3LTSA

Crystal structure of the mutant v182a,i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAAIVGRSIYLADNPAAAAAGIIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 81
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltsA00
1O95A 4JY8A 4O1AA 5I3JA 1YTDA 2NZLA 2Y7GA 1TQXA 1LYXA 2V5LA 3O16A 4ONVA 1B4EA 3HG4A 5DXYA 4UMBA 5LKYA 4JTLA 2QCLA 2OCZA 3A5VA 2QCEA 3M5XA 3S1VA 1OX4A 1N55A 5HWJA 5I3IA 4WY0B 4LVBA 1UASA 3NEVA 4KWVA 1KFLA 3FJ6A 1WBJA 5BNKA 4QJ1A 2EF9A 5FI8A 4JDBA 5D02A 4CLMA 1OFPA 4Y96A 1Z44A 3TK7A 1LCOA 2B7PA 4JTUA 3WK0A 2W79A 3L65A 4L4LA 1EWEA 1IGSA 4GUFA 1XBYA 3W1AA 4LV9A 3P60A 2Y88A 1UB3A 1XKYA 3UWVA 5DLCA 3DKLA 4X9SA 2J9ZA 4CCEA 4K36A 5FF4A 1QMLA 4UTLA 3FS2A 4I9AA 1TPB1 3G24A 4MYAA 4ICNA 3G3MA 3TQ0A 1MSSA 2WOQA 5CKSA 1TTIA 3DFQA 3UWQA 1WX0A 2A7RA 3M5YA 3BG5A 4C1KA 3KVLA 3R12A 3DU0A 3TV8A 4S2BA 2TPSA 1G7UA 4HNNA 2CLMA 4E2DA 3VFLA 3PUEA 4QQ3A 2XFWA 1M5WA 5DY3A 3RLUA 4FB7A 4H3DA 5KZEA 3KVKA 1TTJA 2F7FA 1GVQA 1TQJA 3NGJA 3EWXA 4G1KA 2C0AA 3C2OA 3S0CA 3TDFA 1I45A 4RV8A 5BOOA 1OFQA 1I2OA 5U4NA 4BFAA 1QPOA 5HNRA 3DBPA 2H3DA 5G1YA 1U5JA 1THFD 3G8EA 3G8RA 3STGA 2BZNA 3GAKA 2P10A 2V9DA 2YSWA 2GQ8A 4Z1AA 1LRNA 1RPXA 1OK4A 4Y8FA 3NYZA 4MJMA 3TW7A 1W5OA 5D09A 4M6VA 3LRMA 1FCVA 4AXKA 1NAL1 3PULA 1KM3A 3W1NA 2E6DA 2QJHA 1J2WA 3W7GA 4JYEA 3ABQA 1H7XA 3CEPA 4OGZA 3VI2A 3KVJA 4IWWA 3UPBA 1YLVA 3TR2A 3W87A 2VEMA 5TBOA 3TROA 3A21A 3P5YA 3FYPA 3CQ0A 1LRQA 3L9CA 3N73A 1E51A 1S3HA 1EEPA 3MYPA 3N34A 4XTDA 1SR9A 5D2WA 1ZAIA 1Z41A 4UTHA 3EWWA 2F84A 1O5KA 2CZFA 1WBHA 1W1ZA 5LNVA 1NF0A 1ICQA 1KM5A 3P67A 3L5LA 1TPUA 1XI3A 1FWSA 3DGRA 3STEA 1KBIA 4NNBA 1SUXA 4MFDA 5HR7A 3PBVA 2QCGA 2H8XA 2VFGA 3A23A 3M16A 1VPXA 3M7WA 2BWGA 2WV8A 1K8XA 2Y7DA 2EGZA 3HOJA 3GKFA 3TW6A 1TB3A 1OFEA 1A5SA 1UUOA 3NQFA 3W7HA 1M7PA 4JICA 3M5ZA 3L21A 2E5DA 3RLVA 3LRKA 4UFKA 4DQWA 1BTMA 5AC7A 2A6NA 3TJXA 4O4WA 2VELA 3WFAA 5CPLA 4ZMGA 5MHBA 5HQEA 2C6QA 5EL1A 3B4UA 4WX2A 5EA9A 3Q94A 1M6JA 3SJ3A 2A6LA 3W2LA 4AF0A 3P5ZA 3LLFA 5J5DA 1BKSA 4IGHA 4IPJA 1UCWA 1WV2A 1JR1A 3M5VA 3PSVA 3L68A 3W83A 1QPRA 5F4WA 3HPXA 2YGYA 1U83A 5G2HA 5J5RA 5CSRA 3VCRA 3LTSA 1H7WA 1XBVA 4X22A 3GXPA 3KOFA 2GJNA 3W72A 1JULA 1P0KA 3GLCA 3M41A 1MO0A 1QDSA 3F03K 4WQ6A 2FDSA 1EIXA 1JRCA 2RFGA 1HO4A 1KTNA 5DCBA 3PS7A 4GBUA 3V1PA 4D2JA 3PG9A 3BO9A 5AC8A 1QOQA 1UUMA 4IX0A 1W0MA 4RCXA 1GYNA 2VFDA 1MZHA 2QCNA 3OIXA 4UFMA 1Q3NA 1N8FA 4Z1CA 3P7YA 3E12A 2DU2A 2QKFA 1LP6A 2OJPA 3O05A 5AB3A 3GIYA 3EX2A 3P62A 1LOQA 4DO5A 3BW4A 3VNDA 1YADA 3ZR4A 3GR7A 4HSNA 1OYCA 2Y6ZA 3IIXA 1OG0A 1TPDA 3L0KA 4MPQA 1G4PA 1WOAA 4AF0B 3NQMA 6ALDA 6TIMA 4WXYA 5F2IA 3UY8A 1OFRA 1FBAA 4WY0F 2OT1A 5KSWA 5IBXA 5C5YA 5HINA 3HMJG 1RVGA 1A5BA 1VLWA 2I9EA 5D05A 2Z6IA 4GXMA 1H62A 3GDKA 4FX7A 4ML9A 3NL2A 1FXPA 2YYTA 2H3BA 1UJPA 3CHVA 4DELA 3HF3A 1PIIA 3M0ZA 2V30A 3W7RA 4JYDA 4LT9A 5F4XA 5L6UA 4J9JA 5ABTA 3VKJA 2FPYA 3QM3A 3W2JA 1W3NA 3DH7A 4LOCA 2C15A 3EWBX 2ZRYA 4BR1A 3W6YA 3WK2A 5G4WA 3A22A 2TYSA 4Y6GA 4Z1DA 4FXSA 3NQGA 3GNDA 3FIGA 4YXGA 5CZ0A 3LM7A 2FTPA 2A0NA 1TRIA 4BI5A 5AYYA 3T7VA 3I6RA 1IF2A 3W2MA 3I68A 1XCFA 4QIUA 3PAJA 1QNVA 4MVAA 3DAQA 2QAFA 3NVTA 3AJXA 2Y63A 4ZZ9A 3WJSA 3P61A 1LTDA 4AWUA 5DBTA 4Z1BA 5EYWA 2B0MA 4Z0SA 2OMAA 1WYIA 3W7NA 4NZFA 1HFBA 3LCFA 4QM1A 3SGUA 5A5WA 3C2FA 1OFOA 5HUPA 1QO5A 1LBFA 4BI7A 1T99A 1VRDA 4UTTC 5HWNA 3QPZA 5K4ZA 3HGRA 3GNNA 1FXQA 2BXVA 4NJKA 2E6FA 3NPWA 3PR2A 4LS1A 2ZDRA 2ZZ6A 4A29A 2KZHA 3LBMA 3C61A 3NQ2A 4MY8A 1H60A 5TQLA 5K9CA 4ZL1A 3FKRA 4ZVJA 2GQ9A 2FB2A 4YCPA 3C4UA 4LC8A 3B03A 1F6KA 4MJZA 3TXZA 3N14A 3NQ6A 1OX5A 3EXTA 4WY0A 4PCFA 4UC5A 1SZFA 3LOTA 4O57A 2WNNA 1L6YA 2ZZ2A 4W9TA 2FFCA 1WXJA 1VS1A 1SO5A 4M7SA 1R2TA 3LB0A 1P4CA 3W7DA 2ZRZA 2LLEA 3LHYA 1TV8A 3PF3A 3QFEA 5I3KA 4JGDA 2P0OA 2CWNA 3EB2A 3L2IA 5FESA 3EWUA 3HG2A 1KFKA 1VCGA 4IX2A 2CLKA 3LTPA 3K30A 4LV4A 1JCJA 4AH7A 4R34A 2NUYA 1G4EA 2YYUA 1FUYA 4K8EA 2X1RA 3PBUA 1AMKA 3FEMA 3W7OA 3UZJA 3SECA 3WK3A 4JXCA 5C2XA 3PG8A 3SIZA 3W7KA 3RFAA 4NNCA 4XWUA 2ZA1A 3PM6A 3FFSA 4BWLA 1EA0A 5EMUA 3HQ1A 4JYFA 1TIMA 4LS0A 1J4EA 3DFSA 4QSHA 1ICSA 5A8GA 3EEGA 1CI1A 3HGJA 4Q32A 2BTMA 4YCOA 2Y85A 3OBKA 4MZYA 2QUTA 1FDZA 4LWWA 3W2NA 3QF0A 4XKYA 4CCCA 4GNJA 4POCA 3ZFHA 3IGUA 5FEZA 2V82A 4UTWC 4RZ6A 1B4KA 3NOEA 1M7OA 2A21A 5LNWA 4LTSA 3LBCA 3W1RA 3W88A 5AYXA 4PL1A 4IMFA 2ISWA 1ME7A 2HSAA 2V81A 3ATZA 2BX7A 1Q6QA 1TPFA 1ZFJA 4IXHA 3UY7A 3ZWTA 1RZMA 1JCMP 3OEXA 3UWYA 2ZZ5A 1XUZA 2V5BA 1ZNNA 3B05A 2EHHA 1SO6A 5CPOA 3L5AA 3SR7A 3KRSA 2JBMA 3NO5A 1D3HA 4GWEA 5AOUA 4C1LA 4FO4A 1L9WA 3L0NA 5D38A 3LX9A 3WJXA 1GYLA 2QAPA 1A53A 5G2IA 5DY2A 1GPWA 4HNUA 5KITA 5L9FA 2J9XA 1SPQA 4HSOA 1O5XA 4IJBA 3S5YA 2FPTA 4FX8A 1AW1A 5FEXA 1R2SA 2G5WA 3OHIA 3W07A 3O6CA 1AW2A 4AWSA 3DHDA 3TIMA 4O8RA 2EPHA 3IRDA 3GK0A 4PH6A 1TPWA 3TU9A 4ADTA 1KA9F 2W6RA 2E6AA 3P81A 4A2SA 4UTJA 3ABOA 3W7MA 3NQ7A 1SO4A 4IMEA 1TPH1 2YFNA 2V2DA 1B9BA 2Y70A 3S1UA 4NZJA 3W7IA 1AL7A 3UXDA 3PY2A 1XDMA 4GFSA 4TMBA 1KM0A 4JTTA 4WOQA 5I3FA 5EPDA 1H7RA 5T26A 1ML1A 3QW3A 1DORA 2DJLA 4ZQRA 