3LTWA

The structure of mycobacterium marinum arylamine n-acetyltransferase in complex with hydralazine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the architecture of the Mycobacterium marinum arylamine N-acetyltransferase active site
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
molecule keywords Arylamine N-acetyltransferase Nat
total genus 83
structure length 272
sequence length 272
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 3ltwA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 3ltwA01
1GX3A 3LTWA 4B55A 1W4TA 4NV7A 2VFBA 4GUZA 1W6FA 2VFCA 1E2TA 4BGFA 2BSZA 4NV8A 4C5PA 1W5RA 3D9WA
chains in the Genus database with same CATH superfamily
3LTWA 3U03A 4YFPA 5FAZA 5IO5A 2CZUA 2L67A 5FQ6E 2AKQA 5LJGA 3Q34A 3KZAA 1RBPA 4QYNA 2FLJA 1SLDB 4NLIA 1JIWI 3PP6A 3FR4A 3P02A 4GDZA 4OELA 3CWKA 2RTAA 2FS7A 1G7NA 1G85A 1HMSA 3UEVA 4COTA 1FDQA 1DZMA 1A2DA 2KTDA 2MJIA 4GGTA 3CQNA 5LJKA 1KL3A 1B8EA 1SXYA 1ALBA 3JQOA 3HOEA 2GC9A 3WZPA 2HZRA 3HWGA 1VWIB 1KQXA 1HN2A 1LIBA 4YDBA 5JR8A 2JOZA 1TOWA 4QAEA 2FGSA 4XMGA 4IMOA 1E5PA 1KL5A 4JNJA 3FA6A 1QY0A 3BX8A 3C76X 1QABE 3RDMA 3VU1A 3I17A 4EEJA 1AB0A 4M6SA 1YWCA 4GGZA 4L1NA 4YKMA 1GKAB 3EW1A 3P6CA 3WVMA 3WJDA 3MM0A 2FKGA 1NBXA 1SWOA 2KT4B 2OVDA 1PBOA 3MBTA 2KW1A 1GX8A 5EEDA 5EPQA 5K68A 1NDJA 4YKOA 1LCWA 5HBSA 5JD2A 1GKAA 3RSWA 1RSUB 4ZJ0A 2X45A 3EM0A 3FELA 2QO4A 1SWTA 2Q2MA 1VWGB 4NYQA 2HYSA 4QNIA 4ALOA 1I05A 2OL6O 2C1QA 1KT4A 4ZFXA 5BVTA 1VWRB 1SLGB 4LZVA 1UYOX 2IZIA 2IZBA 3D95A 1LIEA 4CDEA 4D6AA 1W4TA 2RTOB 1IKEA 4UU2A 4ZHFA 1SXXA 1SXWA 4ORYA 1ZNKA 2WEXA 1CJ5A 1KT3A 5H9NA 1O1UA 2Z4IA 4GE1A 4GJSA 1FELA 2BLGA 2I5VO 3OJYC 3RE5A 1SWRA 2RTKA 1Y52X 3FA7A 3I0AA 1SRJA 4MEEA 3B2JA 3VG7A 3MVFA 1LDOA 2A5CA 4ZGUA 1QY2A 5AEOA 3EC5A 4JGLA 3QQ2A 1E02A 1OBPA 5B11O 1ZRYA 3DSZA 2RTMA 5AJCA 1LICA 4KCAA 3ZW1A 5KHPA 5LJHA 5CE4A 4Z2PA 3PEDA 5HTDA 1N4JA 1VWHB 3FYFA 2X55A 1U17A 1I4UA 1MEPA 1VWQB 1SWJA 3FA8A 1FJ1E 4YCHA 2JGSA 3BSZE 1LNMA 4LQZA 2CM4A 2HNXA 3VPJE 1CRBA 2HZQA 2PI3O 1Y9TA 3HWFA 5HWZA 4JO6A 2C1SA 4GK9A 3NX1A 1DV9A 2RTIB 2RCQA 2WWPA 4FGIB 3JSQA 1O1VA 4AZRA 2AF5A 3T6FA 3FMZA 4M7MA 1KZWA 4IB8A 3SAOA 1TW4A 1IIUA 5FFHA 3NR3A 2DJGA 2W2AA 1SY3A 2X4MA 1FENA 4K19A 4U3QA 2KTSA 5HA0A 4BOEA 2FR3A 2LB6A 4CPHA 1PEEA 4RUNA 3VG2A 4LZUA 2BC3A 5LJDA 3GAQA 1GT3A 1SWBA 1D2UA 3FA9A 1X89A 3CBSA 4AZNA 1N0SA 5EZ2A 2POAA 3VG4A 