7MA 1XLHA 4DJEA 4AWTA 3LHUA 1PVNA 3W38A 4IICA 1KM3A 1J0ZA 1VGAA 3N2MA 3Q94A 4HYWA 5HOSA 3V5OA 1VFHA 1KFEA 4I6VA 1W3IA 1VBUA 4BEQA 4H9ZA 3OYZA 3NSXA 1LUCA 1G4SA 1B31A 1Z44A 4Y9OA 2WSPA 4AVNA 2Q3OA 4J3XA 3W00A 1LLWA 3IJ8A 1SFSA 2W0UA 4QITA 4ZQNA 1RJQA 4QNEA 1YMYA 4ZQPA 3UZJA 3W7IA 7TIMA 3VFCA 4JN7A 3W1NA 3UU0A 3TAOA 1H1YA 4C7DA 3LG3A 4E5TA 3SCVA 1LL7A 1NOUA 2ZZ1A 4YIWA 3AUJA 1NU5A 3VKKA 4DYKA 3MKKA 2CLOA 2EPKX 5DN1A 4NASA 5AYIA 1JCYA 2VX4A 3L2IA 3VC5A 4LALA 2Z7GA 2Y7EA 3E0VA 6TAAA 5D8WA 1TPWA 4DHGA 5D03A 3UR5A 4A8IA 1D3CA 2ZUTA 2FLIA 1W3NA 3E9AA 2WMKA 4FO4A 2PB1A 3K2GA 4HPGA 2WJDA 5CH9A 3I3EA 1W3LA 1MRQA 2GPTA 5FSDC 3HM7A 4WSKA 1EHNA 4PL1A 4QX4A 3GVRA 4HZMA 2POZA 2Z24A 3CK5A 2A7PA 1D7KA 4NAFA 3VK5A 3ARZA 5CKSA 2P0OA 1O66A 2INEA 1E9YB 1KXVA 4WJEA 1EX1A 3G22A 1UW9A 2PDPA 3FAWA 2JGYA 4KFPA 3LS9A 2Y8VA 4INFA 3OLGA 3CL7A 4AHQA 3UNDA 1XW8A 1QASA 3KEHA 1KKRA 1XGZA 1F6YA 4CD5A 1WXZA 1F8IA 4P7OA 3V0UA 4UOQA 2DQWA 4FLSA 2VZVA 1TCMA 2BG5A 1E43A 2XTKA 2E8ZA 3BMXA 4Q4KA 4NAEB 2GQ8A 3L4YA 3GIYA 5T8GA 2WC4A 3PZNA 4E8GA 5TAOA 1E40A 3KBJA 4IXHA 1B5TA 4EXAA 4OGZA 2NLYA 2CLLA 3GH5A 2DZPA 2X30A 2VRKA 5BRPA 4XBKA 2FPTA 4HN4A 1S3HA 2V3DA 1SW3A 3DERA 1KC7A 4AZ5A 2XHYA 2C7FA 3PB2A 1X98A 4RLIA 3W29A 1FWEC 4PTDA 1TX2A 1ZAHA 3T40A 3PPHA 3W7OA 1LTDA 9CGTA 3SGZA 3R25A 5I77A 1XBXA 5HANA 4DB7A 4DWSA 3WNOA 3N2CA 2JKEA 4RZ5A 1EXPA 1DHKA 4QBXA 3F2BA 2XH2A 4HTYA 1B9ZA 1GW9A 3KAOA 3B0PA 3H6OA 5EA9A 2HPMA 4O10A 3U2EA 4LY4A 3I7SA 4P8VA 2X40A 2XM1A 3R10A 4QDPA 3U2OA 1K6WA 4QM1A 2WBGA 4IUOA 3UXDA 1YADA 3SQMA 4DEFA 2J7EA 4O14A 3OU8A 3ES7A 4ZXLA 3WMBA 4LS2A 3LZ5A 1M04A 2BODX 4GIYA 1EO5A 2NW0A 3NJ3A 1DYSA 1WUEA 4XZ9A 2F6XA 1I2OA 3QRHA 1OC7A 2J8GA 1KV5A 4KIRA 1E56A 4CNUA 5A8PA 1A47A 2WANA 1A50A 4HK7A 3BG3A 2Y5SA 1N82A 3PFMA 3UWZA 4LBRA 3WF0A 1FWAC 5ENLA 3VCCA 3VGHA 3ZFHA 4HJWA 3H2NA 4Z42C 4R5EA 4HIBA 1XRSA 3UD6A 1VCGA 1E15A 4ZFCA 1BG9A 5FF3A 3LCWA 4ASTA 4GVHA 