3LTSA

Crystal structure of the mutant v182a,i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAAIVGRSIYLADNPAAAAAGIIES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 81
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltsA00
4GFSA 1AL8A 4IX2A 2FPTA 3RLVA 5KZMA 4ZQRA 3PAJA 1W31A 3AO0A 3PG9A 3PF3A 1W3IA 5DLCA 3TMLA 4ZMGA 1B4KA 2E6FA 4UFJA 2E5BA 2V2CA 3V1PA 4YXGA 3BG9A 5CPNA 2DP3A 4RZ5A 2ZRWA 1XKYA 4GNJA 4RV8A 4AWSA 3DHFA 3LCFA 3TKFA 1K7FA 2V0TA 3GX9A 3QPZA 3TNOA 1FBAA 2QCCA 3L68A 1W3TA 2C16A 4TO8A 4O0ZA 2ZZ2A 2WSRA 3UWYA 4XZ9A 4BR1A 3L66A 1GG1A 4R53A 1OX5A 3DU0A 3G1SA 1IXQA 5D2YA 1LBMA 3LTPA 3L9CA 5C6MA 1W0MA 2X1RA 5IM51 1U83A 4GUFA 3SGZA 2GJNA 3P5YA 3KRSA 5F2GA 4JYEA 4ADSA 1MXSA 1OFEA 1PCWA 4IXXA 4O14A 4O50A 1YXDA 2VENA 4AAJA 3O1NA 2Y88A 2VEMA 3R2GA 4AVFA 1ZENA 3G0SA 5DBUA 4NUWA 4H6KA 4WZHA 1ZCOA 2GQ8A 3S1VA 4HHPA 4OHQA 2F84A 1TPWA 3MWAA 3P7YA 2EHHA 3TW6A 1K8ZA 4IJBA 4IOTA 1SO5A 2Q8ZA 3LHVA 4RXGA 1M5WA 1YPFA 4N6EA 2A1YA 4M5PA 3GK0A 1JCXA 1FWNA 2DJXA 1JR1A 5H2ZA 2QCEA 4FEZA 5K9XA 1VS1A 2Z0IA 3P61A 4K38A 3P5ZA 5K2ZA 2FLIA 4IQLA 5G2WA 3VE7A 2EPHA 1UUMA 2V8ZA 3PUEA 4O12A 5CGQA 4MYXA 1FQ0A 4O4WA 3W7KA 3BLFA 4CNNA 5D2TA 2JK2A 3ABRA 1DL3A 3T7VA 5AHMA 2FIQA 3SZ8A 4HSOA 1TV8A 1TV5A 5I3FA 3B4UA 3TAOA 1QO5A 1XUZA 3W2KA 4CQ8A 2O7QA 4O1CA 1OX4B 2NX9A 4QNEA 3O05A 3C2RA 1LOSA 3W1MA 1LRNA 4OT7A 1R2TA 3TFXA 4DF1A 4HPXA 1WXJA 3W23A 1I2PA 1VR6A 1R2SA 2DZTA 1QNVA 3NL2A 4M6VA 1TSIA 2F7FA 3OVPA 3UZ5A 3FLUA 3A22A 1PIIA 3FEMA 3G1YA 2YGYA 3LXCA 5G4EA 1HG3A 3QM3A 4HT3A 2B7QA 1H60A 1LBLA 4K7VA 4A2SA 4K7YA 5FF4A 3S1WA 1V7YA 1F05A 2UV8G 3C6CA 3S8HA 2WO5A 3NQFA 1X1ZA 2VFDA 2ZYFA 3OHIA 3PR2A 4E2DA 1XXXA 3O06A 3I7QA 2W0UA 3LHWA 3M6YA 1JCJA 3QC3A 1SU5A 2C19A 3W70A 4O8RA 1HUVA 2I1OA 3CQ0A 1QO2A 3NM1A 1T96A 5G2HA 1IIGA 1GZGA 5F4WA 2JKPA 5AHFA 2R8WA 3C2EA 3PS7A 1K02A 3DKLA 3IGUA 3PULA 4FNPA 4MIMA 3ABSA 1DORA 4EF8A 4FHAA 4LVAA 3DHDA 4RCXA 4LW7A 3W76A 3W1QA 1M7OA 3VCRA 2A5HA 1FDYA 5AHEA 5LSMA 3TIMA 3OVQA 2ZRZA 4YL2A 5LKYA 4JEQA 2YFNA 1SZFA 1ML1A 1UUOA 1VQTA 3BGGA 3DKJA 5HWNA 2I14A 4MLRA 1H63A 3T78A 4Y6GA 3N34A 3GNDA 4CCDA 2GPTA 3KXQA 3S5YA 3UWQA 4UTJA 4RR4A 1P1XA 3ELFA 3MO7A 5DELA 4Z0SA 2E5CA 3SR7A 1UB3A 5KINA 1R47A 3WJXA 4RX0A 4FX7A 3W84A 1TREA 3CEPA 3JS3A 7TIMA 3W7DA 1F74A 4JTSA 4LV9A 3G0UA 5HQEA 3LXBA 4MJZA 1XI3A 5CZ0A 4JTKA 5EBUA 2ZRVA 2QCLA 2EAWA 3FYOA 3OBKA 1H7NA 5LGXA 5DCEA 3S42A 3HG4A 4N2YA 3QQ1A 1Z42A 2OMAA 1WA3A 4NXSA 4X3ZA 3N19B 1TRDA 3A23A 3EWYA 4IWWA 4UTKA 3PBWA 4UR7A 3I7SA 2ISWA 5L9FA 1DQXA 3W7EA 3TCEA 3S0CA 4O1AA 1SO3A 1J2WA 5LHEA 4Y9AA 4P2VA 4OWGA 4PFMA 1OK6A 4ZVJA 5TBOA 5LNVA 4FNTA 3PB2A 2NV1A 4ADTA 4H3DA 1JRBA 2GVLA 1OYAA 3KHJA 3A24A 1WQ5A 2VEPA 2Y85A 2GVJA 3MI6A 5CPLA 3W88A 4JX5A 3QSTA 5HUPA 5D2WA 2QCDA 2ZDRA 3CWNA 1H50A 2FFCA 3FA5A 5C2XA 2BXVA 4XUGA 3PSVA 4XQ6A 2WKJA 4O28A 4LVDA 3LV5A 3MP3A 4HNVA 3G3DA 1KM2A 4IMDA 5KSWA 3C52A 3W2NA 2CLOA 3EX4A 3INPA 3K30A 4PA8A 5AHNA 2NLIA 1OFQA 1KM4A 3RFAA 4BK9A 5K9CA 1QWGA 4KWWA 1B3OA 1FWWA 1AW1A 3LHYA 4MLJA 1MSSA 3FS2A 3NPUA 3UPWA 3W85A 5CZJA 5E0KA 3GZ3A 4NJKA 4DPPA 3TSMA 1QPRA 2CU0A 3NZ1A 3SECA 2FB3A 3BK0A 3DBPA 3W1AA 2DZVA 3STEA 1LROA 5C5YA 4HIBA 2JBMA 4AF0B 3G0XA 5DY2A 3C4UA 5CSRA 2J27A 3NO5A 2YCEA 1LCOA 2W79A 2A7NA 3UQNA 3W1PA 1I2OA 2R94A 1W5NA 2E77A 3GDKA 3QSRA 4AXKA 4J9JA 1LORA 4NJJA 5LHFA 5CPOA 1GT8A 3T55A 1DV7A 3DGRA 2WSQA 4MY8A 3LRKA 1VCGA 3UWVA 3MJYA 2RDTA 2FJKA 1KTNA 1X7FA 4DO5A 2R14A 1KV8A 4GBUA 4ZZ9A 3OVRA 3N73A 1OK4A 1WYIA 3W2JA 4YCOA 1OFPA 4ML9A 1KV5A 3W1TA 3S5NA 4UC5A 4ZL1A 2EF9A 3UWUA 4QNWA 3EB2A 2PRLA 5J5DA 1L6YA 2V9DA 5DN1A 3M7WA 3P60A 1O94A 2NXIA 1ZY9A 3EEGA 1SO4A 1GVOA 1TRIA 1YDOA 1U5JA 4XKYA 4Q32A 1P0NA 2PE4A 4NJGA 3SGUA 4NVTA 3CLMA 2ZZ7A 4CQAA 1F2JA 3A9IA 3HPZA 6ALDA 1CX9A 5I3GA 1XBXA 5A5WA 1G4SA 3QH2A 4IPIA 1TPDA 3QW4B 4A21A 5HJLA 4PH6A 3O15A 2H8ZA 5HMSA 3FYPA 1LYXA 5F2IA 1QOPA 1C9DA 3QZEA 2B0MA 2H90A 4Y90A 1DBTA 2XN1A 2H3DA 3OG3A 2CLEA 2FDSA 4JTJA 3DZ1A 1J4EA 1H1ZA 3SIZA 4RZ4A 2ABAA 2FPYA 4MFDA 3S5ZA 1KA9F 3LCGA 1ME8A 4I9AA 1SZGA 3GB6A 5AC6A 2JGQA 1M7PA 1AW5A 1A5AA 3ZR4A 3GNNA 4WY0B 4GWEA 3EKZA 3B0UX 3PB0A 3LRLA 1EP1A 5EY5A 3LDVA 3SY5A 2A6NA 1LTDA 1TPC1 4JTFA 3WJSA 1SSGA 3CB8A 3E49A 1F7BA 4TMCA 3EX2A 2A7RA 4E38A 2QR6A 3W7IA 3W7HA 2OCZA 2A6LA 4O52A 4W9TA 5F1UA 1QFEA 1KW1A 2J9ZA 3W7OA 2VFEA 1OVDA 2YFOA 4EWND 3I68A 4X2RA 1FY6A 2VXNA 3W1LA 1UASA 2Y7EA 3QMTA 4LWWA 3TXZA 4GUGA 1L6SA 1OFAA 1D3HA 5CSSA 2FPVA 3G1VA 1YXCA 2X1UA 3B0PA 4XWUA 4NX5A 5FEXA 3TXVA 4DQWA 5IBXC 4UR8A 1RPXA 3QQ0A 4PEKA 1G7UA 1KFLA 2QCNA 2QUUA 2ISVA 2B7NA 1LLWA 4X9SA 3LLDA 1VC4A 4ORIA 2RDWA 3B05A 3M1ZA 2V2DA 3EWWA 3EWUA 3C3NA 2HMCA 2ZCGA 1ZAHA 3EXTA 5K4XA 4ADUA 5DCBA 1F73A 1S3HA 2CLKA 2VOMA 1G69A 2WJZA 1A50A 2PCQA 3GAYA 3QYQA 1Q6OA 2DZWA 5I3JA 1N8FA 2O7SA 3C0JA 3H53A 3YPIA 2ZRUA 4DO6A 1PS9A 2OT1A 4JIPA 3R5EA 4WJEA 3P80A 3S6DA 3G8RA 4JN6A 5CKSA 1TPUA 1K7EA 4DBDA 2TYSA 4LV4A 3IRDA 1RVGA 3GXNA 3WK2A 3CC1A 3DXIA 1QAPA 1ME9A 1A5BA 1YADA 4FNSA 1T0OA 3IIPA 5GVJA 4UTUA 1JQVA 