3LTSA

Crystal structure of the mutant v182a,i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAAIVGRSIYLADNPAAAAAGIIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 81
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltsA00
3W72A 4Z0JA 3DKLA 3C6CA 5I3KA 2I1OA 3OA3A 1G67A 4R33A 3L0KA 5D2XA 2NWSA 3W1QA 3GX9A 2VEPA 1F6PA 5EBUA 4L4LA 3W7JA 1EA0A 2QCDA 3LERA 3M43A 3FKKA 3PSWA 4AXKA 3TJLA 2ABAA 1KLZA 3FS2A 2DORA 4LC8A 1TPUA 3TSDA 5FEPA 1BEUA 2J9ZA 2C16A 4NVTA 3Q94A 2TRSA 1VHNA 2Q3RA 2ISSA 4O16A 1KFKA 1J5TA 1OK4A 2V5LA 3NQ7A 1FXQA 2CLFA 2B7NA 2V8ZA 1TO3A 2J9YA 3DFOA 3A22A 3UWQA 1A5CA 3HPXA 3M9YA 2BXVA 3LTSA 4LV9A 4C1KA 4TO8A 1NSJA 4U28A 3W22A 2DZWA 5L6UA 3LXAA 2FFCA 4HPJA 4Y9AA 3PB2A 5D2VA 1FUYA 4YLWA 2QUUA 4GWEA 3IVTA 3C2VA 4K36A 2FB3A 1KA9F 3QMTA 1AL7A 1PHQA 1P1XA 3HIJA 1F7BA 1VCFA 1YPFA 5BMXA 5D32A 2C19A 4IMDA 1QWGA 1KFLA 4XKYB 4JDYA 3OEXA 3HJZA 4UTWA 4NU7A 3GNNA 3LCXA 2PC4A 2FIQA 4AWTA 3HF3A 2E5CA 4MFEA 3H53A 4NJHA 3THQA 4CNPA 4MJZA 1XDMA 1JR1A 3QZEA 2R94A 2OCZA 5D04C 1VJIA 2A7RA 2E6DA 4D2JA 5C5YA 1UCWA 3E02A 4RXFA 2WQPA 4JTIA 4JIPA 2R14A 4IMEA 4IGHA 3M5YA 4GUHA 3LHTA 1YDVA 3TDFA 3WK2A 1OF6A 4DELA 2H90A 1KM3A 4XZ9A 3W1MA 2CLHA 3B06A 2V2CA 4PCFA 5EL1A 3MHGA 4JN6A 4O19A 1JJKA 1FWNA 4ZQMA 3I68A 5LNVA 4RCXA 4BI7A 4OWGA 3NL6A 4XUGA 4WJEA 3RFAA 1QCWA 3EX6A 4AH7A 4BWLA 1K8XA 5I3IA 3GNDA 5HWMA 1TIMA 2VFIA 4O10A 5AB3A 4O17A 2PCQA 4NNAA 4X2RA 1QPQA 3C2RA 5D09A 4KWWA 3CLMA 5KZMA 5KINA 1MEIA 4R53A 3W1PA 4N9BA 2VOMA 1W8SA 3KOFA 3TQKA 4N6EA 2DZTA 1ZAHA 3EWXA 1QO2A 1C8VA 3BLEA 3NQ2A 5EPDA 2QUVA 3WJXA 4LU0A 2GJLA 4LV4A 4O12A 3C2OA 3STEA 1S3HA 1LM1A 2GUUA 5AN7A 3W7NA 4MVAA 3UNDA 3UWVA 4AHQA 5DBUA 4JTEA 4ZQRA 5AHEA 5HR6A 3RK8A 2JKPA 3EX2A 3LTPA 1GYLA 1K7EA 2A4AA 2Y62A 1EX5A 3NA8A 3R2GA 1OG0A 4IMFA 2A7NA 1CX9A 1SO5A 4MKNA 2WSRA 3F4WA 1SU5A 4C1LA 1H50A 1S5VA 3ZWSA 1J2WA 5F4XA 3NO5A 1FDZA 3THAA 5C2XA 4Q32A 5BRBA 4AF0A 5D38A 4MFDA 2VEIA 4O4VA 3NL5A 2J27A 1VZWA 3W1TA 1VRDA 3TCEA 1FWTA 4GUIA 4XWUA 4UTMA 1ZY9A 2OMAA 3DFPA 2J88A 4A21A 2DP3A 3MW7A 4K39A 3DFNA 3GXNA 3L5LA 1UUOA 4PA8A 5KSWA 3LV5A 1RZMA 1NFBA 1FDJA 3BW4A 3O16A 3S1UA 1FCVA 3CC1A 4PC8A 1FCQA 4I7VA 4TIMA 5LGZA 2YR1A 5D03A 5HMSA 1GZGA 3O6CA 1GWJA 1JUEA 4RK8A 1A5AA 4M6VA 4W9TA 3TE9A 4AWUA 3W7HA 4HNTA 1V5XA 1LOLA 2NUYA 4O1AA 4DXVA 4S1FA 3QSRA 2X1SA 2NV1A 1U5JA 2HS8A 3BLIA 3V1PA 2A6NA 2CFFA 5CPOA 3C0JA 3LGEA 2CLMA 3O15A 4PEKA 3KXQA 4EVZA 3BLFA 3P82A 2ZCGA 5DN1A 4UTUA 3ABOA 4JTUA 3HG4A 2CZFA 5HR7A 2TYSA 3PSVA 1TCDA 3N3MA 3TSMA 2Y89A 3C61A 4NX0A 1LRNA 4FNRA 1EP3A 2H3DA 1H5YA 1LLWA 2FQIA 4N6FA 3G0XA 4UMBA 1LRQA 2GVJA 3LCGA 3PUDA 1G4TA 3SIZA 4UTJA 3ZFHA 1CW2A 1FCBA 1PIIA 5CSRA 3GR7A 4IXXA 3OIXA 5AOUA 1KV8A 5D2YA 1PCKA 2CLLA 2P0OA 3JS3A 3CB8A 4DO5A 1IXNA 2NV2A 2WSYA 4QNEA 1LZOA 4XKYA 5F2MA 2PRMA 5LSMA 1R46A 4XQ6A 1UASA 2V82A 3DAQA 3M6YA 3CT7A 3DI1A 4LRTA 3KHJA 3QW4B 1ICPA 4FX6M 1LLZA 4MPQA 1K8ZA 3A5FA 1K7XA 4RZ5A 4JIQA 3TH6A 4NNCA 5EY5A 3PBVA 1W5PA 4X9SA 3EWBX 1TV8A 4BFAA 1H1YA 1DKWA 3A21A 1AG1O 1UJPA 3UXDA 3NM3A 1NF0A 3E0IA 3EWWA 5KZEA 2GQ8A 2QDGA 4M19A 3W7MA 4AMAA 3ANYA 4M6PA 2OJPA 1JUKA 5KTLA 3W85A 1F5ZA 2YYUA 5D37A 3NL3A 3P5YA 1NF7A 3MP3A 3DFTA 4KWVA 4WXYA 2QJHA 2RDUA 1ML1A 2Y7DA 3G1DA 3FYPA 1VPXA 4O18A 3P61A 3S1XA 2DZPA 1LP6A 2YFNA 4YL2A 3L66A 1X1ZA 1F2JA 4O1CA 4NZJA 3NM1A 1QFEA 4G1KA 4LS2A 4B5NA 5FF3A 3QMRA 4O50A 1SW7A 5CZSA 1W37A 5I3GA 5K4XA 2X16A 3SGZA 3DKJA 4OE7A 2Y7FA 2FJKA 4M6QA 1LTDA 5LHEA 2X30A 3IVUA 1KBJA 3K30A 4CLMA 4A2RA 2V0TA 3R8RA 4WY0A 4UTWC 3QEZA 1KFEA 1QPNA 3O07A 4ORIA 5KMYA 2Q3OA 3T7VA 5LNRA 4JTGA 4Y6GA 4JX6A 1OFRA 3HMJG 3DXIA 4K6AA 1VYRA 6ALDA 3YPIA 1HTIA 2X2GA 3TXVA 3I7SA 3SI9A 1OYAA 2RFGA 3DGRA 4JEQA 6TIMA 3ATZA 4N4QA 1YTKA 3W1XA 3KVJA 1RQBA 3W9ZA 4WOQA 4UNKA 3N9RA 3NQCA 3WJWA 4JXCA 1T0OA 4OQVA 2ZFAA 3S1WA 2WJZA 4IPJA 5CZTA 4UXDA 4ZL1A 1KV5A 5D02A 5CG7A 2QJGA 1ZAJA 3B0UX 5EA9A 4A22A 1AMKA 2ZDRA 1KFJA 3LDVA 3TU9A 4ONVA 1K03A 3OVRA 1DJQA 4MYXA 5HUPA 4IQLA 5G2HA 2P10A 4DEFA 1L6YA 3N34A 1VH7A 4BWLC 2V2HA 3TQVA 1XCFA 3M0ZA 3T55A 1TTQA 2CZEA 4A3UA 3P80A 3LLFA 1EP1A 3G24A 1LBMA 3IEBA 3MI2A 1GVQA 1ICSA 3PWAA 2EHHA 3OHIA 1B4KA 3O06A 1I2RA 1JRBA 1AW5A 1XKYA 2C14A 1H7WA 2CU0A 4PH6A 1T96A 3G22A 3LCIA 1DVJA 3KRSA 3W1UA 2GVGA 1DV7A 3DBPA 2ZA3A 4M7TA 4QITA 3PUEA 4GC4A 1LORA 4HN4A 4UTLA 3W3OA 2W6RA 4O1BA 1ALDA 4CCCA 4DO6A 2QCFA 1Q3NA 3UWWA 3NZRA 1I45A 1OYCA 2Y7EA 3EKLA 5HWNA 2QCLA 1ZCOA 5AHLA 4O15A 1YXCA 4JX4A 1RPXA 3ABRA 2P1FA 3NQDA 3DHFA 1F05A 1OHLA 3KVLA 3TKFA 3LBCA 5FEXA 4LNYA 4WY0F 3NQEA 3P74A 3DH7A 4I9AA 3TMQA 3C4UA 5FF4A 3I6RA 5LGXA 1G4SA 3NPWA 4Z0SA 2C15A 4MJMA 1T8XA 1GTEA 5HJLA 1DQXA 3U2OA 5AC7A 1XBYA 3Q2DA 1GG0A 4JTFA 4JTHA 1NEYA 1LOSA 4N02A 4WD0A 2YDAA 4GUJA 4N9CA 3B0PA 1PL9A 1YXYA 2C0AA 3JR2A 3L0GA 1ZENA 3QW3A 3VKJA 3PBYA 3GDRA 3OVPA 3LBMA 3BARA 1FWSA 5AC6A 1PHWA 3G8EA 3W7RA 4KKXA 3SW6A 4POCA 1SFJA 4UFMA 4Y90A 2ISVA 1VCVA 3M1ZA 3W1RA 2WOQA 2Y63A 4BI5A 3W2KA 2HS6A 2CZ5A 4IPIA 5I3FA 3LX9A 4LVFA 3LHYA 3L0NA 5CSSA 1TPWA 1JCYA 2LLEA 2NXGA 