4M51A 4U2ZA 4DJFD 3PY2A 4PUKA 1HJUA 7TAAA 2I5QA 1E71M 3CYJA 5H8UA 4UTWA 5CGTA 3PZUA 1GT8A 2DSZA 1EA0A 5CBIA 1WXJA 4P7QA 3WLHA 2YB4A 1YNYA 4IPPA 3BAWA 4PTVA 1W2VA 3A23A 3I68A 5DBUA 1VR6A 4LCSA 8A3HA 3WDIA 1AQHA 3F4DA 2VEKA 3GU2A 1IXOA 1UJQA 4XBJA 3ZT6A 3AAMA 2WNWA 3LI0A 4S3GA 4YMZA 1TZZA 3G1RA 3KRUA 1ZGDA 2HBVA 2PTZA 1F3WA 3OJGA 2W66A 4EK7A 1FX6A 1BRLB 3HN3A 4DUVA 4H9VA 4XK2A 5KSWA 2ZTKA 4M29A 2OCZA 3CB8A 4UTWC 4RW5A 4TR9A 1FXPA 3M6DA 2I14A 5I23A 1HO1A 4MVAA 2DEPA 4JGDA 4XISA 1FWHC 3KP0A 2CIPA 2E8YA 5JUVA 4LCRA 5CPTA 4JDYA 1FDZA 1M7OA 3NXFA 2QJIA 5BCAA 4FIRA 1US3A 1XRFA 2OU4A 3LLDA 4PB3A 4MWAC 3SN4A 3PR2A 3VAVA 3TMQA 2VNCA 1PHWA 2V67A 4IMCA 3O0FA 3W6LA 4X2PA 2OLHA 2BFGA 4QCEA 3VDBA 3DFQA 5JH2A 1G7VA 1YRRA 3H2AA 3TROA 3AS0A 2C0HA 3QYSA 4JHZA 3G0UA 1JEZA 3M7WA 1S46A 3NL6A 4G2DA 4IHCA 3U5UA 4GI6A 1IZKA 1IT0A 2RGMA 4NZ5A 4HA3A 1GQKA 2E6DA 4S3EA 1AJ2A 2NXGA 4AX7A 4TX6A 1DTUA 4TXEA 4MKNA 5DX7A 4QE5A 8XIMA 5D05A 1L6GA 4QFUA 1EGZA 3LUTA 3TYCA 2VEPA 1KLZA 3QY7A 4JTJA 5DLCA 3EPOA 4QROA 1RK6A 3U7BA 3K8LA 4NHVA 1V0LA 2PDJA 1PIGA 1HL8A 5IFTA 4JHOA 1DVJA 2NV9A 3TOYA 4AD0A 1O12A 1PZ3A 2W63A 3RO6A 5FJUA 1KCXA 4NI3A 4QJ4B 1TV7A 2R91A 3WUGA 4WY0B 1WO2A 2ANUA 1UBPC 1UH4A 4S3BA 3UCCA 2YZRA 3A21A 3LEPA 1KM0A 1KFLA 1G9HA 2J7CA 2P88A 3CJPA 3GSMA 4CD7A 3NQBA 4GKLA 1YPXA 4F4RA 2E09A 2PS2A 4EKJA 2Z26A 1FWIC 1JRBA 1P0EA 2DQXA 2YBTA 3PJWA 4UOJA 4O54A 5ABHA 4PMXA 3GR8A 5CZ0A 4XD4A 2VOMA 1NY1A 1RHCA 2GUBA 1ODZA 3GLCA 3HG3A 4KMQA 4F2TA 3M46A 2PWUA 1FFQA 4LVDA 4IPJA 4L9XA 7REQB 5LYRA 1WZKA 4ZGYA 2EXOA 1SW0A 4Q8NA 1KRBC 1R8LA 3SBFA 4ICNA 4R3UA 2PRHA 2OVLA 3LTPA 4QE4A 4CKQA 4HK6A 4Q4OA 2VQTA 3HPXA 1M1BA 3NG3A 2FDMA 1EC7A 5CJNA 1UR9A 3PS7A 1RP9A 2A3LA 4FNTA 1OB0A 4FR6A 3GXDA 2J62A 3M5XA 5BXRA 1F4AA 8XIAA 4KPLA 4H41A 4Z1CA 1ME8A 4R7WA 4J3TA 5EKYA 2DIJA 3L67A 5FOOA 3IIPA 3WFAA 4GOAA 3W72A 4QQUA 1T7LA 3K46A 1UZHA 5CC7A 3ARQA 3O1NA 5C2XA 4TMBA 3SCNA 4HNUA 