4JS3A 1I2QA 1YTDA 4JIQA 3L5AA 2P10A 2QF7A 1G4TA 2Z6IA 4K39A 3MMTA 2Y7FA 4BF9A 2VFHA 3NGJA 4QAIA 1BTMA 3M5YA 1H61A 3GKAA 3WK1A 4DF2A 1PV8A 1VHCA 2RHGA 3UY8A 2Y7DA 4S1FA 3TU9A 1SW7A 5FF2A 4I7VA 3ABQA 3R12A 2BTMA 2H6RA 4IMEA 2YX0A 3QMSA 3M9YA 1NF7A 1FCQA 1XFBA 3G1DA 4WX2A 3PBYA 2FQIA 3G18A 5CZSA 3W73A 1VGAA 1IXPA 3W7JA 2RH9A 3KRUA 4MZ1A 1TJPA 4ZQCA 5KMYA 1RQBA 3G24A 3G1FA 4R33A 1GJPA 5HNRA 3MI3A 3LBCA 3L0GA 3LTYA 4KWVA 4PTNA 4O4VA 4BI5A 1JVNA 1QR7A 2V82A 3LV6A 3W2LA 2A2IA 3TA6A 3DENA 1UCWA 3LBMA 3MBDA 1TCDA 1EWDA 1TPEA 3L5LA 3WJZA 2OX1A 4LTSA 3A5VA 3L2IA 2A0NA 2NUWA 1M6JA 1XBVA 1OX6A 1XDMA 1TPB1 4HNNA 4IX0A 2VFFA 3MHUA 4AEOA 4IMGA 3LCLA 3QW3A 1J5TA 1X8FA 3JR2A 3W1UA 3TH6A 3ZFHA 2CWNA 1FCVA 2QJIA 3KVJA 3NDOA 5L6UA 3LXAA 3IVTA 1O60A 2J88A 4U28A 3S1XA 3HJZA 1KM5A 3I7RA 1AW2A 2WNNA 1O5XA 4MYAA 4QITA 2V5LA 4GE8A 1H51A 2RKXA 4UCGA 1B57A 1S5TA 4CQ9A 4UTWC 4HPJA 2XFWA 1NAL1 3FJLA 1HL2A 1KFKA 2WNZA 1Z41A 2B7PA 1UJPA 3W22A 1LRTA 3VE9A 3VNDA 4RJEA 4M6PA 3GR8A 5F2LA 5G4WA 1QMLA 3KVLA 2BZNA 2J6XA 1YLVA 2G95A 3ZWSA 1PL9A 2ATMA 2QUVA 3QMRA 4TR9A 1VYRA 3UWZA 4PODA 4XTIA 2Y6ZA 5HWMA 3NNTA 1LM1A 1JUKA 2Y7GA 3L65A 2BSLA 3STGA 4C1KA 3PBVA 1LOQA 1TTQA 4CLMA 3Q58A 1W5OA 3Q37A 4NQ1A 1P5BA 5F1VA 5I3HA 3A5FA 3MW7A 4IPJA 1JCMP 2A4AA 3B0VC 2TMDA 4ZQOA 3UY7A 4JDYA 1D9EA 4JTLA 3NQ2A 3W07A 1Q3NA 1SUXA 1GVFA 1RV8A 1EA0A 3N2MA 3RNDA 3TQ0A 3M41A 3RK8A 2ZRXA 5FEWA 5BW6A 1FUYA 5HULA 1I45A 3MHFA 3EWBX 2BLEA 3GDMA 1VPXA 3HB9A 8TIMA 4OU1A 4UFKA 2Y63A 4LNYA 2ZA3A 2Y61A 3W7MA 5EL1A 1LOLA 3HGOA 3OA3A 4POCA 1FCUA 1GOXA 3EXRA 4YWIA 1R2RA 4JDBA 3G1XA 3H55A 3GDTA 2V81A 3G8EA 2V2HA 3G1AA 4CCCA 4UFMA 2QCGA 2Z2UA 3CWOX 1OHLA 2V5BA 1OYBA 5LZLA 3E96A 1EEPA 2P0OA 2CLHA 4XTDA 5EYWA 4A22A 1KM6A 2X1SA 2YW4A 1WDWA 3NOEA 2FTPA 3W2MA 2DJLA 1VRDA 3HF3A 2NV2A 1XBZA 4OE7A 1MEHA 3TC7A 2VFIA 1JCYA 4QISA 1KBIA 3M16A 4AB4A 2NWSA 2YZRA 3CIWA 3IIVA 1TTPA 1H7PA 3EKLA 3FKRA 1NEYA 3O6CA 4DO4A 2ZTKA 1LP6A 1JCNA 2ZZ6A 3QPYA 1OF6A 1KM1A 2A7PA 3N14A 1G4EA 1X1OA 1H7XA 5E93A 3W1NA 3P62A 1JUBA 2FB2A 1WBJA 4ONVA 4LVFA 2C15A 3M5VA 3W3OA 3THAA 5H91A 4CNOA 5D37A 1EIXA 3WK3A 4LS1A 3GDLA 4IMFA 5LNWA 5BOOA 2QAPA 2NX1A 3SW6A 4FXSA 3W7NA 3E9AA 1DJNA 4H4IA 5D38A 3DFNA 4LU0A 3VFLA 1TQJA 2QCHA 1SQ7A 4EIVA 2CZDA 1SSDA 2CLMA 1H7RA 5TIMA 1R46A 3L21A 3TR2A 2BWGA 4Z1BA 1W37A 1YPIA 3DAQA 1DQWA 4O18A 3C2FA 4O17A 3ATZA 4E2BA 3FJ6A 2X2GA 4P61A 4UTHA 1KFCA 4DELA 4OQVA 1I8JA 3O8AA 2X1TA 2ZA2A 4HNTA 1LBFA 3DI1A 2PRMA 3RF9A 2OT0A 4HSNA 1H7WA 1Z48A 2JKEA 5FESA 1YTEA 5SWUA 3B03A 2RFGA 3U2OA 1KTCA 4X22A 5AN7A 3LGEA 1Q6QA 3W9ZA 4BI6A 1K3UA 3KOFA 4OBTA 4JTGA 1C29A 4UTWA 1OFOA 2D73A 3FKKA 3UXDA 3L0KA 3P81A 1SW0A 4LUIA 4EOUA 5K7JA 2C3ZA 5ABTA 1EP3A 3NR0A 4UTTC 2VEIA 3BW2A 5EPDA 3NG3A 4QSHA 2H3BA 2NZLA 4NU7A 5D09A 4LT9A 3OIXA 3QRHA 1OG0A 4UMBA 3UXAA 4O10A 1LZOA 4MPQA 3BV4A 3DFQA 4PC8A 2AQWA 1VHNA 3GDRA 5LGZA 2E09A 2ZRYA 3A21A 3EWZA 3TK7A 3TROA 2WOQA 4FX8A 2ATSA 2YDAA 1PVNA 3NVTA 3BG5A 3PUDA 4MZ8A 5DXXA 2ZA1A 3F1QA 2E6AA 3IIZA 3IEBA 5HWJA 5AYZA 5D2XA 1JUEA 3LM7A 3NQMA 1L2UA 1TTIA 3C2OA 5FEZA 1MEWA 2V30A 4M7SA 3HPXA 3USBA 2PURA 4WY0A 3W86A 3O07A 4O15A 1GEQA 4NT0A 3MUXA 1L9WA 1RQEA 1FDZA 3DFPA 3GAKA 4QIUA 3G3MA 1EB3A 4PL2A 3S1UA 3R13A 1HO1A 4JTEA 3BGJA 2Q8LA 1VLIA 2A85A 1RZMA 2QCDB 3S9YA 3TJLA 4OV4A 2QKFA 2PRHA 4LVBA 2QDGA 3GYEA 2VC6A 2H8XA 4TIMA 1N55A 1G4PA 4UTLA 1THFD 3N9RA 3TC6A 3SJ3A 5AB3A 5D05A 3BARA 4KFNA 1JQXA 2Z6JA 4UMAA 1NFBA 1ZHAA 1FDJA 4EF9A 1WOBA 3EX6A 3NQ6A 3HG3A 3GKFA 2VEKA 4JGDA 4B5NA 2XN2A 2EGZA 4I7UA 4O19A 2CLLA 5AYXA 3F03K 2Y62A 3P74A 5F4SA 5BMXA 1G6CA 4O0KA 4WXYA 3UPBA 1AL7A 4E0CA 4ICNA 2CZEA 4Q4KA 1W56A 4TU1A 1SPQA 3O16A 4MOZA 5G5IA 4N02A 1PCKA 3CHVA 3B06A 3DFOA 3BVJA 1B4EA 4KFPA 1TPFA 3HO8A 3MYOA 3IIXA 1IXNA 1TJRA 3W72A 1GVRA 1IF2A 2C6QA 3GVGA 1QDSA 1BWKA 4LC6A 4FB7A 2ZBTA 3PY2A 2G5WA 2CW6A 3M44A 1O4UA 2YXGA 3UWWA 2E6DA 3LCIA 3BW4A 3C56A 2LLEA 1YXYA 1PHQA 3E0IA 1HTIA 1WAUA 1GYNA 4JYFA 1F6KA 3M0ZA 4YMZA 4LUJA 4WD0A 1C8VA 3NQ7A 1KFJA 4XKYB 4N9BA 3SFKA 2NXHA 4FIRA 3LTSA 1PE1A 1VCFA 5DBTA 2WSYA 1CI1A 3I6RA 1FX6A 4LRTA 3W87A 2C14A 2DZUA 1W5QA 4Z1CA 1IXOA 1BEUA 1QPQA 3IV3A 2QEZA 5T26A 3TW7A 3W75A 4ALDA 3R8RA 1OFDA 1AMKA 4DXVA 4BI7A 1WOAA 4WOQA 3KRZA 1DVJA 4GUHA 1ZFJA 2CZ5A 4UTTA 5KZEA 1BKSA 4S2BA 1ADOA 2P1FA 4CNPA 1JJKA 1IGSA 3V75A 4FO4A 4JY9A 1W5MA 4C1LA 5C55A 4ZQMA 1I4NA 1HFBA 3IIOA 1A53A 4K36A 5DY3A 3TV8A 4AMAA 3ZWTA 3N2XA 1GTEA 1F5ZA 4L4LA 5HUOA 1MO0A 1QPNA 4Z08A 2ISSA 3IVUA 1OJXA 4L4MA 3HIJA 3KX6A 2DZXA 4LVGA 2ZZ4A 1H1YA 3W71A 1OX4A 4HKPA 1GWJA 1TQXA 3N9SA 5KTLA 3U6WA 3NQCA 3KVKA 1B9BA 1IIHA 2CFFA 3HG5A 3STFA 4QJ1A 4LRSA 5FF3A 3W7QA 5D02A 5BMWA 3PG8A 5CG7A 3ANYA 4N6FA 5AC7A 4M19A 3M5ZA 4IMCA 5HR7A 4NJIA 1ICSA 3LI0A 4AWUA 2JGYA 4N4PA 3BLEA 4GUIA 3MYPA 4UFLA 5EKYA 3RLUA 1L6WA 4NZFA 4MY9A 2GOUA 2J24A 1T8XA 1KM3A 1X6UA 3QFEA 4BFAA 1WV2A 1YDVA 2ZZ3A 1DHPA 4JICA 4JTIA 4QM1A 3SI9A 4JNMA 2QDHA 3TSDA 5D04C 3IGSA 3M5XA 2AAMA 2GVGA 4K8HA 3PSWA 2WQPA 4NXKA 4AWTA 1E51A 3EX1A 4PCFA 3N3MA 3NQVA 4O11A 