3LTSA

Crystal structure of the mutant v182a,i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAAIVGRSIYLADNPAAAAAGIIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 81
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltsA00
5D03A 3I68A 4MPQA 2RHGA 1FWRA 1MEIA 2FQIA 4FNPA 2X30A 1VC4A 3U8GA 3C2OA 4DXVA 4FNTA 5AYYA 3DI1A 5BW6A 3P84A 4UTWA 3L5LA 4AWUA 2CLHA 3EX4A 1KFKA 2HTMA 1XC4A 3GR8A 4LRTA 4UTTA 3UZ5A 5I3HA 3A22A 3SGUA 1S5VA 1TTIA 4O1CA 3U6WA 5BRBA 4NZFA 4S2CA 1XUUA 3C2FA 3GDKA 5LKYA 2ZA2A 1OYAA 3LRKA 4AEOA 1RQEA 1VCFA 4PL1A 3TV8A 2FPTA 5KMYA 1O60A 4M7TA 1FWWA 1YLVA 3W2LA 4TU1A 1FXQA 2CLOA 2Z6JA 3IIPA 3NZRA 1EP2A 1XKYA 3O6CA 1GJPA 3MBDA 4O11A 1XBXA 2C3ZA 1TPEA 2XN1A 1DHPA 4O10A 2Y6ZA 4FIQA 4LVGA 5CSSA 3TFXA 4NJGA 3MI6A 4H3DA 4ORIA 3G22A 3RMJA 3SW6A 3PR2A 4O18A 1SW3A 4DO4A 1QPOA 4ZQRA 3N9SA 4DBDA 4TMCA 3QF0A 2WJZA 2VFDA 2YGYA 4LC6A 4CNPA 1PCKA 3NNTA 3CHVA 5K9DA 4RK8A 1IXNA 3OVQA 1FCVA 4TIMA 4KFNA 4MZYA 5K9CA 1N55A 4UFIA 1GQNA 2VFHA 4Z08A 1IGSA 5HNRA 1K7FA 3CU2A 5H91A 4YL2A 3HGRA 2HMCA 4QIUA 4YXGA 2O7QA 4UFKA 4FEZA 3VE9A 4GWEA 3OVPA 2AAMA 2QR6A 2YYTA 4LVDA 4K36A 3TQKA 2X2GA 1JCYA 4PEKA 4YCOA 4HPJA 2EAWA 3DFNA 3FJLA 1X1OA 4Z1BA 1H63A 3NZ1A 1W54A 3STCA 2J6XA 5AHNA 1SZEA 1ICSA 1I45A 5DXYA 4WX2A 4N6EA 4LV9A 3CEPA 3IIZA 3HO8A 2A21A 4MZ8A 3C6CA 1FXPA 3B05A 4GJ1A 5HR7A 2WNQA 1ZAHA 1WQ5A 4JR5A 3STFA 1OX5A 1W5NA 2RDTA 4RXGA 2CW6A 1IF2A 1B4KA 7TIMA 3I7SA 3WJWA 3EKLA 4ADTA 4HSNA 1CW2A 1LRTA 4ZZ9A 2ZA3A 1SO6A 1XCFA 1W0MA 4CCEA 4JEQA 4BFAA 1YTEA 4UTTC 5CZTA 2VC6A 2QCDB 1R47A 2XN2A 4IMGA 3EX3A 4EVZA 3L68A 4FO4A 4IWWA 1S5WA 1V5XA 2Y88A 2FFCA 3SECA 1C29A 2QCMA 5EYWA 4JDYA 3JR2A 4HNTA 2RDWA 1LOQA 4WOQA 3IVTA 3FKKA 2NUWA 1TPB1 3W1AA 3W7DA 3PB0A 4GXMA 2ZRVA 4UR8A 2TSYA 1SW0A 3W7KA 4DF2A 2NX1A 1RR2A 1VR6A 1QFEA 3QM3A 3W2JA 3TE9A 4NQ1A 1SZNA 2H90A 3NPWA 1DOSA 3I65A 1W3TA 4UR7A 1Z41A 3L5AA 2FIQA 5SWUA 4ONVA 1QO5A 2FB3A 4GUFA 4RCXA 3DFTA 5EKYA 3L0KA 2ABAA 1QO2A 4M5PA 2V5LA 1PV8A 5HMSA 3RK8A 4LVBA 4CQ9A 1VGAA 5G2WA 3LI1A 5FEZA 1SZGA 2ZDRA 1Q6LA 3NGJA 3NQEA 4UFMA 3LTPA 3W7PA 1RZMA 2PCQA 1P0NA 2VEIA 3ATZA 2OX1A 4FNSA 2GPTA 4PTNA 2ZFAA 4CLMA 2E6YA 1SSDA 3G3MA 4G1KA 1KFCA 3PB2A 5BNKA 5G2HA 4QNWA 1GYLA 1L2UA 3TQVA 3M5ZA 4RZ4A 4UTHA 2A85A 2H8ZA 4OT7A 3W87A 3N19B 2B0MA 3IGXA 3NQVA 3NVTA 3PS7A 3C3NA 2QDGA 2YW3A 3W1MA 1ME9A 2E6FA 3WJSA 3HQ1A 3W83A 3T55A 5LGXA 2DZPA 3LXBA 5EMUA 1VH7A 4LT9A 1UUMA 2GVJA 1H51A 3O06A 3R8RA 4RX0A 2GJNA 2VFEA 4JXCA 1JVNA 2OMAA 3GDTA 3PUEA 5HUOA 2J88A 4MZ1A 4RR4A 4QNEA 1QWGA 3DAQA 4X3ZA 1EP1A 3D0CA 4NXSA 4GRSA 1Z42A 2PRHA 3B03A 3P8IA 1VLWA 1F5ZA 3NQCA 3B8DA 1MEWA 2WPBA 3FYOA 1XBZA 1AW5A 4GUIA 3W74A 3PBVA 4FX8A 2FJKA 3VE7A 3SI9A 4C1KA 3DKJA 3C2RA 3BARA 5C54A 3S1VA 4AXKA 5DCDA 3NQ6A 2VKZG 1KBIA 4OWGA 1OVDA 1CI1A 4GUJA 1TRIA 4RJEA 1G7UA 2EF9A 5BOOA 1DKWA 5EY5A 3NL6A 2VFFA 3N9RA 4AAJA 1JUEA 4IJBA 4O14A 3LCIA 3FFSA 3NM3A 2DZTA 3S6DA 3V75A 1SFJA 3O15A 3P62A 2C14A 5CZJA 4A29A 4KFPA 3QJAA 3TDFA 3PY2A 2A1YA 5K7JA 1JCJA 3GX9A 4JTHA 1KFBA 1TTJA 1P4CA 3AO0A 2Z2UA 1C9DA 3MO7A 4QJ1A 4O57A 3DBPA 1NEYA 2VOMA 3GR7A 5FEWA 3BG5A 2J9YA 3MI3A 3TQ0A 2FB2A 2Q3OA 3W7MA 4RZ6A 5CSRA 3L0NA 2G95A 1GEQA 1PVNA 3C52A 3MJYA 3VFLA 1ME8A 1QPQA 5LNSA 3TCEA 4ZQCA 2NLIA 2BZNA 1VHNA 2CLLA 4LTSA 4O0ZA 1J5TA 1SPQA 3P81A 5EA9A 4WUIA 3P67A 4DPPA 2ZRYA 5KZEA 1P0KA 3UXDA 3ABRA 3BW2A 4X9SA 3KVMA 2CLMA 5D2YA 2DJXA 4PCFA 1KM1A 5F4XA 2QCHA 3W1NA 1OK6A 2YFOA 2GQAA 2FDSA 1U83A 1W5OA 2YW4A 1GWJA 1WAUA 2P1FA 3LHTA 3PBUA 4LY8A 3KVKA 1I2OA 2DZUA 2C13A 2OT1A 2C18A 4Z0SA 2P10A 2QUVA 2RFGA 3IGUA 1F05A 3UPBA 3CWNA 3N2XA 3CEUA 3LERA 5F4WA 3PM6A 4HN4A 1EWEA 3KRSA 1GVRA 3CTLA 3NDOA 3M7WA 4UXDA 1WBJA 4MY8A 1VS1A 3IIXA 4JNMA 4PODA 4HHPA 3W7IA 3QH2A 4NNBA 4HNUA 2Q3RA 4Y96A 4ICNA 4N9EA 3W71A 4IMEA 5D04C 1JCLA 3FA5A 1A5CA 1H7RA 1TJRA 2V81A 4TMBA 2YCEA 2C6QA 3PG9A 4LS2A 5BMWA 1FBAA 2DU2A 3LCGA 4UTWC 2BWGA 3R89A 4D2JA 1KM4A 2H8XA 5D38A 4IQLA 2AGKA 3INPA 3OIXA 4FNRA 2JGQA 5LSMA 2GUUA 4GC4A 3QSRA 4OE7A 5T26A 4ZQMA 2QAFA 3LB0A 3W7EA 2WV8A 1M7PA 3KAOA 3W6YA 3CB8A 3M47A 3LV6A 5E93A 2QJIA 5G1YA 3W88A 1I2PA 4OU1A 2H6RA 4DF0A 5GVJA 1K8XA 5IM51 1IIHA 1P1XA 3BV4A 3GKFA 5MHBA 1DV7A 1W1ZA 3W7OA 1GVQA 4N4QA 1YPIA 5HULA 1WV2A 3W72A 1JRBA 5AC6A 1KM6A 2TYSA 3LCLA 1IXOA 3GKAA 1TPFA 3BLFA 2BTMA 3NQFA 5KITA 2JBMA 2GVGA 4ZVJA 4DBEA 3P60A 1NFBA 3BG9A 2Y62A 3YPIA 3GK0A 3GXPA 5FEPA 1FCQA 4O13A 5KINA 1OFEA 1VYPX 2FTPA 1GYNA 2ZTKA 3LX9A 1AL7A 4WOZA 2VELA 1TPUA 3H53A 3HJZA 4DEFA 4NVTA 2QJGA 2C16A 3EEGA 5H2ZA 5BMXA 1I2RA 3GYEA 3LBMA 1DJQA 1SO5A 2J24A 3BG3A 5AC7A 1ALDA 1OF8A 2YX0A 4I7WA 8TIMA 4JTTA 4NJJA 3GXNA 1QOQA 4Z1CA 3TUUA 3O63A 4JX4A 3TW7A 3HPXA 5K4XA 4JYEA 2NV1A 5EPDA 3QRHA 3HGOA 3QQ1A 3W2UA 4L4MA 2Y85A 4WD0A 5HR6A 3W1QA 2H3BA 4JTLA 3PUOA 2Q8ZA 2VEPA 2ZZ5A 3W1XA 4MLJA 3GNNA 4DO5A 4JTUA 2PURA 4YMZA 1R2RA 4H6KA 4LNYA 1TTPA 3EX6A 2Y63A 4WY0A 3CWOX 3W7HA 2A7RA 1C8VA 4K37A 3C56A 3LHVA 4XBSA 1OFAA 2BX7A 4MYXA 4QITA 1OFBA 5FF3A 3IEBA 1GT8A 1WBHA 2B7OA 2QCDA 2ZZ3A 4MVAA 2W0UA 2ZRWA 