3R89A 3O6DA 3CM4A 3UZ5A 3ANYA 3HGSA 4O1BA 2I1OA 4AHPA 1FCQA 2YXGA 1Z48A 2WSYA 3M6YA 4TIMA 1XDLA 2QJGA 3LRLA 1VGAA 3CIWA 3QYQA 3G22A 3LERA 3FOKA 1FWTA 1QWGA 4O12A 5AYZA 4HHPA 4JX5A 3Q37A 5E93A 2ABBA 1VYPX 4RXFA 2Y7EA 3TJLA 4UFIA 5HR6A 3TCEA 1QPNA 4O14A 1GG0A 2A85A 1KLZA 2VFFA 4ZQCA 3DXIA 4EIVA 1XUUA 3IGSA 1RQHA 1FDJA 3LHUA 3PC0A 3NQAA 3VE9A 4RR4A 2O7QA 4HNVA 2ABAA 3O63A 2NV1A 3SGZA 4DO6A 1H7NA 2GOUA 2A4AA 3G1SA 3WJWA 3CLMA 2WKJA 3KHJA 2VFIA 2HS6A 5AHIA 2AAMA 4WD0A 3FJLA 5CSSA 2VENA 1PVNA 1F73A 2CW6A 3FYOA 1K7EA 3P84A 5F4SA 5FF7A 5AHLA 4OV4A 4CNPA 5AHNA 3C0JA 4GUGA 4NJIA 3QRHA 3QJAA 4NXKA 3DHFA 3N2XA 5HUOA 2VXNA 1OHLA 3HG3A 2UV8G 3SI9A 1S5WA 2WSRA 1SSDA 1P1XA 2C16A 1IXQA 3W70A 1TV5A 4JR5A 3DZ1A 2ZBTA 1SFJA 3UQNA 4ORMA 3U6WA 1ZJIA 3WJYA 4NJHA 3BPWA 5D04C 5D37A 1EP1A 3M9YA 4ZQOA 4EOUA 3NA8A 1C8VA 1KV8A 4K7VA 3M44A 5E1QA 2H6RA 3TH6A 1B3OA 1TYGA 2IQTA 1F05A 3GXNA 3G3DA 4DBDA 4HPXA 3WK1A 1GZGA 4I7UA 4Y9AA 1W5PA 4KFPA 3NR0A 4YMZA 2NXIA 3A9IA 4N9DA 5HJLA 3DFOA 3S42A 4AHOA 1JCLA 3O6YX 5F2MA 3I7RA 1I2PA 5K3VA 3L0GA 1H1ZA 1L2UA 1H50A 4M6PA 2E77A 4HT3A 2R8WA 2ZQ0A 3LCLA 2NWSA 3B04A 4UNKA 1G69A 2PURA 3TQKA 1TJRA 2ZA3A 4HKPA 2G96A 4NJGA 3OVPA 3NM1A 3DFPA 4QNEA 4DBEA 3IIVA 2C19A 2OX1A 2W0UA 4CCDA 5IM51 1H7PA 2DORA 3W1UA 4IOTA 3G1XA 2DP3A 3OVRA 4O0ZA 4K6AA 2PRHA 3O06A 3LHZA 2J27A 4M5PA 1OK6A 3BW3A 3G0SA 4FXRA 1H63A 1ZCOA 1P0NA 4ALDA 3G1AA 1GVOA 4RK8A 2VFEA 3QQ0A 4OT7A 2E6YA 3GX9A 2YZRA 3IVTA 1FX6A 3LI1A 2VKZG 3SY5A 4ZQNA 1KLYA 2X1SA 3CIXA 2X1TA 5BMWA 2Y62A 3E02A 4E2BA 4O18A 3CU2A 4GJ1A 3HJZA 1PHQA 3BGJA 2QCHA 1XC4A 3NZRA 4IUOA 4NVTA 1V5XA 1QAPA 1LZOA 4P61A 5AFDA 1OABA 1WAUA 4LVAA 1DV7A 2G95A 2CLEA 3GB6A 3W1XA 2CZ5A 2FPVA 2PRMA 1Q45A 3QH2A 3LDVA 2XN1A 3TSBA 3MYOA 1JCYA 5DBUA 2DZWA 1J5TA 3LCXA 2FQIA 4NXSA 4CNNA 5BW6A 1OFBA 2CU0A 3NQCA 3C3NA 1JRBA 3W23A 1VH7A 4HN4A 3TMLA 1LOLA 2E5CA 3USBA 1SFLA 4AVFA 3M43A 1SZNA 1X1OA 3PBWA 3TAOA 2B7QA 5F1UA 3W7LA 5DN1A 1TTPA 3TA6A 5LHFA 1VYSX 1V7YA 4BK9A 1XXXA 3GDTA 3OA3A 3NNTA 3LHTA 4XBSA 4K37A 4N9CA 4RZ5A 4NU7A 1LBMA 2C3ZA 4LUIA 4M6QA 4Z0JA 4MLRA 1YXDA 5FF0A 4O28A 3HPZA 4A2RA 4TMCA 3W1MA 4IXXA 1VHNA 4N9BA 2I14A 5I3GA 2P1FA 3HPSA 1S5VA 1RV8A 4UFHA 3TXVA 1DVJA 5SWUA 1ME9A 1PL9A 1FWNA 1YTKA 1W5NA 1K7FA 4L4MA 3NG3A 3E9AA 1L6SA 3L66A 4S2CA 3W7CA 5LZLA 4EVZA 4JD4A 4OQVA 1PCWA 1O94A 2DJXA 4LRTA 4ZQPA 2FB3A 1EPXA 2H90A 3EWZA 3N2MA 1GVFA 1YPIA 2ZA2A 3LCGA 5K2ZA 5AHMA 3W3OA 1K7XA 5LNSA 3HGOA 1XM3A 1EUAA 3C6CA 3PUDA 5KTLA 2Y61A 5DELA 3F1QA 1Q6LA 2AQWA 5FF2A 2TMDA 3THQA 4FNPA 4O15A 4AMAA 2X16A 3AO0A 4MFEA 1VYRA 4UCGA 1KM1A 4P2VA 4JTKA 3TAKA 1WOBA 5I3HA 2VC6A 2GVLA 2VEKA 3KX6A 3LCWA 3MI6A 3E0IA 4TU1A 1W3TA 3O07A 4UUIA 1CX9A 3C2EA 4S1FA 5FEWA 3CEUA 2FLIA 3PVFA 1GEQA 1RD5A 1G4TA 4PA8A 3GYEA 1CW2A 1OFAA 1W8SA 2WSQA 4NJJA 4WXZA 3IGXA 4PEKA 2WJZA 3GDRA 4BF9A 2J6XA 3UWUA 5DCEA 3E96A 3NPVA 5H2ZA 1HO1A 1GOXA 3STCA 5F2LA 3W74A 2CFFA 1X7FA 3QQ1A 3UNDA 1D9EA 2HMCA 3SW6A 2QUVA 2GVGA 2ZRVA 2YFOA 3G1DA 5C6MA 3MP5A 3TFXA 1OJXA 4IMCA 1QCWA 3NAVA 2J24A 4FIRA 3W76A 2YW3A 3GZ3A 3W2KA 3BLEA 2WQPA 3THAA 3Q2DA 3L5MA 4ZQMA 1FWWA 3MBFA 3LV6A 1GVSA 2V0TA 2X30A 4OHQA 3W7JA 4A3UA 3TKFA 2HTMA 1YXCA 1GT8A 5BRBA 1YDVA 5F2GA 3RU6A 3V75A 3DI0A 3EX1A 3GAYA 4LY8A 3TC6A 5U7SA 5CGQA 1JQXA 5CZSA 2JGYA 4A21A 2QJIA 3BV4A 5D03A 1ALDA 4HNTA 1DOSA 5D2VA 4X2RA 3GDLA 3M47A 1SQ7A 3HBLA 4O13A 4GE8A 2RDTA 3G1FA 1I2RA 1EX5A 2ISVA 4LC6A 5D2TA 3OG3A 1DBTA 3LCIA 3NPUA 1IIHA 4UR8A 3STFA 3ABRA 3BLFA 4JTJA 2BLEA 4IPIA 2DZPA 1GJPA 1ICPA 4I7WA 4EF8A 1EUNA 2VFHA 5AC6A 4UTTA 1KW1A 2C14A 2CLLA 4LNYA 3TSDA 4Y90A 3W84A 1TV7A 1Y0EA 3O15A 4JTFA 5AHFA 3R2GA 4DPQA 1OFDA 1I8JA 3C2VA 2G97A 4CQ8A 1JVNA 5HMSA 3F4WA 2VEPA 2NUWA 2RH9A 4EWND 1H1YA 3R8RA 4GUIA 3W2UA 2Q8ZA 3G1VA 1ZY9A 2ISSA 5BMXA 2BSLA 1KM4A 3W1QA 1I2QA 4FNTA 1QFEA 4FNQA 4UTMA 1G4SA 1LROA 1H51A 1NEYA 1AG1O 3W73A 3R5EA 1JCXA 3TSMA 3CWOX 1X1ZA 4N6EA 2C18A 3UXAA 1R47A 3P74A 2YX0A 3LTYA 3LHVA 3B0PA 4WZHA 3MP3A 4ADSA 1YTEA 1LOSA 5LNRA 3HB9A 1OF8A 1KTBA 5D32A 3ZWSA 3S1WA 1H7OA 1QPQA 2QCMA 1JCNA 4FX6M 5K4XA 5GVJA 2DZVA 2A1YA 4Q33A 3W75A 1MEHA 1Q6OA 4RJEA 2FJKA 3MI2A 1A5AA 3G1HA 3B0UX 1NFBA 1JJKA 4JDYA 2ZTJA 4N4PA 3T55A 2DZTA 3T78A 2ZCGA 3GKAA 1FCUA 2NUXA 2CZEA 3QMRA 3BARA 3TFCA 4QNWA 2QF7A 1TMHA 3LLDA 3W86A 4JTGA 2YCEA 4I7VA 1LRTA 2YR1A 4MUZA 4FHAA 2EAWA 5C54A 5G1TA 1H61A 2Q8LA 1HUVA 4GUJA 3W1PA 4A22A 4DF2A 1OX4B 4K8HA 3KRUA 1K8ZA 1G7VA 3GXTA 4NQ1A 1XFBA 4MIMA 5D33A 3N9RA 3CC1A 2CLFA 3UD6A 1T8XA 3F4NA 1W5MA 4UNLA 1KFJA 2Y89A 4RZ4A 4XKYB 3U8GA 3SFKA 5CZJA 1TO3A 1WQ5A 2NX9A 1ADOA 4JNMA 2QCFA 3EKZA 4OV9A 3I7QA 3EKLA 1IXPA 2Z6JA 4O54A 1QOPA 3QMSA 2QR6A 3RNDA 2R14A 2E1DA 1YYAA 1K03A 3TE9A 3IEBA 2NLIA 4O19A 1DJNA 3P8IA 4U28A 4UR7A 4N9EA 4DO4A 4NUWA 4PC8A 2ZTKA 1TCDA 1ZHAA 3MHFA 3RK8A 4JY9A 2QCDB 4O17A 3B0VC 1R2RA 1OYAA 2QDGA 3A24A 1QR7A 2VOMA 2OZ0A 1HG3A 5F1VA 4H4IA 3GDMA 3G0UA 1TPVA 1PS9A 3S5NA 5HWMA 1K8YA 2RHGA 1WA3A 4RLIA 4LVGA 4K7YA 3UWZA 1TRDA 2R91A 4O0KA 1GQNA 1SZGA 1VLIA 4OE7A 1FQ0A 1SO3A 4LVFA 