4ZHDA 2QM9A 5H9AA 1N7YA 1QQSA 2RTBB 4HWMA 4BX5A 4Y0PA 1NP1A 1ADLA 2R73A 5FQ7E 4TKHA 3O19A 1HQPA 1HMRA 1HXLA 3JS1A 1JBHA 1SY1A 3VHHA 2HLVA 1AVEA 1GT5A 3EBWA 1HBPA 1VWJB 3FIQA 3VG6A 3C78X 1VWMB 2NP1A 2OL8O 2RTLA 4IBAA 2BT9A 4U9CA 4MVEA 4KT5A 4CDDA 2ALLX 1VWPB 2OF9A 1BSYA 2RD7C 3CQRA 1EIIA 4GGRA 4CPFA 3E3CA 1IJ8A 5F2BA 4ORUA 4CV7A 2G8CO 2ACOA 1H91A 2Z4HA 4I9SA 1GX3A 5B27A 3BDRA 3DTQA 1KXOA 2ACPX 1ACDA 1LF7A 4IB7A 5HTEA 1BWYA 3PQUA 3VHIA 2AT5X 3WBGA 3KFFA 5AJBA 2RTRB 3AEHA 1EUOA 2RTCB 1SWCA 1BBPA 1SWQA 1YP6A 3TGAA 4TKBA 1TXLA 2C4IA 3CKFA 4N7CA 5HCCC 2VDFA 2OFMX 2L68A 2G5LA 2WEWA 1SA8A 4QRLA 3NPOA 4HFOA 3APVA 4DQ4A 2LA7A 4GUZA 2OY5O 4YFRA 4GNYA 3BX7A 1X8OA 1SWAA 5F6BA 5FQ8E 5L8NA 4A1HA 2QMIA 4A8ZA 4ORXA 4WFVA 5D8JA 3T1DA 1STPA 1VWLB 2W2BA 5BVSA 1ICNA 4CPIA 3PK2A 1SRGA 3AKNA 1BM5A 1RLBE 2VFCA 4XMFA 3STKA 1JYJA 4BGFA 1KFFA 5AQ6A 1W5RA 3D97A 1VWCB 3ELZA 1SWDA 1SWEA 2AL0X 2IZEB 2Y3FA 4Y0QA 5DG4A 1P6PA 4ZHGA 2RN4A 3ZI8A 1CBRA 4QGXA 4O4OA 3OBLA 3EMMA 5HCEC 1BSQA 3RY2A 5HAEA 4D6BA 4I3DA 2FS6A 1VYOA 4BQUA 1S44A 5LJBA 2X46A 1T0VA 1SWKA 3NX2A 3FR5A 1GXAA 1VYGA 4Z28A 4Y5DA 4DQ3A 1VYFA 4Y0SA 1OEJA 1GGLA 2G79A 4AZOA 3VE1A 1SWLA 1T8VA 1ERXA 2X34A 3KVNA 4U46A 2DM5A 3WXQA 4GRJA 4O4SA 1IKJA 1JMZA 1FTPA 3QKGA 1A3YA 1DF8A 1HY2A 2X8TA 3APXA 4MVKA 5IO6A 4NV8A 3PDFA 3P24A 1X8NA 4YH0A 3TGCA 1D3SA 3FDCA 3RDUA 3G7XA 1VWNB 2QCBA 2F09A 2M4LA 3HK1A 3T6LA 3WZOA 3LNBA 4DMOA 2FR2A 4QZUA 2GJ5A 3SZHA 2RTQB 2OVEA 4OS0A 3HPEA 5IXGA 1QFVA 1U0XA 1G74A 4HPAA 3UAQA 1GT1A 4NW4A 2CM9A 5HCDC 4AW8A 3RKGA 1HQQA 4YBPA 3STNA 3WYQA 1EXSA 1MUPA 2MO5A 2PY1A 4BX6B 4ZGFA 2BS5A 1QFTA 3EBKA 3F6ZB 3T2WA 2RQ0A 5K67A 2O62A 4YVBA 4ZH9A 3PH5A 2RCTA 1Y55X 1JJUA 3S26A 1SREA 4KIIA 4BX6A 1BSOA 1VWBB 5KIDA 5C0NA 1X8QA 3KFHA 1MM9A 2OYBO 3RBYA 4OS3A 3TF6A 1GT4A 1SWUA 4AZPA 2FKJA 1ZNGA 1U18A 2RTNB 1XKIA 3WJBA 2ZSCA 2AT6X 2IZCB 2LBVA 3D96A 3CKGA 1KQWA 2G78A 3WJEA 3WZQA 5LJEA 3WJCA 1LUQA 1ML7A 4EKVA 1S7DA 3NADA 4AYHA 1UREA 4GH7A 1DC9A 3S5VA 2RTJA 4NNTA 4O4UA 3ZQ3A 3BS2A 4A1YA 3SOTA 1AQBA 1SXUA 1OBQA 3PH6A 3VG5A 1KL4A 3NQKA 3FEKA 4ALBA 5K06A 1VWFB 2VFBA 1EPBA 2A2GA 4I60A 3AUMO 2JN3A 3CR6A 3RE6A 3BU9A 1EIOA 4ZCBA 2JMBA 1DZKA 1XCAA 1YUPA 3ELXA 3NP1A 3TZSA 3TGBA 1A18A 2HKDA 1EPAA 1MVGA 2GTLN 2MF6A 5CHKA 5H9LA 2A3FX 1OBUA 2WR6A 1E06A 2A5BA 2L9CA 1RXJA 4I3CA 4EQAC 3B2LA 1JJJA 3N91A 2QOSC 2UZ2A 3FW4A 1BEBA 4Y0RA 1FEMA 1CBSA 4BJ8A 