3C8FA 4LS1A 3T44A 4I9AA 5DCEA 3TROA 2QUTA 2FLIA 1TV5A 3K30A 3TX9A 4UFLA 2ZZ7A 3CQ0A 2VFGA 3C4UA 1H5YA 2ZZ2A 1TPVA 2NWSA 4KKXA 5CPMA 3HPZA 3TH6A 3SJ3A 3HF3A 1LLZA 3L5MA 1EP3A 3W23A 2R14A 4WY0F 4JY8A 3NXFA 6ALDA 3EWZA 1J2WA 2Z6IA 1QNVA 3E0IA 2YPIA 4IPJA 3P5ZA 3QYQA 4EF9A 1KFJA 1B3OA 3C0JA 1OF6A 3M41A 3I7QA 1R2SA 1R46A 3PAJA 4Q4KA 3S42A 3MHGA 4M6QA 1F76A 3B04A 4PL2A 4BK9A 1PHWA 2J9XA 1KM5A 2B7PA 1DJNA 3G1VA 4Y90A 1JCNA 2PE4A 1G4EA 2ZA1A 4UTMA 3P7YA 1W37A 4Z1DA 3M44A 2DP3A 3MWAA 2ZRXA 3MUXA 5G4EA 4JTFA 1H1ZA 2CU0A 3LCHA 3GIYA 3DKLA 2Y7GA 5EL1A 4MYAA 4ADUA 1GG0A 3DI0A 5LNWA 1H7XA 1K8ZA 1U5JA 3NQAA 1JCXA 3FEMA 5C55A 5LGZA 1TV7A 1KW1A 1EUAA 4YWIA 2JKAA 5TBOA 3W2NA 2CLIA 1WA3A 1ZAJA 2CZ5A 2QCLA 1SQ7A 3THQA 3VKJA 2ZZ6A 5I3IA 4M19A 3MP5A 2XN0A 3OG3A 3M43A 1AMKA 4Z0JA 4O52A 1Z48A 1NF0A 1K02A 1LRNA 3G1DA 2ZQ0A 1LYXA 3Q37A 2VEMA 1YXYA 5IBXC 4IMFA 4O15A 6TIMA 1EA0A 3DZ1A 4OV4A 2I14A 3S5ZA 3E12A 1TMHA 2B4GA 1LROA 2EKCA 3E9AA 1LRQA 3MI2A 1WX0A 3CIXA 3UWUA 3A24A 3P82A 1FWNA 4ALDA 3OVRA 3UY7A 3FYPA 4J9JA 3C2EA 4N9DA 5C5YA 1VCGA 1GTEA 5AHLA 1KFLA 1A5SA 1O95A 3P61A 4ZQOA 3TU9A 4E2BA 3L65A 1ZNNA 1V7YA 2CLKA 2ZRZA 4WQ6A 3ZWTA 3A5FA 1O4UA 1TPC1 2ZRUA 4LUJA 5HUPA 3HG4A 4P61A 5F2IA 4Y6GA 2E5DA 4O19A 4FX7A 1D9EA 1X6UA 3SR7A 4ZMGA 2OZ0A 1XI3A 3EWWA 3SIZA 1FDJA 4NNAA 5IBXA 1HFBA 1W5QA 4NJHA 3OEXA 3TSBA 1R2TA 1BTMA 1TYGA 3KRUA 3CLMA 3BO9A 2A6LA 4LOCA 1EB3A 4UNKA 4PFMA 4GUHA 4KWVA 3M16A 3IV3A 5D2WA 2ZZ1A 4BI5A 3Q2DA 4CCDA 1A53A 1H1YA 2WSYA 3O05A 4XTIA 5D2XA 3TXZA 3TIMA 3B0VC 3LLFA 3NM1A 1Y0EA 1S3HA 2WSQA 3BK0A 5L9FA 4A3UA 1JJKA 1W31A 4AHOA 3NA8A 3TSMA 4O0KA 1X1ZA 3EWBX 5CPOA 2LLEA 2WOQA 4CNOA 2YSWA 2I1OA 4AHPA 3R2GA 1PE1A 1H60A 2RKXA 2FPYA 4JTEA 1GPWA 3LHUA 3PSWA 3IVSA 1XXXA 2UV8G 2RH9A 3I6RA 3FS2A 3TR2A 4RXFA 5DY3A 3TSDA 4N9CA 4K7VA 4UC5A 4LV4A 4LW7A 4MY9A 4JDBA 1YPFA 1IXPA 3WK2A 5FESA 3TJXA 1LBLA 1VJIA 3G1HA 3JS3A 2X1TA 4IXHA 4K7YA 1XL9A 3B0PA 4AWTA 1O5XA 4MY1A 4MFEA 4LC8A 2CZFA 4U28A 3FOKA 2V30A 1YDNA 3RLUA 5LZLA 2FPVA 5TIMA 1OK4A 3BGGA 4NXKA 4JTSA 2ATMA 1TSIA 1WYIA 1RD5A 3HGSA 2G5WA 3NYZA 4TO8A 1EWDA 3S5YA 3MBFA 4PA8A 5I3FA 2JKEA 5KTLA 3MHFA 4E38A 1I2NA 2QCFA 1B4EA 4FNQA 5LHFA 3S8HA 1F7BA 1GZGA 4X22A 2A7NA 3G3DA 3HMJG 4NT0A 1WDWA 2JK2A 3DFSA 1OFRA 1TPH1 3W84A 3QMTA 4UTIA 2Z0IA 4OQVA 3W2KA 3WJXA 5AHFA 1YADA 3NQMA 4UNLA 4BI6A 1LM1A 1H7OA 4K8HA 4IX0A 3VNDA 4NU7A 2XFWA 3TC7A 3UY8A 1GVFA 3FJ6A 3TC6A 1UB3A 3O8AA 4KWWA 2H3DA 4OGZA 3LCFA 4XKYB 2NX3A 3ELFA 3ABOA 1TV8A 3LCXA 3S1WA 1ONRA 3MMTA 3GDMA 3W9ZA 3GZ3A 3G1SA 2C0AA 1FCUA 1MO0A 3STGA 1SW7A 1ZENA 2V82A 4RZ5A 1YTDA 4UTUA 2OT0A 4LVAA 3C2VA 4IOTA 5CPLA 3G24A 3IGSA 4AVFA 1KFEA 3HB9A 3TJLA 4ZL1A 1TQJA 4HT3A 2QCCA 1W3NA 2YFNA 1LP6A 1TCDA 3LRLA 1SU5A 4IXXA 2BXVA 2E6AA 3R5EA 2E77A 3LM7A 4ML9A 2CLFA 4PC8A 1DORA 3W1RA 5HINA 2NXIA 3W3OA 4QM1A 2DZSA 5FF4A 5K4ZA 2D73A 4JTKA 5D02A 3P5YA 1W56A 2DZXA 3GDLA 1CX9A 1EX5A 2P0OA 2F84A 2YYUA 4FF7A 1XDLA 4C1LA 1H7WA 2ZZ4A 3C61A 3FIGA 1VCVA 5G1TA 3EWXA 1N7KA 2Y7FA 4CQ8A 3W7LA 4WXYA 3USBA 3KVLA 5FI8A 1QDSA 4MFDA 1QAPA 3DHDA 2ABBA 2VXNA 1KTCA 4MOZA 5DBUA 1HUVA 3EXSA 1T0OA 2Q8LA 2CZEA 2GQ9A 2OCZA 4E0CA 3BLEA 2V8ZA 2EPHA 3EB2A 5ABTA 4GUGA 2E09A 5CZSA 2V5BA 2X1RA 5DN1A 3E49A 5CKSA 5CZ0A 3LCWA 1EEPA 1LOLA 3I7RA 4XQ6A 4FXSA 4I7VA 1TPWA 1RVGA 3A9IA 3N34A 1ZALA 4EF8A 3BGJA 5K9XA 1Z44A 5LNUA 4JYDA 4HPXA 5D32A 2DJLA 1SUXA 2GJLA 1F6KA 3ABSA 3KFTA 5KSWA 1KLZA 1WOAA 3DH7A 4K39A 5D2VA 2F7FA 2RDUA 1H61A 4FIRA 1T8XA 3ATYA 3DFPA 3VI2A 5J5DA 2NX9A 4S2BA 2BLEA 2HSAA 4DQWA 3L21A 1W3IA 3HOJA 2QCGA 1HTIA 4Q32A 4OHQA 3SSJA 5HWNA 4LVFA 1T99A 1W8SA 1QCWA 3TAOA 3FKRA 2VENA 1BKSA 3S5NA 1L6YA 3H55A 5HWMA 4JIQA 2NUXA 1QPNA 1HL2A 1RPXA 3IIOA 4N02A 3O1NA 1UJPA 3NQ2A 1KM2A 4BF9A 4GNJA 2EHHA 1T96A 3M5VA 5DXXA 3W73A 2YZRA 1SSGA 3NL5A 1YDOA 4LWWA 3M6YA 2CWNA 3CC1A 5F2GA 4IMCA 2QCNA 4RKAA 4N4PA 3PWAA 2Y70A 3PSVA 1K3UA 3W85A 1NSJA 3G8EA 1Q45A 3IIVA 4A2SA 3HGJA 4MUZA 3LXCA 3UWWA 4CCCA 2J9ZA 3S9YA 3KOFA 1VPXA 2A7PA 4UTLA 3LHZA 3KVJA 4XWUA 1YXDA 4JGDA 3TMLA 4W9TA 1NAL1 1OFDA 1FX6A 4XKYA 4AF0A 1Q3NA 1Q6QA 1WXJA 1IXQA 2TMDA 4Z1AA 4IGHA 5AHIA 1KLYA 3DXIA 3W7NA 1ML1A 3NR0A 3LTSA 3GLCA 1PL9A 1DQXA 4O4VA 1VYRA 4O54A 4O1AA 1ZJIA 4BWLA 4O4WA 3QMRA 1ZCOA 1G7VA 3WFAA 2CLEA 1LTDA 3M5YA 2QCEA 3L0GA 3QC3A 4NJKA 1OHLA 1G67A 4XBKA 3T4CA 2HS8A 1H50A 3WK3A 3HIJA 3NL3A 1DVJA 1DL3A 2JKPA 2NXGA 2WKJA 3QQ0A 1ZFJA 4NZJA 3CIWA 1SFLA 3N3MA 3LTYA 1SZFA 2E68A 3LDVA 4JIPA 3GXTA 1TIMA 1E51A 2ZCGA 3A21A 4R33A 2J27A 4HNNA 1TPDA 1NVMA 3G1FA 3W1LA 1KM0A 3LI0A 3G0XA 3UNDA 1XDMA 5K2ZA 5AFDA 3RF9A 1PHQA 3QEZA 2C1HA 3TK7A 2A4AA 2I9EA 3GNDA 2BSLA 1RV8A 4BR1A 3QSTA 1BWKA 3MP4A 3O07A 4YLWA 1L6SA 5LNRA 1LLWA 3W7RA 5DY2A 3CPRA 2VEKA 3P80A 2WNZA 3LXAA 4QQ3A 4LU0A 3Q58A 1ICPA 4JS3A 3IRDA 4X2RA 3MP3A 2QKFA 4NUWA 3G0UA 1S5TA 4RLIA 2DZVA 3W75A 4IX2A 3UWYA 4ZQNA 4JYFA 3NQ8A 2NUYA 4N6FA 3QPZA 5F2MA 4JD4A 1GOXA 3U2OA 4MKNA 1F74A 2TPSA 3PBWA 5A8GA 2ZBTA 1VQTA 4O17A 4AMAA 2DZWA 2GQ8A 3WK0A 3MW7A 5FF0A 2E6DA 3GDRA 4I7UA 4UTKA 1AG1O 