2QCCA 1YDOA 3PB2A 5DCDA 2TRSA 1W56A 2DZSA 4WOZA 3S8HA 5CPMA 4LVDA 3W7EA 5D2YA 4GRSA 1JUEA 1W5QA 5LGZA 3HIJA 1N7KA 3B8DA 3LCHA 4IMDA 2GUUA 1TREA 4H6KA 3UYCA 1EWDA 1OYBA 1Q6RA 2WNZA 3NQVA 1SU5A 1DHPA 2V2CA 4UTIA 1ZAHA 3R13A 2NXGA 3MMTA 1VZWA 3NQ8A 4R7JA 3W22A 2GPTA 3O1NA 1HTIA 4OWGA 1T0OA 4MYXA 1SW0A 4TX9A 3QEZA 4TO8A 4FNSA 4UMCA 3ZS4A 3EX3A 2ZRWA 4ADUA 2J88A 4N6FA 2Z0IA 3IV3A 1VCVA 3TX9A 4FIQA 4B5NA 4CQ9A 1ZENA 2A2IA 1YDNA 2FIQA 1ONRA 1TTQA 3KAOA 3UWWA 3LXBA 2A7NA 3MWAA 1EP3A 4MZ1A 4UTWA 1VQTA 1PV8A 2V2HA 2PRLA 3DFTA 4QITA 1ZALA 1R46A 2JGQA 5KZDA 3TUUA 3IIPA 4BWLC 4E38A 1XL9A 3GR8A 1G6CA 2B7OA 4JIPA 4FNUA 2JKPA 3S1XA 1PHWA 3M1ZA 1JUKA 1X6UA 4GUHA 3RF9A 3BLIA 1DKWA 1LLWA 4DPPA 4PTNA 1OX6A 3CWNA 1TJPA 2VEIA 1YPFA 3DENA 3I7SA 4AAJA 3C8FA 3QC3A 1UBSA 1O4UA 4KFNA 1KM6A 1VCFA 2CZDA 3LV5A 2NX1A 1PE1A 1OF6A 1R30A 3ABSA 1LORA 1B57A 1EP2A 1KFBA 2D73A 4O1CA 2NX3A 4UTUA 3N19B 2Z2UA 3NL3A 1SW3A 2R94A 1F74A 4JS3A 3W7PA 4DEFA 5HULA 2ATSA 4AB4A 1VHCA 3BGGA 4JTHA 2WO5A 1S5TA 4CNOA 2GJLA 1G67A 2NWRA 3NL6A 4OU1A 1AK5A 1XBXA 4JN6A 4O1DA 1MEIA 3C52A 4KFOA 1W54A 4UIOA 1GTHA 1OVDA 2ALDA 2B4GA 4M19A 4LRSA 2O7SA 2RDUA 1GG1A 3MHUA 2ZYFA 1ME8A 3MBDA 3QMTA 3S6DA 4O10A 3S5OA 4RXGA 4R33A 4HPJA 2DZUA 2QDHA 4JX6A 5KINA 5E0KA 1WDWA 4KWWA 5D2XA 5H91A 4LUJA 5IBXC 2ZFAA 3D0CA 4UFJA 3EX4A 1FY6A 1F76A 4MZ8A 5EBUA 4MKNA 5LNUA 1NSJA 5FEPA 5CPNA 8TIMA 1TPEA 3ELFA 1A5CA 5TIMA 4R53A 4IQLA 4DF1A 3U2OA 3NQEA 4XQ6A 1HL2A 3MP4A 3H55A 3UPWA 4KKXA 3P82A 3SSJA 3W1TA 3W7QA 3EXRA 3NQDA 2C13A 4XUGA 1T96A 1GVRA 2QCDA 3NPXA 2XN0A 1X8FA 4E0CA 3DI1A 5G2WA 4JEQA 2ZZ3A 3QSRA 4UXDA 1W37A 3W1LA 3ATYA 2JKEA 2ATMA 4QISA 4O52A 3EWYA 2ZZ7A 3VE7A 4HIBA 2NV2A 1MXSA 1RR2A 3IVUA 4LW7A 4JTEA 1JQVA 4N2YA 3O8AA 1ZAJA 4LU0A 1C29A 4PFMA 4YLWA 3HG5A 1W31A 5K7JA 3H53A 2X2GA 4K39A 4RKAA 1SSGA 1LDCA 2CLIA 2H8ZA 4N4QA 2Q3OA 2YDAA 4NNAA 3TMQA 3MI3A 3G1YA 4JTSA 3PSWA 1AW5A 3G0XA 4DXVA 4XTIA 2ZZ4A 3BW2A 1YXYA 1H5YA 4MY9A 3C56A 3INPA 3IVSA 1KV5A 4XBKA 3N9SA 1LLZA 1P5BA 4N02A 1DQXA 2TSYA 3MHGA 2DZXA 2OT0A 5G4EA 1KM2A 1F7BA 2A7PA 1LBLA 1TPC1 1NVMA 3NXFA 3MW7A 3OVQA 4CQAA 3E49A 3FKKA 2CLOA 4DF0A 3NDOA 4YWIA 5K9DA 4NT0A 1IXOA 2E68A 2QUUA 4WUIA 3PWAA 3BG3A 4O50A 4JX4A 1W3IA 3LHWA 4Q4KA 3FA5A 4NX5A 1VC4A 2Z1BA 4OBTA 3P8JA 3CTLA 4YL2A 1AL8A 4ORIA 1VJIA 4QAIA 2RDWA 4TR9A 2V8ZA 4MY1A 1K02A 1XBZA 1K3UA 4UTKA 5EKYA 2C1HA 3GVGA 1F6PA 4AHQA 3PBYA 1BWKA 1I4NA 3LXAA 5D30A 4MOZA 3RMJA 1KBJA 3W85A 4GC4A 3TQVA 3MO7A 3KVMA 3DKJA 1VR6A 4Z08A 1BEUA 2E09A 3A5FA 3QSTA 7TIMA 5CZTA 1BWLA 2AGKA 1RQEA 4O53A 1GTEA 1FWRA 2EKCA 2NXHA 4LS2A 2JKAA 3KXQA 4NX0A 3C2RA 3QPYA 4AEOA 1EB3A 3W71A 1SZEA 4EF9A 2PC4A 3KRZA 5LGXA 2XN2A 1A50A 4WJEA 4K38A 3WJZA 3PUOA 3FLUA 1KFCA 1PCKA 4M7TA 2ZRXA 4PODA 4U4MA 2WPBA 2QEZA 1DL3A 2RKXA 5G5IA 3P80A 2GVJA 3CPRA 1DQWA 3IIOA 1C9DA 3I65A 1O60A 4AWTA 2JK2A 3JS3A 3MUXA 1Z42A 3TC7A 3Q58A 5EY5A 1L6WA 2ZZ1A 3T40A 2HS8A 1LM1A 2YPIA 4BI6A 5C55A 3YPIA 3N3MA 1QO2A 3L67A 2B7NA 2Q3RA 3LI0A 5DXXA 3JR2A 3IIZA 3EXSA 5CG7A 3HO8A 1FCBA 3T44A 2A5HA 4FNRA 1IIGA 3NM3A 4RX0A 5LHEA 2PE4A 5LSMA 4FF7A 1TSIA 5FF3A 1FDYA 3S5ZA 3DFNA 3H54A 3NL5A 3LXCA 1MEWA 4O4VA 3CT7A 1DJQA 4O11A 3BVJA 4MLJA 2J9YA 5AN7A 3MJYA 3EX6A 3JRKA 1RQBA 3QW4B 4JTIA 3LGEA 3B06A 1F5ZA 3SZ8A 1KTCA 2GQAA 1JUBA 3T4CA 4XZ9A 2ZRUA 1I2NA 3NZ1A 3QZEA 5KZMA 4IMGA 5K9XA 4JIQA 4O16A 4UFLA 4PL2A 3KFTA 1F2JA 1KFEA 1NF7A 2WNQA 1D3GA 2YW4A 2PCQA 3CB8A 5KMYA 4X3ZA 4UMAA 4FEZA 5AHEA 3W9ZA 3G18A 3TNOA 1SW7A 1IXNA 3PB0A 3BG9A 1GWJA 2X1UA 2CLHA 3S9YA 2E5BA 3BK0A 2Y7FA
chains in the Genus database with same CATH superfamily
4XD4A 1GOOA 1JYNA 3L4XA 1TQXA 2V3DA 5DXYA 1C7TA 4V1YA 1V79A 3WBWA 5LKYA 3UZXA 4QG9A 3A5VA 2PWEA 5MKGA 5FAGA 3PK7A 4WY0B 1CGWA 1ESWA 3SJNA 1XRSA 1X8CA 3WD2A 5FI8A 5CC7A 4LYQA 4JDBA 4CLMA 1OFPA 1Z44A 4LAZA 1YW1A 1XH0A 4H9ZA 4YJ5A 2YCJA 2W79A 1B9ZA 1S2WA 4GUFA 1XBYA 4HJWA 1GQKA 2Y88A 3UWVA 1XD0A 5DLCA 2F2HA 2J9ZA 4DN1A 3GIPA 4CCEA 4K36A 3VOCA 3FS2A 1XLHA 1TPB1 1LUCB 3CBWA 1GZ1A 1CTNA 3G3MA 2JEQA 2Y5JA 4M0XA 4V15A 1Y5WA 1TTIA 3E0LA 2A7RA 1JPHA 3M5YA 3BG5A 3H26A 1DJGA 3GR4A 1G7UA 3HJEA 4DVOA 1NWTA 2ISFA 4IQDA 1UROA 4G1KA 3S0CA 4C6JA 1M41A 1I45A 1JYVA 1FFQA 4P7QA 1PB0A 2VZUA 3H21A 3KBSA 1FFRA 1V02E 1DXEA 3IJDA 1P43A 3KCOA 3DBPA 3PZQA 2H3DA 2QGYA 5HAOA 1THFD 3G8EA 1UKPA 3G8RA 1UJQA 4H9YA 1I1WA 2V9DA 4D1IA 2GGEA 4R5EA 1BRLA 3JZUA 1CXHA 3QOKA 4MJMA 1VENA 2OELA 3TW7A 1W5OA 1QHPA 3SCRA 1AQFA 3BOXA 4OBSA 5D09A 3VYLA 5H8UA 3PULA 4ZSTA 1IEVA 1E9ZB 4EANA 4JYEA 3EMCA 1H7XA 1TUFA 2PUZA 3MC5A 2EPMX 1YLVA 3TR2A 2DUZA 1E5JA 4M1BA 1HT6A 3C0QA 5ABGA 2C1GA 1KRMA 3ZOAA 1LRQA 1P0BA 2PGWA 3L9CA 3N73A 4PMUA 3H24A 3N34A 1SR9A 3RM4A 1Z41A 4UTHA 1B5TA 1O5KA 2F84A 1ICQA 1KM5A 4D6HA 1IE7C 4XVEA 1XI3A 3Q65A 3CHFA 3UZZA 3WYZA 2QIWA 6TAAA 3PWIA 1F6YA 4MFDA 2QCGA 4IG2B 4WCJA 8A3HA 3M7WA 3KL5A 1K8XA 3TW6A 1OQFA 1OFEA 2YCLA 3RLVA 4DQWA 1BTMA 2VGGA 4KEZA 5CAKA 5FKYA 5MHBA 3UR5A 2VGFA 2QLYA 3Q94A 4A05A 4B2DD 2A6LA 1J96A 2D24A 1W9PA 1JNEA 4IGHA 1UWSA 2BV9A 3WQOA 1ISYA 