5F2MA 2ZQ0A 1ZNNA 1SR9A 1TYGA 1VCVA 5HR6A 2NX3A 1RD5A 3P8IA 3GXPA 4EVZA 3LRMA 1FXQA 3LHZA 3TE9A 4M6QA 4UTIA 3M43A 4MZYA 4AHOA 1MZHA 2YW3A 4PL1A 1QOQA 3AJXA 3EX3A 2NXGA 3NQDA 1OFRA 2TRSA 5D32A 2AGKA 2QAFA 4O1BA 3PM6A 2BX7A 1H62A 4K37A 3TQKA 4YLWA 3CU2A 3PUOA 4CCEA 2YYTA 4JX6A 3LI1A 3HMJG 4K6AA 2XN0A 4N9EA 5G1TA 3U8GA 2I9EA 2R91A 4LOCA 1DJQA 4RKAA 3PC0A 2ZTJA 2X16A 3UNDA 5FF0A 3HGRA 3R89A 1R30A 3B8DA 1HO4A 3TAKA 3KFTA 2E68A 1D3GA 4MFEA 3W7PA 5CZTA 1KBJA 2JKAA 4UNLA 3KVMA 5U7SA 2TPSA 4O53A 4RLIA 5LNSA 1GVSA 2HTMA 4BWLC 1DKWA 3D0CA 3MP4A 4UMCA 1KLYA 1ZALA 2B4GA 3PVFA 5J5RA 1GPWA 2QJGA 4HN4A 3NAVA 3BG3A 1W5PA 2YSWA 1VH7A 3THQA 1XL9A 3GIYA 3W74A 5LNUA 3BLIA 1ZAJA 5IBXA 4NX0A 1ICQA 4RXFA 3P84A 4K8EA 4GXMA 1DOSA 4FF7A 2WV8A 1OABA 3RU6A 4KKXA 2WNQA 3UZJA 2VELA 3HGJA 3QF0A 4FXRA 1XUUA 4DBEA 1VYSX 3T40A 2CLFA 5AYYA 1WBHA 2GUUA 4DF0A 1YYAA 3W83A 4O13A 2ALDA 3NPWA 3VKJA 1H5YA 2NUXA 3LLFA 1OYCA 2HSAA 4M7TA 4MKNA 1TTJA 2B7OA 3UD6A 1V5XA 2ZZ5A 3T4CA 4JX4A 3DFTA 4R34A 1AG1O 1XM3A 1P0KA 4UFIA 3MHGA 5D33A 2W6RA 3FOKA 3T44A 2CZFA 3OEXA 4WY0F 4ZQPA 3DI0A 2ABBA 4U4MA 4RZ6A 3CM4A 3QJAA 1F76A 1LLZA 5AFDA 1ALDA 3L0NA 3NPVA 3VI2A 4N9CA 1NF0A 1OFBA 1XDLA 4OGZA 1OF8A 3W1XA 2X30A 2C18A 1SW3A 5TQLA 4ZQNA 3NZRA 3ZS4A 2Q3OA 5G1YA 5K9DA 3NM3A 1LDCA 1Z44A 1Q45A 3G1HA 2NUYA 1GQNA 6TIMA 5LNRA 2Y70A 4IGHA 4O54A 1VLWA 4A29A 4NJHA 4Q33A 4AF0A 5KZDA 3Q2DA 2C1HA 1PHWA 1SO6A 3GXTA 3ABOA 1S5WA 1ZJIA 4JTUA 3NA8A 3MP5A 2QUTA 2KZHA 5CPMA 3F4WA 4FNUA 1TIMA 3CTLA 3GR7A 3W7GA 5AC8A 4NNBA 3Q94A 3NQ8A 3LX9A 4N4QA 4GJ1A 5F4XA 3NL5A 2G97A 4O57A 5I3KA 1KTBA 1FXPA 4GRSA 5MHBA 3FIGA 3NQEA 1TPVA 1TB3A 2HS6A 3O63A 1SZEA 2YPIA 5D30A 4G1KA 4LS0A 5D2VA 1YDNA 2E6YA 1RQHA 3NQGA 1FWSA 1GTHA 1AK5A 3H54A 4WXZA 1FWTA 4I7WA 4AHPA 1SZNA 2OZ0A 4FNRA 4WUIA 3HOJA 2DU2A 3W2UA 1O5KA 1KFBA 4TX9A 3TQVA 3STCA 1EUNA 1JRCA 1Q6RA 3PBUA 4A3UA 5FF7A 1QPOA 1FWRA 1W8SA 2QCFA 1GVQA 3W7LA 3PWAA 4KFOA 3G22A 4AH7A 1NVMA 3W6YA 4NNAA 2DZPA 3NL6A 4A2RA 3W1RA 3HQ1A 4DEFA 4MVAA 2DZSA 3TMQA 1I2RA 4NNCA 1TPH1 4HNUA 3WK0A 3LCWA 3WJWA 5AHIA 4WOZA 2IQTA 4Y8FA 4Z0JA 4UNKA 4NZJA 4BWLA 4IUOA 1EP2A 3HGSA 5K3VA 1A5CA 2GJLA 3C8FA 3FFSA 2OJPA 1MEIA 2Q3RA 4FIQA 3S5OA 1N7KA 1VJIA 2CLIA 5G2IA 3HPSA 3MBFA 5E1QA 4UFHA 1QCWA 3EXSA 1K7XA 1F6PA 4AHQA 1FCBA 3CEUA 4UTMA 4JY8A 5FEPA 2Y89A 3C61A 4RK8A 1G7VA 4JYDA 4O16A 3HG2A 4FNQA 2ZFAA 1LRQA 5DCDA 1XBYA 3NYZA 2WPBA 4Y96A 5EA9A 5BRBA 4D2JA 3P67A 2NWRA 5HINA 3E12A 3M47A 3LHUA 2C0AA 1XC4A 2YYUA 1G67A 2J9YA 4LC8A 4OV9A 4R7JA 1A5SA 1EWEA 3IVSA 3TSBA 1VZWA 4IXHA 3EWXA 4MJMA 1TO3A 3L5MA 4MUZA 1WX0A 5U4NA 2Z1BA 4GC4A 4N9DA 3C2VA 1JCLA 1ZAIA 1O95A 2GQ9A 1K03A 1BWLA 3NPXA 4FX6M 4UIOA 2VKZG 4MY1A 4O1DA 5KITA 3TJXA 3DFSA 3RMJA 1W1ZA 2DORA 5DXYA 3P8JA 1YTKA 1ONRA 3B04A 3MI2A 5C54A 1W3NA 1JULA 4DPQA 1VYPX 3LERA 5BNKA 4GUJA 3F4NA 4JD4A 3TUUA 1KM0A 2J9XA 4JR5A 5AOUA 1RR2A 2VFGA 3W7CA 3BW3A 1GG0A 1KLZA 5EMUA 1K8YA 3I65A 4YCPA 4JTTA 2EKCA 3O6DA 3WFAA 2QCMA 1SFJA 3JRKA 4S2CA 1ME7A 5FI8A 2PC4A 3WJYA 3NEVA 3NXFA 3SSJA 3KAOA 3TX9A 4JXCA 1EUAA 4XBSA 4UXDA 3LOTA 3CIXA 1Y0EA 2G96A 3ATYA 2E5DA 3LCHA 1K8XA 1KFEA 2A21A 2E1DA 1EPXA 1Q6LA 2QJHA 5I3IA 3IGXA 1TMHA 2RDUA 2C13A 3NQAA 4JTHA 4Z1DA 5K4ZA 3TFCA 1SFLA 3TDFA 5A8GA 4QQ3A 1XCFA 1S5VA 1NSJA 1T99A 3O6YX 3LHTA 5AHLA 4XBKA 2YR1A 2ZZ1A 3DH7A 3W7RA 2HS8A 3E02A 3LB0A 3L67A 1I2NA 3GLCA 1EX5A 1UBSA 4Z1AA 3BPWA 1GYLA 1CW2A 1W54A 2TSYA 1H7OA 4ORMA 3HBLA 1TV7A 3CPRA 3LCXA 3QEZA 3CT7A 4TMBA 4WQ6A 4UUIA 4LS2A 5D03A 3NL3A 3BO9A 3P82A 4LY8A 1ICPA 2GQAA 1P4CA 3UYCA
chains in the Genus database with same CATH superfamily
4WDXA 4QFUA 4PTMA 5KZMA 1UR1A 3FCPA 1W31A 3IACA 3PG9A 3T8QA 2OKTA 5DLCA 1HQTA 2GGGA 2E6FA 2WB5A 1JF6A 2WCGA 2E5BA 2I5GA 3V1PA 4NILA 2OWXA 2OXNA 2DP3A 1X1NA 3LPGA 4RZ5A 3SSZA 3M0VA 4RV8A 2XHYA 3QXBA 3DHFA 1W91A 3VGDA 3A6OA 1K7FA 5H8UA 4W89A 3GX9A 3QPZA 4DIAA 5J04A 2QCCA 4Y9MA 3GG0A 5JBFA 1NH6A 1W3TA 4P5UA 3M0MA 4O0ZA 2ZZ2A 1R3VA 1BYCA 1VFOA 1XC6A 2AOSA 2E40A 4O1FA 1OX5A 1IXQA 1LBMA 5C6MA 3AZSA 1LQAA 1U83A 4GUFA 3P5YA 5F2GA 2CBJA 4UWMA 3WQ4A 1UR3M 3MANA 2Y88A 2VEMA 4O1EA 3G0SA 1O6IA 5H6HA 3BJSA 4WZHA 2ANUA 2GQ8A 7XIMA 3MWAA 6A3HA 3TW6A 2CHRA 1MW1A 2OO0A 4GYPC 2Q8ZA 3LHVA 1F3TA 2VD8A 3WL1A 4JAWA 2FMOA 1LF1A 3QC0A 2BP1A 4RUBA 5H2ZA 2ZC8A 4M24A 2P0IA 2QCEA 4FEZA 3L4TA 1UWQA 5C70A 2OZTA 5FJTA 4I5RA 4S3DA 3U57A 5K2ZA 2FLIA 4IQLA 4S3GA 2XVLA 3VOFA 5EMMA 4GJIA 3VE7A 2OYLA 2WZMA 2X40A 3AIUA 4O12A 3MS8A 4HZ7A 3VGGA 3CGTA 5D9NA 4CNNA 5BROA 4RPPA 2HBXA 3ABRA 2FIQA 3NVDA 1TV8A 1P6WA 1TV5A 2PODA 1LQ2A 2XZ9A 3CV2A 1OX4B 2EG8A 4QNEA 2PDXA 1ECQA 2VX4A 4AZBA 1LRNA 4OT7A 3TFXA 2E8ZA 2XGZA 4DF1A 1NJJA 3VFCA 1P1MA 3T6CA 2QPUA 3M0YA 1QNVA 5CAKA 3RR1A 4ZR8A 3OVPA 1E4LA 1W9PA 4B5XA 3G1YA 2YGYA 3LXCA 1Q2SA 4PTXA 2QGYA 1LBLA 4CN4A 1F05A 2UV8G 1MUCA 2WO5A 1EQCA 4JFSA 1XXXA 4E2DA 3BCJA 3I7QA 2V6AA 1XRFA 1CTNA 2VO5A 4AD1A 3M6YA 1SU5A 2ESCA 1UD3A 2ODOA 3B8TA 4Q8UA 1DTUA 3NM1A 3ANUA 1UUQA 5F4WA 2I56A 4OJYA 2R8WA 4ATDA 4UCFA 3DKLA 3ABSA 1DORA 2AL1A 4LVAA 