4AB4A 1WAUA 2J6XA 3NOEA 3IVSA 3LCLA 3W7KA 2Z6JA 1C9DA 1QR7A 2YZRA 2Y61A 1F74A 3UWZA 2I14A 1WOBA 1TPVA 1W56A 1RR2A 1I2NA 4EWND 3QQ0A 1ZJIA 4DO4A 3HGOA 4JTTA 1S5WA 4ZZ9A 1VHCA 5DY2A 2A5HA 1TPEA 3O1NA 4MY1A 1Z44A 4AHOA 1QAPA 1SR9A 1VS1A 4IX2A 3GKAA 4FX7A 5IBXA 4XBSA 2J24A 1H7RA 2C6QA 1VYPX 1OF8A 1BTMA 7TIMA 4Y8FA 2O7QA 2Z1BA 3MBFA 3HQ1A 4YMZA 1XFBA 1EWEA 3M41A 3USBA 3LOTA 1Q45A 1BWKA 1JCJA 1L6SA 4FNTA 5F4WA 3SR7A 3NQAA 1TREA 1X1OA 4MLJA 1SZGA 5DLCA 1M7OA 3TJXA 3IIZA 1FCUA 2ZYFA 4JS3A 3GAKA 5BW6A 4YCPA 3JRKA 5C6MA 3NYZA 1GOXA 1KFBA 1O95A 3M47A 3RNDA 5AYXA 2E6AA 1A50A 4FHAA 3MHFA 1I2PA 3CM4A 2WNQA 1KTBA 3S9YA 1RV8A 4DF0A 1XXXA 3UY7A 1PS9A 3P84A 1WXJA 4X22A 3TA6A 4PTNA 3BVJA 2YX0A 5EKYA 2Z0IA 3W88A 4UIOA 2HTMA 2NUWA 3WFAA 1DQWA 4JYEA 4H6KA 3N19B 4KFNA 1EB3A 4NNBA 2E77A 4O54A 4XTDA 2WKJA 5E1QA 3SJ3A 5J5RA 3S5ZA 2PURA 3BG3A 2V30A 2NXIA 3HG3A 3SY5A 2BLEA 2DZUA 3KVKA 3HGRA 4MY8A 1KW1A 3NDOA 3LRLA 1FXPA 1OFBA 4O13A 2CLOA 3FJ6A 3QYQA 3BG9A 2V81A 4NJJA 5EMUA 4LY8A 4S2CA 3QH2A 4P2VA 3UZ5A 2ZZ2A 4CCDA 3TR2A 2VEKA 2JBMA 5FF2A 1DORA 1GVFA 3C3NA 1YTEA 4N9DA 1VLWA 1XBXA 4QIUA 3W73A 1MZHA 4NQ1A 1TQJA 3UQNA 2EPHA 1IXPA 1G4EA 4A2SA 3QSTA 1BWLA 5U4NA 3WJYA 4HNVA 3A23A 1R2RA 3TK7A 5F1VA 3W7EA 2JKAA 4IMCA 4MZ1A 5AFDA 4GE8A 4LRSA 1DBTA 3W07A 1FX6A 4UCGA 3KAOA 3W86A 3NQ8A 2E5DA 4HNUA 2QKFA 5A5WA 3HG2A 2R91A 2Q8LA 3BW3A 3KVMA 2AQWA 3G0UA 3PVFA 2B7OA 1XUUA 3NR0A 1I2QA 2CZDA 3EX3A 2HSAA 3FOKA 3PBUA 3NL2A 4UC5A 1AW1A 4FXSA 4JGDA 3FA5A 2WO5A 1X7FA 5C54A 4UFIA 3TX9A 3BV4A 5AHNA 1OFEA 2ZTJA 3S5NA 3M16A 4Z1AA 5AYYA 5H91A 5LZLA 3O63A 2Y70A 3LB0A 4PL2A 2ZRYA 4GUGA 4DPPA 3MP5A 3CU2A 3G0SA 1JRCA 1VCGA 1G4PA 3MMTA 4HNNA 3RLUA 5F2LA 3SFKA 1KFCA 2V9DA 1YYAA 2DU2A 5E93A 4NUWA 4N9EA 1OX5A 3ZS4A 3NAVA 2H6RA 1O94A 3BGGA 4X3ZA 2X1RA 3CEPA 3UWYA 1B9BA 3PG9A 4ZQOA 4HT3A 1TMHA 3CEUA 1SFLA 1UBSA 1Q6LA 2HMCA 3MJYA 3G18A 4DPQA 3LCFA 3P81A 1JCNA 1B4EA 4JICA 4FX8A 4UMCA 1OFDA 1KBIA 3ZR4A 3QPYA 5LKYA 5GVJA 2QR6A 4WUIA 5K3VA 5HWJA 3G1SA 4CNNA 1PVNA 3TW7A 3VE9A 1EEPA 2VFDA 2QJIA 1JUBA 5DY3A 5G2IA 4UFJA 3S42A 1ADOA 1SW0A 3EX1A 3I7RA 3STCA 1HUVA 3Q58A 1O60A 3GXTA 1WA3A 3E49A 5D2TA 5I3JA 2ZQ0A 5BOOA 3C2FA 3CHVA 3BGJA 4MYAA 4UTHA 1PV8A 4LVAA 4DF1A 5HUOA 2VEMA 5DXYA 3LXCA 2OT0A 1W54A 1TTPA 4UNLA 4LC6A 4PFMA 4U4MA 2YW4A 5FEWA 1OJXA 2ZRXA 2Y6ZA 3N2XA 5DCDA 2R8WA 2E6FA 4KFPA 2X1TA 3W70A 3LV6A 3IGXA 3NPVA 1GYNA 3D0CA 4JTJA 1WDWA 4OGZA 4O28A 2VENA 4RZ6A 1K02A 1Y0EA 3F4NA 4GUFA 5LNUA 4TMBA 1OFOA 1SW3A 3EXSA 1QOQA 1H7NA 1TYGA 4LVDA 1YXDA 4IJBA 3M44A 2I9EA 2C3ZA 2QCHA 1TB3A 1YADA 3EXTA 3VCRA 3NPUA 4CCEA 2UV8G 1P5BA 1W5NA 3W2NA 1T99A 4LUJA 4E0CA 1SO6A 4YXGA 1DOSA 2A6LA 3M5XA 2JK2A 1ME8A 1TRDA 2A0NA 2FPYA 3CTLA 4RZ4A 4EF8A 1CI1A 3W6YA 1NAL1 2NX1A 2RHGA 1L9WA 1SUXA 4JTSA 3UPWA 4CQ9A 4FXRA 4QAIA 1W3NA 1GJPA 1XI3A 1U83A 1QO5A 1LCOA 4TR9A 1D3HA 2EGZA 2ATMA 4HHPA 3W7GA 3AO0A 3W7DA 1B3OA 4MLRA 1HO4A 2A2IA 3WK3A 4ZVJA 1K3UA 3T44A 3SSJA 4LT9A 3NEVA 1WBJA 3GDTA 1FBAA 1R47A 4XTIA 1OX6A 3VI2A 3TAKA 4NJGA 1WX0A 4ZQNA 1MEHA 3W2MA 4DQWA 2OZ0A 3LTYA 1OVDA 3EKZA 3GAYA 5L9FA 3HO8A 1XM3A 3LHUA 2QUTA 3UWUA 2NX9A 2ISWA 4LS0A 2F84A 1I4NA 1ME7A 1A53A 4LVBA 3LRMA 3HGSA 3W7IA 1RQEA 3CQ0A 5IBXC 1KM2A 1H7OA 2G96A 3NVTA 3LI0A 4UTTA 1GVRA 1YDNA 4H4IA 3RMJA 2ZZ4A 1LROA 4O4WA 5DXXA 2CW6A 1LRTA 4QSHA 1K7FA 4S2BA 3NQMA 3L2IA 5J5DA 3GB6A 2AGKA 4AEOA 3TW6A 4UMAA 3ABSA 3U6WA 3N73A 2ZZ6A 2ZRWA 4OHQA 3LCHA 1W3IA 1THFD 2VFEA 3E96A 1YPIA 4ICNA 3FYOA 3GDLA 1W0MA 4MY9A 2YW3A 2WPBA 5CPNA 3SECA 1W5QA 2ZTKA 4FNQA 3UYCA 2BX7A 1JULA 4FB7A 2PE4A 2XFWA 4Z1BA 2A7PA 2PRHA 4FO4A 4R34A 5F1UA 3N14A 3UPBA 5F2GA 2G5WA 3A5VA 3V75A 1H1ZA 5C55A 3HB9A 1HG3A 2TMDA 3L5MA 1OK6A 4FIRA 3U8GA 1P4CA 5FF0A 3C52A 4JYDA 3TQ0A 2QCNA 3P7YA 4AF0B 4O8RA 1IF2A 4R7JA 5E0KA 2D73A 2H8ZA 1TTJA 5CZ0A 2GQAA 2XN1A 3QF0A 3W1LA 1SZFA 2ZBTA 4WOZA 5K4ZA 3QPZA 3PM6A 2QAFA 3GVGA 3RLVA 3VE7A 3IIXA 3W83A 1KM4A 2RDWA 4JDBA 1W1ZA 1MEWA 2E09A 3BO9A 4EIVA 1UB3A 4MOZA 4ZQPA 3PS7A 2CWNA 1LBFA 4QQ3A 3W76A 4LS1A 3PR2A 3GZ3A 3LHVA 1TSIA 4Q33A 3EB2A 1K8YA 2ALDA 3G1VA 2VFFA 1XC4A 3GDMA 1HFBA 2DZSA 3M5ZA 3GIYA 4YWIA 5AHFA 3UZJA 2NLIA 3MUXA 4H3DA 5TIMA 4UTKA 3HPZA 4I7WA 4EOUA 4LW7A 4WZHA 5D05A 4LVGA 4RX0A 3L67A 1SSDA 3W71A 1TQXA 1TV7A 1KTNA 5CGQA 2CLKA 3E9AA 1LDCA 2RH9A 2DZVA 5G5IA 5EYWA 3TXZA 1F6KA 3KRUA 3HGJA 1KLYA 3GDKA 5ABTA 5T26A 3R12A 1JQVA 1Z48A 1AK5A 1EWDA 3W84A 4N2YA 2ZRUA 1L2UA 3N2MA 4PODA 1H7XA 2G95A 4MZ8A 1YLVA 1G7UA 3W7PA 3KRZA 1VQTA 3A24A 1OX4B 3W87A 1SZEA 1ZFJA 3R5EA 1ZHAA 3EEGA 2FPVA 1YDOA 3TROA 1ZAIA 3E12A 5AYZA 3GXPA 4Z1DA 1GPWA 2EKCA 1ME9A 3P5ZA 2GOUA 2ZRZA 3TC7A 3MI3A 3G1XA 4M5PA 1TRIA 2QCMA 3FLUA 4JX5A 1RD5A 4RXGA 3LXBA 3LRKA 3QQ1A 5K9CA 3TC6A 3TSBA 5K7JA 4HIBA 4OBTA 2JGYA 4Z1CA 2AAMA 1JCXA 3PC0A 4RV8A 3WJZA 4HPXA 3NZ1A 1GTHA 4HSNA 4K7YA 1X6UA 5G1YA 3P8IA 1MSSA 4JNMA 1W5MA 4IMGA 4M7SA 3TV8A 3MYPA 1WBHA 1GVSA 1Z41A 1H60A 3W23A 5LNWA 3B4UA 4K8EA 2V2DA 2YCEA 3LHZA 4JTLA 1TJRA 2ZA2A 3T40A 4EF9A 3BG5A 2FLIA 3NNTA 1D3GA 4UFHA 4Z08A 5FI8A 3NQGA 