4C6CA 3IUHA 4L1GA 3W83A 5F4WA 1CXIA 3N18A 3HPXA 1UP2A 5CSRA 1H7WA 1H2JA 4HPGA 4MNKA 3O9NA 1LWHA 4EXAA 2CZVA 4IIFA 2VMFA 3S6TA 3TTOA 3GLCA 1QDSA 2FDSA 2NVDA 4GA8A 1KTNA 3TYDA 4J5NA 2CXGA 2EO7A 3BO9A 1UUMA 4IX0A 1W0MA 4RCXA 2VFDA 4GZ7A 1OIMA 2PDKA 3OIXA 3KTCA 2P3EA 2CBVA 1AJZA 1V4YA 4Z1CA 3WDRA 3P0XA 3STPA 3EX2A 3WF2A 3ZR4A 1FWHC 2WMGA 4HSNA 5A6KA 1NP2A 3K1GA 3L0KA 4QSFA 1G4PA 3AXKA 4MPKA 3AQUA 5CXPA 9RUBA 4JQ3A 4AF0B 1RXOB 3NQMA 6ALDA 2QJNA 1OFRA 2C7FA 1FBAA 5DMNA 4WY0F 3IJ6A 5C5YA 3WDHA 4MNJA 3DUGA 1V3JA 1E0XA 3M4HA 4NYYA 1UKQA 1L6FA 1H62A 3MVTA 4ML9A 2H3BA 3CHVA 2OQYA 3HF3A 1PIIA 3LZ5A 4JYDA 2VL4A 3GYCA 1W1IE 5L6UA 1GOIA 3R4IA 1B3VA 4HZMA 1W3NA 1K9TA 5G4WA 1BG4A 1JFHA 1XHGA 4Y6GA 3FIGA 3MCMA 4YXGA 4IUGA 4AEEA 4BI5A 5C71A 4MVAA 2VD8A 3AMKA 2QAFA 3NVTA 1OWQA 4ERAA 4L6HA 2Y63A 3WQ4A 4ZZ9A 3TJIA 3W7NA 2GFTA 4TVCA 3SGUA 2J47A 4BI7A 4REQB 4CQCA 4AIUA 4GYPA 5CJMA 3HGRA 4HCDA 1O68A 2E40A 2OB3A 4M51A 1UD8A 4S39A 3V7PA 4H9TA 3GBEA 3KBJA 1CDGA 2GGHA 3REQA 4XVDA 4A29A 4MY8A 5K9CA 4MAVA 4ZVJA 2GQ9A 2YZ5A 2YA1A 4DM2A 2Z4GA 2J7EA 1XYMA 1JFXA 4GO9A 3NQ6A 1MUMA 4WY0A 3S2MA 3QHMA 1H09A 1SZFA 3LOTA 1V3KA 3RITA 4C6BA 2OGJA 4EPEC 3EOOA 5HATA 3LMZA 2FFCA 4MSSA 2W62A 2IXVA 2ZADA 2W3ZA 4HYWA 3LHYA 5A69A 3QFEA 3CO8A 2CWNA 5TF0A 3NURA 4IX2A 1CXKA 4YVPA 2XGIA 3K30A 1JCJA 2E7FA 4HP5A 1EJVC 1FUYA 4TXEA 2BS9A 3FEMA 3W7OA 1OCBA 3CV7A 3DYMA 1C7SA 3S2JA 4F0MA 1AODA 3RFAA 1I75A 4NNCA 2PDMA 2ZA1A 4KRZA 5C9WA 1JPIA 3BMVA 3V0TA 5EMUA 1XGDA 1HJWA 4FMVA 3GXDA 4XAFA 3UVAA 4YCOA 4AZCB 2QUTA 1FDZA 4LWWA 5E0FA 3W2NA 4KCVA 1UBPC 3IGUA 1P0EA 3OGVA 3L4TA 2MNRA 3COTA 1M7OA 1HJVA 2A21A 4AY1A 1JYXA 1XGZA 2GK1A 1NJJA 4PCPA 5EFDA 3LBCA 4AZ7A 3SQMA 1DJZA 4IMFA 1TPFA 3U2ZA 2AMGA 4AIOA 3U3HA 3UWYA 3GNOA 2PDLA 1CIUA 3XIMA 3R0DA 1UP0A 2CESA 3KZSA 3HA1A 3DYPA 1PXGA 3AMCA 2R1PA 3KRSA 2P3ZA 1BVZA 1PWLA 1NELA 1RH9A 4PBEA 4PTDA 3L0NA 1GYLA 2J13A 3TW9A 2J9XA 1SPQA 3ZVHA 2FPTA 4AMCA 3BSGA 2DT1A 7REQA 3IAPA 4PMXA 1R2SA 1H5VA 2DPEA 2G5WA 3OHIA 3W07A 5IHRA 1AW2A 4GIAA 4AWSA 1XLJA 3DHDA 3IRDA 1JF5A 1MMFA 3LNPA 4D8ZA 5F7UA 4ZSUA 3N17A 1X6NA 2E6AA 4A2SA 1N8IA 1DP0A 3QOMA 3S5SA 1IHIA 3W7IA 2VT0A 3CS2A 5A8MA 1XDMA 4HHMA 3OA5A 4US5D 1UMLA 2PWVA 4L5ZA 5EPDA 3VKBA 5I3FA 1ML1A 4Z2LA 1NP0A 2XISA 4AY7A 3GFYA 4D8AA 3CM4A 3EPOA 2VZTA 4QLLA 4C6PA 4J3SA 1XDLA 4LF1A 2JFEX 1O5RA 3CIWA 5I06A 2ANUA 2XVPA 3LERA 1UR1A 1UD2A 4O12A 5AYZA 1DWFM 3UFYA 3KTSA 1RP8A 1W91A 2XIOA 4RXFA 3MMWA 1F3WA 4UFIA 3H23A 1GG0A 3QLDA 4ZQCA 1ADSA 1BPLB 3IGSA 3LHUA 3PC0A 5JBFA 3NQAA 4Z17A 3SUVA 2O7QA 3WN6A 3RU8X 2O9TA 1GYMA 2NV1A 3SGZA 4DO6A 4JHOA 2PGEA 3P2VA 2OKTA 3KHJA 3S9ZA 3ABXA 3D5HA 3FJLA 2VI0A 2ZOXA 2VENA 2J7GA 3CAQA 1SJDA 4AZ6A 4MHBA 3P84A 2XIQA 3GTHA 1XD1A 4NZCA 3WF3A 4GBDA 4Y9OA 4CNPA 4WF7A 3LZ3A 3MUAA 1XP3A 3C0JA 2WVTA 3N2XA 1XLAA 3EZ4A 3SI9A 2WSRA 3AI0A 3WH7A 3AMLA 1EBGA 3PZTA 4GVGA 3VUPA 5BOEA 1P1XA 3W70A 1BYBA 4IJRA 1TV5A 4HMNA 4ECLA 2ZBTA 5DEZA 2D2JA 4NP7A 1ZRQA 2YDRA 4NJHA 5T9BG 5D37A 1EP1A 3SURA 3M44A 3Q67A 4FALA 3NIYA 1PKNA 2VRJA 3EOUA 3T2QA 1TYGA 2IQTA 5FOOA 4R3UA 2HPMA 3B9DA 3PZUA 4PMDA 1W5PA 5CCZA 1C8YA 1Z7AA 1IT7A 3APTA 4HPNA 2VRQA 3S42A 1CPUA 2G0WA 2XDFA 4AHOA 3MSRA 2CYGA 3O6YX 3I7RA 3L7RA 1I2PA 5K3VA 3OTRA 1H50A 2ZX9A 2E77A 3FVDA 2PURA 3KOXA 1TJRA 1B3ZA 4HKPA 1J18A 4DBEA 2BVDA 4F4RA 3IIVA 5BCAA 2OX1A 3N29A 2W0UA 1EJSC 3HMCA 1ZUAX 3W1UA 2DP3A 3LHZA 2OXNA 1HL8A 5JIWA 1EX1A 3VM7A 3CNYA 5CJNA 4FXRA 1P0NA 3G1AA 4RK8A 4DO7A 4W5ZA 3BICA 2E6YA 2FZ8A 3SY5A 5HNNA 2X1SA 3CIXA 2X1TA 2IQ0A 1W1YA 2WWDA 3CU2A 3VU2A 2WCSA 3BGJA 1XC4A 3NZRA 1LZOA 4P61A 1M3UA 1WAUA 1DV7A 3RRXA 4L4PA 5GPRA 2PRMA 2EPKX 2WZEA 5CBBA 3VKDA 1WKFA 4KQNA 4IPNB 3TSBA 2RGMA 2X40A 3ID7A 3LCXA 5BW6A 4H41A 4F0HA 1B2YA 2EJ1A 2PZ0A 1GZJA 2E5CA 3PBGA 1EF3A 2BB0A 2E1WA 1FWEC 3M43A 3RO8A 1SZNA 1X1OA 2WHJA 2B7QA 3NJ3A 3W7LA 4PULA 3GTIA 3OODA 3RGTA 1SJCA 1XXXA 4JNZA 1PTDA 3ERPA 3NNTA 4XBSA 3NXLA 4N9CA 1V0KA 1UQYA 1FWCC 3ZJKA 5D9PA 2BHYA 4J1OA 4M6QA 4MLRA 1BG9A 5TD4A 4A2RA 4H9MA 3HV9A 4TMCA 2VUYA 1VHNA 2I14A 4TX8A 3WNNA 2J62A 3VGDA 3T8QA 5FJPA 3IRSA 3VINA 2XG9A 4FR6A 1ME9A 1PL9A 3ZVHB 3PZNA 1K7FA 1O6IA 3KP1A 3W27A 4KRUA 1LJYA 3W7CA 4GI8A 2DSUA 3SUWA 2YB1A 4JD4A 1XRFA 3DG7A 3XINA 2H90A 5ABEA 4ZB2A 3WQGA 4ZB5A 1FH7A 4GI4A 1RK6A 4L9ZA 1PTGA 3HGOA 1RSCA 3AMGA 3PUDA 4IL2A 1Z9AA 3M64A 5E0CA 1LG2A 1Q6LA 1RUSA 4NG3A 4LBUA 5KETA 4O15A 4O1FA 1VYRA 4UCGA 3MUIA 1EEXA 2GVLA 3IK4A 3LCWA 4TU1A 1EPVA 3TCSA 3T0DA 4OIFA 5FEWA 1RD5A 3I4KA 1GKQA 4JFUA 1CW2A 1XLIA 2VVNA 2RAGA 2Y8UA 5E09A 3R79A 1M7XA 2WJZA 3GDRA 4J27A 2OEKA 1VD6A 5DCEA 1EKOA 1TMQA 4MWAA 4QG6A 3VDCA 2AL2B 3LPGA 2KAUC 1E6QM 5LA1A 1CB7B 3SW6A 4X61A 1KXHA 5AC4A 1P6WA 2YFOA 4C7GA 1VEMA 1VFUA 5C6MA 4D6FA 2WHKA 3JW7A 1OJXA 4IMCA 3V3WA 1JDEA 1PDZA 5D8WA 3W76A 2PWDA 4IFKB 3Q2DA 2UBPC 1VFHA 3MBFA 1GVSA 2HTMA 5F2GA 4X0NA 3V75A 3TN5A 1U1HA 4MWAC 5U7SA 3CYVA 3C0SA 3CV2A 2PP3A 2PWFA 2X42A 2P0IA 4O1EA 1TV4A 2JGYA 4A21A 3A4XA 3WUBA 1KFWA 3DC8A 5D03A 1VBJA 2PPGA 4HNTA 4FOJA 1DOSA 3M47A 4O13A 2RDTA 