5HK4A 3C8FA 2WLZA 2X41A 3NYDA 1SO6A 3VIPA 1UPMB 4AC7C 1ZENA 3L23A 4MYAA 4QNWA 2ZUMA 1R3TA 1EEPA 4RDYA 3OVRA 1R85A 4KW2A 1ONWA 1W9XA 5AC4A 1BXCA 1GVEA 4X0NA 3STFA 1B4EA 1I6NA 5HUOA 3ITCA 4P5UA 3G0SA 3F4CA 2V81A 3GFYA 4GUGA 2J9YA 4GZJA 4F0RA 3H7RA 2W79A 2X1UA 2FFIA 2OODA 4QJ1A 2RDTA 1MYRA 2UY3A 3R7MA 1XUZA 2J47A 1UROA 2O7SA 2AL2B 3TCEA 3TN3A 4DQWA 1NF0A 2D1ZA 4DAIA 3FXYA 4DAFA 1W2PA 1BXBA 4JNMA 4MIMA 3SSJA 4FALA 3WLOA 3W7HA 1ZPTA 2QF7A 2GUUA 1GCYA 1P48A 3P80A 1TV4A 4ORIA 1R0MA 1UOKA 5H8PA 3ANUA 2EJ1A 4KWWA 3RFAA 4R7JA 4ROPA 4GPNA 4E6MA 4Z0SA 1DTNA 1QFEA 4H9UA 1BKSA 1Z42A 5D9PA 3WJWA 1XLMA 4RE0A 5F4SA 1GVOA 5GJMA 3AISA 2DSWA 2CEQA 1XLKA 3BW3A 3NUKA 3SUSA 5JBFA 1TWSA 1SPQA 1FHVA 3SY1A 3G1VA 3NL2A 4JXCA 3BJTA 4IX2A 3VIOA 2FGLA 4LXFA 3BQ5A 4O53A 5HNRA 4PMVA 1I60A 2BOGX 5M03A 1UZDA 3R6IA 3GIQA 2O55A 3P6LA 2E25A 3D3AA 1OFAA 1FHLA 2Q8ZA 1JZ7A 2HNHA 3VUPA 2F2HA 4ZQRA 1B2YA 3ZO9A 3FJ6A 1OYCA 2DZBA 3T78A 2R1KA 1GVFA 3BURA 1TV5A 3MBFA 4J4KA 3M1ZA 3IVSA 4PH6A 1BHGA 4PMOA 3BK0A 7CGTA 3O2LA 3STEA 1CGUA 4O52A 4FNQA 1QR7A 3KX6A 1JCNA 1L0PA 5LXEA 3LCXA 4UQAA 1XWYA 2J25A 3TOPA 4JKMA 2WYSA 3CT2A 3OQEA 2QJGA 3BCDA 2X09A 2OTDA 2ZE0A 3AROA 3QXBA 4Q33A 4U33A 5C9UA 2OPJA 3L4TA 4DO6A 3ZT5A 1ALDA 3JZEA 2YOCA 3WUBA 4IF2A 2V2HA 1WKEA 4PRTA 4C60A 3W1LA 3AS2A 4NT0A 1G4EA 1F9CA 2OGYA 1XG3A 3KL5A 4NY2A 1Z9AA 1CXIA 3E1F1 5HQLA 3CZ8A 1I2RA 2NVAA 1B3VA 4X63A 1UKTA 4IWWA 1XYAA 1ZJIA 3QR1A 1FA2A 1JUKA 4HCDA 2BLEA 5BOEA 3UETA 1JDAA 1Q6LA 3TJXA 3ZLGA 3R4IA 4XKYA 3QQ0A 4QGCA 1DJWA 2ASHA 4GMEA 3QSRA 1I2NA 1J5TA 3UY7A 3SQSA 2C16A 2ZFAA 3WZ0E 1VH7A 4D6JA 1K03A 2AKZA 3WF2A 3NOYA 4W7WA 2IQTA 3CEPA 1VC4A 3TA9A 4R85A 5LGZA 2PTDA 3QSTA 3RYSA 3R43A 3SJNA 1AH4A 5C7VA 4ZB0A 3KBWA 5IBXA 4LUTB 4NQ1A 1OCQA 4GG9A 2AGKA 4CQ9A 2OLSA 1M01A 2JIEA 4XTIA 1TMHA 3UJ2A 2E5BA 4UTIA 3WK2A 4L6HA 3W7LA 1XFCA 1HZYA 2J7GA 2NUXA 2R6OA 2Z2BA 4HJFA 3UESA 5F1VA 5CCZA 5U7SA 3VOHA 1J5SA 2WKGA 