3PF3A 1G69A 1VR6A 3LI1A 1AL8A 1Q6RA 3PAJA 4NT0A 1NVMA 3B05A 2ZA1A 3NQ6A 1N7KA 3FEMA 5FEZA 3S1VA 1TV5A 1JQXA 3P62A 3W75A 1SSGA 4ZMGA 2G97A 4K37A 3G1HA 1Q6QA 3O6DA 4QISA 3L21A 4IXHA 3S0CA 5G4WA 3A9IA 3P60A 4O11A 2B4GA 2QDHA 5HINA 2E1DA 3W7OA 3HG5A 3M7WA 3KX6A 3G8RA 1HO1A 1ZNNA 1QMLA 1JVNA 3NQFA 3BK0A 5HNRA 4E38A 4FNSA 5DCEA 1B57A 1QPRA 3G3MA 5KZDA 2ZZ5A 1OFQA 2NZLA 4UR8A 2E5BA 3RU6A 1XUZA 4BI6A 2BZNA 1TPFA 2NUXA 2ZZ3A 3IGUA 1AW2A 3P67A 3CWNA 2VFGA 1QNVA 4WY0B 2E68A 3ABQA 1TPB1 2Z2UA 4QM1A 5K9XA 2ZRVA 4UR7A 3G1YA 1FDYA 1TTIA 2GPTA 3B03A 3B8DA 4P61A 4LWWA 4BR1A 4FNUA 2Y7GA 1FWWA 3O05A 3FFSA 3W2LA 1Q6OA 3L65A 4UTIA 3T4CA 1O4UA 3AJXA 1H61A 3OG3A 3PUOA 5H2ZA 5CZJA 4N4PA 2QCGA 4GFSA 4CQAA 1I8JA 4PL1A 3S5YA 1FQ0A 3TIMA 1HL2A 1KTCA 1WQ5A 3NPXA 4TMCA 5CKSA 1O5KA 3W7QA 3WK1A 4WXZA 3BW2A 5I3HA 5CPMA 3STGA 3EX4A 3CIWA 1C29A 2FTPA 3L5AA 3QRHA 4GXMA 1G6CA 2A1YA 3F1QA 4DF2A 3MWAA 5HQEA 5F2IA 3QJAA 4AVFA 1D9EA 2JGQA 1VC4A 2DJLA 3FKRA 5DCBA 1S5TA 3L68A 3NGJA 5SWUA 3W74A 4O14A 4UTTC 4QJ1A 5A8GA 4O53A 4QNWA 4GBUA 3W1AA 3SGUA 1LBLA 1M7PA 2TPSA 4WQ6A 3HBLA 3R89A 4NZFA 5FESA 3GLCA 1LYXA 5MHBA 2YYTA 3W2JA 1KM0A 1M6JA 1QOPA 1LOQA 3S5OA 5U7SA 4LOCA 3FJLA 3W7CA 3ELFA 5G4EA 5AHIA 3F03K 4NJIA 1RVGA 2C1HA 3P8JA 4LTSA 1GG1A 1XDLA 4FF7A 5BMWA 3VNDA 1EP2A 2YFOA 3CWOX 3QC3A 3EWUA 4BK9A 2ZZ1A 2VKZG 3EWZA 1PE1A 1OABA 3DZ1A 3L9CA 2IQTA 5IM51 2ABBA 4UFLA 2RKXA 3UXAA 2GQ9A 1DJNA 1H7PA 1IIGA 2BWGA 3VFLA 3GR8A 4FIQA 3B04A 3MHUA 1IXQA 1A5BA 4GNJA 1OX4A 3TMLA 4AWSA 2BSLA 4MUZA 3LHWA 2B7QA 3PULA 3WJSA 3QMSA 3IIPA 3R13A 4TX9A 1XL9A 4RR4A 3QM3A 4MZYA 2CLIA 4O0ZA 3DFSA 2QCDB 3W2UA 4YCOA 2F7FA 5AHMA 1PCWA 3ZWTA 4GJ1A 3OBKA 3T78A 3LM7A 3DI0A 5K9DA 3PY2A 1SO3A 4JY8A 1DHPA 3INPA 5TQLA 2Y85A 3NQVA 4AAJA 4O52A 4NXKA 1A5SA 1VLIA 1VYSX 2NX3A 4O0KA 4E2DA 4CNOA 4ADSA 1Z42A 4RLIA 5LNSA 1I2OA 3DENA 1ICQA 1VGAA 4IOTA 4OV4A 3OVQA 3STFA 3H54A 3UY8A 2WV8A 3TUUA 3GYEA 3LCWA 3TNOA 4UFKA 2NXHA 2Z6IA 2E6YA 3SZ8A 1FY6A 1UUMA 2DZXA 4A29A 3IIVA 1R2SA 1SQ7A 3GK0A 1SZNA 2FDSA 2WNNA 3CPRA 1W5OA 4KFOA 1FWRA 5AC8A 2WNZA 2VXNA 5HULA 1IXOA 4FEZA 3HPSA 2YSWA 1EPXA 2QCEA 1GEQA 4J9JA 4DBEA 1WOAA 3B0VC 4DBDA 1XBZA 2FPTA 5BNKA 1QPOA 2KZHA 3MI6A 4UUIA 2J9XA 1L6WA 4JY9A 1P0NA 3DU0A 2X1UA 1WV2A 2DJXA 2H3BA 2RDTA 4AHPA 2C13A 2TSYA 4TU1A 3G1FA 2BTMA 4ZQCA 5D30A 1H62A 2QEZA 1W3TA 4CQ8A 2W0UA 2ATSA 3EWYA 2ZZ7A 1KM1A 1SPQA 8TIMA 2B0MA 3WK0A 4IWWA 2CLEA 4NXSA 3N9SA 4NJKA 3PBWA 3PG8A 4Q4KA 1V7YA 4OT7A 3HOJA 2YXGA 1TPDA 1JCLA 3MP4A 5K2ZA 2PRLA 5KITA 1XBVA 4LUIA 4ML9A 2Q8ZA 1TPC1 4HSOA 5G2WA 3O8AA 5LHFA 5FF7A 3W1NA 4JR5A 1E51A 3MO7A 1X8FA 1W31A 1YTDA 4L4MA 1IIHA 2C18A 3C2EA 2FB2A 3O6YX 1GVOA 4E2BA 2NWRA 3W7LA 2B7PA 3S8HA 1ZALA 1BKSA 2O7SA 3M5VA 4JYFA 5CPLA 4MIMA 3NXFA 4FNPA 4ADTA 1MXSA 1M5WA 2OT1A 3LLDA 3TFCA 1IGSA 2W79A 3DFQA 1KM6A 3PB0A 3G3DA 5F4SA 3IRDA 1OFAA 3H55A 1OFPA 4NX5A 1P0KA 4OV9A 2XN0A 3RF9A 2GVLA 1F76A 4BF9A 4Y96A 1EUAA 4K8HA 1SO4A 1WYIA 1J4EA 1EUNA 2VELA 4IX0A 5DBTA 1TJPA 3I7QA 3BPWA 2A85A 3TFXA 3G1AA 4ALDA 5TBOA 3IV3A 3IGSA 3IIOA 4IUOA 1H51A 1QDSA 2VFHA 3NG3A 1G7VA 3CIXA 4JTKA 3KFTA 3UD6A 3TAOA 1GT8A 4K38A 2XN2A 1EIXA 1O5XA 1OYBA 3FIGA 2A21A 2QF7A 1KM5A 2H8XA 3C56A 1JCMP 2Y88A 4ADUA 4RJEA 4ORMA 5DELA 2QAPA 1R30A 1RQHA 4O1DA 1H63A 3MBDA 4I7UA 2V5BA 3MYOA 2VC6A 4RKAA 1F73A 1GQNA 3I65A 2JKEA 2GJNA 3S6DA 5D2WA 1N8FA 3ATYA 1ONRA 2YGYA 5D33A 2OX1A 3Q37A 1TPH1 4GRSA 1R2TA 3EXRA 2QCCA 3GKFA 2EF9A 4JD4A 1N55A 3QFEA 2YPIA 4WX2A 2WSQA 4O57A 4OU1A 4HKPA 1DL3A 1MO0A 4XBKA 5G1TA 3DHDA 2EAWA 3C8FA 4K7VA
chains in the Genus database with same CATH superfamily
2IKIA 2WJDA 3C6CA 4J40A 2PPGA 4QFUA 3GX9A 2VEPA 2XUCA 3BURA 1TUXA 3LD5A 1YNPA 3OTRA 3E0FA 1KLZA 3CGTA 4LC8A 3FVDA 1XG3A 1IGWA 1UWUA 2OEJA 4XZLX 2YXOA 1KNWA 4NVTA 3Q94A 5C8BB 2ISSA 4IJCA 4O16A 1KFKA 4ERAA 4FI4A 2FJUB 3GU2A 2J77A 5JMUA 4XG1A 3DFOA 3M9YA 1PIFA 2BXVA 3LTSA 3N11A 4LV9A 3GRIA 2OYMA 2DZWA 3LXAA 3IV8A 1OINA 1W3LA 3ZIZA 4CNSA 3OLIA 4GWEA 3C2VA 1XYCA 4UWMA 2FB3A 4NHVA 1KA9F 4S23A 2ESCA 2WXDM 4XKYB 1VFOA 3AROA 3AXIA 3EA2A 1MZRA 1A47A 3VA8A 1WDRA 4DJFA 4UTWA 1OADA 1HGWA 4HHMA 4JKLA 1IWAA 3VDBA 2UY3A 1JR1A 2R94A 2J62A 1BTCA 2OKOA 2VZUA 4JIPA 4RW3A 5H8UA 2R14A 1RPKA 4GJJA 3OYZA 1DHKA 2D0HA 2JE8A 5KETA 3WK2A 1Q5MA 2BHZA 3B06A 2XSXA 2BV9A 4O19A 1JJKA 3QVQA 1FWNA 5DO8A 3CQHA 1PBGA 2XSAA 5LNVA 1MNZA 3NL6A 4XUGA 3EX6A 4KMQA 1OCJA 4BWLA 1XLDA 3V35A 3UBPC 2OELA 4A8IA 4GACA 4AD1A 2FH6A 4O10A 3NFUA 4X2RA 1QPQA 3UJ2A 4KWWA 3BGAA 1JZ2A 1MEIA 3A4JA 4U2YA 4GZJA 3E2QA 2GGEA 1W8SA 4H9TA 5JQ9A 4MDOA 3EWXA 3MSYA 1QO2A 4IL0A 1AMYA 4DAIA 4L5ZA 2EG8A 3OLDA 5EPDA 3WJXA 1ZL1A 4LV4A 3K4AA 2QQ6A 3STEA 1ESWA 2GUUA 3W7NA 4AHQA 1XIDA 5AHEA 5HR6A 2BNJA 3M0LA 3PFMA 2VGFA 1CGWA 3EX2A 4NZ1A 3S2NA 2HK1A 3ITYA 1TA3B 1Y5VA 4AG0A 4JTRA 1H50A 1S5VA 2XIQA 3KCOA 2VQTA 3NO5A 3THAA 1CLVA 3CV2A 5G4HC 4YS1A 1TZ9A 5BRBA 1UMYA 5D38A 4N0RA 2XH7A 1FWTA 4GUIA 4UTMA 1ZY9A 1KKOA 2OMAA 3DFPA 3H7UA 2J88A 4A21A 2OTDA 2VGIA 4ZTYA 3NSMA 3L5LA 1UUOA 1V3LA 3UG3A 3CAWA 3S1UA 1UIOA 