3G1FA 4DYEA 4ZXLA 3LCIA 2NW0A 1IIHA 3STFA 2Z25A 4UB9A 5FAJA 1GJPA 1PYFA 2E25A 2OOFA 2YA2A 4EF8A 3GHUA 3BC9A 1E4NA 1B31A 7XIMA 2VFHA 4UTTA 5JH1A 2CLLA 3TSDA 5LXXA 9CGTA 2AQOA 1Y0EA 4JTFA 4A3QA 3R2GA 4GIRA 1OFDA 1I8JA 3C2VA 2ZUNA 4IISA 3F4WA 1X97A 2NUWA 4UTFA 4G7EB 1YDYA 3RX3A 3WKZA 3W2UA 2Y4SA 2Q8ZA 3G1VA 3TVAA 4YN5A 3EA1A 4IL0A 3CHCA 4RNFA 3UP8A 3SCUA 1H51A 1ONXA 3SIMA 4PUWA 1JCXA 1IEQA 1WXZA 2WWCA 4N6EA 3UXAA 1BVNP 1A4LA 2YX0A 4WLCA 3LTYA 3LHVA 4WZHA 1UPPA 3MP3A 1MNZA 4H2CA 4H7CA 4GQBA 2PTYA 2PGRA 3VC6A 3PPCA 4MTVA 5GVJA 2A1YA 2HK1A 2PEVA 1MEHA 1ITQA 4E3TA 4RJEA 2FJKA 3B0UX 3VZYA 4JDYA 4N4PA 1J11A 3CASA 2ZCGA 4EPDC 2NUXA 4HU4A 4ES4A 2REQB 5LA2A 3QMRA 2QF7A 2OYMA 3DIPA 3LLDA 3W86A 4XAPA 1TCMA 1NFPA 2YR1A 4MUZA 5CJ5A 2VRKA 4U5IA 1E73M 3W1PA 4A22A 2NVCA 3B40A 3AS1A 3R6IA 4MIMA 3S83A 3TYCA 1UPMB 3GHTA 3HFYA 1WB0A 3UD6A 3F4NA 2PDJA 3NO1A 1FWJC 3CB3A 4KS0A 1KFJA 1PWMA 4XKYB 1TA3B 5AECA 4CCZA 3ARQA 3K2GA 3AS2A 5CZJA 2Y5SA 2ZUUA 3RXZA 3SRKA 1KXTA 3WH6A 4DBUA 3FX4A 4H6QA 2DUXA 1ITCA 4OECA 3ARZA 4N9EA 4OOUA 4PC8A 1TCDA 3RK8A 2XGBA 2WSKA 1AZ2A 3IV8A 4M8UA 1QI0A 2HK0A 5EBAA 3B0VC 1OYAA 1R2RA 2EPLX 3A24A 3SFWA 1KBLA 1HF6A 1WUEA 2CITA 4H4IA 5F1VA 1UWTA 4P8UA 4GVFA 4YS1A 1BWVA 5HWMA 1PIGA 4XAZA 4G1NA 4JTDA 3PJXA 4K7YA 2Z26A 1IV8A 4O0KA 1GQNA 5IOBA 2Z1VA 1HNYA 3THCA 3LY0A 2QCCA 4DLMA 4HA1A 1MW1A 3AIBA 2IW0A 5EMYA 4LVDA 3RDKA 4RE2A 4GRSA 3RN6A 3U5YA 1N7KA 3ZMRA 3FNDA 3VNJA 2WYSA 4IMDA 2GUUA 1TREA 4MWAE 3WNLA 4G2DA 1SU5A 3ZXWA 3SGGA 1DHPA 4UTIA 3BJFA 1ZAHA 3AROA 3IS4A 2Q09A 2NXGA 3WEZA 4CQBA 3A4AA 1RALA 4OWGA 3OZPA 3RPDA 4NIRA 1SW0A 3DYOA 1PEZA 4FNSA 1NWUA 3SDOA 2J88A 4N6FA 2Z0IA 3V5CA 4FIQA 2F6UA 1GOWA 3EB4A 1D7FA 3WQFA 1TTQA 2RGLA 1V6XA 3UWWA 3LXBA 1WKEA 3I4EA 4GHRA 2V2HA 4H2HA 2JGQA 3TUUA 3AC0A 3IIPA 5A6LA 1E6NA 1XL9A 2ZKMX 3GR8A 1G6CA 4PMRA 3S1XA 4I8YA 3W01A 1X6UA 2ASHA 1AZ1A 2AKZA 4EPKA 3CWNA 4AAJA 3C8FA 2CZDA 1A3WA 1IEWA 1K1DA 3LV5A 1TR9A 1PE1A 1R30A 3ABSA 1PZ2A 2D73A 4UTUA 2QVHA 3EMZA 3NL3A 2R94A 4QJ3B 1VHCA 4JTHA 1S5TA 2GJLA 3PZMA 6PTDA 2Z2BA 3NL6A 4JIHA 1AK5A 1PX4A 1MEIA 3LLXA 3MKCA 4AZBA 2NV9A 3TTYA 1QNPA 5BYWA 4LRSA 5JVLA 7A3HA 3RPMA 1ME8A 2PWGA 1YRRA 1JD9A 3DECA 3F4CA 3BLDA 4PRWA 4RXGA 4XZHA 3SCWA 4R33A 4GKLA 2QDHA 5KINA 5I5RA 5D2XA 3GFZA 4LUJA 1GQLA 2DFAA 2G3JA 5E6ZA 8TIMA 3T0TA 3ARPA 4GNVA 3ZLGA 2P8BA 1VBGA 4DF1A 3U2OA 3URNA 5PTDA 4XQ6A 4LUSA 3AXMA 3EXRA 3HTWA 4CKQA 1DWIM 1F07A 1V7AA 2WC7A 1Q65A 1EC9A 1UIPA 1Q8JA 3E5BA 3O3RA 3SB0A 4D72A 3CAVA 2VR2A 1JD7A 3DI1A 5G2WA 2ZZ3A 2G41A 3F5KA 4F40A 1J6PA 1W37A 4E5TA 1KWGA 4YTSA 4PUMA 3VE7A 3GHSA 5A2AA 3TONA 3N6JA 1POJA 4YLWA 1C29A 2NT0A 4PFMA 5K7JA 1E3XA 3CZKA 3H53A 1E3ZA 2G3NA 4RKAA 3LUTA 4LFYA 4N4QA 4NNAA 3TMQA 3MI3A 3NSXA 1A4MA 3G1YA 4UQEA 2OX4A 3WLKX 3MO4A 4DXVA 4XTIA 1HKVA 2OSYA 3C56A 1X38A 3FYYA 5I24A 3IVSA 4DBWA 1LLZA 2PCEA 1P5BA 2OT0A 4C5YA 1KM2A 3FJ4A 5AKQA 3BQ5A 4M6UA 1Y8BA 3OVQA 4CQAA 3E49A 4IHCA 4QGCA 4DF0A 3OZOA 3WLNA 1O1ZA 4HVXA 2PLJA 1B90A 1IXOA 2E68A 2VC9A 5BOFA 1TZ9A 1GVYA 4ZO7A 5DMMA 1W3IA 4EX4A 3LHWA 5DO8A 4CD5A 2XZ9A 1HJQA 1VC4A 2Z1BA 4FS9A 4PUKA 4YL2A 1AL8A 5D9OA 2RDWA 3GS6A 4TR9A 3PZIA 1C8QA 3S2LA 4J40A 2OYKA 1K3UA 4V33A 4H7VA 2QMKA 4D6JA 1UG6A 1YNQA 1NDZA 3LXAA 5D30A 3ZLHA 1FHLA 3RMJA 3VILA 1RY0A 1OADA 4LXFA 3TQVA 3ZZ1A 3WIJA 2HXUA 2PZNA 3KVMA 3DKJA 4M82A 4P7RA 3W37A 4Z08A 1BEUA 3A5FA 1V3HA 1OT2A 2C71A 4PFHA 1OB0A 3G1RA 1SMDA 1TZZA 2EKCA 3S2NA 4AD5A 3KXQA 3QPYA 5I03A 1V6VA 1FHUA 3TR9A 4GVIA 3KRZA 4Q8PA 4K38A 1JDCA 3WJZA 1CLVA 2C0HA 4JN8A 4KW2A 3WFZA 4M7TA 4E3VA 1OGBA 4U4MA 1X98A 3UR2A 1DL3A 3T81A 2GVJA 3WO8A 1PYMA 3IIOA 1O60A 3KOYA 3OLGA 4HZ8A 1AH4A 3CQHA 3AJ7A 3E74A 3EPNA 1PZ1A 5EY5A 3UYIA 1NOUA 3T40A 4C90A 5I07A 4BI6A 5JH2A 5C55A 3ARYA 3N3MA 5E5CA 3OOQA 1QO2A 3L67A 3VMPA 3LI0A 3U5UA 2Y5EA 3JR2A 4ZR8A 3AOFA 3IIZA 1Y5VA 4IIBA 1P1MA 4OBRA 3N2TA 1IIGA 2PE4A 5FF3A 1R85A 1TSIA 1FDYA 2PTWA 2VEGA 2CERA 3VDGA 3FN9A 1CEOA 4O4VA 3CT7A 1DJQA 2UZ9A 4MLJA 5A95A 5AN7A 3MJYA 3EX6A 3JRKA 4P8WA 3VK5A 1Y65A 3LGEA 3B06A 1YNYA 1F5ZA 4AVOA 2IXUA 1VF8A 4H9UA 2FVMA 4W5UA 4JTCA 1JPDX 4I5RA 2RJHA 1IR2A 3V0UA 1I60A 4W89A 4UFLA 4MADA 1KFEA 3CPUA 4ATDA 2YW4A 4Z1YA 4PB4A 3CB8A 4X3ZA 5A6SA 4HBKA 5AHEA 1D2KA 3E2RA 3PB0A 3PPHA 3V35A 3H22A 2V3EA 4TV5A 3BAJA 2XIBA 5DFAA 2CLHA 4AISA 1O95A 4JY8A 4X9YA 1YTDA 3BMXA 2V5LA 4ONVA 2DDXA 2XUCA 4JTLA 2QCLA 4ASTA 4XB3A 2QCEA 3M5XA 3WUFA 1DWHM 1FOBA 3BJTA 1ZQ5A 5I3DA 1QHOA 3D46A 4Q6XA 1WBJA 4DAIA 5BNKA 5FA5A 4AC7C 1ODUA 1Q2RA 4R7OA 3R8HA 2J8GA 1EYEA 4MG4A 4Y96A 1EH9A 3TK7A 3NCOA 3L65A 3M6DA 2IQDA 1EWEA 1J0HA 4NZ4A 1WXYA 3W1AA 4LV9A 3K8KA 4LQ1A 3WLOA 5IFPA 3FCPA 1XKYA 3E0VA 1EQCA 5HANA 2VM8A 1XX1A 1V6TA 1DJYA 3N12A 4LAUA 5XIMA 1AH3A 3QGVA 4ICNA 1MSSA 3TLLA 3B9OA 3QC0A 3D3FA 3WLTA 3N1AA 4RE3A 3KVLA 1O1HA 3TV8A 4S2BA 2TPSA 4HNNA 4E2DA 2X2YA 3LM3A 3VFLA 2XFWA 4FB7A 4H3DA 5KZEA 3KVKA 1TTJA 1DIOA 3ECQA 3NGJA 2C0AA 3TDFA 3ZR5A 1W3HA 1JZ8A 3VTRA 4RV8A 5CC6A 1OFQA 3BCFA 1JAKA 4BFAA 1QPOA 1NQKA 4D71A 5GNYA 3T09A 3LPOA 5G1YA 1U5JA 