3ZUIA 3UEXA 1OSPO 1VWEB 1N43A 1Y9LA 4Y59A 5F7GA 4CPEA 1UZ2X 2ZAGA 3UEWA 2A13A 4FBRA 2CBRA 2BSZA 2FHNX 2OZQA 3K3LA 3PPTA 4IRWA 3H3IA 2AMMX 4B55A 2IZDB 1Y0GA 2EU7X 2K23A 3RDXA 4HPCA 1S2PA 3OD9A 4YCEA 2WQ9A 1RSTB 4NLJA 2F01A 4TNNA 2X32A 3GE2A 2NNEA 4YBUA 2IFBA 4OS8A 4MISA 4XMEA 1AELA 3D4RA 1WBIA 3O2YA 3CMPA 4QQ1A 2RTGB 4MVIA 1RXHA 3HWDA 1NQMA 2OY7A 1SWFA 4CDCA 3MX7A 5IO7A 2DJFA 2FTBA 3Q6LA 4RUUA 5D47A 2WUTA 4KH8A 3VE2A 3EW2A 1WUBA 2AH7X 1X71A 5FENA 1VWKB 3NBXX 4ID2A 5CYBA 3ZW0A 1X8PA 5F1EA 3LHNA 3NQ9A 4ML7B 4O3ZA 3BRNA 5D4AA 1YWDA 3VHMA 1LKEA 1EW3A 1MK5A 5B29A 3RDQA 5L3YA 4BVMA 1A57A 2X56A 1BRPA 3RDSA 1FE3A 5B2AO 2OY8A 4I6SA 4MIRA 1NC9A 1TVQA 2HMBA 2AVIA 3MG5A 4YFQA 1L6MA 4N7DA 4IABA 5L8IA 1KT7A 4AZMA 5IRAA 4GD9A 3FR2A 4UU3A 3ZW2A 1MOYA 3U0DA 3WYPA 4U8UM 1SWGA 1BRQA 2IZAA 2RTPB 4OMWA 3F9DA 1B4MA 4O9SA 1JYDA 1JV4A 3HWEA 5DPQA 5CSEA 1DF3A 1LFOA 1VPRA 2W2FA 1SWSA 4QYPA 4ZR2A 5KICA 1W6FA 5H8TA 3BU1A 1ZNLA 2ANSA 2BS6A 4ODDA 1KOIA 4LKPA 2OY1O 1X8UA 4L3RA 5D45A 3O22A 2IZGB 4Z27A 3C77X 1OPBA 1LDQA 2R56A 1LIFA 2WSJA 4U8UN 2ZAIA 1EQDA 3BLGA 2IZKA 1ZNDA 1ZNEA 4ORWA 1YWAA 1KT6A 2BHVA 1SMPI 4QZTA 2FWVA 1QY1A 3SZIA 3VG3A 1EALA 3VGWA 3B2IA 1KT5A 3SLJA 2L5PA 4YGZA 1KGLA 1QWDA 1VWAB 2CBSA 3FIDA 2PFRA 4R0BA 2GTFX 4NP1A 2MWHA 5B5FA 4C5PA 5B3MO 1PBYA 4O49A 5L8OA 1GM6A 3RY1A 4YGGA 2YG2A 4BBOA 3SZJA 1CBQA 1B56A 5B10O 4O4XA 2R74A 1VWDB 1N9MA 4GU8A 1SY2A 4ORSA 4WBKA 5HZ6A 5LKEA 3T2XA 2OF8A 3D9WA 2RTHB 1N9YA 2N93A 2YMSA 3APWA 1DZJA 1O8VA 3F8AA 2Y3EA 3P6DA 4FBOA 4NV7A 4XMDA 3V8UA 4ZHHA 2CAMA 1IW2A 4KC7A 4ON1A 3OE3A 3RZYA 4IB6A 2X8SA 4I95A 1JJXA 2A8GA 1Y53X 4YGHA 1LPJA 4U8UO 4BX7A 4GETA 1LCVA 1AVGI 1T68X 1IFCA 2GH7A 2RTEB 1UYNX 4JHQA 1JMXA 1HBQA 2FHLA 4IAXA 2OVAA 4A60A 3WOVA 4EFGA 2FT9A 5HZQA 4WFUA 2X8FA 4IMNA 2CZTA 4ES7A 2WQAE 2RTDB 2UYWA 4TQ2A 3S5XA 1YP7A 4BX5B 1MDCA 3B2KA 1K24A 3FLLA 1I06A 5LKFA 2WPUA 2P8GA 3AKMA 3SLOA 1TOUA 3APUA 3WJFA 3FEPA 4ZHCA 3RDOA 5F58A 5HZ5A 2GTLO 4QGWA 1SLEB 3IFBA 4TKJA 3P6HA 3KFIA 3STMX 1RAVA 4MVLA 4XMHA 4Z6JA 2G7BA 4TJZA 1I04A 3S60A 1K3BA 1I78A 1VWOB 2Q9SA 2OFRX 1E00A 2Q39A 4FQBB 4OEMA 5EEEA 3ZZVA 1DFVA 2MHDA 1HMTA 1IFBA 1PTSA 2LFOA 2MM3A 3X00A 1JZUA 3SLTA 2A0AA 2OVSA 3NQ3A 4GZVA 5HZ8A 4O3YA 5HZ9A 4INNA 2Q4NA 4IB9A 4I3BA 4O3WA 1SRIA 5IRUA 4OMXA 1YIVA 2JW1A 4HPDA 4TLJA 3UEUA 1JQPA 2OFAA 4OKAA 3LV4A 3WJGA 3IA8A 1NP4A 3B2HA 1STRB 3BY0A 1MX8A 4AZQA 