3KZSA 3CC1A 4P8UA 3PZQA 3UXLA 1FCQA 5HMSA 5EU9A 4D6DA 4RK8A 3OU8A 3UETA 3B9OA 3FAXA 5XINA 1R3WA 3N3TA 3T42A 3AMCA 4M8UA 2WHMA 4YNGA 4IFKA 2PWGA 3MVIA 1Q85A 2NV1A 3GH7A 4QDWA 3DESA 2Z25A 2A6NA 1ITUA 4J27A 5CPOA 3N6QA 1R3RA 3UCDA 4QE1A 1PKMA 1QOXA 2BBFA 4QSFA 3GS6A 3VVGA 4UTUA 1QNQA 2CZFA 3S2LA 3CUXA 4NASA 3N3MA 2Y89A 1LRNA 1EYWA 4FNRA 5HBFA 4GNVA 2DW7A 1H5YA 1LLWA 2FQIA 3H22A 4N6FA 5C9RA 4QDMA 3F4CA 3ITVA 2Y8VA 1FCBA 3QY7A 5BU9A 1XRSA 3B8VA 3A4WA 1QI0A 3UG8A 1E3ZA 6CGTA 3QFWA 4FOKA 3OIXA 2FGBA 5FAGA 4HD5A 1KV8A 4R7OA 2PU0A 2CLLA 3JS3A 4Y7EA 4MNKA 4W93A 3BOLA 5LSMA 2INEA 1UASA 7ODCA 1TZZA 3DAQA 2VC7A 4HTBA 3CT7A 2FYMA 3SAZA 2A3BA 6XIMA 1L8PA 1TKKA 4I6VA 4MPQA 1UUQA 5KEZA 4C6LA 1K7XA 1B3ZA 4G6CA 4RZ5A 4JIQA 3TH6A 3PBVA 3E3HA 2GGJA 1TV8A 3DECA 4DUVA 2IPJA 4C60A 3A21A 3AHYA 3UXDA 1QI5A 2GQ8A 4M19A 1CXLA 3W7MA 2OJPA 1JUKA 3AYVA 4F0RA 2OSXA 1O68A 3MP3A 1S1PA 3GHTA 4KWVA 2E9LA 1AH0A 3WMCA 3TOYA 2RDUA 2DT2A 3G1DA 2VEGA 2DZPA 1LP6A 4TV6A 4YL2A 3EWDA 4GPNA 3UNTA 4E3VA 1FP8A 4G1KA 3F4VA 3MUAA 4B5NA 2IQDA 5FF3A 2E67A 4XO6A 3NUKA 3A3XA 1V08A 3DN5A 5I3GA 3W0KA 2EG7A 1ECEA 4OE7A 1XYZA 1VJZA 2WMJA 3I6EA 2X30A 3HA1A 3CUHA 2X2YA 4X9YA 2JIEA 3K30A 1AH4A 3WD3A 4A2RA 1GKQA 4WY0A 4DJFC 4UTWC 3OHMB 1QPNA 4JBRA 3T7VA 5LNRA 4Y6GA 3W6LA 2GK1B 4D6CA 4JX6A 4B2DD 4FMVA 4Q22A 4K6AA 1YQ2A 3SRFA 2X2GA 5A6KA 3I7SA 1OYAA 4NRSA 3DGRA 1R3YA 2GLKA 4N4QA 4PGLA 1A5LC 4QJ3B 3QLLA 1RQBA 4QEEA 3H6OA 2FVLA 4U5IA 4JXCA 4HVXA 1T0OA 4AD3A 4UXDA 2YBUA 6REQA 3LPOA 4CQCA 3UT0A 5EA9A 3LDVA 3TU9A 3T07A 3GUGA 3VMPA 3NXLA 5HUPA 3RILA 2V69A 3IPWA 1L6YA 3N34A 2J7HA 4BWLC 1PX3A 3TQVA 1NOFA 3AMDA 1TJ2A 4IP7A 1TTQA 5E6ZA 3IEBA 1ICSA 3OHIA 3CUGA 3D47A 1HJQA 1AW5A 3PTDA 1US3A 2R1PA 2XSBA 3AXMA 1KBBA 1DTUA 3B8WA 4PH6A 1JNEA 3KBVA 3ZVHA 3LCIA 3W1UA 4DX3A 3WX7A 3O0KA 4TVCA 3MA8A 1LORA 1KBLA 1YBQB 3EGJA 2WM1A 4JQ2A 3LM3A 1ALDA 1RY8A 1J9YA 1DJHA 1Q3NA 3EKLA 5CJNA 2DVXA 4LYKA 3T0CA 4W5ZA 1ZCOA 4O15A 1P48A 4JX4A 5BXPA 3ABRA 2P1FA 3RXZA 3G6MA 1OHLA 3AAMA 1Q2RA 1WDPA 3TYBA 1OB0A 2FH8A 1IR2A 2PLKA 3DH7A 3UJEA 4YYCA 3TTYA 5FF4A 1OZMA 1N8WA 2C15A 1H2JA 3K8LA 3WBWA 5HJLA 3U2ZA 1XBYA 5I0DA 4GYKA 4J2MA 1LOSA 4N02A 3ITLA 4N9CA 1J79A 3QW3A 3VKJA 3GDRA 3LBMA 1SFJA 1A5NC 1MW0A 2ISVA 3W1RA 5BU6A 2QHAA 3IAPA 1UQYA 4G56A 3T05A 2F2HA 2PBOA 4MM1A 1C91A 1I1WA 5CSSA 1TPWA 1JCYA 2NXGA 2X7VA 7CGTA 1V3KA 3RM4A 2J75A 3IVSA 1F9CA 2DIKA 1FKWA 3W7KA 2Z6JA 1C9DA 2D2GA 2YZRA 5T9CE 4DBUA 2QT3A 2I14A 2XISA 4LUSA 1TPVA 2I16A 4DO4A 3HGOA 3E2VA 1W9UA 2CITA 1Z44A 2P5NA 4AHOA 1VS1A 4IX2A 3HV8A 3WELA 3AIWA 3POCA 3FYYA 5IBXA 1LWHA 2J24A 2C6QA 1BTMA 1JFHA 1MUWA 2BDQA 4Y8EA 2O7QA 3PZIA 1XFBA 1VFUA 4YYFA 3S2MA 3LOTA 1Q45A 1B2YA 1BWKA 3NZGA 1KC7A 2VTFA 3SRHA 2GJPA 4FALA 4Z2LA 3N4FA 1X1OA 3CHDA 1UWIA 1SZGA 5H1WA 3TJXA 5BW6A 1EGZA 1JPIA 3NYZA 3WQPA 4US6A 1OEPA 1SJAA 3UA4A 1XISA 1XLLA 2BHYA 3WQ4A 1TX0A 2DT0A 1I2PA 5HPCA 1KTBA 3S9YA 3L4ZA 1XXXA 3UY7A 5I5RA 3SB0A 4KRTA 5AKQA 4D6GA 4NYYA 4ECLA 3BVJA 1E15A 2PP3A 2WC4A 2YX0A 4IQJA 1UWSA 4UIOA 4XSLA 4DI8A 4JYEA 4H6KA 3N19B 5HJXA 1PJ9A 2Y5JA 1XGDA 4ZB0A 1R6WA 4PUDA 4O54A 1SFSA 3S5ZA 2PURA 3HG3A 4F9JA 2NXIA 1SMAA 4MY8A 2HXUA 4HA0A 3LRLA 3CO4A 4C1NA 3DGBA 4L56A 3PP7A 3VUSA 4F0LA 2WHLA 2V81A 2XZ9A 1OC7A 3FGCB 4XAPA 1RK5A 4H1ZA 4P2VA 3UZ5A 3CNYA 3GNRA 4CCDA 2VEKA 4GD0A 3H2EA 3KZPA 2JF7A 4AZBA 4P5UA 1YTEA 3FCPA 4QIUA 1PYFA 1P43A 3W29A 5A6SA 3NCOA 4HNVA 3ZM8A 1R3VA 3AMLA 2EPNA 3PZOA 2DVTA 3EMCA 3OBAA 2FGZA 3BLKA 1RA5A 4RDVA 1DIOA 3W86A 1NFPA 4Q7BA 2QKFA 2W4XA 3LGDA 3DG3A 4F0MA 3M6DA 2NQZA 1UIPA 3NR0A 1XSKA 2HSAA 3FOKA 2WVTA 1K6WA 1DJYA 1AW1A 4RL3A 4Q8WA 4JGDA 3FA5A 1EC9A 3FHQA 1OCQA 3EEZA 5AECA 2ZC8A 3KS5A 1B1YA 3TX9A 4D6IA 3S5NA 3M16A 4Z1AA 1ZS2A 5JH1A 1WXYA 3IK4A 7A3HA 1QNRA 2GSJA 1XC6A 2CBVA 4PL2A 2YA0A 4DPPA 3MP5A 5I00A 5PTDA 1G4PA 4C6FA 3MUY1 3EMZA 2VX7A 3VDGA 3KP1A 1E5JA 4X60A 2WLYA 3ZS4A 2H6RA 3CMJA 2X1RA 1HT6A 1J11A 2J74A 3CL7A 3KL0A 4ZQOA 5H8PA 5AYIA 2HMCA 2WHJA 1GZ1A 3G18A 5DX7A 3EB3A 2YLLA 2AGTA 2PWUA 4FX8A 3SY1A 4KEUA 4DJFD 1MRAA 1KBIA 2R1NA 1ITXA 4GFIA 3ZQ9A 2W3ZA 3AZSA 4WUIA 4MAVA 1PVNA 3TW7A 3VE9A 2QJIA 5DY3A 1QHPA 3S42A 1MW1A 1ADOA 2OG9A 1K70A 4I9JA 5D2TA 2Y2WA 3M0XA 3BGJA 1M41A 1BRLA 4V28A 2D2OA 3WLSA 4PRRA 2XH0A 4LCSA 5HUOA 1HJWA 5DXYA 3LXCA 4QG9A 1E1CB 4Q6JA 3IJDA 3K4WA 2O9PA 2OZTA 4PFMA 3I10A 4HYRA 4NIRA 3N2XA 2Y6ZA 4PUNA 4E2OA 2GSEA 2QV4A 4DLFA 3W70A 3LV6A 1JZ5A 1E6XM 4OGZA 3HFTA 2OODA 1Y0EA 3RPTA 3ZT7A 2PWEA 4YTUA 4LUTB 1HGYA 1OFOA 3M0MA 5ABHA 1H7NA 4LVDA 1YXDA 2E3ZA 1VAHA 2I9EA 1IEQA 4CU6A 4HMDA 1ZCCA 1TB3A 1YADA 2X0HA 4RPPA 3SM0A 4DN1A 2XZ7A 2FGLA 4YXGA 2A6LA 2JK2A 2FPYA 4RZ4A 4EF8A 3VKKA 3W6YA 1NAL1 2RHGA 3CH9A 4GX8A 2X0YA 4CQ9A 4FXRA 4QAIA 1W3NA 4JQAA 1GJPA 1QO5A 3WLMA 4HHPA 3RM8A 3WK3A 4ZVJA 1XD0A 2P50A 4LT9A 3NEVA 4IUGA 3P2VA 1XF0A 4AIUA 4XTIA 3VI2A 3U4AA 4ZQNA 1DWGM 3W2MA 1ADDA 4DXKA 3EMQA 3FNDA 5HXMA 1OVDA 3QGVA 1OZQA 3H2CA 3HO8A 3LHUA 1RA0A 1GNXA 1OD8A 1K9EA 2ZUUA 3O2LA 2J8FA 3N1AA 5DQPA 3BSHA 2X7WA 3LRMA 3HGSA 3SJNA 3CQ0A 1ONXA 