6XIAA 1E1FA 4L6DA 3STGA 2E9BA 3GAKA 2P10A 1QI4A 4UQDA 3WL1A 3NFUA 2GQ8A 1ZL1A 1J5SA 4N7QA 1W3LA 1RPXA 1OK4A 2OZTA 3SQSA 3NYZA 3CYJA 1JZ7A 4B4FA 2BY3A 2WMJA 4FLQA 1QNSA 2OU4A 1MW3A 4GACA 3R1ZA 1VFFA 1UD6A 1E6XM 1XLDA 2R1LA 1DIDA 2QJHA 3W7GA 4U10A 3K5XA 3ARWA 1W1TA 2O4QA 4OGZA 4AD1A 3VI2A 3KVJA 4IWWA 3PTDA 4LANA 5TBOA 3GH4A 1TFVA 3P5YA 4GZJA 4H9XA 4CN4A 1R3TA 1XWYA 3AIVA 4CD6A 2ONEA 4B3LA 4GO8A 3MYPA 4XTDA 1G9HA 4H7ZA 1NFGA 3CMGA 1TV3A 1XR2A 1WBHA 3GUGA 2ZXBA 1NF0A 5B7ZA 3LNMA 1FP8A 5HBFA 1CT5A 1NDWA 1FWSA 3STEA 1PO9A 2BVTA 4NNBA 7ENLA 5HR7A 2H8XA 2VFGA 3A23A 3M16A 1VPXA 4YU1A 3VXGA 2Z27A 4C1NA 3FEQA 3AICA 2V3FA 1ZP3A 1JZ2A 3W7HA 4B5VA 3EAUA 2E5DA 4UFKA 3C86A 2D22A 4W7WA 2A79A 3AXXA 3F2CA 4O4WA 3I6EA 3WFAA 5CPLA 4ZMGA 1XSJA 2PDYA 5EL1A 3RJXA 1SFSA 4WX2A 5EA9A 2QW5A 1M6JA 1QW7A 4WKFA 3SJ3A 1IT8A 3TTSA 2UY4A 3LLFA 3MJMA 2GJXA 1R3SA 3GXIA 2V5JA 3M5VA 1XIFA 3FK4A 3L68A 1PKLA 3BTNA 1U83A 3RM9A 3SRDA 5J5RA 2XFFA 2XINA 1GOMA 4QE1A 5LIXX 3GXPA 1V0MA 1W9XA 2GJNA 3CIVA 1E56A 5FJRA 5E9AA 1P0KA 3BANA 4WQ6A 2V5CA 3HPFA 1W1PA 2EPNA 3K4WA 1HO4A 3WG6A 2ZX6A 4LYRA 3UJ2A 4BA0A 2VC7A 1MQPA 3DEQA 3PS7A 4D2JA 3PG9A 1CYGA 3EBVA 1GYNA 2ON3A 2QCNA 2PLKA 1N8FA 1VBRA 1LP6A 2OJPA 5AB3A 3P62A 4DO5A 5HJXA 3VNDA 2IMRA 1GONA 4HMDA 1B3YA 1OYCA 1DE5A 2Y6ZA 1YPXA 1U1UA 4DXKA 1XIMA 2ZX5A 4Q22A 2WW5A 6TIMA 4WXYA 3VZXA 3DHPA 2OT1A 4GCAA 1HQTA 3HMJG 1RVGA 1VLWA 2I9EA 3AU2A 3WMSA 2Z6IA 4GXMA 1TKKA 3GDKA 4FX7A 3UG3A 3NL2A 1TX2A 3FA4A 1E0TA 1UJPA 2PMQA 3M0ZA 4QFUA 5F4XA 1RCQA 2BG5A 3WUGA 5ABTA 2FPYA 3W2JA 4LOCA 1UZHA 2TYSA 3VAVA 3NQGA 1E70M 1ZP4A 4C1NB 3GNDA 2WJDA 5CZ0A 3PZ9A 2FTPA 3B8IA 1UD3A 5BZAA 1KBKA 3I68A 5BWAA 3AJXA 4M24A 3WJSA 1LTDA 4AWUA 1XH1A 5DBTA 5EYWA 4Z0SA 4AIBA 4P7OA 3AIQA 3JU2A 4HJFA 1HFBA 2DT2A 4TTUA 1E4LA 1OZQA 1LBFA 3QHOA 1VRDA 4UTTC 3QPZA 3KDNA 4XUYA 3UR7A 2BXVA 2EPOA 5LIUX 4NJKA 2E6FA 4NAEA 1A80A 3NPWA 4RDYA 3PR2A 3NGFA 4LS1A 2HRWA 2ZZ6A 4GH3A 1B30A 2QQ6A 3UA4A 1QJWA 3CUJA 5TQLA 3QV7A 4GISA 3FHAA 2CBUA 4ZL1A 5HJYA 1XRVA 2HE5A 2Q02A 4LEQA 4NRRA 3CUXA 2X09A 4DYKA 3B03A 4F8XA 5LIYX 4BF5A 1S39A 3TXZA 2UWFA 3T42A 1SYTA 3URAA 3IJ8A 4PCFA 4L64A 4O57A 3NYDA 2ZZ2A 1XDJA 1VS1A 1H3GA 4NY2A 4M7SA 5C9RA 3LB0A 1TR1A 4Y9MA 4ERGA 1P4CA 2ZRZA 1L8PA 4Q8NA 4JTQA 2P0OA 1S1PA 2YDSA 5FESA 1KFKA 2WXDM 5LIWX 4JOMA 3U57A 2CLKA 1EC8A 4OUIA 1QNOA 1W32A 1J0IA 2DV0A 3VX1A 2NUYA 1G4EA 4IPPA 2WB5A 1GHSA 5LXEA 1HVQA 2E9MA 1ZJAA 3PBUA 4AZHA 1W2VA 1OINA 3UZJA 2X41A 3UVIA 1IWPA 2VTFA 1Q8AA 4MUPA 3WK3A 1EF2A 1E9YB 1MDLA 3PG8A 4GMEA 2R1MA 3VNLA 3O0KA 4GINA 4IP4A 3W7KA 1TWSA 4DJFA 4BWLA 1QVBA 1LWIA 5HMDA 4W8LA 4QS5A 3HQ1A 3M0MA 4QRNA 4ZOEA 1UC4A 4CEXC 3WLIA 5A8GA 1CGXA 1CI1A 3OBKA 5DT5A 3QFWA 2ZX8A 3QF0A 3B8SA 4CCCA 4GNJA 1F4AA 3ZFHA 4MKSA 1B3XA 5FEZA 3ARUA 3ITTA 3KOWA 4US5A 1J12A 2GWNA 4CVWA 2W9MA 2GJXB 4HHLA 5HPOA 3W88A 3CUGA 1E15A 4PL1A 1ME7A 4RNIA 4DHGA 1XLGA 2AMXA 2V81A 1Y7VA 2BX7A 4ATWA 1ZFJA 1S1RA 2G37A 1JCMP 3OEXA 4NI3A 1ZNNA 3VNMA 3B05A 4PE8A 3L5AA 4WKHA 3EOLA 1D3HA 3QKZA 1KCKA 4HNUA 3OQ8A 5KITA 1CGVA 4HSOA 1O5XA 1KR1A 2Z7GA 1AW1A 5A6JA 3IAQA 3SCQA 3GC2A 5EMLA 2O0TA 4PMOA 4O8RA 3RM8A 1HKMA 2W67A 3N2CA 3BCDA 1EOKA 1TPWA 4ADTA 4B3ZA 4C6OA 2IKJA 2BY0A 4O8AA 2WNWA 3P14A 4JIEA 1XYBA 3FA3A 1SO4A 2YFNA 2V2DA 4QTGA 1AL7A 1CCWB 2CPUA 3CZLA 3PWGA 1B1YA 1XYCA 2DJLA 4ZQRA 4WSJA 1T6MA 4WR3A 2P5NA 3R89A 3RCMA 2BHUA 1YMYA 2DW7A 4KCWA 4IICA 3GG1A 3RCNA 2VX5A 1XS2A 1US2A 1TELA 1GW9A 3QYQA 3L4VA 4DWDA 1BLIA 3G22A 3FOKA 2QDDA 4JX5A 2RDXA 1BKHA 4ZFMA 4JQ1A 1JCTA 3TCEA 4PSPA 3EWDA 3NQBA 3M07A 3RO6A 4GQRA 4H01A 1VIZA 1JZ4A 2A85A 1OC7A 1A0EA 2OEJA 2VFFA 2G3MA 4EP8C 3DXIA 2QDEA 2NQHA 1XUUA 1W3KA 2VDGA 1A49A 1FDJA 3VE9A 3KL0A 5REQA 4PMVA 3GTFA 5GJPA 3A3HA 4HNVA 5D9NA 1R38A 2A4AA 3CZ8A 3CLMA 1WPCA 5H1WA 3TOYA 1I1XA 3EEZA 2HS6A 1K9DA 4WD0A 5CSSA 3SEPA 1EJRC 3CHDA 1F73A 2CW6A 1PTAA 4N0RA 1DJIA 3VNKA 5BWFA 2NSXA 1KGXA 5AHNA 1JL8A 2CLPA 4G7FA 4ICMA 5I02A 1W9VA 3DHFA 4PUJA 5HUOA 3HG3A 4YYCA 4XISA 4IIHA 1S5WA 3TQPA 3PANA 4FOUA 4X60A 4Q4RA 1P6CA 2C16A 1LT7A 1D8WA 2I57A 4JR5A 3UQNA 3PBMA 5XIAA 3U6WA 1ZJIA 4L4OA 1A5NC 1EJXC 1HP4A 1H0IA 3NA8A 2ADAA 1JZ5A 3SO7A 1B3OA 3UA3A 1F05A 3AMDA 1RBLA 2OR2A 3G3DA 4DBDA 2HWGA 2GK1B 4KFPA 5HJLA 4GG9A 4M80A 3HV8A 5MF5A 3B3DA 1T40A 3SRFA 2J8FA 1SFTA 1RJPA 3K46A 3TYEA 3AHVA 1JCLA 3WQ5A 5DX7A 5AVHA 1H1ZA 3OBEA 4M6PA 4FXJA 3MUCA 4HT3A 4EACA 3VGBA 3LCLA 3WBYA 3TQKA 1QBAA 4UQCA 2ZA3A 2VWSA 4QNEA 3DFPA 5XINA 2CKRA 4REQA 4CCDA 3UU0A 5HA7A 2DORA 2D23A 3APGA 3G1XA 3OVRA 4O0ZA 3S46A 4KGLA 3FSUA 1OK6A 3BW3A 4PB5A 1H63A 1ZCOA 4ALDA 2HVOA 1GVOA 3OQEA 1V51A 4QJ4B 3QQWA 3WLQA 3QQ0A 2P8CA 2YZRA 2VKZG 1UKTA 4ZQNA 4HU0A 1POKA 1V6YA 3W6MA 3E02A 4E2BA 2E8ZA 3HJZA 2WJEA 1PHQA 2QCHA 5AFDA 1VFSA 1OABA 2QNEA 4HA3A 4FAMA 3GB6A 4PR4A 4QEEA 3QH2A 1P6BA 3N25A 4JN7A 3LDVA 3MYOA 1UWIA 1XW8A 2Y7FA 4J3ZA 4NXSA 5I2UA 1S46A 2CU0A 3T4WA 2PTZA 3GNPA 4DWSB 1JRBA 1CXLA 3W23A 1KC7A 3TMLA 1LOLA 2MUCA 1SFLA 2QGHA 3RCYA 3IANA 4D6DA 1Z32X 2ZUMA 4Q7IA 4PTWA 3WQPA 4C60A 4RV3A 3QLLA 