3DHDA 4RCXA 3GQYA 4MMWA 3TYCA 2HZGA 5HOSA 3VCRA 1H09A 1PZ0A 1GQIA 3BTNA 2IPJA 3WNMA 4DJDA 3TIMA 3OVQA 2ZRZA 1A5KC 4WKAA 1ML1A 3EDDA 1UUOA 1VQTA 3E3HA 1U2YA 5DMNA 1US2A 1NWTA 3U9IA 5HWNA 4ML4A 3N34A 3WH7A 2GPTA 3KXQA 3S5YA 2BGSA 3VD7A 2OPJA 1PDZA 3FAXA 3LPFA 4UTJA 3FN9A 4L1GA 3AIRA 1W6TA 3MO7A 4QGCA 3ENLA 1G9HA 4FMVA 3SR7A 3JUGA 3GG7A 1J96A 2PBGA 3R43A 4DBWA 3A4WA 4LV9A 5HQEA 3ORWA 3WL0A 2ZRVA 2QCLA 5FKYA 4ATWA 4G7FA 2J7BA 4GPNA 3SCPA 4Z2LA 3W38A 3DDMA 4UTKA 1U5HA 3FY1A 1HJSA 1W9XA 3TCEA 2BY3A 4YNGA 4ZENA 1GYMA 3GHSA 1Z3NA 5LHEA 1XYBA 5TBOA 1HF6A 3WNOA 1YNPA 1GQLA 4ADTA 1HKVA 4H3DA 3ARTA 2GVLA 3SB0A 3KHJA 2FHBA 2GVJA 5CPLA 4GA8A 3VDCA 4UQ9A 3QSTA 3VILA 3KBVA 5D2WA 2BGNE 1C7SA 2FFCA 1ZBVA 4XV0A 3FHAA 1K9EA 5AYBA 2ICSA 3LV5A 1EO7A 4H9UA 1CT5A 3QHMA 2GUYA 2QZRA 1C90A 4ZEPA 1XRVA 3W2NA 3DYMA 2CLOA 3EX4A 2Z2AA 5AHNA 4BK9A 5K9CA 4Z2HA 1TJ2A 4FR1A 4QDMA 2OQLA 2DPEA 3TSMA 1TV4A 3UZZA 2ISFA 3NZ1A 3OBEA 3W1AA 2DZVA 1LROA 1SFSA 4AF0B 3C4UA 4MDOA 5CSRA 2J27A 3VOHA 4EX4A 2XIQA 2D24A 2W79A 3VCCA 2A7NA 3OLDA 1LL7A 4IP7A 1I2OA 3KBWA 2A3BA 1W5NA 4CUCA 2NQLA 3GDKA 3QSRA 1MNSA 1VIZA 4XG1A 5BZAA 4J9JA 4K1GA 1MDLA 1FWBC 2ZX5A 3DBNA 3UWVA 4U2YA 1NWSA 4UTFA 3XIMA 4DO5A 4ZZ9A 1JPDX 1XIFA 3N73A 1OK4A 4H9XA 3GXFA 2YXOA 4M29A 3SCNA 2RAGA 3NQBA 1KV5A 4QR6A 4WEVX 3MT1A 3ECQA 4QNWA 3NURA 4MNJA 2PWHA 2CLPA 4PMDA 4B3ZA 2NXIA 2QGHA 1SO4A 1EDGA 1YDOA 5I79A 1U5JA 1ISZA 1VEMA 4NJGA 2INFA 4MAVA 3WLKX 6ALDA 1CX9A 3FX4A 5I3GA 1XIGA 4I8DA 1DIKA 3QH2A 2W91A 1TPDA 1TVLA 2VMFA 3QW4B 2WBGA 3DG6A 2J6VA 2DSKA 1E5JA 4PH6A 4LUTB 5HMSA 4B4HA 3IJQA 5F2IA 2Z25A 3MY9A 3VUSA 2H90A 3T0CA 5TD4A 4Y90A 4PGLA 3U2CA 4HPGA 1R6WA 4PUWA 3TYUA 2H3DA 1G5AA 1JZ2A 3UGVA 2ABAA 1ECEA 4HA3A 4L9YA 1TWSA 3QKZA 5AC6A 4AW7A 5A6BA 4WY0B 1UQYA 3EKZA 1ONWA 3I3EA 4GWEA 2PZNA 2RJHA 4ZOBA 3N25A 2OG9A 3R11A 3WJSA 3CB8A 2XUCA 3GWQA 3S46A 1F7BA 2QR6A 3W7IA 2A6LA 2YDSA 4DJED 2PMQA 1KW1A 2VFEA 3N04A 4LAKA 1U5VA 2Y7EA 1UPPA 3TXZA 3VKKA 4I5UA 5C9UA 3RPTA 1EGVA 3PTDA 1V51A 1OFAA 2FPVA 3OYZA 2XISA 4UQCA 2EG6A 2FZ9A 4XWUA 4NX5A 3OW1A 1R7OA 1KFLA 2QCNA 3KBMA 3K8MA 1DE5A 1OZMA 2ISVA 3VA8A 2B7NA 2WMKA 1LLWA 4X9SA 4ORIA 3CUXA 3T1GA 3JZEA 3EWWA 1XHGA 4ZSUA 3WLMA 1S2WA 4H9TA 4ADUA 3DG7A 3E0LA 1F73A 2CLKA 3WCZA 3LNPA 2VOMA 3SN0A 4Q7BA 3GAYA 1Q6OA 4EAYA 1N8FA 4LB4A 5CC6A 3NZQA 4BEQA 5I07A 6CGTA 4M80A 3YPIA 2FZDA 1XICA 3M4HA 1VBRA 5CKSA 4P7OA 2VZOA 1CLKA 4QG8A 2ONEA 4JTCA 2C0HA 4ACYA 2TODA 3TYEA 3GXNA 4K68A 3OJGA 2F38A 4D1JA 4ZTYA 1YDYA 5BRQA 4K2SA 4FNSA 2V3EA 1JQVA 2O92A 1RXOB 4R3UA 1NFPA 1I2QA 3I4EA 4DLMA 4PMXA 4K39A 3TOYA 3UVAA 2ZXAA 2VFHA 4GQBA 2A3HA 1S2VA 1BTMA 3GKAA 2RHGA 7REQA 3QZ6A 2FH6A 9RUBA 4I7VA 4KWUA 1P7TB 4WHBA 3PJUA 1F9CA 4IMEA 2YX0A 4MB4A 3M9YA 3SUUA 1NF7A 1XFBA 3G1DA 3PBYA 3G18A 3W73A 4TX6A 1IXPA 5KMYA 3IK2A 4AY8A 2WJFA 3MKVA 4KWVA 2EPMX 4PTNA 4O4VA 2VNCA 1QR7A 4QP0A 3BAXA 2KAUC 3LV6A 4CD8A 3IJ6A 3EPNA 5A94A 3MBDA 3EDJA 1GQJA 2OX1A 4LTSA 3A5VA 1M6JA 2XVKA 1TJ1A 1OX6A 4R7WA 4IL0A 1TPB1 4HNNA 3MHUA 4IMGA 1EA9C 3W00A 1J5TA 3R0UA 3JR2A 3V1HA 4AC7C 2CWNA 1FCVA 2WZIA 3NDOA 3RO6A 4UOQA 2OX4A 2HPIA 3B0XA 1SR0A 1E1CA 2Z1KA 4ZTXA 5FACA 2E1WA 1O5XA 1HN1A 4GE8A 5A6JA 1H51A 4UCGA 3HPAA 3LS9A 5CXPA 4M1BA 5DANA 4RDWA 5CGTA 2FTYA 1OT2A 4QE4A 1NAL1 1K1DA 1HL2A 1KFKA 5HNUA 3GM8A 2PD9A 2J62A 3PZNA 1UJPA 3R1ZA 3W22A 5FJUA 1BKHA 4B91A 1Q6GA 1AD4A 5DRIA 4Z1YA 3FW6A 1QMLA 1O5QA 1YLVA 1K6AA 4XAPA 3QMRA 1VYRA 3PFMA 4PODA 1OIFA 2EJAA 3NNTA 4HA0A 1LM1A 3N2CA 3STGA 3PBVA 1VKFA 1S2UA 4CLMA 4LEQA 1UA7A 3AHZA 2TAAA 1MFUA 2PU1A 1DJWA 5F1VA 4B9ZA 3A5FA 1N8IA 3E2VA 2TMDA 3OPSA 1RJQA 3MJMA 4HYRA 1JG9A 2XYLA 1SUXA 2P76A 2QMKA 3M41A 3AMCA 5BW6A 3ARUA 3G5EA 1FUYA 3NSMA 1Q65A 1I45A 1XLFA 3EWBX 4PB4A 8TIMA 3FDGA 1CXIA 4LNYA 2ZA3A 2Y61A 4PMZA 4C6QA 2C79A 5EL1A 1LOLA 3HGOA 4POCA 5ENLA 1TCMA 4JDBA 2J7DA 3GDTA 4LBUA 2WSKA 2VRJA 4NSBA 3UXLA 3EMZA 4GG9A 2ZX8A 4AD4A 1LL4A 2DIKA 2QPSA 1OHLA 2FZ8A 5LZLA 3PZQA 2J25A 3CZLA 1PIGA 3LLXA 4WGXA 3CZKA 1XLDA 2FTPA 1ZRQA 1J11A 3B8SA 2DGAA 3HF3A 2F8QA 3T42A 2NV2A 1XBZA 4OE7A 5DQPA 5C2GA 1TWWA 3V4BA 1KBIA 3M16A 2NWSA 4OUIA 2YDQA 3FGCB 3FKRA 1E4IA 1JCNA 1BVNP 4BY3A 1KM1A 1E6ZA 3N14A 1X1OA 1H7XA 1JUBA 4H04A 1QNSA 1C8YA 4AVOA 4PCSA 3RLHA 5H91A 1IEIA 2PI6A 4M0XA 3VD4A 3MPGA 4GQRA 1BGAA 2NX1A 3SW6A 5D38A 1UR0A 2YBVA 3VFLA 2QCHA 3GG8A 2INZA 4DBSA 4EIVA 4LF2A 3JU2A 2CZDA 1SSDA 1LLOA 1W1A1 4J2PA 1J6OA 2BWGA 1V3IA 2O4QA 2G50A 3N4AA 3DAQA 5CC7A 1Y7VA 4O18A 4GGBA 2XPKA 4E2BA 4KF1A 3FJ6A 4FLRA 4P61A 5BRPA 1M7JA 2ZA2A 1N2VA 3DI1A 1H7WA 3RX4A 2CITA 2QXWA 5FESA 3MMWA 5I02A 2XIBA 1XW8A 4GX8A 2YCJA 2ZUMA 3U3HA 4X22A 3LGEA 2Y8VA 4OBTA 1C29A 1KGUA 1OFOA 2D73A 3N9KA 3FKKA 4US5A 2VGGA 2VI0A 5ABTA 3KWSA 3NG3A 1FP9A 4QSHA 4A4AA 2NZLA 3RM8A 1GJUA 1V6UA 3LK6A 5BXSA 5D09A 1SJAA 4S39A 4O10A 1DJZA 2QT3A 3ALGA 2JF6A 3LM3A 2AQWA 2F2HA 1P0EA 2ZRYA 4A05A 4U10A 3TROA 2GGIA 2PGWA 4IGSA 3IIZA 4FALA 4HVXA 3QOMA 4OIFA 1CCWB 3MDUA 3FJNA 4GH3A 1WKFA 3W86A 4O15A 4E2OA 3ICJA 1VEPA 2HK1A 3WKZA 4B90A 1PX3A 1W8GA 1EB3A 2PDJA 