1KA9F 1N8FA 4Y8FA 4HNVA 4PH6A 4RV8A 1SO3A 5D05A 3M0ZA 1XBYA 4CQAA 3W70A 3PUDA 4O1DA 2NZLA 4MJMA 3W1TA 3OBKA 1F2JA 5CGQA 3LGEA 3NQ7A 4DO6A 2A6NA 3TXVA 1XFBA 3LLDA 4S1FA 4UMBA 3Q94A 4O16A 4LUIA 1LORA 3OA3A 1KV8A 3SFKA 3HG2A 1K7EA 3DFOA 4EIVA 4XUGA 1UCWA 1L6WA 4A21A 3F03K 5TQLA 1KBJA 3F4WA 3OHIA 1FWSA 1W5PA 1JULA 3O6YX 1FDYA 5D09A 1GTHA 3BPWA 3L2IA 2NV2A 3EX2A 3O6DA 2AQWA 3F1QA 3GAYA 4O50A 5HQEA 4Y9AA 3S5OA 2A2IA 3WJZA 3G1XA 4M6PA 5F1UA 3HBLA 3DENA 3H54A 1H7PA 3KXQA 1LZOA 1H7NA 4FB7A 3EWUA 2KZHA 1QR7A 2Y89A 4ORMA 2X16A 5D37A 2V2CA 2E5CA 1OYBA 3WJYA 5FF7A 4Q33A 1GVOA 1K8YA 1ICQA 2X1UA 4XTDA 1OX4B 5FF2A 1A5AA 5C2XA 3SY5A 1M5WA 1MEHA 5D30A 1SR9A 2ALDA 1GG1A 5G2IA 1GVSA 4UFJA 4BI7A 1ADOA 1VZWA 5I3KA 3KRZA 1JQVA 1JUKA 4XZ9A 2GVLA 2B7NA 4QSHA 1M7OA 5LNVA 5A5WA 3EXRA 4L4LA 1RQBA 2QJHA 2W79A 1FY6A 3JRKA 2QAPA 4OV9A 2C15A 1YXCA 3W22A 4ADSA 4WY0B 1WOBA 3ABQA 3NG3A 1KM3A 3W86A 2DORA 5L6UA 3QMSA 4M7SA 4MJZA 4N9BA 2PC4A 1O94A 1EUNA 1PS9A 4JX5A 4UMCA 1OX4A 4O28A 1A5BA 4AF0B 1EIXA 4O8RA 2CFFA 1XM3A 2ISVA 4NX5A 4IUOA 1OYCA 1TO3A 3GB6A 1AL8A 5CPNA 3L9CA 1RQHA 2ATSA 4UTJA 5DBTA 1I8JA 1OG0A 1JR1A 1KV5A 1VRDA 3DU0A 4LRSA 3DHFA 1MSSA 3G8RA 3B06A 3V1PA 3L66A 5AN7A 4JN6A 1YDVA 3UZJA 3W7CA 4JICA 1AW2A 3PBYA 2HS6A 3NOEA 3O16A 3TA6A 3B0UX 3UWQA 4AH7A 2A5HA 4AB4A 1I4NA 4FNUA 3TFCA 3L67A 2O7SA 4M6VA 3UD6A 1ME7A 2Z1BA 3BLIA 4E2DA 1VHCA 4LS0A 3PVFA 4DF1A 3ANYA 1THFD 5EBUA 3M5XA 3KX6A 1ZAIA 4A22A 1MZHA 1K7XA 1OABA 4JTJA 5U4NA 3E96A 3GVGA 5D33A 4MIMA 4R34A 3MYOA 2ISWA 4DPQA 2YDAA 3NPUA 1G69A 3KHJA 5AB3A 1P5BA 5FEXA 1K03A 1FDZA 3EKZA 4WXZA 2WQPA 1TJPA 1FQ0A 1FWTA 3ZFHA 3RFAA 4QAIA 1I2QA 4OBTA 3VCRA 4UFHA 1TREA 1JCMP 1Q6RA 3LOTA 5HWJA 4IPIA 4KFOA 2PRMA 3AJXA 2B7QA 4IMDA 1SO4A 3S0CA 3GAKA 4HKPA 4WZHA 5AHMA 3QW4B 2V2DA 1QOPA 1H62A 1EPXA 3THAA 3NPVA 3UYCA 2Y7DA 1R30A 4U4MA 2QF7A 1LCOA 2E5BA 1UBSA 5AYZA 3NQDA 5HJLA 1D3HA 2YR1A 3BVJA 3NQGA 1TRDA 3R12A 3G18A 1DBTA 3LBCA 4EOUA 1FCBA 3LRMA 2E1DA 4DELA 3BW3A 3EXTA 4AWSA 3LV5A 3LHWA 4POCA 5I3JA 5AHEA 1TQXA 2TRSA 3CM4A 1OFOA 3T40A 4R53A 5AC8A 2X1SA 3M1ZA 4A2RA 4NNCA 3SZ8A 1TB3A 5CG7A 3TKFA 5K3VA 3NO5A 1YYAA 3W07A 2ZTJA 1KTBA 1PIIA 3RLVA 2WNNA 3EX1A 1DQWA 5KZMA 4BWLC 1NF7A 3S1UA 1X7FA 2R8WA 3DGRA 3W7QA 1HO4A 5J5RA 4O53A 3UWVA 1TTQA 5DLCA 3G0SA 4N2YA 5KZDA 4O12A 4QISA 3T7VA 3QZEA 3FLUA 2W6RA 2G96A 4K8EA 4GFSA 2R94A 2QUUA 1QMLA 3STEA 1X8FA 4HIBA 3T78A 1F6PA 2QEZA 2EGZA 3MHUA 1YTKA 1G4PA 2V2HA 3SGZA 1AW1A 4TX9A 1VLIA 2Y7EA 2NWRA 1UUOA 3QFEA 3HG3A 4UCGA 3DFQA 1ZHAA 2ISSA 1UASA 1F73A 2YXGA 1O5KA 4JTIA 5DELA 3TAKA 4YCPA 3UWZA 1G4TA 2ZYFA 4NJIA 1M6JA 3NPXA 3QW3A 1L9WA 3NL2A 4TR9A 3R13A 1MXSA 4MLRA 3W1PA 4NX0A 4P2VA 5AOUA 2GOUA 5F1VA 1XBVA 3RU6A 3G1YA 4FX6M 3NAVA 1IIGA 5AYXA 3MYPA 1LOSA 3HG5A 4O1BA 5G4WA 3PF3A 1LBMA 2V9DA 4GBUA 1AK5A 4K6AA 1KTNA 2IQTA 1HO1A 1A50A 4K38A 5E1QA 4JTGA 4HSOA 3N2MA 1OJXA 3WK1A 2OJPA 2JGYA 5F2LA 1ZY9A 5I3GA 4UIOA 1BEUA 1JQXA 1BWLA 2CZDA 1OFPA 1LDCA 2QDHA 5LHEA 2C19A 4ZQPA 5G5IA 3PULA 1W5MA 1OX6A 4GE8A 3P8JA 4FHAA 3W7GA 3QPYA 1G6CA 3UXAA 5F4SA 3NEVA 3ZWSA 3F4NA 3HPSA 3B4UA 4UMAA 1LBFA 3RNDA 3BW4A 4R7JA 1Q6OA 3TW6A 3W7JA 2NXHA 1QPRA 3A23A 3P74A 3W76A 3ZS4A 4UUIA 4B5NA 5U7SA 5DCBA 4JX6A 1PCWA 2A0NA 2Y61A 4H4IA 1JUBA 4EWND 1B9BA 3LHYA 2V0TA 2R91A 3EWYA 4WJEA 1JRCA 3PG8A 3N14A 3TMQA 1D3GA 3IVUA 1OFQA 3G1AA 2PRLA 5E0KA 1VYSX 3A5VA 3N73A 1XUZA 4AHQA 1J4EA 1HG3A 3E02A 3CT7A 5D2TA 3ZR4A 4CNNA 3UPWA 1FUYA 1G4SA 2WO5A 3M9YA 4JY9A 2VFIA 3PC0A 3TNOA 3W1UA 4FXRA 2WSRA 3S1XA 3W2MA 1B57A 3UQNA 5C6MA 2G97A
chains in the Genus database with same CATH superfamily
2GJRA 3BAXA 1V0NA 5D03A 3I68A 3S4TA 1P1MA 1FWRA 3VNYA 2V5KA 3WD2A 5A95A 2JIEA 2X30A 5FKYA 4D6DA 5AYYA 1NU5A 5BW6A 2WZEA 5T91A 3C0QA 4AWUA 3E5PA 3OTRA 2G8ZA 4H6QA 3E0VA 4LRTA 3TR9A 3UZ5A 3SGUA 3H8AA 1UW9A 4XSMA 4O1CA 2RDXA 4IP7A 4A8LA 5BRBA 1G9HA 1QI3A 1XUUA 3WYZA 4E3VA 4F0HA 5HMFA 3C2FA 5LKYA 3BWWA 1RQEA 4B2DA 1NWUA 2BS9A 1VCFA 3KCJA 3MWCA 4O8AA 1O60A 2WZIA 1V3LA 4M7TA 3L4UA 1YLVA 4MM1A 1RCXB 2CLOA 3NZRA 3IIPA 5CLWA 1EP2A 3UCDA 3CQIA 4HMNA 5C9RA 4RE3A 3TQPA 1XH0A 3MBDA 4OBRA 5LA2A 3PWIA 3VILA 1QWKA 4O10A 2DV0A 3A3WA 2Y6ZA 4LVGA 1PX8A 3TFXA 1E70M 3MI6A 3IUDA 4DO4A 4JBRA 4EKJA 3IAPA 1EQPA 4G2DA 4TMCA 3QF0A 5GNZA 1PCKA 4RPQA 1LG1A 5K9DA 4RK8A 1HKWA 2AQOA 5K9CA 3ARSA 1N55A 2GWGA 3IGHX 5HAOA 1IGSA 3GQYA 1R0MA 3CJPA 2VHLA 2HMCA 3ITGA 3M0KA 4AZHA 1S2CA 3T42A 2RGLA 3NEHA 1R6WA 4YIWA 4B5TA 1HVXA 4GWEA 3QC0A 4W7WA 2WW5A 4LVDA 2ADAA 3M0HA 3VGFA 4HPJA 3FJLA 1TX0A 5A6JA 1KBLA 2O9OA 3NZ1A 4CQBA 1W54A 3STCA 4PRWA 4DJDD 2J6XA 3S2MA 4Z2IA 3BQ6A 4LUYA 5A2CA 4LV9A 3MUIA 3S2CA 2A21A 2XU2A 3WELA 4FS9A 6ENLA 4GJ1A 4EPBC 5HR7A 1S2UA 1ZAHA 3MDWA 4K68A 3STFA 1W5NA 3FN9A 3PJUA 5E09A 3I7SA 1V7AA 4HSNA 4QLLA 1CW2A 1Z69A 2F38A 1LRTA 2ZA3A 4AY8A 1W0MA 4KWSA 3GRIA 3EOEA 5C7HA 2VC6A 2Q6ZA 1R47A 2XN2A 3EPNA 4DB7A 3MDUA 1Q85A 4IWWA 4Q8NA 5EB8A 5I2UA 1C29A 1OC6A 5EYWA 3JR2A 2RDWA 3QVQA 2ZC1A 3EYPA 1AA1B 1LOQA 3WLTA 2WVVA 1L0PA 3PB0A 3U4FA 1SW0A 1RR2A 2Y5SA 2HNHA 