1UR9A 3TA6A 5LHFA 4U31A 2OLSA 1LWJA 4ILSA 4K37A 1JNDA 3WMLA 4YVXA 3ZJ7A 3GU2A 1LBMA 4PYSA 4Z0JA 3M0LA 1YNPA 2X05A 4LALA 3UZWA 4HOWA 2VOTA 2ZUWA 3CZJA 2O4MA 3W00A 2O56A 4IXXA 1CLXA 1S5VA 2BVYA 1DVJA 5SWUA 3ZLFA 3A12A 3PP7A 2HE8A 1FWNA 1MUCA 1W5NA 3GDBA 5I6SA 2DVXA 1HX0A 4DB7A 4H04A 3N6QA 4GC3A 4OQVA 3WCZA 3V18A 1PCWA 5IDZA 4LRTA 1GVFA 4DWSC 3FY1A 3P3BA 1GOKA 3FJNA 1RY8A 2WC3A 1KRBC 1GQJA 1Q6DA 1EUAA 2X0SA 5DELA 3F1QA 2WLZA 5FF2A 4DJED 4PTVA 3CMFA 3CPGA 2X16A 3UXIA 3GO2A 3TAKA 4Y9PA 1WOBA 4LAOA 2ZXAA 2VC6A 4LEFA 2VEKA 1PSCA 1NQ6A 2ZVRA 1E72M 3C2EA 1JAEA 2F2KA 3PVFA 1GVEA 2QS8A 4PA8A 2VGBA 4Q8OA 2WLYA 1W8SA 2A3LA 2WSQA 3IGXA 4PEKA 1XLCA 2P53A 2X7VA 2E8YA 3TZFA 2WKGA 4UQBA 5F2LA 2HXTA 3EA3A 5B7YA 1X7FA 3UNDA 2X1IA 5HPCA 3KS5A 4GYKA 2ZRVA 3WBXA 2GDQA 3W38A 5FL1A 3II1A 4OJYA 3TFXA 2QMJA 4W4QA 1QCWA 2WM0A 3H7RA 3HU7A 1T7LA 2PC8A 3DX5A 1K70A 3GZ3A 3W2KA 3BLEA 1OG6A 1T41A 4KF1A 3W7JA 4QEHA 2YLLA 3DI0A 2BBFA 3GAYA 2FVLA 3TTQA 3QKEA 4C6LA 3TC6A 4Q8VA 1XCWA 4L61A 2FZMA 2D0HA 3GVRA 4XAYA 2QPUA 3LPFA 3ARSA 2VZOA 1OGSA 2J78A 1I2RA 1EX5A 5D2TA 1R3WA 4UR8A 2DEPA 3BLFA 3N2BA 2DVTA 1PAMA 4U2YA 4DJFC 4JFVA 1NM9A 2C14A 2HNEA 2PDWA 1LF1A 3OLIA 4Y90A 1IEIA 2KX9A 1V93A 4GXPA 3VIPA 2ZE0A 3LK6A 3O15A 4G56A 5AHFA 4QROA 4TVUA 2CBJA 3UG5A 2NT1A 1KO0A 2RH9A 2D3LA 1H1YA 1WDDA 4ZB0A 3R0UA 4NZ3A 4L1WA 4OKDA 5BMXA 2BSLA 1KM4A 1P48A 4R9OA 1S5NA 4FNTA 4FNQA 1IQ8A 1G4SA 3TSMA 3B9EA 3CWOX 2J77A 2QF8A 5KZ6A 3QR0A 3KRBA 3SCTA 4AC1X 1GPFA 4GNKB 3S1GA 1KCXA 1W6TA 3HB9A 1KTBA 1A3XA 3H70A 3NZGA 4XIAA 4I5XA 1QPQA 4FX6M 4IZGA 4YHEA 3W75A 1NU5A 3N15A 1VEOA 1VPYA 2DSWA 4AZIA 4QDWA 1JJKA 1EGMA 1RJRA 3HFTA 3GKAA 1FCUA 2XYLA 1IR1A 3RG6A 3AISA 1I0DA 2CZEA 4TQTA 1BF6A 3TFCA 4QNWA 1TMHA 4JTGA 3L4WA 1MFVA 1LRTA 1UWRA 1E6PA 2YXOA 2Q8LA 4GUJA 3U4AA 3GXTA 4NQ1A 4Y2WA 2VCCA 1UW9A 4P5UA 3VGGA 4UOQA 2C8NA 1P7TB 1NIUA 1W5MA 4RZ4A 5JUVA 4XO6A 3U8GA 4JKLA 2WMIA 1ADOA 1P7TA 4C6EA 2HISA 1V6UA 3EKZA 1DHKA 3EKLA 1O7AA 1C91A 4O54A 1QOPA 3QMSA 4M1RA 3RNDA 2R14A 3CJPA 1UR3M 2E1DA 1R6WA 1K03A 4RE4A 2DIJA 3QTPA 1UD4A 4U28A 4UR7A 4DO4A 3CV6A 1W1VA 2W92A 9XIAA 1CNVA 1WDQA 2QDGA 3MDUA 1QR7A 2PDPA 3GW3A 1HG3A 3GDMA 2NQZA 4C6FA 1TPVA 1PS9A 2ZXQA 3S5NA 1QHZA 3RX2A 4L56A 1RCOB 4WGHA 4QJ5B 1FHDA 1O66A 1E0VA 4BEQA 4J35A 3ME3A 1XIDA 4C5ZA 1SO3A 2PGFA 4LVFA 4C6QA 3PB2A 5DCDA 2O9OA 3CUIA 1EO5A 4WOZA 1MYRA 3S8HA 5CPMA 2DUAA 3W7EA 5D2YA 1JUEA 3N2OA 5LGZA 2PF0A 3HIJA 4DJFD 4AEFA 4S3KA 3WFLA 4W86A 5A6BD 2F6KA 4LUTB 1VZWA 3O1NA 4XZWA 4MYXA 3BLLA 1BSLA 1FWGC 2BMBA 2Q6ZA 1L2QA 1M03A 3EX3A 1TZ7A 2D0GA 3U2CA 4CQ9A 7REQB 2EQDA 2A2IA 3WH5A 3NEHA 1Z3NA 4WIWA 1ONRA 3GXFA 3QN3A 1PX8A 4MZ1A 2BDQA 1T5AA 2OLAA 1D7KA 1Q4WA 3DFTA 4QITA 1Q7QA 1E9IA 4W8BA 3AWNA 2REQA 4F0RA 2YBUA 2GGGA 2Q01A 4JIPA 4MNMA 3VOIA 2WVVB 2JKPA 2PF8A 4HZ7A 2VJXA 3H2OA 5AYIA 3ITXA 4GUHA 1JDDA 2VZSA 4UCFA 4PTNA 1S5MA 3I3BA 3TYZA 1QXLA 2W27A 4RDWA 3VFCA 3WH8A 3R94A 2NX1A 2V3GA 1TWZA 1Q6FA 1KFBA 2D0FA 4O1CA 4WEVX 1CXFA 1F74A 1E5NA 1AD4A 3OLEA 1UIOA 3UZYA 5CAHA 4GLEA 1KKRA 4WJ8A 2Z1XA 4RDZA 1G67A 4OU1A 1DIEA 3SCVA 4JN6A 3WH9A 5G1MA 1UWAA 3TP4A 4HA4A 1TJ0A 3GG0A 1OVDA 2O7SA 2J7FA 8RUCA 5HMEA 3DFYA 3LD5A 1FWFC 5IFTA 3LQGA 4BQ5A 4D9PA 3S6DA 2I5IA 3C3UA 3QGKC 2DZUA 4JX6A 4A35A 1NOWA 3O6AA 4JHZA 3I3DA 2WC4A 2PODA 3EX4A 1FY6A 1F76A 3GHRA 2D2GA 5EBUA 4M29A 4A8NA 3AUOA 4UZSA 2HNHA 4LUYA 2BODX 4IQLA 4GJIA 4NILA 1HL2A 4FLOA 1VAHA 1ZLPA 3UPWA 3P82A 3SSJA 4S3CA 3W1TA 3W7QA 3NQDA 4GZEA 4XUGA 1JZ3A 3WEMA 1KRAC 1T96A 1GVRA 3GUWA 2W5FA 1W8GA 3KOZA 2XN0A 1X8FA 3ES7A 5BXRA 3W1LA 3ATYA 4O52A 2INFA 4HMCA 2Z7KA 4DUXA 1JQVA 4ROQA 1NDVA 3T0CA 3WLSA 2X2GA 1FTXA 3LPPA 1SSGA 1BVWA 5I00A 1OC5A 1NWRA 1J0YA 5FCZA 1S2CA 1TWIA 3B9NA 1UKSA 7PTDA 4AQLA 4JFSA 4DLFA 3C2YA 4CUCA 4XBKA 1DQXA 2TSYA 2XGZA 4QQUA 3TN4A 4NI8A 3MZNA 5G4EA 1F7BA 3AS0A 2V5KA 1LBLA 1AH0A 1LL7A 3NXFA 3MW7A 4H8NA 1R3VA 3E2VA 3FKKA 5I0DA 2YL6A 3NDOA 1ZBVA 4NT0A 4XIMA 3WF1A 3PWAA 4DYJA 1XF0A 1R9ZA 3WLLA 2WMKA 4OBTA 3CUZA 3S47A 4CN6A 4ORIA 4QAIA 4B92A 2F9RA 1K02A 2FGZA 5EKYA 3GNXA 2DGAA 4GKTA 1A0CA 3E1F1 3UBPC 2R6OA 4J28A 2WANA 4Z2JA 1J0ZA 4R7WA 4PRRA 1KBJA 2I16A 4JQ2A 3O7UA 3HQPA 2QVNA 4D6EA 3ALGA 1KGWA 1VR6A 1XPGA 3MU7A 5IDIA 3VNZA 2E09A 7TIMA 3MSYA 5CZTA 1BWLA 3WQEA 2PWHA 2AOSA 4NX0A 4F3HA 3DGBA 3SCSA 1EB3A 2XN2A 1WKYA 2DY3A 1IWAA 2OZ3A 3FLUA 4CQDA 1KFCA 2HQAA 2I17A 1RLCL 3Q4DA 3IK2A 5M3WA 3CPRA 1C9DA 3I65A 4DI8A 5T8GA 3JS3A 3HM7A 1O5QA 4W87A 2OSXA 2VGIA 2YPIA 2O55A 3BOLA 3YPIA 1OM0A 2B7NA 2Q3RA 3AHYA 3WQVA 3E0WA 3MVIA 3L2MA 3QBUA 5CG7A 3HO8A 2XVLA 1MFUA 3NM3A 1JEZA 1FH9A 5LSMA 3DBNA 2BVWA 4ZOCA 2XFYA 3DFNA 3NL5A 8XIAA 1F3EA 1ZSXA 5CBJA 3VNYA 3QW4B 1VIWA 4YVVA 1KTCA 2H9AB 1JUBA 3T05A 2FZ9A 4M3PA 2IUZA 2CIPA 1I2NA 4QR6A 3NZ1A 4GFIA 3WDIA 4FLRA 5K9XA 4XKMA 3U9IA 2XH4A 4PSRA 2Q71A 1NF7A 4D6CA 1D3GA 5KMYA 4B2DA 1H4PA 4TV6A 5M17A 4UMAA 3WY1A 2PA6A 5A6MA 4FEZA 3UXKA 3TNOA 1SW7A 4FK9A 3DDMA 3BG9A 1MRAA 2X1UA 4UOZA 1FWIC 1VFTA 4DJDA 4CNUA 2E5BA 5GQBA 4BZYA 2NZLA 2ZXDA 2D2HA 2Y7GA 3ZT7A 1LYXA 1B4EA 