5IBXC 3EKGA 1OC5A 1H7OA 2G96A 1GVRA 4EACA 4HU4A 4H4IA 4MB5A 3AOFA 4XV0A 1OWQA 4O4WA 2Q6ZA 4JFWA 3AICA 1LRTA 1XYFA 4FF5A 1K7FA 4S2BA 3L2IA 3LEPA 2QV5A 2PDGA 3P6LA 4FXJA 3N73A 1AODA 1YPIA 4ICNA 3GH4A 5CPNA 3M7SA 5BWAA 3WLNA 4JFVA 4KWUA 4JFUA 2BX7A 1DIDA 3B8SA 1EJTC 2PRHA 1OCNA 3DEQA 3HB9A 2VYOA 4A3YA 1P4CA 2O4QA 4AF0B 4C7FA 1IF2A 2BG5A 1GKRA 5E0KA 4GZIA 5CZ0A 5LA2A 2OGJA 4KH2A 3QZ6A 1P6BA 1W1TA 1AA1B 3F2CA 2ONEA 3GG7A 1J0YA 3PM6A 2QAFA 1R3SA 2PDLA 2RDWA 4LJ3A 1MEWA 4F9DA 2HRWA 6TAAA 1K4GA 3QKEA 4I6KA 1A49A 4YTQA 3RRXA 2V38A 5C0QA 1XC4A 2QDDA 2NLIA 3MUXA 4H3DA 1E4NA 1XV8A 4I7WA 4EOUA 1H41A 4HZ6A 3AQUA 2R1KA 1UWRA 3L67A 4W88A 3W71A 1TQXA 4P7OA 5A94A 3E9AA 3OZOA 3SCPA 3G1RA 1KGUA 2DZVA 1CXEA 3TXZA 2JQXA 3PUGA 3TWBA 2WMKA 1X1NA 5BROA 5A6LA 3AIEA 3SSZA 1Z48A 3FV9A 1AK5A 1XLCA 3CHEA 4PODA 4CVWA 4F0KA 1G7UA 3CHCA 1OX4B 1SZEA 1ZHAA 5FL1A 3IS4A 3TROA 2EG6A 1W9XA 2A79A 4B5SA 1EJUC 4IFRA 4Z1DA 1MUMA 1Q65A 4KERA 3TN4A 2GOUA 2G3JA 1RY0A 4NAFA 3ZYZA 2POTA 4WDWA 4M5PA 3HN3A 5F7UA 1S2TA 2DFAA 4GISA 1IYXA 1EDQA 1JCXA 4NILA 4ZO9A 3WJZA 3DUGA 3MQTA 3NZ1A 3SCUA 1X6UA 5G1YA 3HQPA 3UFYA 2Y0FA 3P8IA 3MYPA 4DUXA 4HQVA 1O7AA 2NVCA 1JFXA 4K8EA 3LHZA 1O5QA 3T40A 4EF9A 5C7VA 4UFHA 3NQGA 3PF3A 3R0KA 1FWJC 1G69A 1VR6A 1Q6RA 3RLHA 5FEZA 1N7KA 3S1VA 1JQXA 4ZMGA 4K37A 1S2UA 3SO7A 3G1HA 3O6DA 3TA9A 9RUBA 4LBRA 1MMFA 3P60A 2REQB 4PEEA 4DIAA 2XVPA 3HG5A 5CC5A 4P7NA 3M7WA 4F0HA 4I8YA 3SUUA 4CN6A 1REQA 3IACA 4DBWA 1JNDA 4M29A 4E38A 4W86A 3VO0A 2E1WA 3G3MA 2ZZ5A 1GPFA 4ZO8A 2ZKMX 1OFQA 4UR8A 2YB1A 2E5BA 4HN8A 1XUZA 2WVUA 2BZNA 4C6BA 2NUXA 3SDOA 4PMYA 2BXYA 4PB5A 3CWNA 3BMXA 1RK6A 3BQ5A 2G4JA 5IHRA 2ZRVA 1BG9A 4UR7A 4AIEA 5CBBA 4XVDA 3PTMA 2AMXA 1NOWA 1J5SA 3B8DA 4P61A 4LWWA 2ON3A 4H9VA 5GJMA 4BR1A 7REQB 4Z17A 1T6MA 4IF2A 1H61A 3OG3A 3PUOA 3RPDA 1ZJBA 5CZJA 2QCGA 1CGTA 4MWAE 3T2QA 1Q63A 1HL2A 1KTCA 2UBPC 4IIHA 3WK1A 4NF7A 5CPMA 4MNJA 1PKYA 3L5AA 3QRHA 1Z7AA 2F8QA 4WGXA 5GNYA 2A3LA 3CL8A 1E4IA 4EPKA 5B80A 2JGQA 4PRTA 1JD9A 4QQUA 3PTKA 4GINA 3L68A 4CN4A 5XIMA 3WUBA 1XIIA 2KX9A 4LBSA 4WQ6A 1G94A 1PWLA 4NZFA 1V79A 1LYXA 3IJQA 1EFZA 1RCXB 2YA1A 1QOPA 1XPYA 4LOCA 2BY1A 4Q8MA 4LALA 5AHIA 3F03K 4QBXA 1R3TA 2VC5A 5FJPA 1EP2A 2YFOA 3E2RA 2ZZ1A 1EF3A 1PE1A 1CPUA 2IQTA 2FHBA 1KQZA 4KEZA 3R8HA 2HROA 3KBJA 2WC3A 4E8GA 1F61A 4A8RA 1XSIA 3PZMA 1JPMA 2ISFA 1B9ZA 1IXQA 3H2NA 3T81A 3OOQA 2OO0A 3LQLA 4EKJA 1LT8A 1GZJA 3LHWA 4CVUA 3PULA 3B8UA 3WJSA 4CUCA 3R13A 1V93A 3CQJA 4AIOA 2OZ3A 3QM3A 2CLIA 4O0ZA 3DFSA 4FP1A 1J0JA 4YCOA 1A3XA 2F7FA 1VF8A 5A69A 3FDGA 4RDWA 1HX0A 1PCWA 4GIAA 2PDPA 3T78A 2G37A 1SO3A 1DHPA 4HCDA 3CYJA 4AAJA 4FLQA 4JHOA 2HQAA 1A5SA 1VLIA 2AKZA 1W1B1 2ICSA 2UWFA 1ODZA 2G8ZA 3DENA 3WF2A 1UYQA 4OV4A 4ERIA 1UJQA 5CSYA 4WJXA 1XYLA 2XGZA 4D6FA 3TUUA 4Q8NA 3L4TA 4OFCA 2Z6IA 2O9RA 2E6YA 5LA0A 1PEZA 1UUMA 4A29A 3UESA 1SQ7A 1SZNA 2DW6A 4FOJA 3LUTA 3V4BA 4L1XA 5HULA 3MCOA 3XIMA 3HPSA 4CNUA 4BQ4A 1GEQA 4J9JA 4L7ZA 4DBEA 3B0VC 1EIBA 1A5KC 2VNCA 4A6GA 3CZKA 2NV9A 3PNZA 5JBDA 3C8NA 4UUIA 3WEZA 2X1UA 4AHPA 5C9XA 5BCAA 4QS6A 4CQ8A 5DMMA 2XGIA 1FOBA 3ARRA 4FR6A 3LY0A 1W2PA 1VFSA 1J01A 2V5CA 4F48A 5I2UA 4OT7A 4PSRA 1JCLA 3MP4A 5K2ZA 4S3JA 4ML9A 5G2WA 2YL5A 5LHFA 5FF7A 3W1NA 2GUBA 1UZ1A 4JR5A 3VGDA 4L4MA 1YTDA 1E0XA 1XLHA 1PB0A 5EMMA 2Z00A 4GYJA 1EL3A 4NY2A 3ZJ7A 3NZPA 2OQYA 1BKSA 1YNQA 3AS2A 4JYFA 4MIMA 5LIWX 1RXOB 4LYRA 3WQFA 3PB0A 3G3DA 3IRDA 1RCQA 1OFPA 1CEOA 4OV9A 1E9YB 4Q8QA 1XCWA 4Z2IA 1IZKA 2QJJA 2Z26A 3C3UA 3WNLA 1F76A 1V6TA 4K8HA 1SO4A 1EJWC 2JFEX 4IX0A 1US0A 3AHVA 3AXHA 1V3HA 3AIQA 1QNPA 1W1A1 4DB7A 1H51A 2VFHA 2DQWA 3M46A 4PTXA 1EIXA 4O8AA 3G6LA 2A21A 1KM5A 2EO7A 3C56A 4HMCA 4H04A 1QT1A 2EKGA 2Y88A 1QPKA 4RJEA 2WSKA 3IK2A 4ORMA 5DELA 3PBGA 1PZ3A 3MMUA 2YCKX 4I7UA 1MQQA 4C6EA 3CT2A 3B4YA 2VI0A 1TV4A 1F73A 1GOMA 2FZNA 2GJNA 4XZWA 3GXDA 4AY1A 1FKXA 5D2WA 3U7VA 2RDXA 5D33A 2OX1A 3Q37A 2DUZA 3QYSA 3ITXA 2W62A 1FWCC 1E4MM 1P6CA 4WX2A 4LUYA 1Q8JA 4BF5A 4LYPA 4PBFA 4B5TA 4OTKA 1DL3A 3DX5A 4AYGA 4IFKB 5G1TA 3DHDA 3C8FA 3ONBA 4C6JA 1O12A 3W72A 5IFPA 4Z0JA 2I1OA 2RGLA 3EOUA 4EPDC 3A3HA 2NWSA 3W1QA 1SJDA 1J10A 3W7JA 3WL0A 3LERA 3UCQA 3FKKA 4AXKA 4PTMA 1Q7QA 2ABAA 2XIIA 1DE6A 2DORA 3R43A 1TPUA 3TSDA 1PAMA 3DERA 4PZVA 5FEPA 1BEUA 4EANA 2J9ZA 1J5TA 3NQ7A 5MKGB 1FXQA 1EC7A 3NO3A 4ZSTA 3UWQA 1A5CA 2VM8A 3A3WA 3P3BA 2WB5A 1XG4A 4C1KA 4TO8A 2OEKA 5LYRA 3BAXA 3PZTA 4YTTA 4HPJA 1FUYA 2QUUA 3IVTA 2X05A 4K36A 1CENA 3WDPP 3QMTA 3ZT6A 1VCFA 1YPFA 3R10A 1TELA 1B3YA 1QWGA 1KFLA 4YTRA 2QF8A 4JDYA 1NWTA 3GNNA 4BQ3A 2PC4A 4X0NA 2NSXA 4DM2A 3THQA 4CNPA 4LXFA 3KDOA 5D04C 1LL4A 2DVUA 1UCWA 3E02A 2WQPA 3CL6A 3WQ6A 3DCPA 3QHMA 1IEVA 2PDXA 3M5YA 1YEYA 1ZUAX 4IGSA 3CO8A 3TDFA 2FZDA 5D8ZA 5EL1A 4KCWA 3T4WA 1P1MA 3RX2A 2EXOA 4W7WA 3I68A 4C6KA 3QC0A 3RFAA 1QCWA 4AH7A 1K8XA 4MNLA 1E4LA 5I3IA 3KEHA 1TIMA 5T8GA 3S6OA 4NZCA 3WUGA 4ZSUA 5AB3A 4O17A 2HZGA 2PFHA 5E9AA 4DZAA 5KINA 4R53A 3B0YA 1UH3A 3W1PA 1CZ1A 3UJRA 2VOMA 3ARVA 1J18A 3KOFA 3SEPA 3TQKA 3WLIA 1VEPA 2PDMA 3HU7A 1C8VA 3AI0A 