3BOFA 1QFEA 1K9FA 1TG7A 4YYCA 3TE9A 1SZNA 2H90A 3NPWA 1EEXA 4UR7A 3IARA 4B5VA 1HKMA 3N17A 2J74A 1E5JA 1PZ2A 2FB3A 4EANA 3V5FA 3LZ3A 3ARWA 3WNMA 3L0KA 2WANA 1E4IA 2V5LA 1PV8A 5CC6A 4LVBA 3WUEA 5G2WA 1QJWA 1SZGA 3POCA 2ZDRA 3NGJA 1F3EA 1R3SA 2OX1A 5FJOA 2ZXQA 4D71A 1H09A 4PBGA 3ES7A 3G3MA 5EMMA 5BNKA 4RL3A 3CZKA 5G2HA 4IM4A 5GQBA 1ZBKA 3B8TA 2NV9A 2X7WA 3TYCA 1Y8BA 1IV8A 2WPGA 4ROQA 3DUGA 4D8ZA 4A3RA 2A85A 3C3UA 3N19B 4PYSA 3KBSA 3OOQA 2VT0A 2B0MA 5LXXA 3PS7A 5HNNA 3GBEA 3C3NA 3W1MA 3WJSA 2GK1A 3W83A 3CUHA 1C92A 3LXBA 3UR8A 3WNKA 2HBXA 5LIKX 3V16A 3V3WA 2E28A 1BYAA 4RX0A 2ZVIA 1EC9A 5AYIA 2OYKA 1HVQA 3T8QA 1GNXA 5HUOA 3NSXA 4RR4A 1XLDA 1XP3A 2DVTA 4L4PA 3UXKA 2AOSA 3ITXA 1EP1A 3SN0A 4CVUA 4X60A 4GRSA 1Z42A 3SB0A 3URQA 1PTDA 1VLWA 1F5ZA 1MEWA 2VGIA 1GORA 1AW5A 6A3HA 3PBVA 3GIQA 3EDKA 3VE7A 3WQPA 3FVMA 4LUTB 3DYOA 3B8IA 4JTCA 3BARA 2FZMA 1KBIA 4OWGA 4RJEA 5E5CA 1WE5A 2BMBA 2Z7KA 1S46A 3GXDA 5EY5A 2BY3A 3WD4A 4H8NA 2Z1WA 2EG8A 4AAJA 1ZBCA 4O14A 1J2BA 3NM3A 1BSIA 1TV4A 2DZTA 3S6DA 1O1HA 2TODA 3O15A 3P62A 4IUGA 1J0IA 3M0IA 2A1YA 2INFA 1JCJA 2WHMA 1J0KA 3GX9A 1OC5A 1TTJA 1P4CA 3MO7A 3K8MA 1AUSL 5GNYA 4GH1A 4I6VA 1ELSA 4YPJA 1AH3A 2VOMA 5FEWA 3R1ZA 3BG5A 3CAVA 1NFGA 3MT1A 5EBAA 3VIHA 5CSRA 3L0NA 4ASTA 2G95A 5T8GA 2MUCA 1ME8A 1SMAA 3PPHA 1QPQA 1B1YA 1NOWA 5LNSA 4FXFA 4ZQCA 1W3LA 1VHNA 2CLLA 4LTSA 1J5TA 2VD8A 4S38A 5EA9A 4WUIA 3P67A 4DPPA 2P53A 3CUGA 3OP2A 3F4VA 4LJ3A 4X9SA 2WQDA 1JNDA 5D2YA 3AWNA 2P5NA 4US5D 3OYZA 3FK4A 3WEOA 1OM0A 1RY8A 1KM1A 1WUEA 1W5OA 2P1FA 1MNZA 1XYBA 3TLQA 2WHJA 2POZA 2QQ6A 3RAOA 4X2PA 3IGUA 4GQ0A 3N2XA 4A05A 5F4WA 1EWEA 2I17A 2XH2A 3RRAA 2E8YA 4RNHA 4Z17A 2ISDA 2OEMA 1WBJA 4FOJA 2BDQA 1VS1A 3C8NA 4JNMA 4HHPA 3W7IA 5EMLA 3QH2A 4PMRA 4Y96A 5LIXX 3W71A 1MQPA 1A5CA 1TJRA 1E0TA 3CMGA 2YCEA 4C6FA 2Z24A 3RJYA 3BOXA 1TE6A 5DMLA 1KRCC 1KM4A 1DWJM 4J27A 1QNSA 3INPA 2PLJA 3W81A 3BAIA 3AWOA 2GUUA 3PZMA 4ZQMA 3W7EA 1H0GA 2XVNA 4DZAA 3M47A 1EDGA 3LPFA 5RUBA 3UG3A 1QNOA 1H1NA 4DF0A 1OD8A 1K8XA 3GNOA 4ZOEA 1A49A 5IM51 3W82A 3BV4A 5MF5A 3ZT5A 2EXOA 3W7OA 3VXGA 1KXTA 5HULA 4F0KA 1WV2A 3GU2A 3W72A 3MMWA 1K77A 2X09A 1KM6A 2PS2A 1RP8A 5FACA 1TPFA 2A3HA 1C7SA 3NUKA 4ATLA 1GK8A 1DTNA 5HNUA 3BTNA 1DXFA 3P60A 1BHGA 3BG9A 2Y62A 3UZWA 1FCQA 1W2PA 4O13A 3KL5A 3L2MA 1VYPX 3BCFA 3VPLA 1R3YA 4L56A 1D7FA 2XIOA 4DZ5A 4WOZA 3LX9A 2VELA 3BUVA 1TPUA 4ICMA 4NVTA 2QJGA 2YCLA 1F9CA 2PU0A 4LGXA 1DJQA 2R1NA 2F6KA 4A6GA 1J11A 1TR1A 4CQCA 2V5DA 3NWRA 4JTTA 4GZ7A 4NJJA 2DT1A 2PWDA 3TUUA 4JX4A 3HGOA 3GO2A 2KAUC 1QNPA 2Y85A 1UUQA 3MUY1 3KZSA 4JTLA 2Q8ZA 1Z6KA 2Z1XA 1EIBA 2VO5A 2I7GA 2PURA 2RGMA 2AL2A 2IQ0A 3AHTA 1Y7VA 2PTYA 2Y63A 4HU0A 4WY0A 3H21A 1RJRA 5FF3A 2DSKA 1WBHA 3AMKA 1CDGA 5CEWA 2B7OA 4RZBA 3TROA 3DC8A 4LANA 4LUTA 1TV5A 3KHDA 1V6VA 1OINA 3C4UA 4KKXA 1VJZA 1TPVA 2NWSA 2WKGA 1BF6A 4QE1A 3WQ8A 3SJ3A 3BLKA 3W23A 3L5MA 2OWXA 4WY0F 2V67A 4A3HA 1EPVA 6ALDA 3VDBA 4ZSTA 3RITA 4N0RA 3VC6A 2Z6IA 3MPGA 2XVKA 1OADA 1XPYA 1E3ZA 3ZSSA 1KFJA 1R9ZA 3MV01 3G5EA 3TC3A 3PAJA 3MCMA 4IICA 4F0LA 1PJ9A 3KCOA 4ZA0A 4BK9A 1MW2A 1KM5A 3G1VA 4CEUC 3W00A 4KCWA 5CLTA 4MNMA 3P7YA 5REQB 3RX2A 3SCVA 3M44A 5GJPA 2YL5A 2B31A 1HGWA 3ANUA 5G4EA 4MG4A 1HL9A 3QQWA 3VOCA 4XAZA 1U5JA 3NQAA 3UVIA 2V3FA 3FEMA 2WM1A 1KW1A 4AVOA 2VQUA 4NILA 1UD6A 1YKWA 3AYTA 1WA3A 3OIHA 1ZAJA 4E4UA 2CZ5A 3VKJA 2OSXA 5BRQA 3SIMA 4R88A 3V5CA 1P43A 4JPGA 3A4JA 1AMKA 4O52A 3CXOA 3TN5A 1XG4A 3Q37A 1YXYA 4IMFA 1E43A 3DZ1A 3E12A 3G2GA 1LROA 2Z2BA 3OLDA 5AZ1A 4LF1A 3CIXA 3F5KA 2WWDA 4ALDA 3OVRA 3UY7A 5AVHA 3WUGA 5C5YA 4GOAA 3WL1A 1KFLA 1ONXA 1TV3A 1UH2A 3H2NA 1O95A 1WKFA 2VNCA 4NI8A 3TTQA 1ZNNA 2CLKA 2ZRZA 3AALA 4DJFC 4LUJA 5F2IA 4Y6GA 2E5DA 3BOLA 3VYLA 4ZMGA 1E72M 3EWWA 4OOZA 5A8NA 1W5QA 4NRRA 1TYGA 3OHMB 3REQA 3K4WA 4XBJA 1EB3A 4PFMA 1EGVA 4GUHA 1FWCC 1XIDA 4KWVA 4Q4PA 4L80A 3L4ZA 1XLCA 2ZZ1A 1E55A 3RX4A 4GISA 1W1PA 1CTNA 3QOKA 2PDPA 4GACA 2ALRA 4CCDA 2Y5JA 4DYEA 3IS4A 3NM1A 5A2BA 2WSQA 4YN5A 1JJKA 2ZX9A 3GXMA 3LU2A 4O0KA 2LLEA 2J8GA 4Q8VA 1UR4A 4K1GA 5BXTA 1VPQA 4JTAA 4AHPA 1O66A 1H60A 4LPCA 1ONWA 3LGGA 1JI1A 3MUCA 3OVGA 3IVSA 3R8HA 4ZB0A 2Z1VA 4BQ5A 4NKCA 4IIHA 1DWAM 3KP1A 4UC5A 1DWGM 4YVXA 3WX7A 1LL7A 1L8NA 3WK2A 2POTA 3W29A 1VFHA 3TJXA 1VJIA 3G1HA 1PZ0A 5I3DA 2X1TA 4IXHA 1MQRA 3UR5A 3AMLA 1C8QA 2XSXA 2DT3A 4JQ2A 4UWMA 3UU0A 2JQXA 2YBUA 5LZLA 3BGGA 4GQQA 2ATMA 3PTQA 3GHSA 3HGSA 1XYAA 3NYZA 4ROPA 3MBFA 4PA8A 5I3FA 4IL0A 1R9YA 1B4EA 4MNJA 1NM9A 3V35A 1AQHA 1A5LC 1MUCA 3AIRA 3HMJG 1ISVA 4NT0A 3BICA 2OLHA 2E3ZA 4UTIA 1XKJA 3VIFA 1VBHA 3WJXA 4WIWA 1E0UA 3NQMA 4U5KA 4UNLA 5IHRA 1J0ZA 3WLJA 4Q22A 1V0MA 1CBGA 1PDZA 3QOMA 4K8HA 4IX0A 1YNQA 4NU7A 1UD5A 2VL4A 2XFWA 3UY8A 5B7ZA 4RUBA 1XYZA 3LCFA 3CAQA 2NX3A 3ELFA 3ABOA 4QX4A 3MJMA 1ONRA 3F5LA 4Y9NA 4DI8A 2P8BA 3GDMA 4A8RA 1SW7A 2CBJA 3OBAA 1ZS2A 2OT0A 4C7GA 1V3IA 4IOTA 3IGSA 4AVFA 4PCSA 1PB0A 3WNNA 5H6HA 4ZL1A 4INFA 1TQJA 1Z32X 2QCCA 1KGWA 2FH6A 2OXNA 5C9ZA 3EKGA 3UG8A 4H9XA 4PB3A 3T09A 4PC8A 1BXCA 5HINA 1PKYA 2R1MA 2OX4A 5A69A 3EA2A 