1QG5A 3WZNA 1STSB 3FENA 2F73A 5F6ZA 5B5GA 4EDEA 4IAWA 5BYPA 5LJCA 5IRWA 1LIDA 2AT3X 2OFBA 3ZW1B 3U9PC 4PSQA 2PQTA 4WHIA 1SRHA 1GX9A 3P6FA 2AT0X 1HXZA 2RTFB 2NNDA 3P6GA 2FRSA 4YMYA 4CSBA 3ZUOA 2QOMA 3CBCA 4YDAA 1PM1X 1LCZA 4EXZA 3KFGA 5EDCA 1YWBA 2JU8A 1NGLA 4PJ2A 4DNEA 1SWNA 3ZWEA 1OPAA 3HOLA 2E4JA 1DZPA 4XMCA 1SWPA 2JU7A 3PECA 1OEEA 4QGVA 1KZXA 2IZJA 4LKTA 1G5WA 2ASNX 2IJAA 4ARHA 4GJVA 5D48A 2KD2A 2XKLA 1E2TA 1EI5A 2IZLB 1LELA 3L4RA 2NNQA 5H9KA 1ERBA 1B0OA 1R0UA 2XSTA 1AVDA 4DCBA 2JU3A 4HPBA 1SLFB 1OEKA 1NQNA 4CPHB 1BJ7A 4I9RA 2RA6A 4KC8A 1ICMA 4CK4A 2GTLM 5EDBA 2A2UA 4ZH6A 1Z24A 1SWHA 4Z2VA 2Y32A 4BCSA 3P6EA 5BVQA 4BX7B 2AT8X 1SY0A 4NNSA 4Z2OA 1I9HA 1ZNHA 2Q2PA 3HTYA 5HA1A 4CDFA 2LBAA 2LKKA 4ORRA 4O3XB 1SRFA 2IZFB 2K62A 2QO5A 4GKCA 1PMPA 3FW5A 2IZHB 1CBIA 2I5ZO 1MX7A 2QO6A 4GNWA 3RWXA 3KQ0A 3ZW0B 3EYCA 2OL7A 4NYRA 4FBVA 1RXKA 3PQSA 4GDAA 1BLRA
chains in the Genus database with same CATH topology
3LTWA 3KKUA 1CJLA 2C0YA 1CS8A 3P5UA 3PNRA 3PBHA 1PCIA 1KXRA 3MHSA 1QOLA 2PBHA 4G54A 4OELA 3H6SA 3OVXA 4QRVA 3IEJA 3V6EA 1NLJA 1U9QX 3S3RA 5CHVA 3BPFA 3CBJA 1Y08A 5CHTA 1BP4A 2DC7A 1CQDA 3H89A 3I3TA 1GMYA 2AYOA 3IUTA 1THEA 2E02A 1QDQA 1ZIVA 2Y6EA 2AIMA 4YVAA 3I06A 4BPVA 2IPPB 4YV8A 3DF0A 1POPA 1AIMA 2CB5A 2VHSA 2NQDB 1W4TA 2P7UA 3WXGA 1F2BA 1YVBA 4ZUXU 2OZ2A 2ARYA 4P6EA 2PNSA 3MORA 3KX1A 4Q8HA 1MHWA 2FO5A 2AU1A 2PADA 5CVMA 4BS6A 1AYUA 1CPJA 3V6CA 5EGWA 1CVZA 3KWBX 4MZOA 4BSQA 4W4UA 5FPWA 1PPDA 1AU4A 3BPMA 1VJVA 2FUDA 3QSDA 1ITOA 2WBFX 3WXFA 1PPNA 4WA6A 2ACTA 5K16A 9PAPA 1CV8A 2BDZA 4QBBA 1AYWA 1YK7A 2B1NA 1K3BB 1GX3A 3TNXA 4I07A 3RVWA 2NQIA 2DC8A 4I05A 3H7DA 2JQFR 4PP2E 2R9FA 4AXMA 1KHPA 1TLOA 4GUZA 1MIRA 2YJCA 2P0RA 1IWDA 2R9CA 1AECA 2AVWA 2XU5A 3F75A 1U9XA 4MZSA 1CB5A 3KW9A 2Y5BA 3N3KA 1TL9A 3IMAA 3N3GA 3BWKA 1Y4HA 2HXZA 2PREA 2VFCA 3OF9A 4BGFA 1W5RA 2BDLA 2HD5A 3KFQA 3HHAA 1ATKA 3NHEA 4CDEB 1YALA 3ZUAA 4P6GA 3H8BA 4K7CA 2AUXA 2XU3A 4N4ZA 2NQGA 4CDFB 1PXVA 1S4VA 3K9MA 1BGOA 4NV8A 3PDFA 4YYSA 1O0EA 2FT2A 3OVZA 1ZCMA 4AXLA 3D6SA 4YYVA 5JA7A 4MSXA 1GECE 1PADA 2R9NA 2VHFA 3CH2X 2YJBA 4CZWA 3E1ZB 1ICFA 1PPOA 3KSEA 3GCBA 2XU1A 1PIPA 3B79A 1AU3A 3C9EA 3OISA 3IV2A 4CDCB 2G8EA 3H8CA 1ME3A 2DCAA 1GLOA 1QXPA 5CVNB 2DCDA 3S3QA 1PBHA 1DF0A 3O1GA 3ERVA 1STFE 2VFBA 1AU2A 4DMYA 2GHUA 2YJ9A 4QRXA 1MEGA 1NQCA 2ATOA 8PCHA 2FYEA 1F29A 5EF4A 4W5BA 5JH3A 2DC6A 2DCBA 1KFXL 