3R13A 4NF7A 4N42A 1XH0A 1IE7C 3SBFA 1Q4NX 4L56A 3S9YA 3WNKA 3S1GA 2QKFA 3E2RA 3AISA 3N2BA 3GXIA 2PRHA 2QDGA 5AZ0A 1UR4A 4F0MA 4PCNA 3VGEA 2PB1A 2VC6A 1PKYA 2VZTA 2GQ3A 4J27A 4L1XA 2H8XA 1G4PA 4J3UA 3VNMA 3WLTA 3TC6A 4IQDA 1Q2RA 1EF2A 3VKBA 4C6IA 3NZPA 3QR0A 2Z6JA 3CK5A 5KETA 5ECUA 1CGTA 4UMAA 1ZHAA 1FDJA 1V0KA 2Q8XA 4PTVA 2PBOA 5CZKA 2HQAA 4JGDA 3GKFA 6XIAA 2DUXA 4I7UA 4O19A 3P0WA 5EFDA 5AYXA 2Y62A 2J8FA 3P74A 3KDOA 4ZGYA 1JFHA 1US0A 4Q4KA 4G8TA 4PMVA 1Z6KA 3B06A 1AUSL 3BVJA 3L23A 1B4EA 5BU6A 1TPFA 1FHVA 3IIXA 1IXNA 4LBSA 3CYJA 4FR6A 1GVRA 4IT1A 4GY1A 1TELA 2XM1A 1VBHA 2UY3A 3GTXA 4CVUA 3CMJA 4NZ1A 1QK0A 1ZLPA 2ZBTA 3IUIA 1KXHA 3UWWA 4CD6A 3LCIA 3BW4A 2POZA 3C56A 3WQCA 2LLEA 3E0IA 1HTIA 4DUOA 3BL3A 3M0ZA 4WD0A 3S5SA 1S1PA 4XKYB 1ZL1A 3CV6A 2EPOA 2NXHA 3W26A 1XIBA 4JEJA 3N13A 2NT1A 3P3BA 4LRTA 1CI1A 1FX6A 1OBAA 3TYDA 2VZVA 1MRAA 1W2PA 1J93A 1Q8AA 4Q22A 2OLHA 4DM1A 1E0XA 5T26A 3TW7A 3FJ4A 4DXVA 4EPKA 5IHRA 4BI7A 1I75A 1WOAA 3PZTA 1M04A 1ZBCA 1PUDA 3AI0A 4UTTA 4HJFA 2P1FA 1IGSA 3BH4A 4FO4A 1FTXA 1B54A 4YHGA 2BVTA 3TV8A 3G77A 2W3ZA 1F5ZA 4L4LA 5HUOA 4Z08A 1V3MA 4XD3A 3TEVA 4LVGA 5DO8A 2BDQA 2ZZ4A 4R9OA 3PJXA 1OX4A 3D47A 5B80A 3NQCA 3RU8X 4H2HA 4QJ1A 2XWEA 3MV01 4C6PA 3TZFA 5EBAA 3WLQA 2PDLA 5BMWA 3GBEA 5CG7A 2CHNA 5TNVA 5DFAA 4M19A 5HR7A 3UU0A 2JGYA 2WNWA 2G4FA 2R6OA 4UFLA 5EKYA 3LSBA 1WB0A 4DUXA 2GOUA 2J24A 1X6UA 1YDVA 1UD8A 3XINA 4S38A 4JNMA 4PUKA 3IGSA 3GVWA 2GVGA 4K8HA 4PZVA 3PSWA 3DHPA 2WQPA 4AWTA 1E51A 5A2CA 4KRUA 3V0TA 4H9MA 4PCFA 3UETA 1GEHA 4XZIA 2GWNA 5F2MA 4J3XA 2O56A 5ABEA 4P7LA 4Q4PA 1PSCA 3MUCA 4ERGA 1FH8A 9CGTA 4QAWA 3ARYA 4MZYA 4XVEA 2YW3A 1QOQA 3GVQA 5AZ1A 3NQDA 2QAFA 3PM6A 4YLWA 4JX6A 4PE8A 3L2LA 3HMJG 2D2HA 4XKMA 4HOZA 2R91A 4ECLA 2YA0A 4RKAA 4CEXC 4DWSC 3QV9A 2V69A 5LA0A 3R89A 4FK9A 5CG0A 3TAKA 1RH9A 5B7YA 2E68A 3W7PA 2IXVA 3CASA 4O53A 1PXGA 1QATA 4RLIA 3CTTA 5LNSA 1EEXA 1VBGA 2HTMA 4BWLC 1DKWA 4CQBA 4JN7A 4DHGA 2C7FA 2QJGA 3RCNA 3M64A 4DYKA 3BAKA 5I7GA 2MNRA 1VH7A 2DEPA 3MA8A 5LNUA 1ICQA 1IEXA 1DOSA 5G4HC 3VM5A 1F3WA 4IIBA 4DAFA 1XLHA 3UZJA 3WLSA 4M56A 2MANA 2VELA 1KWKA 2WQDA 3UZYA 3EYPA 3EOLA 3T40A 2CLFA 2VJXA 5AYYA 1A3XA 1WBHA 3N11A 3K2GA 1PKLA 1I0DA 2XM2A 4DF0A 4O13A 1ZJBA 3N15A 3TZNA 3VKJA 2NUXA 3SDOA 3WQ8A 3ZLFA 2HSAA 1IZJA 3AMLA 1R9YA 4S3JA 3B40A 4AQLA 1O1ZA 2B7OA 4Y8EA 3UD6A 1V5XA 5GNZA 2ZZ5A 3T4CA 4GINA 4F9JA 1P0KA 3P6LA 3WDPP 1SFTA 4PFHA 1DP0A 3T44A 4PYSA 4WY0F 4ZQPA 1KCXA 2ABBA 4R88A 3RIKA 3CM4A 3WLRA 3WBWA 3QJAA 1LLZA 1ZBWA 1XDLA 1EXBA 1HX0A 4FF5A 4W86A 3OVGA 3H2EA 3WQFA 5DMLA 5G1YA 1EGMA 3NM3A 3CZEA 2QV5A 3A12A 1Q45A 3G1HA 2NUYA 3O9NA 1Q6CA 2XIOA 1AFSA 4C6NA 5LNRA 4IGHA 5CBIA 5JXQA 4AF0A 5ABHA 3BMXA 3R25A 3E0WA 3MP5A 5FCZA 5CPMA 3F4WA 5D9MA 3NQ8A 3LX9A 3WF4A 1J0JA 2CKSA 2PTYA 1FXPA 5TAOA 1Z8AA 3MU7A 3CUFA 1SYTA 5IXEA 3GR4A 3TWBA 2HS6A 3O63A 5E9XA 3R4IA 5D30A 1XSIA 2WCAA 4G1KA 5D2VA 4X63A 1YDNA 1LUCB 3FV9A 5EMKA 1F61A 3MWCA 4XZBA 3MMUA 1AK5A 2Z00A 5GNXA 1EOMA 3CUZA 1PX4A 3RCYA 3VM7A 3UG5A 1JRCA 1Q6RA 4YPJA 4QROA 4MNMA 4HU0A 1W8SA 2QCFA 5I03A 3WQ6A 3R94A 1ZS2A 1MW2A 4H6RA 5HJYA 1E9YB 1KFWA 3FEQA 3HQ1A 4MKSA 3WYZA 4AVNA 4XSMA 3ZJ7A 2BXYA 1TPH1 4LUTA 2P3EA 3TLQA 4AZCB 4C5YA 2PZ0A 4S3CA 4NZJA 4GQ0A 1EP2A 1OCNA 4DAIA 1A5CA 1PZ3A 3CQIA 1JYWA 2OJPA 1N7KA 2P3ZA 3L2MA 4UBPC 2YB4A 2G3IA 1QCWA 3EXSA 4YWSA 2HDJA 5FEPA 2Y89A 1MVYA 4JYDA 4QDWA 4DNMA 1EJXC 3VINA 1QHPA 3BSMA 1UR9A 3E12A 2Z1VA 3LHUA 3AU2A 4OV9A 1A5SA 1DJYA 5JU6A 3GH4A 3UVIA 3VZXA 4RE0A 3VMOA 1VZWA 4IXHA 1E0WA 4UB9A 4MJMA 3ZT6A 4QDPA 2GVYA 3WIJA 1MZRA 1JCLA 1B3XA 1POKA 4NY2A 4UIOA 4JQ1A 4MY1A 3ARRA 3VIOA 5KITA 1CGXA 3LPOA 1YNQA 1ODZA 5C54A 3IAQA 1JULA 2WCSA 1VYPX 4GUJA 4TQTA 3JVAA 1KM0A 1U30A 4PMRA 2J9XA 4JR5A 2GLKA 5CLWA 7CGTA 4TV6A 3GBDA 4B5TA 3OO2A 3JRKA 3VDHA 4J3ZA 1SM9A 1GQKA 3NXFA 3TX9A 4GABA 2W27A 1FHDA 4XBSA 1XD1A 2F61A 3ZJKA 2A21A 3A3WA 3A4XA 1IR2A 1EPXA 2E1DA 2QJHA 1FFRA 1IWBA 3C0SA 4IIGA 1X97A 4KBXA 1B2YA 2YCKX 3WDIA 3TFCA 4M81A 1XCFA 1V6XA 4H8UA 1NSJA 3MUY1 1T99A 5AHLA 5JBEA 5KZ6A 3NEHA 3EKGA 4BCEA 5FJPA 3UR8A 1TX2A 1P7TA 3W7RA 3GW3A 1UG6A 3U0HA 3LB0A 3L67A 1I2NA 2O9TA 3VU2A 2NLYA 4L6DA 4WRHA 3UBPC 4CD4A 4V28A 4B2DD 1H7OA 3FDKA 4WQ6A 4LS2A 5D03A 2W61A 3P82A 1SGJA 1ICPA 4GFSA 4IX2A 3T2PA 4ZQRA 3PAJA 2INEA 3AO0A 3PTQA 1L0PA 1VFTA 2I5IA 4FOJA 4JPGA 3PF3A 3HZ3A 3TMLA 2XFRA 4KEUA 4UFJA 2V2CA 4DJDC 1A47A 2XVGA 5DF0A 4GZJA 4C5ZA 1Q66A 4HMCA 3KS5A 1NFGA 3DC0A 2ZRWA 4AYSA 1WXZA 1VB9A 4AWSA 3SUTA 3TKFA 2WHLA 2ZX9A 2V0TA 3SADA 3TYAA 3TNOA 4U5KA 4AISA 2WZEA 2BY1A 4TO8A 2C16A 3WFZA 3QHNA 3UWEA 3APTA 1FVPA 1XFCA 1RCQA 1WKDA 3KLKA 3WNPA 1WDQA 3G1SA 3NUKA 4LAMA 5D2YA 3LTPA 3ZMRA 1W0MA 1Z69A 2IPGA 1DEDA 1E3ZA 1UKTA 3SGZA 2GJNA 4PRWA 3U2EA 2J4GA 4ADSA 1DE6A 4O14A 4IXXA 3GD6A 4HSHA 4QEEA 2VENA 6PTDA 4AVFA 1ZENA 3WSUA 4MWAB 3EOOA 4H6KA 2FTWA 4LFYA 3P7YA 4HTYA 5REQB 4IOTA 4L4PA 2XH7A 4RXGA 1IZKA 2ZUUA 1YPFA 4N6EA 2X0YA 3SCRA 3AWNA 1FWNA 1KCZA 3B8UA 1JR1A 3ZOAA 2PF0A 1WZLA 1VS1A 2Z0IA 3P61A 4WDWA 4K38A 5G2WA 3AALA 1IR1A 