1WZKA 4JTKA 4MWAD 3P5YA 3ZZ1A 1W56A 3U2CA 1ITXA 2CETA 2PP3A 1U1JA 2KX9A 5IRPA 1PKMA 1XDLA 3CHFA 3EOOA 3W7LA 3HV8A 1JYXA 3FGCB 3MA8A 3KWSA 5DBUA 3VO0A 2CZEA 2OCZA 3OYXA 4E0CA 3EB2A 4I5XA 2E09A 1E1CA 2E4TA 1IHIA 4EPEC 1J93A 4Y9OA 3N34A 1ZALA 4EF8A 5K9XA 3TN6A 5D32A 4MTVA 3VMNA 3ABSA 1H11A 4AFYA 4C6CA 1WOAA 5D2VA 3BXWA 4J7RA 3WFLA 4NZCA 1E1EA 2QJJA 3CZEA 2V6AA 3DFPA 1W8GA 3KLLA 2NX9A 4S2BA 1PBGA 2DUXA 4DQWA 4YJ5A 3BQ5A 5A6TC 1HTIA 2FGLA 1W9PA 4Q32A 1T99A 4H8UA 1LJYA 2VDIA 1FFQA 3GFZA 3K4AA 4U3AA 5J8LA 4OKDA 1IEIA 2E9LA 3S5NA 4MMWA 5A6BD 1TFVA 2NUXA 1QPNA 1HL2A 2X41A 3NO3A 3T0DA 4W8LA 1U5HA 1RLDA 5DXXA 4LWWA 1CGUA 2W62A 1XS2A 2QCNA 4RKAA 2Y70A 3PSVA 1K3UA 5C8BB 1Q45A 4QAWA 7ODCA 2WZHA 1OT1A 2A7PA 5FJTA 4JGDA 5EFFA 3WEMA 2PDGA 5B80A 3WDRA 1WXJA 4KRUA 3DXIA 2Y5EA 1ML1A 1H2JA 2XGIA 1B3YA 4QEHA 1LL4A 3TLLA 3COTA 3VD9A 3QFWA 1ZCOA 4GY7A 1V77A 3QC3A 4NJKA 1D8WA 4I3GA 1G67A 4XBKA 3WK3A 4IIBA 3NL3A 4LNCA 2JKPA 2NT1A 2YXXA 1XLKA 2WKJA 4DWSA 1ZFJA 4NZJA 3LTYA 5JQ9A 1SZFA 2E68A 3LDVA 4I8YA 3GU1A 3GXTA 4R33A 2J27A 1NVMA 3GZAA 3G1FA 3W1LA 1KM0A 3GTXA 1QXLA 4HVXA 5AFDA 1PHQA 3WO8A 2C1HA 1C90A 3WLPA 1RV8A 1BWKA 3MP4A 3O07A 4YLWA 1L6SA 4C6OA 1LLWA 2W91A 2F6UA 2WNZA 3SCUA 1ICPA 1A4MA 2QZRA 3RO6A 3OLIA 3JUGA 1E6PA 2XUCA 2VX6A 2PDFA 1LUCA 3QTPA 4N6FA 3QPZA 4ZO8A 2JE8A 5CC3A 4MKNA 3ARQA 1FH9A 4AEEA 3PZUA 2CHOA 5A8GA 2ZBTA 5E6YA 3WMSA 4KERA 1AD1A 3MW7A 3GDRA 4I7UA 1AQMA 3HA1A 1HKKA 3W28A 2DVXA 1KA9F 4O1EA 4L65A 2OSYA 4DZIA 1SO3A 5D05A 4W8AA 1XBYA 4CQAA 3W70A 2G3NA 3PUDA 4O1DA 3EZ4A 4MJMA 2ZUMA 1M68A 2DUZA 2GGEA 5JBDA 4U10A 5CGQA 4Q4SA 2AMGA 4IFKA 3NQ7A 3TXVA 3LLDA 3RCNA 3Q94A 4O16A 4GA8A 1LORA 3OA3A 3UJRA 4DI9A 2VDHA 1K7EA 3UF9A 4XUGA 1S2AA 1UCWA 3MB9A 4A21A 3CHDA 2ODOA 5TQLA 8A3HA 1F4HA 3OHIA 1UD2A 1W5PA 4MWAE 3AS1A 3AIBA 2EBNA 1XG3A 4G56A 1GOIA 5D9NA 3L2IA 3SN1A 2ZX7A 3B0YA 3AUJA 3EX2A 1BXNA 4NIRA 1A5UA 3IV8A 5HQEA 4DJED 3HBLA 5A8PA 1G5AA 1LZOA 1POKA 4MWAB 2KZHA 3WQFA 4NZ5A 2Y89A 4ORMA 3BSHA 2V2CA 2E5CA 1GVOA 2X1UA 2ZDSA 1TA3B 2FVKA 3GY1A 3GDBA 1GZJA 1VPYA 1SR9A 4GXWA 2ALDA 3WLHA 3N6QA 1UZDA 4BI7A 4HD5A 2BY2A 2ZXBA 1UIPA 1B9ZA 2ACRA 1JF5A 3OODA 5LNVA 2OOFA 5A5WA 1CLVA 1B0IA 4EX4A 2W79A 1FY6A 1UPPA 2QAPA 1YXCA 2R1PA 3TTSA 1EJ7L 3W22A 3OB8A 3CZ8A 3U7BA 3BAWA 3SFWA 4HA1A 3SCOA 4UMCA 3IPWA 1DJXA 3M0VA 1A5BA 4XAPA 4AF0B 3Q67A 2X0YA 4O8RA 2WSKA 3LPOA 1OYCA 1AL8A 2GFTA 1AVAA 4HHHA 1RQHA 3H23A 1A5MC 1OG0A 4TX8A 3DHFA 3ZM8A 2BOGX 1XLLA 3G8RA 2QJMA 1RJPA 1OSEA 1V93A 3BCJA 3P6LA 4JN6A 3UZJA 3T81A 4ZFMA 1Q7ZA 4AG0A 4PRRA 2DSUA 3DFHA 4KCUA 2BHUA 3I4EA 3RPTA 2V63A 3GNXA 3N4EA 4GX9A 4UZSA 2BB0A 2Z1BA 3BLIA 1JPKA 3UPMA 3VOGA 1AZ1A 1SFSA 5C2GA 1XCXA 3KX6A 3HZ3A 4J2PA 1R5YA 3NZGA 4JTJA 4M3PA 3N2CA 5U4NA 1NOUA 1NARA 1BGGA 2GYIA 4PN2A 4XD3A 2CCRA 4IT1A 5A8QA 3NPUA 1G69A 1CGVA 4KESA 2VR4A 5AB3A 4GI8A 3KDOA 3URBA 1A4LA 1TJPA 1DP0A 1GQLA 4QAIA 4HQVA 4L7ZA 4UFHA 4JIEA 5HWJA 2PRMA 4IMDA 3GVVA 4F66A 1SO4A 3AYVA 3S0CA 2VRQA 4HKPA 2Q09A 2QDDA 4LALA 3QW4B 3ONCA 3U9IA 1SR0A 2W63A 2W9MA 1NDVA 7XIMA 3WLIA 3VKDA 1CGXA 1LCOA 4L1GA 3BVJA 5HOSA 2ACUA 4PULA 5CJ5A 1FCBA 1HNYA 5A6AA 2E1DA 4DELA 1LWIA 1A5OC 4US6A 4AWSA 4HPHA 3LHWA 5I3JA 3BJSA 2NVAA 4MAZA 1OFOA 3T40A 4R53A 1MRAA 1EBHA 4UQDA 3M1ZA 4A2RA 4NNCA 3SZ8A 1P48A 2I5IA 3PNZA 7REQB 5K3VA 1YYAA 2YL8A 5G4HC 3EX1A 4FA3A 3T2PA 2YZ5A 3QHMA 1X7FA 4X0NA 1X1NA 5J5RA 4X0VA 4TTUA 5DLCA 4PCNA 1JD9A 4LAZA 2PTZA 4B9YA 3QZEA 3FLUA 2W6RA 2G96A 4K8EA 4QR6A 3APGA 2CKRA 3T78A 4HIBA 1E15A 1F6PA 2EGZA 2QEZA 4E3TA 3MHUA 4C6MA 1F8MA 1VLIA 2G3FA 2PCEA 6REQA 4UCGA 3ABXA 2ISSA 2PI6A 2YXGA 5DELA 4P8VA 3TAKA 4HJFA 3LPPA 3OZYA 3DCPA 3H4GA 4HOXA 2OZTA 2E9MA 2HK0A 1BVNP 5F1VA 1XBVA 4FX6M 5ENLA 3IRSA 3WDHA 1US3A 1LOSA 3HG5A 3I3EA 3G6LA 3N18A 2A79A 4GGHA 4HMDA 1AK5A 1XIBA 3HFTA 4S3GA 4F8XA 3H2AA 2IQTA 1VBJA 5LXEA 2GGHA 3IACA 3N2MA 1OJXA 4WJXA 2OJPA 4L4OA 4B3LA 3I4KA 3ARZA 3WQ5A 3MUZ1 4NAFB 1E6ZA 2WM0A 1Q6EA 4JTDA 3OGSA 2CZDA 1WKEA 3QR0A 1OFPA 5LHEA 3RU8X 2NT0A 3WN6A 5G5IA 3PULA 4GE8A 4F0SA 2EJAA 1J6PA 3W7GA 4JCLA 3UXAA 3KS6A 4CU8A 5F4SA 1NWSA 4FAMA 4L9XA 4IGSA 2ANUA 4H9TA 4JHMA 4WJ8A 3C5QA 4ZXOA 3RNDA 4R7JA 2ONEA 2P3EA 3WY1A 1QPRA 3A23A 4E8GA 1RHCA 3ZS4A 4UUIA 5U7SA 2FZDA 2QT3A 4JX6A 4GI4A 1B9BA 1BRLB 1JRCA 2C1GA 1F61A 2E9BA 4IZGA 3N14A 3ARUA 2QIIA 2PZNA 3TMQA 2I5GA 4US5A 2J13A 3B4YA 5BWFA 4JL1A 5HK4A 3VNMA 1XUZA 4RW5A 3E02A 3CT7A 5D2TA 4ZB2A 3ZR4A 1FUYA 1G4SA 2D0HA 4JY9A 2VFIA 4Q8QA 3TNOA 4F9DA 4UQBA 1UWAA 3W2MA 1UPMB 1B57A 1PAMA 3IJQA 3KWXA 5C6MA 1DWHM 4BF7A 3XIMA 1Y65A 4MPQA 2RHGA 3EMZA 3GE7A 2E25A 1EF3A 2OLAA 5I06A 1VC4A 3U8GA 1EJRC 4DXVA 1ISZA 4FNTA 3DI1A 2C8NA 1DJIA 1EZWA 1NELA 4UTWA 4I5UA 2VX7A 3A4WA 3L5LA 2VUNA 3A4XA 1XC4A 3HMCA 4IIGA 2XGZA 5A3HA 4FPSA 1B90A 1TTIA 3U6WA 3RO8A 1XYMA 4NZFA 2J6VA 1AZ2A 4DAIA 2ZA2A 1OWQA 2I9UA 1K6WA 2G3IA 1FWWA 5H1WA 1QI2A 4LYRA 1YE4A 4BY3A 3H4WA 3VA8A 1XKYA 3RR4A 1GJPA 2OGJA 1JI2A 3ZSTA 1VFOA 1GUVA 1XBXA 3CNYA 4CNTA 4NASA 2X42A 4L6HA 4MSSA 4PTWA 3WMCA 3WBEA 4FIQA 3VGHA 3CS2A 3G1RA 2OPJA 