3LXSA 2HHNA 2BSZA 4QH6A 1NPZA 4B55A 1KFUL 2AYNA 1CTEA 1U9WA 3P5VA 1YK8A 3AI8A 2FRAA 3IOQA 4FIPA 2FTDA 1SNKA 4CDDB 2DZYA 4DMXA 1VSNA 3MTNA 4RY2A 3CH3X 2DCCA 1BQIA 2H7JA 1X9YA 2FRQA 3KWZA 5J94A 3CBKA 4W5CA 5PADA 7PCKA 3HHIA 4FK5A 3HD3A 4XUIA 4YYWA 1YT7A 2XU4A 1CSBB 1W6FA 2GFOA 2OP3A 1M6DA 4X6JA 1F2CA 4YYRA 1NL6A 3HWNA 2AUZA 1Q6KA 4C5PA 1GCBA 3OF8A 1A6RA 4YYUA 4HWYA 2IBIA 1MEMA 3P5WA 1U5IA 3D9WA 1TU6A 4XR7A 3F5VA 3QJ3A 2NQAA 2R9OA 2DJGB 4NV7A 4PI3A 2F1GA 2YJ2A 1F2AA 2P86A 4PADA 3USVA 3MHHA 4I04A 2G6DA 2OULA 5F02A 1EWPA 1MS6A 2DC9A 2G8JA 3LFYA 1SP4B 1NB3A 1NB5A 4OEMA 4X6IA 3N4CA 3QT4A 2HH5A 1FH0A 3U8EA 3P5XA 1AU0A 1QMYA 4BQVA 1EF7A 3RVVA 1JQPA 4BS5A 2E03A 2G7YA 4X6HA 3O0UA 6PADA 4PP1A 2DJFB 2AS8A 2FQ9A 1AYVA 5CVOB 2B1MA 2JQGR 2YJ8A 3PW3A 1PE6A 4YYQA 1MDWA 3BCNA 2O6XA 1EWLA 1U9VA 2E00A 3BOWA 1ME4A 1E2TA 1DEUA 2R9MA 4FJCA 4KLBA 1KHQA 3IHPA 1PPPA 2F7DA 4N8WA 3K24A 4Q8GA 1XKGA 3M99A 3WXEA 4QRGA 2CIOA 3K8UA 1BY8A 4N79A 2DZZA 1HUCB 3BC3A 3RVXA 1EWMA 2R6NA 1EWOA 2E01A 5A24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX3 A;  3LTW A;  4B55 A;  1W4T A;  4NV7 A;  2VFB A;  4GUZ A;  1W6F A;  2VFC A;  1E2T A;  4BGF A;  2BSZ A;  4NV8 A;  4C5P A;  1W5R A;  3D9W A; 
#chains in the Genus database with same CATH topology
 3LTW A;  3U03 A;  4YFP A;  5FAZ A;  5IO5 A;  2CZU A;  2L67 A;  5FQ6 E;  2AKQ A;  5LJG A;  3Q34 A;  3KZA A;  1RBP A;  4QYN A;  2FLJ A;  1SLD B;  4NLI A;  1JIW I;  3PP6 A;  3FR4 A;  3P02 A;  4GDZ A;  4OEL A;  3CWK A;  2RTA A;  2FS7 A;  1G7N A;  1G85 A;  1HMS A;  3UEV A;  4COT A;  1FDQ A;  1DZM A;  1A2D A;  2KTD A;  2MJI A;  4GGT A;  3CQN A;  5LJK A;  1KL3 A;  1B8E A;  1SXY A;  1ALB A;  3JQO A;  3HOE A;  2GC9 A;  3WZP A;  2HZR A;  3HWG A;  1VWI B;  1KQX A;  1HN2 A;  1LIB A;  4YDB A;  5JR8 A;  2JOZ A;  1TOW A;  4QAE A;  2FGS A;  4XMG A;  4IMO A;  1E5P A;  1KL5 A;  4JNJ A;  3FA6 A;  1QY0 A;  3BX8 A;  3C76 X;  1QAB E;  3RDM A;  3VU1 A;  3I17 A;  4EEJ A;  1AB0 A;  4M6S A;  1YWC A;  4GGZ A;  4L1N A;  4YKM A;  1GKA B;  3EW1 A;  3P6C A;  3WVM A;  3WJD A;  3MM0 A;  2FKG A;  1NBX A;  1SWO A;  2KT4 B;  2OVD A;  1PBO A;  3MBT A;  2KW1 A;  1GX8 A;  5EED A;  5EPQ A;  5K68 A;  1NDJ A;  4YKO A;  1LCW A;  5HBS A;  5JD2 A;  1GKA A;  3RSW A;  1RSU B;  4ZJ0 A;  2X45 A;  3EM0 A;  3FEL A;  2QO4 A;  1SWT A;  2Q2M A;  1VWG B;  4NYQ A;  2HYS A;  4QNI A;  4ALO A;  1I05 A;  2OL6 