4H9ZA 3PUEA 3CPGA 4O4WA 2QDEA 1R8LA 4AY1A 5AHMA 3SZ8A 2E9BA 2D1ZA 1BVZA 3B4UA 3W02A 3AUOA 3PWIA 1XUZA 3U4FA 2KX9A 2R1MA 2O7QA 4M1RA 4C60A 1EX1A 2BBFA 3VIGA 1LOSA 3QLDA 2C1IA 4UNIA 2XVPA 5CAHA 1R2SA 2DZTA 1ZP4A 5M03A 4M6VA 1WE5A 2IKHA 2C1GA 4QS6A 5JIPA 3FLUA 3A22A 1V0LA 1UR2A 1ZQ5A 3FVDA 5BOFA 2QQ6A 1HG3A 3QM3A 4N0RA 1X96A 3FGCA 1H4PA 3GFYA 2B7QA 2F6UA 1ZZMA 4B3LA 4W7WA 4PMQA 1VFMA 3KL3A 3PJTA 4IICA 3LN3A 5LXXA 3S8HA 3NQFA 2VYOA 1RLDA 4NIRA 1PYMA 3AROA 3O06A 5A6TC 3WBEA 4JFWA 5I3DA 3CAKA 3ZVIA 3LHWA 4IHCA 4OECA 3QC3A 2Y24A 1QASA 4RW3A 3I3BA 3ZLHA 2AAAA 1QO2A 2OB3A 4LJ3A 1IIGA 1TIWA 1VEOA 2JKPA 5AHFA 3SN1A 1TWIA 3IGUA 2PDMA 2ZVIA 4M6UA 4LW7A 3W1QA 3LG3A 5I00A 3WMCA 3PK7A 1BXNA 2A5HA 5AHEA 1V6WA 3B8WA 3NDZA 4YL2A 5LKYA 4X9YA 4JEQA 4P8VA 1SZFA 1A4LA 2E25A 1BAGA 2VP8A 1CXKA 3DKJA 4MSSA 3T78A 3SY8A 3GNDA 3MV11 4LCQA 4ROPA 4RDZA 4L61A 3ELFA 3KCJA 1ISVA 3URNA 1XGEA 2E5CA 3IANA 1R47A 5LYRA 1TREA 1B30A 7TIMA 4A3YA 8RUCA 3BOFA 1ISWA 1WPCA 3BICA 4DI9A 2IW0A 4JTKA 5EBUA 4RNHA 2EAWA 1ZSXA 5DCEA 3S42A 3HG4A 1NOWA 3QQ1A 1WA3A 2WC4A 2QLYA 2EQDA 2OQHA 3EWYA 3I7SA 5L9FA 4W4QA 3S0CA 4R85A 4Y9AA 3WQPA 4Y2WA 1TR1A 1OK6A 4ZVJA 3PB2A 1CB2A 4EACA 1A0EA 2NV1A 2WC7A 4EWJA 1JRBA 3M0JA 3K1DA 3MI6A 1Q4WA 4AEEA 4DM2A 5HUPA 4XZNX 4KEVA 3WEMA 2AKMA 2FVMA 2GL5A 4F3HA 4XUGA 4GZ7A 1RJRA 1CECA 3PSVA 4XQ6A 2V3DA 2WKJA 1SJDA 3CL7A 1LL6A 2OELA 3GU1A 3INPA 3K30A 4PA8A 3QGKC 2NLIA 1OFQA 4H1ZA 1FWWA 3M0XA 3FS2A 1T5AA 3TONA 1BYDA 3LPPA 4R7OA 1QI5A 3SUSA 3AQUA 1JPHA 3DBPA 2IKJA 2J7FA 1F4HA 1EXPA 3N6HA 2DH2A 2JBMA 3G0XA 1H0IA 1E9ZB 3PBGA 3EDKA 3NO5A 2YCEA 4HZ8A 4W84A 1R7AA 4WCJA 4PSRA 3D5HA 4AZHA 2F6XA 4IFOA 4MPKA 4AXKA 4OUEA 2W5FA 2PSNA 5HBFA 5CPOA 1C91A 1GT8A 3T55A 4MJ4A 1DV7A 3DGRA 2HV5A 2WSQA 1VCGA 2J7HA 3MJYA 4OOUA 1PO9A 4GC3A 1JEZA 3BXWA 4EE9A 1CBGA 1KV8A 4ATLA 1WYIA 3W2JA 4AEFA 1B9ZA 3W1TA 3S5NA 3THUA 1J2BA 3EB2A 2PRLA 5J5DA 4I8YA 1H5VA 3GTHA 1Q6DA 2QYGA 3OIHA 3KCOA 4LYPA 2GJPA 1BYAA 4UZUA 1OG6A 2Y5JA 3WENA 4XKYA 4Q32A 1P0NA 2CIPA 4MKVA 3ARVA 2O9OA 2ZZ7A 3BV7A 3HPZA 3RYSA 2UY5A 4KCWA 2Q6ZA 1G4SA 3W24A 2BOEX 2XH0A 3OOQA 2R1LA 4IM4A 3O15A 1O1HA 4EANA 4JTRA 1TVNA 4KRZA 3PFRA 1QOPA 1VIWA 1RA5A 3SCQA 1YNYA 1DHKA 1DBTA 2ZUVA 5BYWA 5I78A 3WD1A 2CLEA 2FDSA 4JTJA 3QHOA 1S46A 1XH1A 4MFDA 3WUFA 3AIEA 2H9AB 3Q4DA 2WANA 3GB6A 3KBSA 2JGQA 2O9PA 1A5AA 1AW5A 2PDKA 1S1RA 1SZRA 1PYFA 1ZU8A 3MUIA 3ITCA 2WLZA 3SY5A 4HPHA 4HP5A 5HA7A 1SSGA 3SUVA 2VVSA 3EX2A 3H7RA 4E3TA 3UR5A 1HGYA 3G2GA 3W7HA 4O52A 4W9TA 2D3LA 4KS0A 3CPUA 1HP4A 1FY6A 3I6TA 1BVWA 3LMZA 4GUGA 4Q8QA 5CSSA 3GHRA 3G1VA 4XVDA 1QNOA 4JFUA 5FEXA 4HYWA 4UR8A 2CHOA 2EO7A 4PEKA 4IUGA 3LLDA 1VC4A 2P88A 2RDWA 2YA1A 2FH8A 2V2DA 2UY4A 5CSUA 3JW7A 1ZAHA 3EXTA 3WY1A 5K4XA 3MCMA 4YU1A 1UH3A 4ZO7A 1A50A 1MDRA 3QYQA 1W9BM 4GH1A 4I6KA 2D0HA 4DZHA 3ZT5A 4BHYA 2QV4A 3H53A 4HHHA 1QW8A 3UJFA 1XISA 1E6SM 2VWSA 1PS9A 2OT1A 3P14A 3R5EA 3S6DA 4DWSD 5H8MA 2XIIA 4JN6A 5IFPA 2VRQA 3GZAA 2VCAA 3T0AA 1K7EA 5E70A 3VNKA 2TYSA 2IMRA 3O0KA 4LV4A 4O8AA 1E5NA 4CN1A 3WK2A 3DXIA 4A6GA 1QAPA 4LY4A 1YADA 5AC4A 5C2CA 3GVVA 2OWWA 3IIPA 1RBOB 5GVJA 2RUSA 4UTUA 3TR9A 4U5IA 4J3WA 4KCTA 3L5AA 5MF5A 2DIEA 5GPRA 1B3WA 2QF7A 3OG2A 1RSCA 2C71A 1GONA 4FOUA 2V5DA 5A2BA 4XX6A 2XIJA 2AQOA 3WH9A 3M5YA 1QRQA 1PV8A 1M9HA 1VHCA 3UY8A 2Y7DA 3TU9A 4AG0A 1J8VA 4C6KA 5FF2A 1C7TA 3CLWA 4YTQA 1Q7ZA 2BMBA 1FCQA 1WCGA 3MKKA 2PDQA 1VGAA 3W7JA 3KRUA 4ZQCA 2VEGA 2WVSA 3G1FA 4R33A 3MI3A 4AZ5A 1AJZA 4BI5A 1J0YA 3QY7A 4P8WA 2V82A 3W2LA 5AKQA 3DENA 1OINA 1UR8A 3L5LA 1M3UA 2NUWA 3L2IA 1CXLA 1XBVA 4YS1A 3T05A 1BG9A 2PA6A 2VFFA 1S5MA 3CAVA 3FK4A 3V0SA 2OVLA 2QJIA 1AMYA 3LXAA 4E5TA 5IDZA 5RUBA 1O60A 2J88A 4W5ZA 4JNZA 3HJZA 3I7RA 4MYAA 2VVNA 2WBKA 1D8WA 2RKXA 1BYBA 3PHAA 1S5TA 4TVUA 1XQKA 4K8GA 2D2OA 2WNZA 1HKIA 2PDWA 3BQ5A 5JQ9A 4P7NA 3U7VA 2EG7A 1LRTA 3LGDA 3WF3A 1NWUA 2WLYA 1SJBA 3KVLA 3EGJA 2BZNA 2J6XA 4JHMA 4B5WA 1PL9A 2ATMA 2QUVA 3BGAA 4XTIA 7PTDA 2BGQA 1EO5A 4C1KA 3ID7A 1TTQA 1CYGA 4MB3A 1W5OA 2VUYA 3Q37A 3C3UA 5CH9A 2I5QA 3T0BA 3M0LA 5I3HA 3MW7A 1UQZA 3UY7A 4KGLA 4JDYA 1D9EA 4JTLA 5C8BB 2VRKA 3EOUA 1GVFA 1E6XM 3N2MA 3RNDA 1PJ9A 2J8TA 2WSPA 4NI3A 3RK8A 2O55A 3NO1A 2ZC1A 2JEPA 3VMPA 4WR3A 4D71A 4GD0A 4U2ZA 4J3SA 4OU1A 4UFKA 4BQ4A 3AIVA 1TFVA 2V3GA 3OA3A 3EXRA 4YWIA 3ARZA 1R2RA 3W27A 3G8EA 4PEEA 4US6A 2XGBA 2EEXA 1O7AA 4UFMA 4ROQA 4IG2B 1EEPA 4H9VA 1TZ9A 1BXBA 2X1SA 1WDWA 4HK6A 4AY7A 4J35A 1VRDA 3PZ9A 3K8KA 1MEHA 3TC7A 3PNZA 4HMNA 1XP3A 4QISA 1V4YA 2ASHA 3GTFA 1NEYA 3MSGA 4DO4A 1LP6A 2ZZ6A 4AZCA 2YLAA 1OF6A 4NZCA 3OZPA 4E2VA 3W1NA 1Z9AA 5DEZA 4A8IA 1A5MC 7TAAA 3IJLA 1WBJA 4LVFA 5H1WA 1IHIA 1M1BA 1V0NA 5EMJA 4S3AA 4LS1A 1M41A 3EDFA 3GDLA 4IMFA 2QAPA 1X98A 4BA0A 2CESA 3DFNA 3CUHA 3GUGA 1TQJA 1RY0A 2D23A 4C6JA 4XSLA 1R46A 1WDDA 1L8PA 2GK1B 2ZICA 1J0KA 5M17A 2D2JA 4QHRA 3S2NA 3C2FA 3ATZA 1W9VA 3LQLA 1R3WA 4OQVA 4UOZA 3O8AA 2WMFA 2X1TA 2XJ7A 2PRMA 4PN2A 3RF9A 1IQ8A 3RJYA 4E6MA 2JKEA 1Z48A 1EL3A 2OZ8A 4LGXA 2DFAA 4XAYA 2ACRA 3KCLA 2G37A 3U2OA 4C6FA 2BS9A 2QIIA 