4EXAA 3SW6A 1IZCA 3FYYA 1W1TA 1W1B1 1U22A 4DBDA 2FVMA 2F2KA 3N1AA 4LC6A 3NNTA 4TX6A 3OGVA 3CHVA 4KEVA 1IXNA 3OVQA 4URIA 4H01A 4U5IA 4MZYA 1KC7A 4OOUA 7PTDA 4ZCWA 1NWTA 2VFHA 1HW6A 1W9VA 4YL2A 3HGRA 4PFHA 2GDVA 3GFYA 3DYPA 1MXGA 4H00A 4FEZA 3DX5A 4M51A 4XZWA 1LT8A 4CN6A 2AAMA 3O0FA 2QR6A 1LWJA 4K36A 3TQKA 4YCOA 2P3ZA 3N04A 4F2BA 1H63A 2ACSA 5BU6A 1Q8JA 5C7VA 3ARPA 1SZEA 4W7UA 4N6EA 4J3SA 4IFOA 1FWDC 4PCPA 3SN4A 4MZ8A 3C6CA 1VEMA 1GVEA 3VNJA 3QY7A 4KWUA 3B05A 4FXJA 4F40A 4B90A 4LUSB 1WQ5A 4QG9A 2PPGA 2VC7A 1OX5A 2NQ9A 1B4KA 1K9DA 3WJWA 2I56A 3EKLA 4C1NB 4IL2A 3VU2A 1LQAA 1K9TA 4MB4A 1XCFA 1REQB 2OQHA 1WKDA 4BFAA 1YTEA 3GC5A 4R7WA 4IPNB 2QCDB 4Z2GA 2GVYA 3EMCA 5DT5A 4DNHA 4YTRA 4EVZA 2Z25A 1S5WA 1W9DM 1VFTA 2E0PA 2FFCA 2VZVA 2QVNA 3NDYA 4HNTA 2WAGA 1Q13A 4DJDC 3IVTA 1PWMA 3VABA 1IWPA 4GXMA 4KQNA 2D20A 1CENA 2ZRVA 1VFLA 3W7KA 1WDPA 4DF2A 1VBUA 3W2JA 5DANA 4NQ1A 3I65A 2OZ3A 4D6HA 1UR2A 2EQDA 3VCNA 1QO5A 3S9IA 4C6KA 4DUWA 1UH4A 1QO2A 3ARYA 4M5PA 2VR2A 3KL3A 5HMSA 3QTGA 4CQDA 3LI1A 1NFPA 1LG2A 3OO2A 1Q63A 1XLJA 1Q6LA 4C90A 3TN3A 4HU8A 1TCMA 2PCQA 2ZXAA 1PYFA 3WIJA 3ATZA 3RCMA 4M29A 3QZ6A 3OQEA 3QBUA 1UKTA 1JPIA 2ZFAA 3TWAA 3UJSA 3M46A 4CLMA 1XCWA 1ISYA 5DX7A 1X6NA 3RR1A 3ITOA 4UTHA 9RUBA 2DQXA 2OQLA 2H8ZA 1PX4A 3NCOA 4MJ2A 3F4CA 3CAKA 2Q8XA 3NQVA 3CMJA 3IGXA 1Y5WA 1R87A 4YS1A 2YW3A 4ECLA 3UERA 1ME9A 4KGLA 2E6FA 4LEFA 5EMUA 4HYWA 3ZYZA 5BXRA 2GVJA 2HBVA 1Z7AA 4JN7A 5LA1A 1UKPA 2VFEA 4JXCA 4NYYA 1VFFA 3EBVA 2DEPA 3MZ2A 4MZ1A 1A47A 2NVCA 1QWGA 3D46A 3HQOA 4YTUA 2PDCA 4OBSA 2VC9A 3P8IA 2BASA 4QROA 3NQCA 3ORWA 3FYOA 4HA3A 4FX8A 4I6KA 5C2CA 3SI9A 4JQ1A 3G6MA 3UVAA 1I1WA 5CGTA 1RA0A 7CGTA 4FOUA 5C54A 2A3EA 3NQ6A 2ZIDA 1CI1A 4GUJA 4CD5A 1TRIA 4D8LA 2HZGA 2EF9A 1DKWA 1Q6CA 2E8ZA 2ON3A 2BGQA 1ZJBA 3N9RA 3AXXA 1R38A 2X7VA 1JGIA 3WLQA 4G7FA 3TVAA 3V75A 2EO7A 3F7JA 3QJAA 4IIFA 3TDFA 5T9CE 1KFBA 3SM0A 3IUIA 1PIFA 1C9DA 2H9AA 1AH0A 1P6WA 2QPSA 3SO7A 1CB7B 4NY2A 1NEYA 2ICSA 1EOMA 3O3RA 3GR7A 4QE5A 2J9YA 3OGRA 3APTA 2Q3OA 4NP7A 3W7MA 2CESA 3MQTA 1GEQA 1PVNA 2DSVA 1MZRA 4W93A 4H9VA 2D1ZA 2HXTA 2BZNA 2MNRA 4O0ZA 1HXJA 4ZOAA 1BPLB 4IFKB 5KZEA 2IKHA 3R43A 1IE7C 4DO7A 2NLYA 1OB0A 3UXDA 3ABRA 3KVMA 3IUHA 5KZ6A 1K4HA 1UOKA 3CO8A 4PCFA 2PDHA 1OK6A 1XGDA 4AXNA 3EWDA 3AUOA 5DMNA 4OUIA 4JCMA 3S6OA 3KVKA 3RLHA 2JF7A 2DZUA 2C13A 4IQDA 1MVYA 4MWAA 4E8DA 5BZAA 2P10A 2RFGA 1F05A 4FP1A 4H2CA 2D3LA 3CWNA 3CEUA 3LERA 3PM6A 4MDOA 5BOFA 4DM1A 2X1IA 2G3JA 1GVRA 2PEVA 4QRNA 1FHUA 2GJXA 3DFYA 3ITLA 4M8UA 3U57A 3OPSA 3DECA 1UD4A 2BVDA 3SRDA 1UR3M 4FLSA 4PODA 4XAYA 3VIOA 4ICNA 4N9EA 5IDIA 3FA5A 4WSJA 1H7RA 1FWAC 3AQUA 4Z42C 2C6QA 3PG9A 4I5RA 4LS2A 5CZKA 2DU2A 2DPEA 2INZA 4UTWC 2EPOA 4NZ1A 2H8XA 1XQKA 1MFVA 3NVDA 1KR1A 1E6SM 2JGQA 2QVHA 4GC4A 4HZMA 2J8FA 1YQ2A 1XGZA 3KAOA 1SM9A 4L6DA 1FWFC 4AC1X 5G1YA 4GVIA 3EWCA 1I2PA 4HPNA 4OU1A 3T08A 2DSZA 2GJPA 1O6IA 5D9OA 5MHBA 1RLCL 2QJNA 1YPIA 1AQFA 3S9ZA 3K1GA 2HVMA 3LCLA 3BDKA 4C6QA 2GK1B 3VK5A 3GKAA 3HV9A 3AXKA 2JBMA 2PDXA 4ZVJA 4DBEA 3CUXA 3P14A 5FEPA 3FX4A 3M0MA 1QOXA 1S2VA 4M80A 4KH2A 2AQVA 1FHVA 1ECQA 2QGHA 3H53A 2HK1A 3GVQA 5E6ZA 3IJLA 1XR2A 2BOEX 2XIJA 1OY0A 4DYJA 5BMXA 3F2DA 3XISA 2REQB 1QATA 1SO5A 3BG3A 1JPMA 4Q3MA 5JBFA 4FSAA 1ALDA 4LUSA 3N2BA 3ARRA 1J18A 1QOQA 5LIWX 1UWIA 3IJ7A 3HPXA 4JYEA 4FR6A 3QRHA 3W25A 4W5ZA 1AH4A 1RA5A 3ZXWA 1H5VA 3KRBA 1CXLA 3CZJA 4KIRA 3WF0A 1IGWA 4DJEC 1RP9A 2OODA 3B40A 1QBBA 1KQYA 3G77A 4S3CA 3NZPA 4HHMA 3TYEA 1WDSA 4DO5A 3CK5A 4YMZA 3W4RA 1R2RA 2Y2WA 4CU6A 3EX6A 4C6DA 2JEQA 4JZ5A 1XLIA 3CWOX 4LYKA 4XBSA 3LHVA 2BX7A 4DY1A 4DUOA 3ZLGA 2QCDA 2ZZ3A 1ENUA 2ZRWA 5DCEA 5CXPA 3PJTA 3K30A 3GFXA 1B3ZA 3CQ0A 3L4XA 4ZODA 4G8TA 3ZVHB 1LLZA 4BCEA 1E4NA 4WK9A 1FWBC 4IJCA 5EMJA 2ISFA 1QNVA 4NRSA 4IPJA 3C0JA 3M41A 1OQFA 3LQLA 3PFMA 3S42A 4LXFA 2E1WA 1HJQA 4GI6A 3PP7A 4M6QA 3B04A 2HRWA 1PHWA 2J9XA 4CVWA 1VJSA 2XTKA 1DHKA 3WL0A 2Y4SA 3T0BA 1JCNA 1W1VA 1VFSA 2ZA1A 1W1YA 5A6KA 4UTMA 1W37A 4P7RA 4AX6A 2VQTA 3VIIA 2DP3A 3MUXA 4QCEA 4PB4A 3ZO9A 4YNGA 3DKLA 3EB3A 4ADUA 4XD5A 3DI0A 1GOKA 1H7XA 3RN6A 1JCXA 4AMCA 2QHAA 3PZNA 1BQGA 4A4AA 1DJGA 4YWIA 5TBOA 2QCLA 5I3IA 3MP5A 1CNVA 4C6JA 3OG3A 2HE8A 2L5HA 5AYBA 4JIRA 3O6AA 2RUSA 1Z48A 1LRNA 1HJXA 2PLKA 3G1DA 3D47A 5IBXC 1XIIA 2VTFA 1GJUA 3PAOA 2B4GA 2EKCA 5BYWA 2BBFA 4WHBA 3SQLA 1LRQA 3MI2A 4Z2HA 2HISA 2PGWA 3UWUA 3A24A 3P82A 1FWNA 1PXGA 4N9DA 4GQBA 1GTEA 3N3TA 3MTWA 1KBKA 3LY0A 3P61A 3TU9A 1O12A 3L65A 2DVUA 1MDRA 1TWDA 1A3HA 3A5FA 1ZSXA 2ZRUA 1GOQA 1B3XA 4P61A 2OWWA 4OFCA 1XX1A 1XIMA 2OZ0A 2BHYA 2EPLX 3ZJKA 1FFRA 5GNXA 1FDJA 4NNAA 4QEEA 3FY1A 5IBXA 3OEXA 3TSBA 1R2TA 1E1FA 1P0EA 2A6LA 2G3MA 5M3WA 3M16A 5D2WA 4TXEA 1EX1A 1MRQA 4GVHA 2WSYA 4AU0A 1ZBWA 3B0VC 5E0FA 1Y0EA 3BK0A 3TYZA 1J0YA 3AI0A 1W31A 4AHOA 1BWVA 1X1ZA 4J3ZA 3PK7A 4F79A 3R2GA 1PE1A 4GFIA 3LGDA 1FVPA 2VVSA 2FPYA 3LHUA 3HJEA 4RXFA 2WBGA 5DY3A 4N9CA 2OLSA 2J7HA 4LV4A 4EPKA 3OQ8A 4MY9A 1W1IE 1ZZMA 3QHNA 4JDBA 1YPFA 4S3KA 3JS3A 3CPGA 1XRFA 3WENA 4DXXA 4DZHA 4K7YA 5IFTA 1XL9A 5KETA 