3MS8A 4QEHA 5IHSA 1YHTA 3C2OA 3ZLHA 1G9HA 1LM1A 2ZUTA 5DBUA 3FAWA 4ZQRA 4LX4A 2JKPA 3GVRA 3R2GA 3B9AA 1CX9A 1NOUA 4MKNA 1LUCA 3WBEA 3LK6A 2DIJA 1BYAA 2F2KA 2L5HA 5C2XA 4Q32A 4HK7A 5HMDA 4E4UA 4G5DA 4BS0A 3M0KA 2WJEA 4O4VA 6REQB 3H21A 1CTNA 3AU6A 4C6IA 4XWUA 4JTCA 2NLYA 1PWMA 2DP3A 3MW7A 4K39A 3WIJA 3TJ4A 4PA8A 3P0WA 1FDJA 2PAJA 3BW4A 3WN6A 3BCDA 3NWRA 4CEUC 2VMFA 1GJUA 2C0HA 4I7VA 5LGZA 4GOAA 5D03A 3GTHA 1GZGA 1GWJA 1NP2A 4M6VA 4W9TA 5FA5A 4XB3A 3G77A 4AWUA 4H8NA 3V1HA 3W7HA 1AVAA 1U22A 4ZO7A 3ZVHB 4GQGA 3URAA 3SRDA 4JTQA 2NUYA 5GNZA 5BOFA 4HU0A 5JH2A 4S1FA 3QSRA 3FHAA 2X1SA 4QHRA 3KW3A 4H9XA 2ZDSA 4H7CA 4JZ5A 2VHLA 3LGEA 1XIJA 3O15A 4A05A 1L0PA 3KXQA 4DYJA 2MUCA 2E28A 1OT2A 3OODA 4B16A 3ABOA 5HR7A 2TYSA 3MDUA 2VJXA 2OYLA 3PSVA 4GQ0A 3JU2A 3TSMA 3C61A 4FR1A 2WPGA 3PJWA 5CXPA 5G1MA 1TV2A 5E0CA 1MRQA 4UMBA 2I7GA 1E6NA 5DFAA 4HNCA 3AZRA 3SIZA 4HNOA 4XZHA 2O9TA 3EDFA 3GR7A 2I5GA 3KS6A 4IXXA 1FWEC 4P8WA 2E9MA 1PCKA 5E70A 4EAYA 1AJ0A 1OIFA 4DO5A 1IXNA 3HM7A 3DOPA 2PTYA 2PRMA 3GW3A 1R46A 4RPQA 1J0ZA 1KR1A 5EMYA 2VDIA 3KHJA 3S5SA 1ICPA 5FACA 3VIFA 1LLZA 1RUSA 3GVVA 2HNEA 2XJ7A 4QRNA 3WNOA 3HURA 5EMKA 4GIEA 5EY5A 1Z9AA 3EWBX 4BFAA 4DUOA 1H1YA 3DC8A 5FJOA 1UJPA 4L4PA 3E0IA 2QDGA 3U2CA 4AMAA 4JPGA 4C6CA 3WQ5A 4ICCX 4Q4SA 5D37A 5HQLA 4IISA 4LUSB 3N04A 5HMEA 1MFVA 2QJHA 1F3TA 1ML1A 4ACZA 4O18A 3ITOA 4M82A 1GW9A 1UKPA 1X1ZA 2BGNE 3KUMA 4O1CA 3VNLA 2E40A 1U1HA 2V68A 2D2JA 4ENLA 1KXTA 1SW7A 1MW3A 1JEZA 3V3WA 3WNNA 2CKSA 5EGRA 1EOMA 2Y7FA 3MKVA 4M6QA 1BQCA 3GTXA 1LTDA 4EAMA 1WUEA 2PBGA 3H2OA 3IVUA 4AZ7A 3WQOA 4CLMA 3GNOA 2VD9A 1B30A 3KL3A 2CLPA 2V0TA 3R8RA 1KFEA 4D1IA 1UH2A 4JTGA 1FA2A 4ZOAA 3HMJG 3DXIA 5E6YA 6ALDA 3ZMRA 1WDQA 3GSMA 5LXEA 6TIMA 3ATZA 1E6QM 3MZ2A 1YX1A 5BRQA 1UP0A 2DSWA 3N9RA 3OG2A 1J6PA 3S1WA 3W38A 4ZL1A 2CZVA 4TTUA 1KV5A 1W1YA 5CG7A 2CXEA 4D6EA 4UQBA 2O55A 2ZDRA 4HPHA 2VR4A 2AQOA 3T8LA 4IQLA 3I3DA 4IIBA 3MUCA 1VH7A 1XCFA 4C1NB 3M0ZA 1C7SA 2PF0A 2CZEA 3P80A 3LLFA 3WD1A 3TEVA 1LBMA 3WLRA 1GVQA 4LCRA 1BYCA 1I2RA 1ODUA 3CQIA 1H7WA 2CU0A 1JPKA 4K2SA 3H70A 3KLKA 1K9FA 3S9ZA 3RCMA 3T08A 1JPHA 2W6RA 5C7HA 2PZ0A 3L23A 1V6YA 1F3WA 1QJWA 3UWWA 1OYCA 4PBGA 4AD2A 1IEXA 1LG2A 4IM4A 1UWTA 2Z1KA 2ZUVA 8XIMA 4J3WA 1IT7A 3DHFA 3KVLA 3ZXWA 3V0SA 4P7QA 3CZ8A 3CB3A 4I9AA 3TMQA 3KOYA 2W63A 3ES8A 4OUIA 4GHRA 3HV9A 4Z0SA 4MJMA 1T8XA 1GTEA 3OPSA 3TW9A 1DQXA 1UD6A 4JIIX 1GG0A 1VFLA 1B0IA 3SCOA 1RLDA 3VPLA 4L6HA 3WLKX 4GUJA 3B0PA 4MWAA 1LJYA 1YXYA 2C0AA 3JR2A 2PI6A 1ZENA 4HOZA 5ECVA 1WCGA 2Z1XA 3OVPA 3C0SA 4MMWA 3BARA 3TTQA 1FWSA 5AC6A 2R82A 1FWDC 4L64A 3VIMA 3TN5A 1WB0A 3WLJA 4POCA 3KDNA 4UFMA 4W8BA 3HZ3A 2CIPA 1RJPA 2VQUA 3W2KA 1E9ZB 4IPIA 5A8PA 4LVFA 3ZLGA 1R9XA 4LBUA 4PB4A 3SCTA 4LEFA 4FA3A 4A3RA 1NDWA 3H23A 2LLEA 1I75A 1QI2A 4AB4A 1WAUA 1FHUA 3VIOA 3AS0A 1EBHA 3N9KA 2PD9A 4R85A 2D3LA 1BRLB 1RR2A 1I2NA 5I23A 2G3MA 1SM9A 2WHKA 1VHCA 5DY2A 3F5LA 1TPEA 3O1NA 1IZCA 3SQMA 4CCZA 2CYGA 3GHRA 4NKCA 1H7RA 2OU4A 2W5FA 1D2KA 2VVNA 1OF8A 3HQ1A 4YMZA 1K77A 3GVWA 1R9ZA 2PWHA 3M41A 3USBA 5KZ6A 3NTYA 3W00A 4PUKA 1JCJA 5I09A 3NQAA 5CSUA 1RSCA 5DLCA 3IIZA 1UHVA 3GAKA 4YCPA 1BXNA 4PUUA 1X98A 3BZJA 3UWEA 4CN1A 1SGJA 2PLJA 1KD0A 2TODA 3CZLA 3M47A 3RNDA 5AYXA 1A50A 3VC6A 4FHAA 5A8OA 1RV8A 4DF0A 4J4KA 1WXJA 4CD4A 2YXXA 4QCFA 3WO8A 4PTNA 2NQLA 3GFZA 4AY7A 1CIUA 2J7CA 5EKYA 4ZO6A 2HTMA 4NP7A 2NUWA 1KWGA 3WFAA 1DQWA 3UXKA 1F4AA 1EB3A 3VU2A 1TWZA 2E77A 4XTDA 2WKJA 1VFMA 2GVYA 4IPNB 1C93A 1RH9A 1KW1A 4HB7A 3NDOA 5EFDA 1FXPA 4O13A 4W87A 2A3EA 3U5UA 2CLOA 2HJPA 1B5TA 1XS2A 1BSIA 4NJJA 1MI3A 1NWRA 3TC3A 1CYGA 3TJIA 3KHDA 4BKNA 2QGYA 1XIFA 2JBMA 5FF2A 1DORA 2E8ZA 4CQBA 1AJ2A 4WIWA 4KRUA 3MMWA 4YHEA 2XIBA 5CQ1A 1M68A 4RZBA 3W73A 3UQNA 2VO5A 2EPHA 3N6JA 1TVPA 2V5DA 5U4NA 3WJYA 1R2RA 2JKAA 4IMCA 3AYTA 5AFDA 4GI8A 2IW0A 4G1NA 1DBTA 1D8WA 4G7EA 3W07A 1FX6A 3K13A 1S46A 3EYPA 3NQ8A 2E5DA 3AXXA 4K3ZA 2VZSA 3HG2A 1Q2SA 2Q8LA 3BW3A 3KVMA 2AQWA 3PVFA 3GW0A 1EF2A 4EP8C 2VWSA 2CZDA 3EX3A 4UC5A 3NL2A 1NWUA 2DSVA 1BF2A 2JEQA 1TE1A 4Z1YA 3I4KA 4MAZA 3FN9A 1W1VA 1FWHC 2YA2A 3VK5A 5H91A 4Q8OA 3O63A 2PP1A 3LB0A 3WLOA 1R87A 3CU2A 2CBJA 3MMTA 3WFZA 3L4XA 2EEXA 3RLUA 1KFCA 4AWEA 2V9DA 3MB9A 2ACQA 4CKQA 2YLAA 4NUWA 4WKHA 1A80A 3QR1A 3CEPA 4ZOCA 1B9BA 1E6PA 3PG9A 4HT3A 2R1MA 2VP8A 1UBSA 1UD5A 2JF6A 4XZNX 1JZ6A 4AIBA 4M24A 2CBUA 2VUNA 1ZPTA 3KTCA 3MZNA 2O4MA 1B4EA 4JICA 1OFDA 4FZIA 4AX7A 1LQ2A 2YZ5A 2XU2A 1VP5A 5DF0A 5K3VA 2QR6A 1KXVA 1L2QA 5HWJA 3G1SA 1EEPA 3SQSA 5G2IA 3IAQA 4UFJA 4IG2A 1SW0A 3STCA 3AXKA 1HUVA 1O60A 4OECA 3K5XA 3GXTA 5RUBA 1S2VA 4AUBA 3IUIA 5I3JA 2ZQ0A 5BOOA 4HOWA 1O5RA 3WY1A 1CLKA 1DWHM 4KCTA 1B3VA 4UTHA 3KOXA 3MCMA 3VTRA 3S46A 2VEMA 3R79A 3E6EA 5CH9A 1GORA 4LC6A 3AIBA 3W26A 2ZRXA 1CXHA 4NAFB 4PMZA 2P76A 1F6YA 4BJHA 5A95A 1R5YA 1VFHA 3MU7A 2J7GA 1Z6KA 1GYNA 2YL8A 4MWAC 1Z69A 4QP0A 4AYSA 1K02A 3F4NA 1ZRQA 2Z7GA 3WD0A 1DTNA 5B7ZA 4MPKA 1SW3A 4WGHA 3SBFA 2VX6A 1UP3A 2CPUA 2DSUA 4MJ2A 1U1UA 2OWCA 2PGWA 3QV9A 1DJZA 3GBDA 2CKRA 4BY3A 3EXTA 4TX6A 3C5QA 3VCRA 4FOUA 1H0GA 1T99A 4LUJA 4E0CA 1DOSA 3M5XA 2OOFA 1ME8A 1TRDA 2A0NA 3CTLA 2Y1HA 9CGTA 4S3CA 1KB3A 4ZCWA 5E09A 8RUCA 2EGZA 2ATMA 3W7GA 3W7DA 1B3OA 2A2IA 1JAKA 2D22A 1AJZA 1H0IA 3CUJA 3CAVA 2VWTA 1FBAA 4ZODA 1OX6A 3EOLA 3BTNA 4B9YA 3UVAA 1DWJM 3GAYA 2DSKA 4U3AA 1ZBVA 1EHAA 4ZENA 1I4NA 1EX1A 1EOKA 3WH7A 1RQEA 2VGGA 3VC5A 2HV5A 1REQB 1KM2A 2XM1A 5CC6A 1A3WA 4UTTA 3RMJA 4RNFA 1M65A 4OVXA 2ZZ4A 1O6IA 2POZA 1U33A 3I4EA 1XH0A 4QSHA 4DZIA 3ARXA 2OWXA 2OLAA 1V51A 4I5XA 3GB6A 3UCCA 3U6WA 4DO7A 3T0TA 2V63A 1THFD 2CHOA 2VFEA 3NIYA 1E40A 1QBBA 2WPBA 3SECA 3GG1A 1U5VA 4IP5A 1FWIC 1GCYA 1ZJHA 1GHSA 2C91A 4Q4QA 4FO4A 5F1UA 3N14A 3UPBA 2Q09A 1HG3A 5A2CA 2TMDA 1N2VA 4DM1A 3U5YA 2GUYA 2Z27A 4O8RA 3SN4A 5HNNA 4LB4A 2CNCA 2QJNA 3WDQA 2D73A 2H8ZA 4ROQA 3QF0A 4O1EA 1SZFA 4QE5A 4K8GA 2INFA 4WOZA 5K4ZA 3RLVA 2PLMA 3VE7A 3IIXA 4EIVA 1UB3A 3PZ9A 4MOZA 3PPCA 4Y9MA 1X7IA 4NG3A 2CWNA 2ZE0A 1LBFA 2XFRA 1A3HA 3LHVA 1TSIA 2VZVA 4KW2A 2BOEX 3EB2A 1K8YA 2VFFA 2DZSA 1TV3A 2E0PA 1P0EA 4YWIA 5AHFA 5TIMA 4UTKA 5BYWA 5D05A 3OZPA 4PSPA 4RX0A 4XVEA 1TV7A 4WHBA 3TLQA 5DMNA 3SN1A 5CGQA 2CLKA 1LDCA 1BYDA 5G5IA 5EYWA 3SCNA 4PN2A 3LZ5A 4GO9A 3AS3A 3U48A 4MF4A 4FS9A 3GDKA 1S5NA 5ABTA 5A6MA 1IR1A 3NEHA 1US2A 1JQVA 1NDVA 3M07A 5EB8A 2X41A 1DPMA 1KFWA 5A6BA 3DYOA 2BOGX 3L12A 1QWKA 1YLVA 3A24A 3H12A 1GKPA 4R3UA 3W87A 3DG7A 3R5EA 2DSZA 4IPLA 4Y9OA 2FPVA 2BB0A 4J3UA 1YDOA 3RR1A 3UG5A 3E12A 5AYZA 3TNBA 2JIWA 4LEQA 4B5VA 1BVNP 2XTKA 1R85A 1L6GA 3ABZA 2I9UA 2OWWA 5JU6A 3MI3A 3RDKA 3FLUA 4JX5A 3LRKA 1H09A 3UA3A 1GOWA 3QQ1A 3A4XA 2SFPA 3SCRA 3SFWA 3MUIA 3TSBA 2GQ3A 4HIBA 2JGYA 1C3FA 3BLLA 3A4AA 3WKZA 1GQLA 4K7YA 2OXNA 4GG9A 4JNMA 4IMGA 2WCSA 2VT0A 1WBHA 1FHDA 1J2BA 1H60A 3W23A 2V2DA 1XLKA 1UD4A 3E38A 4L9ZA 1ZQ5A 3URNA 2ZA2A 3BG5A 2FLIA 1XIBA 3MDWA 2HK0A 4C5YA 2P53A 1ITQA 2Y8UA 3LI1A 1T8QA 4AC1X 3RM9A 4QX4A 3PK7A 2ZA1A 2ADAA 2V3DA 3NQ6A 4Z42C 3GXFA 2V67A 3W75A 4GVIA 1F3XA 4REQA 3WF4A 2IMRA 5D9NA 3GTNA 5CG0A 2EJAA 3S0CA 5G4WA 3C86A 1VB9A 4J5NA 2ANUA 4RE3A 5LIUX 4KT2A 1H5VA 3KX6A 2OKTA 1KCZA 4I5UA 1VBRA 2IQ0A 1S3TC 1DXFA 1JDEA 5DCEA 1B57A 2NT0A 3LNMA 3TYAA 3VD4A 1VEMA 3RX4A 2NZLA 1A4MA 1HXJA 3WCZA 2WZIA 3DG6A 1Z89A 2WZEA 3UJSA 3KLLA 5REQA 2ZZ3A 1AW2A 5M03A 1UR1A 4PMDA 3CASA 2E68A 3ABQA 4AZIA 1TPB1 3RU8X 4XD4A 2E8YA 3G1YA 1TTIA 2Y7GA 1FWWA 3ARQA 3PJUA 2D3NA 3W2LA 4YTSA 4ZEPA 3L65A 1CXIA 1Q6CA 1UKSA 4UTIA 3T4CA 5CPTA 1DYSA 4O0QA 1D8CA 3VM7A 4GFSA 4XSMA 4CQAA 1EDTA 3TIMA 4P7RA 1WQ5A 4DRSA 1O5KA 4WXZA 2BVTA 2D1ZA 3STGA 2VDGA 5BZAA 2FTPA 1VENA 2RJHA 4GXMA 2QPUA 1G6CA 3HFYA 3MWAA 3ZO9A 5FD0A 4URIA 5F2IA 4AVFA 1D9EA 3FKRA 5DCBA 1S5TA 2C1IA 1W9DM 4O14A 1BFNA 4UTTC 3IJ9A 4GBUA 4ZXOA 1LBLA 1M7PA 4WSHA 4CU7A 4MWAD 3M0HA 2YYTA 5TNVA 1KM0A 1M6JA 4DNHA 1LOQA 2YCLA 4JIEA 5CJ5A 4NJIA 2C1HA 3P8JA 4IIFA 1GOIA 1XDLA 5BMWA 1ADSA 3IJLA 3Q67A 2G41A 3UJFA 3DZ1A 1E1FA 1V0KA 1BSLA 1ZLPA 3W81A 1C90A 1CBGA 1DJNA 3TTSA 1IIGA 3GC5A 3WH6A 4ZTXA 3U7BA 4F2UA 1BYBA 4FIQA 2R6OA 1CDGA 1A5BA 3SIMA 2QULA 1DE5A 2UY2A 1ZSXA 2BSLA 4MUZA 3IIPA 4G7FA 3UZYA 1UD2A 2HE5A 4MZYA 4RDYA 1X38A 3W2UA 4K68A 1E70M 2IKHA 3ZWTA 3N4AA 3OBKA 3REQA 2PDBA 4RE4A 4JY8A 5LIYX 3E74A 4HJFA 4O52A 4NXKA 1K1DA 1VYSX 1PDZA 2NX3A 4B5XA 4E2DA 4ML4A 4C6DA 4ADSA 3BMVA 2PA6A 5LNSA 2IPFA 4F66A 3OVQA 3F4DA 3W82A 3H54A 4DJDC 4C6MA 3UY8A 5M3WA 3AHTA 3LCWA 3BQ6A 1DJXA 4UFKA 2PGEA 3MO4A 2DZXA 3IIVA 2FDSA 2WNNA 1E5NA 3WG6A 2D0FA 1W5OA 5A1AA 1FWRA 4DBSA 4EPBC 3D3AA 4DWSA 3ICJA 3RGTA 4EX4A 2YSWA 2GGIA 1UC5A 3RMEA 4Q4PA 1JAEA 1F8MA 1HKMA 2ISDA 1QW7A 1WV2A 4QTGA 3VIKA 2RDTA 4B9ZA 2C13A 2TSYA 2OSWA 3G1FA 4JKKA 4H9UA 3Q65A 3EWYA 2HVOA 2VZTA 8TIMA 2B0MA 4GLEA 4F3HA 4IWWA 4WR3A 2WAGA 3GUWA 3N9SA 3PBWA 4GIYA 2F6UA 4R7WA 3HOJA 2YXGA 1QHZA 1NTHA 5KITA 2Q01A 2Y24A 5I3DA 2BXZA 4NSBA 4R9OA 1TPC1 3AISA 3KBMA 1GVEA 3PFRA 1Y5XA 1OIMA 1X8FA 2X40A 2DEPA 3UR7A 3M64A 4BCEA 5DEZA 4WVXA 2IXVA 5JUVA 3W7LA 1UR9A 3PZVA 1JF5A 2HBXA 3GU1A 4FAMA 4J3SA 3EBVA 1S2CA 1UWQA 1M5WA 1UA3A 2OT1A 3LLDA 3TFCA 1WE5A 3PWGA 1JYWA 4MB3A 4H19A 3H55A 1V6VA 4KS0A 3AIRA 1BG4A 4D71A 4DZ5A 2GVLA 4Y96A 2X1IA 3OQ8A 1EUNA 3PPFA 4RW5A 1RLCL 3I7QA 3BPWA 5TBOA 4AD0A 3IGSA 3H2FA 1LUCB 4L6OA 3OZYA 3NG3A 3CIXA 4GGBA 1OGSA 3UD6A 3TAOA 3BV7A 1KCXA 1GT8A 2Z4GA 3GIQA 4H7ZA 4GA8A 2HPIA 4B4FA 3ITTA 2BS9A 3FA4A 1EYEA 3PWIA 2CHNA 2UY5A 1X6NA 2ZWYA 4O1DA 1E56A 4XD3A 5M17A 2VC6A 4RKAA 1GQNA 2JKEA 1KKRA 1V0NA 1PSCA 2IKJA 2WW5A 1NFGA 3S6DA 4MJ4A 1IQ8A 5HMFA 1E6SM 1XRVA 1EXBA 1TPH1 4GRSA 1R2TA 1FVPA 3EXRA 1P7TB 1N55A 9XIAA 2O92A 1Y65A 2ZIDA 2WSQA 1UZDA 3VKAA 3ARSA 2AOSA 4L61A 5B7YA 2ZXDA 3CUIA 2J47A 1BF6A 3EDDA 4B91A 3BMWA 5CC7A 1ZP4A 3ZOAA 4GI4A 1AZ2A 4D72A 4R9XA 1G67A 4R33A 5D2XA 2EQDA 1F6PA 5EBUA 1EA0A 3RYSA 2Z2AA 4ZB2A 1I1XA 3APYA 4YHGA 1V6XA 3P14A 3SCSA 3FS2A 1IE7C 3AMKA 4GY0A 3K1DA 1XLEA 4E8CA 3BC9A 4UOJA 4Y2WA 4C91A 1OK4A 2V5LA 3WMBA 2CLFA 2B7NA 2V8ZA 1E1CA 1TO3A 2J9YA 2YBVA 5DT5A 4XD6A 1J0IA 3A22A 2HE8A 1NSJA 1XLGA 1OM0A 4U28A 3W22A 3BOXA 5L6UA 1JI2A 1JYXA 5D2VA 1CGYA 4V2XA 4AZGA 3A13A 9XIMA 