1RAKA 3W9ZA 3DN5A 1K3UA 3BLDA 4JTGA 4UTWA 1YMYA 4LUIA 3CHEA 2X0SA 4GYJA 3W0KA 5K7JA 3AU6A 1EP3A 4UTTC 1QW9A 3BW2A 3GHTA 5EPDA 3GTNA 3MSYA 1I0BA 3SIMA 1OG0A 5AY7A 4UMBA 3UXAA 2REQB 2CERA 1VD6A 1DJXA 1VHNA 1PKNA 1CNVA 3GDRA 2PP0A 3TK7A 1BWVA 4XO7A 1EIBA 1PVNA 2YDAA 4MZ8A 5HDRA 5DXXA 2ZA1A 3SAZA 4ZB0A 5HWJA 4CD7A 2BOGX 3LM7A 1DYSA 4HK5A 1TTIA 5E9AA 5FEZA 2PWGA 1KBBA 1Y5WA 3HPXA 4CCZA 5ECVA 4J2MA 1NM9A 1WZMA 1QU4A 4NT0A 2XFYA 3OYXA 3OGRA 2NQ5A 3WUBA 1L9WA 3EZ4A 1WO2A 1JDEA 4WKHA 1MI3A 1EFZA 4KIRA 4QIUA 4NAEB 1HO1A 4JTEA 1J6PA 2A85A 4V15A 4RZBA 1RZMA 2QCDB 4PBGA 3TJLA 3BAYA 1UZDA 4LVBA 4G1NA 2WMGA 3GFZA 4C7FA 1GOMA 3E38A 1N55A 3W53A 4I3GA 1THFD 2X7VA 3QY6A 1BSLA 1PPIA 3SJ3A 2QJJA 1E40A 2WVTA 5AB3A 3O7UA 4KFNA 1A5LC 3D6NA 4DJDD 5A6LA 4LCSA 4EF9A 3M7SA 3EX6A 3NQ6A 3WD3A 3BLPX 4JFTA 2GYIA 4B5NA 2EGZA 2CLLA 3VIJA 4P8UA 4AX7A 3REQB 5F4SA 1UKOA 1DWIM 4EPBC 4O0KA 1AH3A 2UZ9A 3UPBA 1ENUA 4P7QA 4EPEC 3R8HA 4E0CA 3V3WA 1W56A 3COTA 4D6CA 5G5IA 1B0IA 1PCKA 3ZXWA 3FHQA 1FHUA 3LGGA 5D9OA 3PBMA 5A3HA 1Q5MA 3MYOA 4G2DA 1EJTC 4F66A 1IF2A 3GVGA 4GX9A 4LC6A 3KTCA 2PDFA 2CW6A 2E6DA 4GVIA 2QUNA 2QULA 3ZT7A 3OGSA 4DRSA 3ZSTA 1I1XA 1WAUA 1GYNA 3O2LA 4LUJA 4LCRA 3RX2A 1Z89A 3A9BA 4FIRA 1PE1A 4INFA 4MWAA 2WSYA 2BODX 2C14A 3DHUA 1W5QA 4Z1CA 1IXOA 5REQA 1QUMA 1FKXA 1FWIC 1PDYA 4FAMA 4H6EA 2CETA 4JKMA 2PWFA 5A6AA 4IFRA 3VKDA 1DVJA 4GUHA 2CZ5A 5KZEA 5JVLA 2WWCA 1BKSA 4S2BA 1ADOA 4JL1A 3LUTA 1JJKA 2X2YA 1W1B1 4V2XA 1WAWA 3HA1A 1I4NA 4K36A 3G1RA 3N2XA 1C8XA 2J8GA 1MO0A 1QPNA 4Y9PA 3IVUA 3HIJA 3KX6A 2DZXA 4B15A 1XDJA 3W71A 4HKPA 4IIDA 1UIOA 1TQXA 3N9SA 3DIPA 3U6WA 3TN5A 5XIAA 1B9BA 3QV6A 1IIHA 4L1WA 2CFFA 2Y5SA 2ZKMX 1UD5A 4LRSA 5FF3A 2CWXA 1ESWA 3BC9A 3IJ7A 3PG8A 4I90A 1KWGA 5AC7A 3DYOA 4IMCA 1ICSA 3LI0A 3MYPA 1YEYA 5FJIA 4NZFA 4OOZA 5HNTA 4BFAA 3QGVA 3QFEA 1WV2A 1MQQA 2DV0A 2VQUA 3HFTA 3WLNA 1KCKA 3URQA 2AAMA 2PF8A 3CS2A 4XAGA 1EZ2A 2ZX7A 2ZUSA 3EX1A 4I6VA 2CBIA 1K4HA 2BY0A 4IPNB 2FHFA 3CHDA 3N3MA 2ZQ0A 2IPFA 1U1JA 1VCVA 4V1YA 4F0HA 6XIMA 2GUBA 3P8IA 4IQJA 1T8QA 3KWXA 5GJNA 3OB8A 1PB0A 1JAEA 1JPKA 4UTIA 5I06A 3KL5A 3FYYA 4BF7A 3EX3A 1XH2A 3WQGA 2TRSA 1WP6A 5D32A 4O1BA 1H62A 2BHZA 5FJJA 1ONEA 4K37A 3L4WA 3TWAA 3PUOA 2YYTA 4IP5A 4LOCA 1LJYA 1DJQA 3UW6A 2VGBA 4C6EA 3IJ9A 4IH3A 1PX8A 3UG3A 3GU2A 2X7WA 1QNRA 3B8DA 3KFTA 4Z2GA 1XLIA 3WDJA 2FKPA 4MFEA 5CZTA 4LX4A 3VYLA 1W9DM 4UNLA 4GK8A 1C9WA 5CC5A 3VD9A 1AQ0A 2OODA 5TF0A 2HEJA 3TJ4A 5HNNA 4UMCA 3S9ZA 5A6BD 4OBRA 1GPWA 1NTHA 2AMGA 4HN4A 2YSWA 2P5NA 1I6NA 3ABZA 2ACUA 4A3RA 3N29A 4FF7A 3AJ7A 3MUAA 1H2JA 2PDPA 1HVXA 1TV2A 4PUDA 1J0HA 2GJRA 4ICCX 3VXGA 4Q8TA 4PRRA 3LQGA 4HB7A 1VYSX 1UH4A 3EB4A 2VDIA 2GUUA 2JEQA 1YYAA 3TOPA 1RBAA 4HMDA 3BCDA 1VBUA 4ZXOA 1WUEA 4CVWA 3E5BA 3W6LA 1OYCA 3ITLA 1K8CA 4M7TA 4MKNA 4ZA0A 4MUPA 4NYYA 3UJEA 1VP5A 3DFTA 3K46A 3VOCA 4UFIA 1A3HA 3K13A 2CZFA 1POJA 2GJXB 5LXEA 4L9ZA 5AFDA 1XD0A 3M0IA 4R9XA 4NZ5A 3NPVA 3VI2A 2DH3A 4OGZA 3EWCA 4PBEA 1OF8A 5ABGA 3KHDA 4FXJA 2C18A 3B3DA 4H41A 4W88A 5K9DA 2WHMA 1UP2A 1V3KA 1R9ZA 2Y70A 4O54A 2YBTA 3V0UA 4WJ8A 4ZFMA 3PZVA 2C1HA 2VC9A 3ABOA 4C6DA 8CGTA 2AMXA 1YKWA 2KZHA 4FNUA 2FZMA 2I9UA 5C0QA 4D6IA 4UQEA 3CH0A 2D2GA 1ADSA 5F4XA 3A3XA 3ZO9A 1MW3A 4L64A 2X8RA 1W17A 3A4JA 4GRSA 2ZUWA 5CEWA 5HPCA 1E6PA 4MNKA 1DIOA 1TB3A 1EJSC 3GC5A 4I9MA 3WH6A 3BDKA 3IAPA 3I10A 3MB9A 4LS0A 4E4UA 4GOAA 2IKIA 3TN4A 1RQHA 2WVUA 2YXXA 1FWSA 1VENA 3ZJ8A 4DUVA 3R58A 4WXZA 1FWTA 1FKWA 1SZNA 5HMEA 2J7GA 5G1MA 2OZ0A 4WUIA 3HOJA 1O5KA 1V6YA 3OQEA 1NARA 3H4XA 3STCA 1EUNA 1EJWC 3DECA 1E0VA 1R5YA 3APYA 4QJ5B 5FL0A 1GVQA 1AZ1A 2NV9A 3PWAA 1H11A 4XD4A 3Q65A 3W6YA 4KEMA 2W92A 1FA2A 5AECA 4A2RA 4J1OA 3HV8A 4MVAA 1A80A 2DZSA 3U5YA 3WK0A 2IQTA 4LBRA 4MG4A 3HGSA 3HV9A 3PPGA 1A0DA 3VGBA 2GJLA 1PWLA 4GIAA 3ITVA 2Q3RA 3S5OA 1VJIA 2CCRA 1TA3B 1XX1A 4GISA 5E1QA 1K7XA 1OC5A 4TVCA 3H2NA 3CEUA 4HNCA 2ZWZA 1UD4A 3T9PA 3HG2A 1JZ6A 2ZFAA 4GXWA 4JQ4A 1XBYA 3HQNA 1B3ZA 3KTSA 2WJEA 4ZFCA 5HINA 1XC4A 2YYUA 2J9YA 4R7JA 3DFHA 2E0PA 3NSNA 1Y8BA 3EWXA 3QVQA 3GU9A 3NSXA 1XPYA 1MQPA 2C91A 1QVBA 4ZB2A 4UQBA 3HQOA 3L5MA 1WX0A 5U4NA 3IPWA 1ISXA 1O95A 1W2VA 2GQ9A 1K03A 4GFIA 4HNLA 3NPXA 4O1DA 4TX8A 3TJXA 3DFSA 2PDHA 3RMJA 1W1ZA 4D8ZA 2DORA 3QOKA 1HT6A 3MI2A 1W3NA 3KP0A 4B16A 3LERA 5GJPA 5C9WA 3HTWA 2ALRA 1AA1B 1J0ZA 3VDAA 1XYAA 1KLZA 4AZGA 3WLJA 1K8YA 3I65A 2SFPA 1XLJA 2EKCA 1C93A 4F4RA 3HQPA 1H1NA 1XS2A 2HISA 5E09A 1PTDA 5FI8A 3Q67A 1AQFA 1V02E 3WJYA 1ZPTA 3NEVA 3GS6A 2GGHA 3R7MA 4NP7A 5F7UA 3CIXA 3LCHA 2W9MA 4IIFA 5A6SA 1TWDA 2IPWA 1C8QA 4CNUA 5I3IA 3IGXA 2RDUA 4Z1DA 3GTIA 3LEPA 5K4ZA 3TW9A 2F6KA 2YLLA 1KD0A 1SFLA 1Y5XA 2WKLA 4QQ3A 4Q8VA 2E28A 1XKJA 2CYGA 5A2AA 1L2QA 4AIEA 3CUGA 4XBKA 2YR1A 2GGEA 4DX3A 3QR3A 2EBNA 3AHVA 2FMNA 2PCEA 4RDVA 4L6HA 2OEKA 4Z1AA 3ARQA 1CW2A 2OOGA 4AIUA 4Y7EA 4QLJA 2TSYA 4ORMA 4RW5A 3CPRA 3QEZA 4TMBA 1WZKA 3VX1A 2YCIX 4GI8A 3RXZA 3AYVA 2CBVA 4HOWA 2GQAA 1HJVA 2XFFA 5AVNA 2FDMA 1AL8A 2B31A 2FPTA 4GKTA 1IGWA 3RLVA 2QDDA 3LSCA 3POCA 3THCA 1W3IA 2HVMA 1G1YA 1H41A 4I9JA 