2YLLA 4BWLC 3DIPA 3EWZA 1NDVA 2NXHA 1OJXA 3ABXA 4HTBA 4S39A 4B5VA 2OKOA 4I9JA 3W22A 3I6RA 4KF1A 1DWHM 3OA3A 1IHIA 4MY9A 2O4MA 4A8LA 1DJNA 2QCCA 1Q8JA 2UY2A 3SAZA 2HRWA 3GDKA 3ITTA 4XZHA 3GDRA 5DEZA 1V7AA 3L0GA 1FP9A 3B8DA 2QGHA 1PV8A 3GRIA 3NQ8A 3MUY1 4H6QA 4H83A 3ERPA 2EPMX 1LL4A 4YYFA 4TMCA 3NGFA 4JCLA 1WZMA 2X8RA 2QUTA 3BAXA 1N8FA 1YNQA 4O1CA 1PO9A 2DT1A 3WNKA 5LKYA 2PUZA 1EJWC 3C4UA 2PDFA 1HT6A 3AXXA 5EMJA 3W2NA 2OX1A 1WDRA 3ONBA 4XD5A 1HVXA 3XINA 3RU8X 4ES4A 2XZ7A 3KHDA 3MTWA 2VEGA 3ZXWA 1QMLA 4YJ5A 4MYXA 5FL0A 4DIAA 1V77A 4C7FA 1J79A 1W3JA 1X1ZA 3FJLA 3HPZA 1FQ0A 6PTDA 2GJRA 3VGFA 3WK1A 1XISA 4F3HA 4XVDA 4GYPA 4DELA 2ODOA 3VABA 1PE1A 3LNPA 2XVNA 1I0BA 3C52A 4U3AA 5F2LA 3SCUA 2C0AA 2JEQA 2XINA 3MI3A 1EZ2A 1E73M 1F61A 1OT2A 5AFDA 3BC9A 1XIMA 2VZSA 2EPOA 4UTKA 3FVMA 3RCNA 5ECVA 1Z8AA 4K38A 3TN5A 2LLEA 1BQGA 2QDEA 1XDLA 3WD4A 3N3TA 3EWYA 4GUJA 1K9DA 3B9DA 2DT2A 1X8CA 3GE7A 1NH6A 2EEXA 1IIGA 4H01A 4O4VA 2WHMA 1DXEA 3UA4A 2DORA 3SFWA 1UJPA 3CHCA 2GGJA 4NRRA 3WLRA 1YBQA 3S1XA 2XVKA 5XINA 4RDZA 2H90A 2Q6ZA 2A3AA 3OZPA 1LYXA 3UWVA 3ITXA 1MDRA 7PTDA 1TZ7A 2PLJA 4AVOA 2HK0A 3LPFA 2DZUA 1SFTA 3HMCA 2CLPA 1X6LA 3MU7A 1JCJA 4YTSA 3A4AA 5C5YA 3HBLA 2PC8A 3NSMA 1UP0A 5D4YA 1LORA 4JIQA 3C0JA 4ICMA 3TQPA 4IT1A 3WL1A 3M0YA 3NIYA 2VUNA 4H7ZA 3R13A 4GRSA 3LENA 3W7QA 4ZZ9A 4NJGA 4UFKA 3MS8A 3B40A 3ZMRA 3QM3A 2GL5A 2QGYA 4LEFA 4YWSA 1OFQA 5C9WA 1CDGA 3BOFA 4IP7A 1F74A 5KETA 1RCQA 2G3FA 3CU2A 4PUNA 1ZP3A 1R3VA 4PUMA 3WH7A 3SURA 1NQKA 3DFOA 4M5PA 3GKFA 5F7UA 1TTPA 3WBAA 2VEMA 3VD5A 1OEPA 4V33A 2DZSA 1EJSC 3EZ4A 3KE0A 3SCTA 4HNVA 1Y0EA 2FPYA 1JD7A 1XKJA 3PHAA 4IP4A 4NG3A 2ZUVA 3TA6A 4L7ZA 3O6CA 4YHGA 2WNQA 3EGJA 4C7GA 1WXYA 4L56A 3C0LA 4E3VA 1MDLA 1J11A 4AHOA 4CGTA 4OVXA 4LCQA 3MY9A 3PTQA 3IK2A 1OADA 3S1WA 3LU2A 1V0KA 3OHMB 5BOOA 2OLAA 3ZVHB 5G1TA 3SW6A 3QHNA 3QN3A 4C1NA 4JQAA 1GEHA 1BGAA 1GVYA 3D3FA 3E74A 2DUAA 3IGUA 1TR1A 1VEMA 2F84A 