O;  2C1Q A;  1KT4 A;  4ZFX A;  5BVT A;  1VWR B;  1SLG B;  4LZV A;  1UYO X;  2IZI A;  2IZB A;  3D95 A;  1LIE A;  4CDE A;  4D6A A;  1W4T A;  2RTO B;  1IKE A;  4UU2 A;  4ZHF A;  1SXX A;  1SXW A;  4ORY A;  1ZNK A;  2WEX A;  1CJ5 A;  1KT3 A;  5H9N A;  1O1U A;  2Z4I A;  4GE1 A;  4GJS A;  1FEL A;  2BLG A;  2I5V O;  3OJY C;  3RE5 A;  1SWR A;  2RTK A;  1Y52 X;  3FA7 A;  3I0A A;  1SRJ A;  4MEE A;  3B2J A;  3VG7 A;  3MVF A;  1LDO A;  2A5C A;  4ZGU A;  1QY2 A;  5AEO A;  3EC5 A;  4JGL A;  3QQ2 A;  1E02 A;  1OBP A;  5B11 O;  1ZRY A;  3DSZ A;  2RTM A;  5AJC A;  1LIC A;  4KCA A;  3ZW1 A;  5KHP A;  5LJH A;  5CE4 A;  4Z2P A;  3PED A;  5HTD A;  1N4J A;  1VWH B;  3FYF A;  2X55 A;  1U17 A;  1I4U A;  1MEP A;  1VWQ B;  1SWJ A;  3FA8 A;  1FJ1 E;  4YCH A;  2JGS A;  3BSZ E;  1LNM A;  4LQZ A;  2CM4 A;  2HNX A;  3VPJ E;  1CRB A;  2HZQ A;  2PI3 O;  1Y9T A;  3HWF A;  5HWZ A;  4JO6 A;  2C1S A;  4GK9 A;  3NX1 A;  1DV9 A;  2RTI B;  2RCQ A;  2WWP A;  4FGI B;  3JSQ A;  1O1V A;  4AZR A;  2AF5 A;  3T6F A;  3FMZ A;  4M7M A;  1KZW A;  4IB8 A;  3SAO A;  1TW4 A;  1IIU A;  5FFH A;  3NR3 A;  2DJG A;  2W2A A;  1SY3 A;  2X4M A;  1FEN A;  4K19 A;  4U3Q A;  2KTS A;  5HA0 A;  4BOE A;  2FR3 A;  2LB6 A;  4CPH A;  1PEE A;  4RUN A;  3VG2 A;  4LZU A;  2BC3 A;  5LJD A;  3GAQ A;  1GT3 A;  1SWB A;  1D2U A;  3FA9 A;  1X89 A;  3CBS A;  4AZN A;  1N0S A;  5EZ2 A;  2POA A;  3VG4 A;  4ZHD A;  2QM9 A;  5H9A A;  1N7Y A;  1QQS A;  2RTB B;  4HWM A;  4BX5 A;  4Y0P A;  1NP1 A;  1ADL A;  2R73 A;  5FQ7 E;  4TKH A;  3O19 A;  1HQP A;  1HMR A;  1HXL A;  3JS1 A;  1JBH A;  1SY1 A;  3VHH A;  2HLV A;  1AVE A;  1GT5 A;  3EBW A;  1HBP A;  1VWJ B;  3FIQ A;  3VG6 A;  3C78 X;  1VWM B;  2NP1 A;  2OL8 O;  2RTL A;  4IBA A;  2BT9 A;  4U9C A;  4MVE A;  4KT5 A;  4CDD A;  2ALL X;  1VWP B;  2OF9 A;  1BSY A;  2RD7 C;  3CQR A;  1EII A;  4GGR A;  4CPF A;  3E3C A;  1IJ8 A;  5F2B A;  4ORU A;  4CV7 A;  2G8C O;  2ACO A;  1H91 A;  2Z4H A;  4I9S A;  1GX3 A;  5B27 A;  3BDR A;  3DTQ A;  1KXO A;  2ACP X;  1ACD A;  1LF7 A;  4IB7 A;  5HTE A;  1BWY A;  3PQU A;  3VHI A;  2AT5 X;  3WBG A;  3KFF A;  5AJB A;  2RTR B;  3AEH A;  1EUO A;  2RTC B;  1SWC A;  1BBP A;  1SWQ A;  1YP6 A;  3TGA A;  4TKB A;  1TXL A;  2C4I A;  3CKF A;  4N7C A;  5HCC C;  2VDF A;  2OFM X;  2L68 A;  2G5L A;  2WEW A;  1SA8 A;  4QRL A;  3NPO A;  4HFO A;  3APV A;  4DQ4 A;  2LA7 A;  4GUZ A;  2OY5 O;  4YFR A;  4GNY A;  3BX7 A;  1X8O A;  1SWA A;  5F6B A;  5FQ8 E;  5L8N A;  4A1H A;  2QMI A;  4A8Z A;  4ORX A;  4WFV A;  5D8J A;  3T1D A;  1STP A;  1VWL B;  2W2B A;  5BVS A;  1ICN A;  4CPI A;  3PK2 A;  1SRG A;  3AKN A;  1BM5 A;  1RLB E;  2VFC A;  4XMF A;  3STK A;  1JYJ A;  4BGF A;  1KFF A;  5AQ6 A;  1W5R A;  3D97 A;  1VWC B;  3ELZ A;  1SWD A;  1SWE A;  2AL0 X;  2IZE B;  2Y3F A;  4Y0Q A;  5DG4 A;  1P6P A;  4ZHG A;  2RN4 A;  3ZI8 A;  1CBR A;  4QGX A;  4O4O A;  3OBL A;  3EMM A;  5HCE C;  1BSQ A;  3RY2 A;  5HAE A;  4D6B A;  4I3D A;  2FS6 A;  1VYO A;  4BQU A;  1S44 A;  5LJB A;  2X46 A;  1T0V A;  1SWK A;  3NX2 A;  3FR5 A;  1GXA A;  1VYG A;  4Z28 A;  4Y5D A;  4DQ3 A;  1VYF A;  4Y0S A;  1OEJ A;  1GGL A;  2G79 A;  4AZO A;  3VE1 A;  1SWL A;  1T8V A;  1ERX A;  2X34 A;  3KVN A;  4U46 A;  2DM5 A;  3WXQ A;  4GRJ A;  4O4S A;  1IKJ A;  1JMZ A;  1FTP A;  3QKG A;  1A3Y A;  1DF8 A;  1HY2 A;  2X8T A;  3APX A;  4MVK A;  5IO6 A;  4NV8 A;  3PDF A;  3P24 A;  1X8N A;  4YH0 A;  3TGC A;  1D3S A;  3FDC A;  3RDU A;  3G7X A;  1VWN B;  2QCB A;  2F09 A;  2M4L A;  3HK1 A;  3T6L A;  3WZO A;  3LNB A;  4DMO A;  2FR2 A;  4QZU A;  2GJ5 A;  3SZH A;  2RTQ B;  2OVE A;  4OS0 A;  3HPE A;  5IXG A;  1QFV A;  1U0X A;  1G74 A;  4HPA A;  3UAQ A;  1GT1 A;  4NW4 A;  2CM9 A;  5HCD C;  4AW8 A;  3RKG A;  1HQQ A;  4YBP A;  3STN A;  3WYQ A;  1EXS A;  1MUP A;  2MO5 A;  2PY1 A;  4BX6 B;  4ZGF A;  2BS5 A;  1QFT A;  3EBK A;  3F6Z B;  3T2W A;  2RQ0 A;  5K67 A;  2O62 A;  4YVB A;  4ZH9 A;  3PH5 A;  2RCT A;  1Y55 X;  1JJU A;  3S26 A;  1SRE A;  4KII A;  4BX6 A;  1BSO A;  1VWB B;  5KID A;  5C0N A;  1X8Q A;  3KFH A;  1MM9 A;  2OYB O;  3RBY A;  4OS3 A;  3TF6 A;  1GT4 A;  1SWU A;  4AZP A;  2FKJ A;  1ZNG A;  1U18 A;  2RTN B;  1XKI A;  3WJB A;  2ZSC A;  2AT6 X;  2IZC B;  2LBV A;  3D96 A;  3CKG A;  1KQW A;  2G78 A;  3WJE A;  3WZQ A;  5LJE A;  3WJC A;  1LUQ A;  1ML7 A;  4EKV A;  1S7D A;  3NAD A;  4AYH A;  1URE A;  4GH7 A;  1DC9 A;  3S5V A;  2RTJ A;  4NNT A;  4O4U A;  3ZQ3 A;  3BS2 A;  4A1Y A;  3SOT A;  1AQB A;  1SXU A;  1OBQ A;  3PH6 A;  3VG5 A;  1KL4 A;  3NQK A;  3FEK A;  4ALB A;  5K06 A;  1VWF B;  2VFB A;  1EPB A;  2A2G A;  4I60 A;  3AUM O;  2JN3 A;  3CR6 A;  3RE6 A;  3BU9 A;  1EIO A;  4ZCB A;  2JMB A;  1DZK A;  1XCA A;  1YUP A;  3ELX A;  3NP1 A;  3TZS A;  3TGB A;  1A18 A;  2HKD A;  1EPA A;  1MVG A;  2GTL N;  