1Q6GA 1PO9A 4MFEA 3V7PA 3HQNA 3DIPA 2CZFA 3FW6A 2BGSA 2V3EA 2V30A 1JAKA 1YDNA 3ITYA 5TIMA 4KRZA 3VM7A 5AKQA 1TSIA 1WYIA 1X97A 1L6GA 3CHEA 4TO8A 1SJAA 2JKEA 4JIIX 4AZ5A 4FNQA 3R0UA 4ZGYA 3UEQA 2A7NA 3G3DA 3MZNA 2OO6A 3HFYA 5JIPA 1A0CA 3W84A 4OQVA 3W2KA 5AHFA 3M0XA 1ITQA 2Q71A 4HK7A 1CGYA 2V69A 4Q8WA 5TNVA 1E71M 3EA3A 4GYJA 4RDYA 3SSZA 2IPGA 1NIUA 1UB3A 2Y24A 3TC6A 2CC0A 5CPQA 3O8AA 4AD1A 1B3VA 5M03A 2XIMA 1EO5A 4DJEA 2C71A 1TV8A 4WDWA 4N42A 1HIZA 1T7LA 4QG8A 4XIAA 3WLNA 1HP5A 1OT2A 1FH7A 1C8XA 3K8LA 5HDRA 3U2ZA 1UWSA 3K46A 3G1SA 1VIWA 2C0AA 1FCUA 1MO0A 2D0GA 1OEPA 1XJBA 3WQVA 1ZENA 4RZ5A 1YTDA 4LEQA 1CYGA 1J0JA 2OSWA 3VD3A 4ZTXA 4H19A 1KFEA 4Q4OA 3HB9A 3KW3A 2OQYA 5MKGA 3VZXA 1MMFA 4IXXA 5H8PA 1JZ2A 1UROA 2ZWZA 3R5EA 2BP1A 3FDKA 3LM7A 4ML9A 4YU1A 3W1RA 3W3OA 4QM1A 2PDMA 4ZEPA 1CX9A 1EX5A 4HCHA 2YYUA 3GTFA 5D8ZA 2VD9A 1J79A 3AIUA 2ZZ4A 3FIGA 5G1TA 5M5DA 3EWXA 1BLIA 3OLEA 3RUBL 4MFDA 3DHDA 2ABBA 1XINA 1HUVA 1ZLPA 1QW8A 1T0OA 3T0AA 4JN8A 1EGZA 3BLEA 3NSNA 2V8ZA 1TZ7A 1QRQA 3MUAA 2YOCA 5CKSA 1KB3A 1MI3A 4XQ6A 4FXSA 2D23A 2X8RA 4AUBA 4AVNA 4Q4MA 4FLQA 1TPWA 3A9IA 4L9YA 3W27A 1JPHA 2G41A 3VINA 3SCSA 2GJLA 2CZVA 1F6KA 3KZPA 1WP6A 5E9XA 3BZJA 1KLZA 2RDUA 1H61A 4CD6A 4FIRA 4HPGA 3VI2A 5JXQA 2BLEA 2HSAA 4YTTA 5FL1A 3EDJA 4QQUA 3OZMA 1S3TC 2JIWA 3WLSA 5HWNA 3SSJA 1BQCA 4LVFA 1W8SA 4GVGA 3FKRA 3VZZA 2VENA 4TV5A 2WCAA 4R3UA 2XWEA 1U33A 1BKSA 2XVPA 1LQ0A 1L6YA 5HWMA 4JIQA 4AZGA 1ISXA 1EC7A 4BQ3A 2YDQA 4C60A 3O1NA 1UJPA 3DHUA 2EHHA 2QIWA 3W73A 2YZRA 2CEQA 2A3CA 4AD4A 5ECVA 1PZ3A 2OKTA 2CWNA 2W4XA 5F2GA 3RYSA 3PWAA 2P8CA 3BLOA 3W85A 2QPUA 1FWGC 3HGJA 3LXCA 1VPXA 5CPSA 1V51A 3GNPA 1HL8A 4XKYA 3E5BA 4GVFA 4AF0A 4IGHA 5AHIA 1KLYA 4H9UA 3LTSA 3GLCA 1PL9A 3GG0A 3V5OA 1TWIA 2XDFA 1W32A 3KBJA 4O1AA 1ZPTA 4BHYA 1HN1A 1CEOA 2FZBA 7A3HA 1MFUA 3QMRA 3K13A 2YA2A 1UD8A 3WDPP 2AAAA 1LTDA 5CSYA 3WBAA 2QCEA 3L0GA 1EZ2A 2BVWA 1H50A 4KETA 3I3DA 3L2LA 2NXGA 3CIWA 3VGEA 5I5RA 1TIMA 3A21A 2GOKA 1TPDA 2HV5A 3GSMA 4GMEA 3CV2A 3SJNA 3WD0A 4HMCA 1XDMA 1XIHA 6TAAA 3RF9A 5C9UA 3QEZA 3SUWA 3E0WA 3GNDA 2BSLA 4BR1A 2OB3A 5LNRA 3WBWA 2R1LA 4G6CA 3W7RA 3CO4A 2VM8A 2R6OA 3S1GA 3NURA 4S3DA 4JS3A 3IRDA 4NUWA 1E56A 1S5TA 4RLIA 3SADA 3W75A 1UP3A 3TCSA 2DT0A 3UWYA 5CBIA 4LAUA 4DVOA 4JYFA 3NQ8A 4JD4A 1V79A 2G37A 3MY9A 3WH9A 3Q65A 2XWDA 1KGXA 2TPSA 4C5ZA 1XPGA 4JKLA 2PBGA 4O17A 4AMAA 1EXBA 2GQ8A 3VC5A 3EMQA 5I09A 5FF0A 4UTKA 2AGTA 4IQEA 4MGGA 4Y8FA 4RV8A 1ADDA 1V02A 3WBYA 4GYKA 4QTGA 2XIQA 2NZLA 4HOZA 1CWYA 3UGVA 3W1TA 1OCBA 4H1ZA 1KFWA 1C8YA 4UMBA 1Q65A 4ZOCA 4HA0A 1K1DA 1TE1A 3BAKA 3DFOA 4EIVA 3WUBA 1L6WA 4W86A 4AYGA 4W8BA 3SCWA 3F4WA 2CBUA 5CGMA 1JULA 3O6YX 5XINA 4WF7A 3TYUA 3GTIA 3U7VA 4Z2LA 2OKOA 3DEQA 3PTDA 2NV2A 4HZ8A 1V3HA 3O6DA 2V68A 3GAYA 2GLKA 3O2LA 2A2IA 3QLLA 3DENA 1WXYA 3H54A 1H7PA 2DW6A 3W37A 4RW3A 1FHLA 1I0BA 5CCZA 1OYBA 3WJYA 4Q33A 4UOZA 1RSCA 3BLLA 1OX4B 5FF2A 1A5AA 3V4BA 2XJ7A 5I0DA 1EF2A 5G2IA 3ID7A 1GVSA 4UFJA 4C5YA 1GOMA 1ADOA 5I3KA 3KRZA 1EDQA 3I6TA 1JUKA 4XZ9A 1LWHA 2GVLA 2B7NA 4J3TA 3H2OA 4JKMA 4L4LA 3EPOA 2FKPA 1Q4NX 3A13A 5B7YA 2C15A 4LQ1A 1W6TA 1HGYA 3UNTA 2PLMA 4ADSA 1WOBA 3AXHA 3ABQA 2QF8A 3W86A 2DORA 2WMIB 3QMSA 4M7SA 4N9BA 3FVDA 1EUNA 1PS9A 4D6IA 4S3AA 1XLHA 1OX4A 3AHXA 4O28A 2QDEA 4QP0A 1TMQA 4A3QA 1EIXA 2CFFA 1XM3A 2V5JA 3BAYA 4NX5A 3C0LA 3HN3A 2ATSA 4UTJA 1I8JA 1GQJA 1UMYA 5I23A 3VUSA 1KV5A 5GJMA 2QW5A 4C6EA 5AN7A 4U33A 3CV6A 2XISA 2XH0A 1VEPA 4NZ3A 1U5VA 2FTWA 1W3KA 3EOUA 3THUA 3UG5A 1EC8A 1XGEA 1R85A 2HS6A 3NOEA 4RE0A 1UC5A 2WZMA 1SJCA 3UR2A 4JOMA 3UWQA 4KIEA 1I4NA 1T8QA 4M6VA 4E2DA 1ME7A 1VHCA 1MWOA 4DF1A 4D8AA 1P7TA 4RNIA 2DGAA 4A22A 1MZHA 1OABA 5A6LA 4J35A 1M53A 5ABHA 3GBDA 8XIAA 5D33A 3VIGA 3ZIZA 4R34A 3RG6A 2XYLA 3S3GA 4DPQA 2YDAA 1FTXA 5DMMA 3KHJA 4WXZA 4D9PA 1HKVA 3RHGA 1MW0A 1FQ0A 3ZFHA 4XAGA 3FJNA 2WCGA 5D9PA 3K8KA 1QHOA 2CERA 3WLMA 4OBTA 1JCMP 1Q6RA 3LOTA 3TZNA 4IPIA 2DZBA 4PTMA 2B7QA 4GQGA 4KF1A 1KCXA 4DN1A 2PDUA 4WZHA 1UR1A 1SGJA 1CZ1A 1JDCA 2RJHA 3E0LA 2QF7A 4UCFA 4BKNA 4QS5A 4B9ZA 2YR1A 3R12A 2VDGA 3G18A 2VCCA 3LRMA 4S3EA 2FTYA 1K8CA 3EXTA 3LV5A 3BMXA 3CGTA 4EE9A 4UB9A 1WNOA 1TQXA 2TRSA 4BEUA 3VDAA 3SQSA 5AC8A 2J8TA 3BGAA 2GWNA 2YBTA 5HMDA 1V03A 4BZYA 3GXIA 1JD7A 3W07A 1KTBA 1PIIA 3RLVA 3WDJA 1NF7A 1IQ8A 4JIHA 3ME3A 2PDLA 1DJHA 1JG9A 1HO4A 3FNDA 1GCYA 3G0SA 4N2YA 1HQTA 4QISA 1AQ0A 3EDEA 4GFSA 3T2QA 3STEA 1BFNA 1X8FA 4DBSA 1YTKA 1G4PA 2V2HA 2O0TA 2VX4A 3HG3A 1NQKA 2VWTA 1XIFA 4WDTA 3UWZA 1G4TA 1FWEC 2ZYFA 4NJIA 1M6JA 2VURA 2OYLA 2IPWA 4TR9A 4P2VA 5AOUA 2GOUA 4PUKA 1XRVA 3NAVA 3MVIA 2OZ8A 1WB0A 4O1BA 4MAVA 1Q4WA 1V3KA 4K6AA 1XFCA 1KTNA 2V5CA 1FH8A 4K38A 3O9NA 1ZTVA 4Q4QA 4HSOA 1YW1A 3OW1A 3UBPC 3ONBA 3CMFA 3E2SA 4PEEA 3SRHA 4QFUA 1KO0A 4HCLA 5I3GA 1M9HA 3FAWA 3LUTA 1BEUA 1UA3A 5A6MA 4JHZA 1JQXA 3MMDA 1BWLA 2QDHA 4HYVA 1W5MA 1JDDA 1OZQA 2WVUA 1A3XA 2X05A 4HYRA 4L1XA 1SYTA 4QJ5B 1QHZA 4QXIA 2YXOA 4GXPA 3BW4A 4RE4A 4DBWA 1Q2SA 2NXHA 3P74A 1G1YA 3W24A 3AS3A 5DCBA 4HOWA 2A0NA 4EWND 2CBVA 1RCQA 2V0TA 3EWYA 