2JKPA 3WQCA 2DV0A 2OSXA 1VP5A 4CNPA 3M47A 1IIHA 4A3UA 2XSAA 5EFDA 3U9IA 4DZHA 4Y90A 1P6BA 3LMYA 2BASA 5D30A 1GQIA 5TD4A 4GACA 2X16A 4LUIA 3FGCA 2V5KA 4M6PA 3N6JA 2JQXA 3DG3A 3AC0A 2E5CA 4X61A 3QLDA 3S5YA 3NCOA 3O16A 3HB9A 1AQMA 1H11A 4LRTA 4C6OA 2WM1A 2PLCA 1EOKA 2ZIDA 1ONRA 1ZBWA 3W81A 2X42A 5EMLA 4HBKA 4JTEA 3UJSA 3W2UA 4IMFA 2FZ8A 5AC5A 1A4MA 4HP5A 1CGXA 4KWOA 2J74A 1F6PA 3UNTA 1K8XA 4DUXA 3RIKA 4NX0A 3H4XA 1A3WA 1UD8A 2P5NA 4HNLA 2ZICA 4C5YA 3TR9A 3E5PA 3M0ZA 1I1XA 4YHEA 1M3UA 4LBSA 1M7PA 3I4KA 3TVAA 4MG4A 3RJYA 4H7CA 1A3XA 4GBUA 4IJCA 2Q8XA 1OF8A 2P0IA 1XICA 1DL3A 2YL9A 1ZBVA 2VX5A 4S2CA 5F4XA 1KXQA 4TX8A 1ISXA 1MI3A 3GHTA 4UZSA 2QMJA 4B9YA 1OWQA 1L6FA 3CLMA 4FLRA 3RCYA 1QI2A 1DJIA 2VEIA 4DLMA 3CUXA 1K8CA 3LTSA 2VUYA 1TPUA 3IJIA 4MLRA 2VR2A 3H23A 3TQKA 1P4CA 4FXSA 2J79A 4LWWA 1OX4A 4IISA 4PBFA 2VC6A 1W1IE 4AIUA 1YDNA 3WH5A 2TSYA 1I45A 5B7ZA 3MUXA 4MWAB 3VX0A 3A5FA 1KV8A 1QWGA 3GTXA 3VNIA 4H6KA 1CLVA 1XBYA 3UPWA 2Q8LA 4MDOA 4YLWA 1A80A 2IKGA 2WBKA 4PCNA 4JTQA 3CWHA 4ZMGA 1XPYA 1MRAA 1XGDA 1JDFA 4UFIA 1E9IA 3BLLA 3PSWA 3CV1A 1XPGA 2H8XA 5A6KA 2HS6A 3KUMA 3E0LA 3W7EA 1BLIA 1WA3A 4RL3A 1BTMA 1C3FA 1E1FA 4AU0A 2HS8A 4P61A 1U1UA 2PF0A 4FLOA 4FIQA 3C2OA 4JTIA 2WZTA 4MB1A 3UW6A 4H1ZA 1KR1A 1W1B1 4KS0A 3PZQA 3RAOA 3C2FA 3B8WA 1Q4NX 3EA1A 2WMGA 3M0IA 3CPUA 3UPBA 3DGBA 4KFOA 1TTIA 2VXNA 3AIUA 4JIRA 3H2CA 1KO0A 2ZTJA 4HNNA 4UZUA 2E7FA 1JYXA 2NQHA 2PRMA 3W74A 4QE1A 5BW6A 1OCJA 3OODA 5K9CA 4CD8A 3TLQA 1P7TB 1K4GA 3FGCB 1XXXA 4CU7A 1SZGA 4D8AA 5HWMA 3RR1A 3L5MA 4K39A 2SFPA 4Y8FA 2W62A 2E1DA 1TWWA 4AY7A 3P61A 5LNVA 1XINA 1UZ4A 2J8FA 3EWCA 3QGAC 3LV5A 3RDKA 1XIJA 4DM2A 3B3DA 1J9YA 2PP3A 3WD1A 4HN8A 1S1RA 1Q3NA 2NX3A 3BAKA 3CV6A 3KS6A 3W26A 1ODUA 1QI4A 4A22A 4LV4A 4B3KA 1WAWA 4I7VA 1TUFA 3PG9A 1I75A 2D3LA 3APGA 3UCQA 4QR6A 1XUUA 1W8SA 5ABFB 3H7UA 2PAJA 3D6NA 3QMTA 3GTHA 2WJFA 4DUOA 4Z2HA 2OWCA 5I3DA 3WFZA 4V2XA 1JRCA 1D9EA 2ACSA