1EXPA 5ECUA 1N55A 3B8TA 4PMYA 1BF2A 4GI6A 1UASA 3LA4A 3NEVA 4KWVA 1DJWA 3CZGA 4QJ1A 3OO2A 5IRPA 4YTQA 2BHZA 2GVEA 3KCJA 4GXWA 4JTUA 2B7PA 4YYFA 3P6LA 1IGSA 1AD1A 1K77A 4CN1A 3QVQA 3D47A 4C7DA 1VBUA 3DKLA 1EJWC 4X9SA 3MPGA 4PCSA 1QMLA 4UTLA 1HKKA 3F2BA 5LIKX 4MYAA 1E6SM 4GX8A 4L7ZA 3TQ0A 1NDYA 2WOQA 4HOXA 3U7VA 3DFQA 1JIBA 3UWQA 1WX0A 4C1KA 4Z2HA 4DI9A 2XH7A 4JIIX 3PUEA 2ZC8A 1NWSA 2YCIX 5CC5A 3WBAA 1G1YA 3LGGA 3C2OA 4HD5A 5BXPA 3M0HA 4ZBCA 1CENA 3MQTA 3F5JA 2ACSA 5BOOA 4JKKA 3IPWA 5BXTA 3EDDA 2J7HA 5HNRA 2VUNA 5AY7A 3OIHA 2BZNA 5ABHA 4B3KA 5FD0A 2VP8A 3TN6A 1LRNA 5C9ZA 1JXKA 4OVXA 2CHOA 2WZHA 1NARA 4XBJA 4XO7A 3BMWA 4Q8WA 5JQ9A 3KEHA 4F2BA 1M01A 4KRTA 1NAL1 1MI3A 3W1NA 2F61A 2V38A 4HNLA 4C6KA 2VYOA 3ABQA 3CEPA 3BE7A 1XCXA 4QLKA 3EB3A 3SN4A 1XQLA 5FJTA 1Q6GA 3A21A 3ARXA 1OEPA 1J2BA 3FYPA 4P8XA 3CQ0A 1E51A 4AD3A 4CGTA 5CPQA 1MWOA 3ES8A 3H2EA 1ZAIA 1XICA 1PX3A 2VCAA 2Y1HA 1H0GA 1JPMA 3L5LA 1TPUA 1FRBA 3WELA 1OD8A 3V0SA 1EHAA 4JFTA 1KBIA 2J74A 6A3HA 1FHVA 3SUTA 3PBVA 1JI2A 3NZQA 2A3CA 3T0AA 1A5MC 2BWGA 2O92A 2WV8A 2Y7DA 4QDMA 2EGZA 3GKFA 4F2UA 1TB3A 1D3CA 1UUOA 1A5SA 1GKRA 1M7PA 3L21A 1QNQA 4DWSD 5CSUA 5AC7A 4IH3A 1FVPA 4MNLA 4A3YA 4CVUA 3LN3A 4DUOA 1XYFA 3TOPA 4WDTA 2PBGA 3GG8A 3H2AA 3QY7A 3B4UA 4P8VA 4RZBA 3L12A 5GNZA 3P5ZA 2WVUA 4E4PA 5J5DA 4DM1A 1UOKA 4NRSA 1JZ6A 2W63A 3UESA 3BWWA 1UCWA 4W93A 3B0YA 5HMFA 4U2ZA 2WSPA 3REQB 5G2HA 5C7HA 4FI4A 1XBVA 2TODA 3KOFA 5HNUA 2NQ9A 1Y5XA 4ZOAA 1EZWA 3CHEA 1JULA 2MANA 4KCUA 4Q6JA 1MO0A 4V2XA 1EIXA 4E4FA 4AVNA 2RFGA 1PPIA 2W66A 1KXVA 5DCBA 4GBUA 3V1PA 1J0JA 5AC8A 2AL1A 3LG3A 2XVNA 4H9VA 3UEQA 4IM4A 1MZHA 4UFMA 3UPMA 3TZNA 4DNMA 2DU2A 5EMJA 3O05A 3H2NA 3GIYA 2WCAA 3BW4A 1YADA 4TUFA 2WQDA 2FTYA 3GR7A 5BRQA 3E3HA 4RW5A 3W6LA 5D8ZA 1US0A 1OG0A 1OCQA 5A8PA 1DEDA 1TPDA 3OZMA 2WZTA 4FF5A 5CZKA 5F2IA 4A8IA 4W7UA 1W3JA 1A5BA 2OZ8A 3OYXA 1WZAA 4Y8EA 4RNHA 1BRLB 1FXPA 4GCXA 3BCJA 2IPFA 2V30A 2XSBA 4J9JA 3TYUA 3VKJA 3QY6A 4A3RA 3IGHX 2GSHA 1AMYA 3DH7A 2ZRYA 3W6YA 3WK2A 3ANVA 4KBXA 3KBWA 3LM7A 3VIHA 4PMJA 3FSTA 4DNHA 4BKNA 4XAGA 4H83A 4ACZA 3T7VA 3I6RA 4F9JA 1IF2A 1TIWA 2QPXA 3K4DA 4QIUA 5CGTA 2R1KA 3PAJA 4WHBA 1QNVA 4NHVA 4Z1BA 3E5PA 2OMAA 2Q8XA 1KWKA 5AZ0A 4S3EA 4QM1A 5A5WA 1RBOB 3C2FA 4LUSB 1OFOA 5I78A 1QO5A 1QT1A 4LY4A 1T99A 3GU9A 3VCNA 5HWNA 5K4ZA 3EYPA 1WUFA 3PPFA 3DFHA 3GNNA 1FXQA 3D6NA 1KBBA 1HGYA 5CQ1A 2YJQA 3VKCA 1EXBA 2ZDRA 4IPLA 3VDBA 2KZHA 3C61A 1ZPTA 4MF4A 1H60A 3E0FA 4GGHA 1MUWA 5DF0A 3AIRA 4NAFB 5CSYA 4E8CA 1ITUA 2FB2A 3C4UA 2HEJA 5GJNA 4LC8A 1V3LA 1BAGA 5C2GA 3AAMA 3N14A 2HROA 3KWXA 5DRIA 4AZCA 2RUSA 3EXTA 4GYPC 1E6ZA 4JNYA 2WVSA 4PCTA 2WNNA 3W29A 3C5QA 1SO5A 4JL1A 2VVSA 3PZVA 1R2TA 3W7DA 2HVMA 2LLEA 4IG2A 3CV1A 3AZTA 1TV8A 5I3KA 4QCEA 4JGDA 1CGTA 2CNCA 3F4DA 2NQJA 2PB1A 5J8LA 3L2IA 3EWUA 3HG2A 4U3CA 3BH4A 2V6AA 2Z2AA 1GQIA 4AH7A 4R34A 2YYUA 1AMKA 4KT2A 1W9UA 2X0YA 2E3ZA 4LPCA 1TG7A 4CEUC 4JXCA 5C2XA 3VIGA 3KDOA 1J93A 3LEPA 5LA0A 3IJ9A 3FHQA 1HGWA 1ZS2A 4HB7A 2E9LA 4Q7BA 2Y2WA 4LS0A 5A6BA 1J4EA 1EQPA 3DFSA 4QSHA 1ICSA 2PFHA 1ZGDA 2QHAA 3HGJA 1PKMA 4PGLA 2Y85A 2DVUA 3BDKA 1S38A 2XHYA 1VJSA 2YCLB 2WKLA 3V4BA 1T8QA 3BOFA 4POCA 1A5OC 4LCQA 3POHA 3AHXA 4ZA0A 4GH1A 1B4KA 3NOEA 4GABA 2FGLA 1G5AA 1Q7ZA 3W1RA 1K6WA 2ISWA 1AQ0A 2PP0A 3OJGA 1RZMA 1MRQA 1REQB 2ZZ5A 1XUZA 2V5BA 4ZTYA 2EHHA 3MV01 5CPOA 3SR7A 3DERA 2JBMA 2QIIA 3GC4A 1JF6A 3VGEA 4HK6A 4PUUA 1J8VA 3NO5A 3R58A 3FDGA 4LGXA 4F9DA 4GWEA 4E2OA 2JF6A 4C1LA 3LSCA 1KNWA 1L9WA 2FHFA 3LX9A 3WJXA 1Q7MA 2QAPA 1A53A 4U33A 1OZMA 5DY2A 3CUHA 4IJBA 3S5YA 1C90A 4A8LA 5C9UA 2EG6A 5FEXA 1EGZA 5C70A 2IKHA 1DWJM 1YBQB 4I8DA 1QTWA 3QHNA 3GK0A 5FJIA 4PH6A 3BZGA 3TU9A 1GVIA 4AW7A 5B80A 2W6RA 3P81A 4UTJA 3ABOA 1F3XA 3DOPA 3W7MA 1JI1A 3K8MA 1FWDC 3NQ7A 1TPH1 2ZX7A 2EJAA 7TAAA 3S1UA 4GY7A 4OUEA 3PY2A 3CGTA 4TMBA 1KM0A 4WOQA 1H7RA 3QW3A 4INFA 4PB3A 1DORA 1MXDA 1ITXA 2PDHA 1QI5A 3O6DA 3HGSA 4O1BA 1F61A 2I1OA 2WHLA 1XQKA 3T8LA 1PDYA 1FCQA 4TIMA 4BQ4A 1Q6EA 1QW8A 1LT8A 1VGAA 3AXHA 4KETA 4HA0A 1FWTA 4BY3A 2D1ZA 4HHPA 4H19A 3UGRA 3Q37A 4H6RA 2OLHA 3L4YA 2ABBA 3TJLA 3KUMA 2Y8VA 5HR6A 3QZAA 4AZGA 1WDSA 3PFMA 4C7FA 5HDRA 4GX9A 4LB3A 4QHRA 3GTNA 3WQ8A 1GGOA 2J79A 1W1B1 1DPMA 4US6A 4DBSA 1R87A 3O63A 3G1SA 3WJWA 3VMOA 4FR1A 2VFIA 4JBRA 5C2CA 2AAMA 4GJJA 4AU0A 1YHTA 1HKJA 3FYOA 1K7EA 1OCNA 3TWAA 5F4SA 2BASA 4OV4A 2ACUA 4GUGA 3DC0A 4ZENA 4NXKA 4X63A 1S2VA 2UV8G 4BQ3A 1PKYA 1SSDA 2P76A 3TNBA 4QG8A 2OGYA 3V36A 4KEUA 2BNJA 1M1BA 3DZ1A 1SFJA 3MV11 4ORMA 4ZTXA 3WJYA 3M9YA 4ZQOA 1E4IA 4EOUA 4K7VA 2JIWA 1UA7A 2EG8A 5E1QA 2H6RA 3TH6A 3RIKA 3CUFA 4AY8A 3WSUA 3WK1A 1GZGA 4I7UA 2J8TA 3VVGA 4Y9AA 4YMZA 1F8IA 2NXIA 4N9DA 3GC5A 2Y0FA 3T6CA 1U22A 4A8RA 5F2MA 2PDBA 4Y9NA 1L2UA 2OWWA 3B04A 1G69A 3EOEA 3IACA 3RAOA 2G96A 3OVPA 3ZM8A 2C19A 1E0UA 4F66A 5IM51 3KTXA 2VQUA 1EYWA 4AIEA 3ZVIA 4S3GA 4QDPA 4Z2GA 4GQQA 3SBFA 4IIEA 3BAXA 1K8CA 2PTXA 1FX6A 3LI1A 2FFIA 1UZDA 4HGXA 3VIIA 4GIEA 2WBGA 3GVWA 4GJ1A 2WVVA 1DJXA 4NVTA 1V5XA 2AL2A 4TVDA 3R11A 6XIMA 1U5VA 4LVAA