1Y5XA 3PG8A 3GR4A 3IVUA 4IP5A 3AZTA 3WQ6A 1UH3A 3DESA 1VYSX 3A5VA 4XISA 4CNNA 2P50A 3M9YA 1GYMA 1MDLA 1GONA 1RBLA 2J25A 3VMPA 3AHVA 1HJVA 4FXRA 3S1XA 3TZFA 2O9PA 2UY4A 1R3TA 1VFUA 2HDJA 2DH2A 4X9YA 3AAMA 4MDPA 3T1GA 3VGGA 1W17A 1TUFA 1GPFA 4U31A 2WWCA 1DPMA 4E4PA 3VNZA 3N4AA 3AJ7A 3UJFA 2HTMA 4UTTA 1R3QA 2FH8A 3RPMA 1DIDA 2PA6A 1S5VA 4S2CA 4NAEA 4MKSA 4YHEA 1XH1A 4AEOA 3R94A 1EHNA 4G9PA 1DWFM 3TV8A 2FPTA 4HZ6A 1YBQA 3W2LA 4TU1A 4IIDA 5I79A 2CWXA 3H24A 3FGCA 2BXZA 5IXEA 3THCA 1FKXA 2C3ZA 1TPEA 2ACQA 1WCGA 4J28A 5ABFA 3AOFA 1DHPA 4ZO9A 3FXGA 1UKOA 2P0IA 4ORIA 1QK0A 1SW3A 2DZAA 3KTSA 1E40A 1KR0A 3GU9A 2WJDA 3T8LA 2FMOA 2VCBA 2ZXDA 4PUJA 4MF4A 1E5NA 4PMOA 2VFDA 2YGYA 3PPCA 2WCSA 3GVRA 4ENLA 1FCVA 5BCAA 4TIMA 3CBWA 4KFNA 4JQAA 4PZVA 4Z08A 3FJ4A 5HNRA 1K7FA 5H91A 5A6BA 5CBJA 4PE8A 3WQEA 1FWJC 4PMQA 1A0EA 3ZT7A 4YXGA 4HNOA 4DLFA 6REQB 3TWBA 3CYVA 4UFKA 1CECA 4TQTA 3AU6A 3B8VA 2X2GA 1JCYA 5I24A 2D69A 4W89A 4AC7C 2EAWA 3DFNA 4Z1BA 2TAAA 5AHNA 4S3JA 4W84A 1ICSA 1X6LA 1QI4A 2WNWA 5DXYA 1X8CA 4WX2A 4Z2JA 5CSUA 3HO8A 2YB1A 3DERA 1FXPA 2PWFA 1BYBA 2WNQA 5EGRA 4QCFA 1VBGA 2E67A 1BG9A 4GPNA 4AIOA 1RY0A 4JFSA 3V18A 3TONA 7TIMA 5EFDA 3LBOA 4J4KA 1GKPA 4CCEA 1TVPA 3WQGA 4Y9PA 4EP8C 1P0BA 2EEXA 4IMGA 1JDEA 3L68A 4HP5A 1BVWA 4A35A 2GUYA 3BAJA 3QV6A 3U0HA 2QCMA 4JDYA 4WOQA 1UJQA 2UZ9A 3KTXA 1D3CA 4H2HA 4WDUA 3WH8A 2GJXB 4UR8A 4LCRA 2TSYA 1KCLA 3FSTA 3BE7A 3VMOA 1JYVA 4YTSA 3IJ6A 2PWHA 4H7ZA 3QM3A 3WMLA 3VNIA 1DOSA 3H7VA 1W3TA 5I78A 1BG4A 1ZCCA 5SWUA 2GGIA 2VVNA 2VP8A 4IGNA 3AYRA 5DT7A 4CQ9A 3QGVA 1VGAA 3N13A 2CXEA 4CD7A 1P0NA 3ARVA 3QGAC 4HU4A 3N6HA 2GPTA 4DYKA 4PTNA 3MO4A 5ABEA 2XG9A 4KRTA 1SSDA 4G1KA 3PB2A 1QTWA 2DW7A 4ZFCA 4UQAA 4QNWA 1GYLA 3VD4A 2QXWA 3TQVA 4O1FA 3VOJA 1R9XA 1AD4A 3BSMA 3RDKA 4AD5A 4OT7A 3K1DA 3PZGA 4IHCA 4W85A 1S39A 2HPIA 3NVTA 2UY2A 2QDGA 1CLXA 2C1IA 3T0TA 3VNLA 4AY7A 3HQ1A 3H2CA 1IR1A 4LT9A 1ONEA 1H51A 3O06A 3RGTA 4ZB5A 3L23A 3JZUA 5CAKA 2GJNA 2J78A 1XDJA 4PBEA 4PRTA 2OMAA 3PUEA 1GGOA 4CN1A 3WQOA 4OUEA 4X3ZA 2FVLA 3D0CA 4NXSA 2YBVA 4NF7A 2WK2A 4C65A 4JAWA 4KBXA 1VBRA 3B8DA 5FAGA 4GUIA 1RBOB 1DJYA 1M03A 1DIOA 3DKJA 5CC7A 3QPEA 3C2RA 3CPUA 3UG4A 4AXKA 5HNTA 1HX0A 1OVDA 4M82A 2REQA 1KXVA 1OGBA 1G7UA 1BF2A 3ALFA 3WSUA 3NL6A 2VFFA 3KUMA 1F6YA 3W6MA 3V0SA 4AZBA 4ML4A 4ZE4A 4IJBA 1W9UA 3CL8A 2PU1A 1SFJA 2C14A 5CZJA 1VF8A 1W1A1 4A29A 2OFJA 1MNSA 3F2CA 3PY2A 1KNWA 5K7JA 4LB3A 3VIPA 4JTHA 2R24A 3NYDA 1K9EA 4ZENA 2BODX 3H7UA 1EOKA 2FB2A 4PR4A 4RDVA 4RZ6A 3B97A 1JZ7A 1SZRA 1JIBA 3TCEA 2J7EA 4WKAA 2NLIA 2MANA 3WBXA 1S2WA 3P81A 1S1RA 2A3BA 4HN8A 3GHTA 1P0KA 4DJFD 2NQHA 5DEZA 5D8WA 2CLMA 1C9WA 2JALA 3ZVIA 3K2GA 2VRKA 5J04A 2O9TA 3M4HA 3W1NA 4Q6JA 4HU3A 2NQ5A 4XSLA 1I6NA 4C6LA 4GABA 1U83A 4OECA 3OZPA 4H9MA 1GWJA 2D22A 4LY8A 3PBUA 7TAAA 3T4WA 2GDUA 1ZJAA 3LMZA 2C18A 3BH4A 2QUVA 3EDDA 3FV9A 4D6GA 3MSGA 4HN4A 4I8DA 3ARXA 3IK2A 5FOOA 5FJPA 3CTLA 1UZ1A 3NDOA 3M7WA 4JFVA 4JQ3A 3W53A 4KEZA 1QI5A 4UXDA 4MY8A 1GEHA 3GTHA 4M1RA 3IIXA 4DM2A 4HNUA 4XVEA 4J1OA 1W91A 4TMBA 5H8UA 1SVDA 3LYEA 4R7OA 5BMWA 3VX1A 1FBAA 3DG3A 3LCGA 2PTDA 4GIYA 2ZICA 2BWGA 3R89A 4D2JA 4E5TA 3P93A 5IHSA 3PTMA 1IZKA 3S2LA 5D38A 2AGKA 4FNRA 4MPKA 5LSMA 3UW6A 2BHZA 1CT5A 3QSRA 5T26A 2DFAA 3LB0A 1PX3A 2F9RA 1M7PA 1YDYA 3CB8A 2QJIA 4R85A 3W88A 2H6RA 3TW9A 5GVJA 3UZYA 1IIHA 4WGXA 5AZ0A 1F3TA 1PEZA 2Y8KA 3GKFA 2FGZA 3TTOA 1BSLA 3GH4A 3WQ4A 4YHGA 2JF6A 2HJPA 3KBVA 1IZJA 1IXOA 2PGRA 1XYLA 1Q7QA 3AIVA 3VOIA 3H12A 1HZYA 3LMYA 3GXPA 4PTDA 1Z9AA 3EEZA 3VD5A 5KINA 2XFRA 1KQZA 1GYNA 4CNSA 2ZTKA 1AL7A 3HJZA 3KTCA 3VVGA 1JAEA 1N82A 2I16A 2GZXA 4GKTA 2C16A 3EEGA 3RCYA 3PBMA 5H2ZA 3L4VA 1I2RA 4XZHA 4E2VA 3GYEA 3GXFA 3JU2A 3WH6A 2J24A 7REQA 3CL6A 3VKCA 3NOYA 3SUTA 1UWUA 1I75A 1OF8A 4I7WA 8TIMA 4Z2KA 3GXNA 3QKZA 1US0A 4MB1A 3TW7A 5K4XA 2WJEA 4F9JA 2D24A 3QQ1A 3W2UA 1BYCA 2R9RA 3ZJ7A 3VFCA 3R58A 4L4MA 3CWHA 4WD0A 5JUVA 5HR6A 1H3GA 1PTGA 2A3LA 2VEPA 2YCLB 1JDAA 3SCTA 4KCTA 1XYCA 4MLJA 4Q8TA 4JTUA 4LNYA 1TMLA 1JDFA 4GIRA 4P7LA 4JEJA 3VDHA 1LQ2A 3ZJ8A 4GJJA 1A5KC 1OFBA 3D3FA 3IEBA 4NL1A 4JHOA 1GT8A 1EJWC 4MVAA 2W0UA 3MSRA 1T40A 4LS1A 2ZUWA 3AFBA 3CZLA 3CQJA 3TX9A 1H5YA 1M04A 1ITCA 2ZZ2A 1DJWA 3HPZA 1XIJA 3VIMA 3HF3A 3IK4A 1BGAA 4HHLA 5C9XA 3NXFA 1U30A 3EWZA 3CQHA 1J2WA 3E0IA 2YPIA 2XIBA 3P5ZA 4EF9A 1B3OA 1EDTA 3UT0A 4QDWA 5IDZA 4Q4KA 3MHGA 2G0WA 1PZ1A 4CD4A 5AC4A 1BRLA 1XWYA 3ZLFA 1CXHA 4Y90A 3EPMA 2J4GA 2PE4A 4DHGA 2PF0A 2WC3A 2PP1A 2QUNA 4Z1DA 3E3HA 4AY1A 3MWAA 1XICA 2ZRXA 2QULA 4EWJA 1QK2A 1H1ZA 3LCHA 5MKGB 8XIMA 3GIYA 3KE0A 4MYAA 1GG0A 1K8ZA 5C55A 5LGZA 1MYRA 3QV7A 3I3BA 3LK6A 1S5NA 1XRSA 1EUAA 2XH7A 4P8WA 2AKZA 3W2NA 4LBSA 1YX1A 5HJXA 1NOFA 2X0SA 2BY1A 1SQ7A 1F3XA 1E1CB 2ESCA 3W01A 1V08A 2G50A 1ZGDA 2XN0A 3H4XA 3E1F1 4Z0JA 2C79A 1NF0A 3HPFA 1LYXA 2EJ1A 4AD2A 2VEMA 4O15A 6TIMA 3UXIA 1EYEA 5FSDC 3TA9A 1RD6A 3QHOA 1TMHA 3S5ZA 1JZ4A 1TVLA 4GZIA 3BCDA 5FD0A 5E9AA 3W0KA 2SFPA 4FK9A 1R8LA 2VGBA 3B8UA 3L12A 1EQCA 3FYPA 4J9JA 4IQJA 4OTKA 2BNJA 4GZJA 2Z26A 2V3DA 1UWRA