4HGXA 5I6SA 1B4KA 1F07A 1S2AA 1QXLA 3CMFA 3S2MA 2E9LA 2J7CA 1GOIA 3VD3A 3ZYZA 4US5D 1XKYA 3GSMA 2JQXA 4D6JA 4BS0A 4KEZA 3LCFA 2IXUA 4C6LA 1UKQA 3KP1A 1V0MA 1GK8A 1HKKA 3EMCA 4WJXA 3BAIA 9XIMA 3KS6A 4F0RA 5LIUX 3U5UA 3L66A 1GG1A 5A8QA 3WD2A 3DU0A 4ZO6A 4IIEA 1AODA 1HP5A 1ITXA 2X1RA 5IM51 4DZAA 5A8NA 3KRSA 5DMMA 1IYXA 3BQ6A 1MXSA 1OFEA 1PCWA 4O50A 3AS2A 1YXDA 1Q6FA 3WUEA 3O1NA 3R2GA 5DBUA 4ZSTA 3CIVA 3S1VA 2F84A 1K8ZA 2ACSA 4JTQA 3KZPA 1D2KA 1M5WA 3NYDA 2A1YA 1IEWA 2WMIA 1CGVA 2YA2A 3GNPA 5HQMA 2X0HA 3L4ZA 3PN8A 5EU9A 1YIXA 1XYCA 4HNOA 3CQHA 3C86A 2V8ZA 3G6LA 3GUWA 4CQDA 5CGQA 2R1PA 4JCMA 1VJZA 4MYXA 2PFHA 5D2TA 3KOYA 1DL3A 4HSOA 4YHEA 3O0FA 2EPKX 1U1HA 2ZUTA 4O1CA 2NX9A 1KBKA 4IG2A 1V8EA 3W1MA 1JZ4A 1R2TA 1X39A 1XLMA 4HPXA 1WXJA 4ICMA 1I2PA 4GY0A 4JIHA 4IJCA 4PUEA 1QHZA 3ERPA 2F7FA 4TTUA 3UZ5A 1HJXA 3BCFA 1PIIA 1LQ0A 3AHYA 1H49A 4GI9A 1FWFC 1EDQA 4K7VA 3UR7A 4K7YA 1HGWA 4TTGA 1V7YA 3TNBA 1NDVA 1X1ZA 2VFDA 3CL6A 2ZYFA 3GIPA 2W67A 3OHIA 2X41A 2GSEA 1XR2A 3VO0A 2CKRA 3KZSA 4H00A 3EBVA 4F48A 1JCJA 1Q6EA 3W70A 4O8RA 3BAWA 1HUVA 3RG6A 3CQ0A 4Z2JA 3RPMA 1T96A 1GZGA 3BLKA 1IT8A 4QX4A 2DVUA 2PWVA 2ZOXA 2E67A 4FNPA 3PULA 1ONXA 3VC5A 2G0WA 4FHAA 4E8GA 3A4AA 4TVDA 1FDYA 1RJPA 4EAMA 3T0TA 1MXGA 5BU9A 2QS8A 3OP2A 4H7ZA 3LA4A 2DT2A 5GJMA 1V6VA 4C6OA 3USZA 2PTDA 4JFVA 1H63A 4Y6GA 3PUGA 4CCDA 2VC5A 1W1VA 2YKKA 4Z2IA 2Y4SA 2G3JA 4G6CA 3VAVA 3T07A 3LMYA 4RR4A 3WLOA 3VC6A 1PTGA 1HZYA 4Z0SA 1G0CA 1XLLA 4KH2A 3DFYA 3M07A 1UJQA 4FX7A 4JIIX 3W84A 3CEPA 4PTDA 3V7PA 3JS3A 1YX1A 3W7DA 1F74A 2PTXA 2XWDA 3UJ2A 2REQA 3AIBA 3GYCA 5CZ0A 1OGSA 1J12A 5T91A 3FYOA 1GCYA 3CV7A 4V1XA 5LGXA 4N2YA 5EMLA 1Z42A 2OMAA 4NXSA 3N19B 4QLLA 3SCSA 1TRDA 3CBWA 5FSDC 3RDKA 2Z24A 1VFHA 3BZGA 3PBWA 3I3DA 4UR7A 1EH9A 2E8YA 2ISWA 4C65A 1DQXA 2FGZA 4IFKA 4BF5A 3SRFA 1SO3A 1R38A 4P2VA 4OWGA 4PFMA 1EKOA 1KRAC 2BY2A 5LNVA 1VBJA 4FNTA 1OADA 4NAEA 4HCLA 1R3SA 4AD3A 3FAWA 1US3A 2VEPA 4U3AA 3W88A 1NY1A 4JX5A 2QCDA 2ZDRA 3CWNA 1H50A 5C2XA 1A0CA 5E6YA 2ON3A 4LVDA 4OFCA 2HBVA 3MP3A 2OEMA 1KM2A 4IMDA 3IUDA 3C52A 8XIAA 3RFAA 1QWGA 4KWWA 4P7RA 3WO8A 1AW1A 3NPUA 3UPWA 1OIMA 5CZJA 5E0KA 1B1YA 3GZ3A 4NJKA 1T7LA 2CU0A 1JZ5A 2PLCA 4KCUA 3SECA 1OCJA 2FB3A 4JCLA 2W66A 4F2UA 5C5YA 4GO8A 4Q8PA 4HIBA 4YTSA 1R85A 5DX7A 4H9YA 3REQA 7ENLA 3CAWA 3UQNA 4F2BA 3W1PA 4AD2A 4B5UA 1NOUA 2E77A 6ENLA 1LORA 4NJJA 5LHFA 2WXDM 3PZOA 4FZIA 4ZBCA 1I9CB 2RDTA 2FJKA 1O12A 5A6KA 3TN6A 3V35A 1XIIA 3OVRA 4GVGA 4TUFA 1OFPA 3SN4A 3W82A 1GZ1A 2Q02A 2EF9A 4C6CA 3ALFA 1Q7QA 3UXIA 4HHMA 3EAUA 1ITUA 1L6YA 3M7WA 2D0FA 3P60A 5A8MA 1ZY9A 2XSBA 3UR2A 3EEGA 3UP8A 3N6QA 3WQ5A 4D6DA 2XH2A 1TRIA 1CLXA 3AXXA 3E74A 1XG3A 2QNEA 5AYIA 3P0XA 2PE4A 3RM9A 1QOXA 4NVTA 1XWYA 3CLMA 3SEPA 3GG1A 1D3CA 1F2JA 3A9IA 1PWMA 2XGIA 3H4WA 3L4XA 1JIBA 3WFLA 1SMAA 5HK4A 4A21A 3B9DA 5HJLA 3URBA 4D72A 2VR5A 3E0VA 5CPQA 2H8ZA 7ODCA 1LYXA 1DJHA 1UYQA 3UXKA 1EYEA 1DPMA 2Z26A 5I77A 1B5TA 2XN1A 4HD5A 1QBBA 3OG3A 2Y1HA 1J4EA 1P0DA 1H1ZA 4RZ4A 3S5ZA 3LCGA 1ME8A 1EDTA 4IISA 1M7PA 4YJ5A 3AMDA 3GNNA 2CZVA 3T2OA 3TJIA 3UCCA 2PAJA 4DJFA 5JBDA 5M2FX 2J74A 3KRBA 4TMCA 2A7RA 3CXOA 1WDPA 3M46A 1QBAA 2F2KA 5F1UA 4FLOA 3NWRA 2YFOA 4OKDA 4EWND 3I68A 2DT3A 4X2RA 3V5FA 2VXNA 3W1LA 1UASA 1VF8A 3WLHA 2VR4A 1L6SA 3WF0A 1D3HA 4M8UA 4NKCA 1HL9A 1YXCA 2X1UA 3B0PA 4PUNA 5IBXC 4RPQA 4PMUA 3QQ0A 1G7UA 2QUUA 4GCXA 1OY0A 4B92A 2JIEA 2FVKA 1GNXA 3B05A 3FXYA 3ZJ6A 3C3NA 2HMCA 2ZCGA 4LSBA 4AIOA 4PBFA 4REQB 1JGIA 5DCBA 3S6TA 1S3HA 1FH9A 1G69A 4LANA 2DZWA 2PU0A 2DY3A 3BANA 5I3JA 4DO7A 2O7SA 1OM0A 1BLIA 4DO6A 4U3CA 4JIPA 1V77A 2PP3A 4WJEA 4AIBA 3ITXA 2Q01A 5DRCA 2WC3A 3B9EA 1UWIA 4HU4A 2PDUA 1TPUA 1EC8A 3VOIA 4DBDA 5A1AA 1CXEA 1L6FA 4Y9NA 3IRDA 1CEOA 3QFWA 3CC1A 5JUVA 2O4MA 1ME9A 1A5BA 1BQCA 3WN6A 1T0OA 3BMWA 7A3HA 4WSJA 1XINA 1YTDA 4JIQA 2P10A 1RHCA 1G4TA 4W85A 2VGIA 3UERA 2Y7FA 3KBNA 4QAIA 2ZXDA 1GPFA 3QY8A 4DF2A 4D8LA 2VEFA 1YBQB 2OGYA 1UOKA 3ABQA 5BCAA 1BHGA 4BZYA 3ARWA 3IARA 3THDA 4WX2A 5CZSA 3POHA 2RH9A 4MZ1A 5CLTA 1TJPA 3VIKA 3G24A 3SQLA 5T9CE 1GJPA 2ZDSA 1JPIA 1RUSA 3QKEA 4GI4A 4L65A 3TA6A 3GO2A 3LBMA 1XYMA 2FVLA 3KTXA 2YL8A 4Y9OA 1OD8A 3SO7A 1EWDA 3UZXA 1UROA 1WZAA 2A0NA 1KB3A 3B9AA 1XDMA 4IX0A 3B0YA 4AEOA 3QW3A 1ZP3A 1E73M 3W1UA 3TH6A 3HU7A 4D6HA 5DT7A 4UQDA 3KVJA 1S2TA 4JQ3A 1AW2A 2WNNA 4AWEA 1MYRA 2V5LA 3S2LA 3LD5A 3BJFA 1CIUA 2BFGA 2I57A 4CQ9A 4UTWC 4HPJA 1DXFA 4YN5A 3TA9A 3KUMA 1GKQA 1Z41A 3ITTA 4GVFA 2B7PA 2GJXA 3T08A 2OZ3A 2YBUA 3VE9A 5I09A 4M6PA 4FA3A 4GJJA 3GR8A 1B31A 3VNYA 5F2LA 5G4WA 3ZWSA 2G95A 3A3HA 3QTGA 3O3RA 3A64A 1GHSA 1GORA 3P2VA 8A3HA 1JUKA 2Y7GA 3FSUA 1DWGM 1LOQA 1PIFA 2CXGA 3OTRA 3T81A 1DWJM 2BHYA 3Q58A 1QNQA 4W93A 4IPJA 4IF2A 3AHTA 2A4AA 3WQDA 3W37A 1XRSA 2YB1A 3O6AA 4ZQOA 2XINA 4DY1A 3NQ2A 3WDQA 1NELA 3ZSSA 1RV8A 1EA0A 9XIAA 3AICA 2ZRXA 2PDYA 5HULA 2XDFA 2XH4A 3MHFA 2BLEA 2OTDA 1VPXA 3HB9A 1H3GA 3KL0A 1R3YA 3H8AA 3W7MA 1GZJA 2PDBA 3XISA 2R9RA 2VUNA 4IP4A 4GXPA 1VPYA 4NASA 4LUSB 3G1XA 3H55A 1EF3A 2CNCA 2V81A 2V2HA 3WMSA 4LAUA 1FWJC