2OEMA 3RN6A 4CQDA 1A0CA 1AL7A 3HIJA 1F7BA 2FZBA 3CBWA 4B5WA 5M2FX 5D32A 2C19A 4RV3A 3UXIA 4IQEA 3HJZA 3H2AA 3B3DA 4NU7A 4JQ3A 2OPJA 1WP6A 3LCXA 2XFFA 1IZJA 2FIQA 4AWTA 2AQVA 3HF3A 3H53A 4WSJA 4NJHA 3ZT5A 4M56A 1SFTA 4MJZA 1HKJA 3TQPA 3QZEA 2OCZA 2E6DA 2CXGA 4D2JA 5C5YA 3L2MA 3R8GA 3W25A 4IGHA 5HA7A 1BGAA 4W4QA 3EOOA 3LHTA 3T0DA 1YDVA 5E5CA 4DELA 1U30A 3MSRA 1KM3A 2OOGA 2CLHA 2WANA 3CTTA 4KESA 2DUAA 3D5HA 4PCFA 2V2CA 3U3HA 2Y5EA 3B0XA 1OD0A 3PTQA 4ZQMA 3SRKA 1JL8A 4RCXA 4BI7A 4OWGA 3WDHA 3VD3A 3GNDA 2PC8A 3N15A 5A8NA 2OR2A 3TZFA 3WD4A 2PCQA 2FZ8A 4NNAA 4FLSA 2WCGA 4HHLA 4J2PA 4MGGA 8CGTA 5AY7A 3GG0A 2GGHA 4ERGA 1ZJAA 4GCXA 1EC8A 3RPMA 4N9BA 4N6EA 4LF2A 4DWSC 1FWAC 1EZWA 3BLEA 3NQ2A 2QUVA 4LU0A 3GHSA 5AN7A 3VD5A 4US5A 1C8QA 4MVAA 3UNDA 1TJ1A 3CJPA 3B9EA 5IRPA 3IJ6A 1JXJA 2GJRA 3LTPA 1GYLA 1K7EA 2WM0A 2Y62A 3F4WA 4LY4A 1SU5A 5C70A 1J2WA 1FDZA 3V18A 4AF0A 2XFYA 4GQBA 1GHRA 4MFDA 1OBAA 2VEIA 3NL5A 2J27A 1F07A 1VZWA 3W1TA 3TCEA 1IWBA 4AEFA 3UVIA 3OLEA 4OOZA 1QW9A 3Q4DA 4ZGYA 1JCTA 3DFNA 5BRPA 3GXNA 4PMXA 1UKQA 1W2VA 3O16A 4P7LA 1V6WA 3BICA 4PC8A 3LPPA 4DJDD 2YR1A 5A3HA 1MQRA 2XIJA 4GH1A 1YIXA 1JUEA 1A5AA 4LB3A 3R11A 2HWGA 1HL9A 4HNTA 1LT7A 4PB3A 4UQAA 3VOJA 1E0TA 4O1AA 4RE0A 2BP1A 5IXEA 4DXVA 1J0KA 2YL6A 4S3BA 1K9DA 4JTDA 2BVWA 5HNUA 6A3HA 5A6BD 2HS8A 3BLIA 4P8VA 3V1PA 2PDKA 3RITA 1A5MC 2CLMA 3ZJ6A 4Q8VA 4EVZA 2WCAA 4BZYA 3E0LA 4PTWA 5IFTA 3P82A 1E55A 2ZCGA 5DN1A 2BFGA 4GYFA 3GC2A 1LLOA 3U2EA 4JEJA 3HG4A 2UZ9A 3WQVA 3CLWA 3GO2A 1PTGA 2YDQA 4ZBCA 3QZAA 4NX0A 4O1FA 1EP3A 2QVHA 4AD5A 5JBEA 4X0VA 5IDZA 2V5KA 1S2WA 2GVJA 3ZFHA 1PIIA 1B3WA 5CSRA 5A2AA 2ODOA 4EXQA 5CC3A 2PB1A 5AOUA 5AYBA 2P8BA 1XJBA 1XHGA 4MWAB 2P0OA 1O66A 3CB8A 1CNVA 2WSYA 4QNEA 3WENA 2V3EA 1V6UA 4OIFA 2G50A 5FJIA 1JZ4A 4HA1A 4NAEB 2V82A 5HATA 3M6YA 2GJXA 4LRTA 4CD8A 3RCYA 1X6LA 4FX6M 2X42A 4DVOA 3A5FA 1ISXA 1WDSA 1HP5A 1FHLA 2PS2A 1LG1A 4NNCA 3DYMA 1YMYA 1HW6A 4X9SA 1H1NA 4PMVA 1N8IA 4W8AA 3LGGA 2ZVRA 1DKWA 1AG1O 1NF0A 5AZ1A 3EWWA 4JNYA 1BWVA 3CPGA 3VXGA 2NVAA 1DP0A 5KTLA 2AL2A 3W85A 4H41A 1F5ZA 2YYUA 1A4LA 3C0QA 1NF7A 1PTAA 4HZ7A 1WKYA 1KCLA 8XIAA 1XLJA 2O56A 3FYPA 1VPXA 3P61A 2NT1A 3S1XA 3H26A 2YFNA 2QPXA 5FSDC 2ALRA 4LS2A 1VJSA 3ARYA 3N17A 4I5RA 3DHUA 1ZBWA 4O50A 3RRAA 4XIAA 3EOSA 2QNEA 2FJKA 4DUWA 3V16A 5LHEA 1DIEA 1WUFA 1KBJA 4Q7NA 3CH0A 1UROA 4HU3A 3CXOA 3QEZA 2VCBA 3O07A 4ORIA 5HK4A 5KMYA 1IEIA 3WYZA 1ENUA 2B31A 4E4FA 1HTIA 3RCNA 5HANA 3TXVA 3KL5A 4RUBA 3QY8A 3SI9A 4JEQA 3U9IA 4JIHA 3GG8A 1YTKA 4M1RA 1S5MA 3W1XA 2OQHA 3KVJA 1MWOA 3E5PA 2AAAA 1TVNA 4Q8UA 5EBAA 3W9ZA 4WOQA 3NQCA 3ZR5A 1WO2A 1E6RA 4IZGA 4IPJA 5CZTA 5CLTA 5EMJA 3URQA 2OYKA 3VIIA 3P93A 2QJGA 4PMNA 1A0EA 4A22A 1AMKA 1KGXA 3WNPA 1KFJA 2VD8A 2ZICA 3UERA 4M3PA 4ONVA 3W37A 4MYXA 2ZADA 3AWOA 1Q4WA 1Q7ZA 2V3GA 2P10A 5G2HA 5M1TA 4DEFA 3OGVA 2V2HA 3T0AA 4S3KA 3V36A 3MI2A 3M4HA 2Y8KA 3VNZA 1KRAC 4D8AA 3O06A 3IJIA 4S38A 4AZ5A 2R24A 3MV01 3G22A 4AC7C 3KRSA 2A3HA 3IUDA 4E8DA 1PZ1A 4GK8A 2GVGA 3DBPA 2XVLA 1RD6A 4GC4A 4K1GA 4HN4A 4UTLA 3W3OA 2C8NA 4HZMA 1EDGA 3CV7A 4CCCA 3QOKA 2ZUWA 2QCFA 3NZRA 3A6OA 4G7EB 4PMJA 2QCLA 3PZUA 3SY8A 4F40A 1YXCA 4ZFMA 1F05A 4S3FA 1FTXA 2R9RA 3TKFA 3VGFA 3QY6A 1A0DA 5FEXA 2RJGA 5H8MA 3NQEA 3ECQA 3P74A 5CBJA 3S83A 2P8CA 1BGGA 4PCNA 1E72M 3EDJA 3B8IA 5LGXA 3W24A 3NPWA 3SCQA 1NP0A 3ABXA 1DWFM 4DY1A 1C8YA 4ZOBA 3QLDA 1O1HA 2XVKA 1JI1A 4JTHA 1NEYA 1QBAA 1BD0A 3AZTA 4BF7A 5CAKA 4IT1A 4PFHA 2YDAA 3PJXA 4IIDA 1PL9A 3Q45A 4FSAA 4PCTA 1KGWA 1PHWA 3A12A 3G8EA 4KKXA 3SW6A 6ENLA 4Y90A 2VRQA 1VCVA 2BODX 5DRIA 1AQMA 2Y63A 3EDEA 4BI5A 4GY7A 4DWSD 1JGIA 1ZP3A 2CZ5A 3KP0A 5I3FA 4PMQA 3WH5A 4X61A 3ZSTA 3LX9A 4GY1A 1EGVA 3L0NA 4PMRA 4M51A 2A3AA 4Z2GA 4F4RA 3XISA 4IG2B 3KOZA 3T0BA 1FH9A 3S2JA 1MXGA 3FW6A 3LCLA 3AS1A 1QR7A 4ZE4A 5DRCA 2Y61A 1QI3A 3CZEA 1UD3A 1W56A 4EWND 4XAZA 4DAFA 3QQ0A 1TR1A 3NVDA 3WF3A 2IPGA 3T8QA 1BAGA 4MY1A 1QAPA 4ICMA 3CUZA 4FX7A 1RAKA 4XKMA 4KRZA 3GDBA 1VYPX 1E1EA 7TIMA 4OUEA 3R25A 3MBFA 1CGXA 3S1GA 1EWEA 4U31A 4QLJA 4CU8A 1NWSA 3TWAA 5ABGA 1L6SA 2WZHA 5F4WA 3SR7A 2P88A 1AQHA 4MLJA 1C7TA 3JZUA 4E5TA 1M7OA 1FCUA 2ZYFA 3KBWA 3JRKA 5C6MA 4KPLA 3ERPA 4S39A 4H8UA 1GOXA 3LMYA 4FLRA 2E6AA 2G4FA 1QK2A 1PYMA 3MHFA 4B15A 2VL4A 1Y7VA 4JFSA 3V0UA 4WDTA 1JGMA 3P84A 4TV5A 2PODA 3JUGA 2PLCA 3FY1A 1ISYA 3DBNA 1ISZA 4EXAA 2YBTA 2P0IA 3ZZ1A 3OVGA 3W88A 1JDCA 2WLZA 4KFNA 4DZHA 2RGMA 4DJEA 2Z1WA 4C6PA 5E1QA 3SJ3A 2XM2A 5J5RA 3BG3A 4TVUA 4HZ8A 2BLEA 2DZUA 3BUVA 3KVKA 3HGRA 4GVGA 1QUMA 4W89A 5HOSA 1NQ6A 2G3NA 1OFBA 2H9AB 1POJA 1VIWA 5EMUA 1CXFA 4S2CA 4JFTA 1HKKA 2XDFA 3QH2A 3ARUA 2D2HA 1LQAA 2Z7KA 3GXIA 3TR2A 2BASA 1T40A 2BY3A 1NY1A 4UB9A 4LFYA 3UR2A 1GVFA 1V3IA 3C3NA 4N9DA 1AD4A 1VLWA 4GI9A 4NQ1A 4ACYA 3TP4A 4A2SA 1Y8BA 3QSTA 3A23A 3GYCA 3TK7A 3NOYA 2C1GA 4J1OA 3IRSA 3HPFA 2PDHA 5C9ZA 3U57A 4DYEA 4UCGA 3WD2A 3KAOA 1G01A 4GX9A 5GPRA 5CEWA 1KR0A 1NU5A 4QLLA 4E6MA 4J3VA 1RVKA 3VGBA 3NZQA 5AVNA 2AKMA 1UP2A 3CMGA 3EPOA 4C7GA 2XINA 3D46A 1I2QA 2C79A 3S9IA 1EJVC 3PBUA 3GR4A