2MF6 A;  5CHK A;  5H9L A;  2A3F X;  1OBU A;  2WR6 A;  1E06 A;  2A5B A;  2L9C A;  1RXJ A;  4I3C A;  4EQA C;  3B2L A;  1JJJ A;  3N91 A;  2QOS C;  2UZ2 A;  3FW4 A;  1BEB A;  4Y0R A;  1FEM A;  1CBS A;  4BJ8 A;  3ZUI A;  3UEX A;  1OSP O;  1VWE B;  1N43 A;  1Y9L A;  4Y59 A;  5F7G A;  4CPE A;  1UZ2 X;  2ZAG A;  3UEW A;  2A13 A;  4FBR A;  2CBR A;  2BSZ A;  2FHN X;  2OZQ A;  3K3L A;  3PPT A;  4IRW A;  3H3I A;  2AMM X;  4B55 A;  2IZD B;  1Y0G A;  2EU7 X;  2K23 A;  3RDX A;  4HPC A;  1S2P A;  3OD9 A;  4YCE A;  2WQ9 A;  1RST B;  4NLJ A;  2F01 A;  4TNN A;  2X32 A;  3GE2 A;  2NNE A;  4YBU A;  2IFB A;  4OS8 A;  4MIS A;  4XME A;  1AEL A;  3D4R A;  1WBI A;  3O2Y A;  3CMP A;  4QQ1 A;  2RTG B;  4MVI A;  1RXH A;  3HWD A;  1NQM A;  2OY7 A;  1SWF A;  4CDC A;  3MX7 A;  5IO7 A;  2DJF A;  2FTB A;  3Q6L A;  4RUU A;  5D47 A;  2WUT A;  4KH8 A;  3VE2 A;  3EW2 A;  1WUB A;  2AH7 X;  1X71 A;  5FEN A;  1VWK B;  3NBX X;  4ID2 A;  5CYB A;  3ZW0 A;  1X8P A;  5F1E A;  3LHN A;  3NQ9 A;  4ML7 B;  4O3Z A;  3BRN A;  5D4A A;  1YWD A;  3VHM A;  1LKE A;  1EW3 A;  1MK5 A;  5B29 A;  3RDQ A;  5L3Y A;  4BVM A;  1A57 A;  2X56 A;  1BRP A;  3RDS A;  1FE3 A;  5B2A O;  2OY8 A;  4I6S A;  4MIR A;  1NC9 A;  1TVQ A;  2HMB A;  2AVI A;  3MG5 A;  4YFQ A;  1L6M A;  4N7D A;  4IAB A;  5L8I A;  1KT7 A;  4AZM A;  5IRA A;  4GD9 A;  3FR2 A;  4UU3 A;  3ZW2 A;  1MOY A;  3U0D A;  3WYP A;  4U8U M;  1SWG A;  1BRQ A;  2IZA A;  2RTP B;  4OMW A;  3F9D A;  1B4M A;  4O9S A;  1JYD A;  1JV4 A;  3HWE A;  5DPQ A;  5CSE A;  1DF3 A;  1LFO A;  1VPR A;  2W2F A;  1SWS A;  4QYP A;  4ZR2 A;  5KIC A;  1W6F A;  5H8T A;  3BU1 A;  1ZNL A;  2ANS A;  2BS6 A;  4ODD A;  1KOI A;  4LKP A;  2OY1 O;  1X8U A;  4L3R A;  5D45 A;  3O22 A;  2IZG B;  4Z27 A;  3C77 X;  1OPB A;  1LDQ A;  2R56 A;  1LIF A;  2WSJ A;  4U8U N;  2ZAI A;  1EQD A;  3BLG A;  2IZK A;  1ZND A;  1ZNE A;  4ORW A;  1YWA A;  1KT6 A;  2BHV A;  1SMP I;  4QZT A;  2FWV A;  1QY1 A;  3SZI A;  3VG3 A;  1EAL A;  3VGW A;  3B2I A;  1KT5 A;  3SLJ A;  2L5P A;  4YGZ A;  1KGL A;  1QWD A;  1VWA B;  2CBS A;  3FID A;  2PFR A;  4R0B A;  2GTF X;  4NP1 A;  2MWH A;  5B5F A;  4C5P A;  5B3M O;  1PBY A;  4O49 A;  5L8O A;  1GM6 A;  3RY1 A;  4YGG A;  2YG2 A;  4BBO A;  3SZJ A;  1CBQ A;  1B56 A;  5B10 O;  4O4X A;  2R74 A;  1VWD B;  1N9M A;  4GU8 A;  1SY2 A;  4ORS A;  4WBK A;  5HZ6 A;  5LKE A;  3T2X A;  2OF8 A;  3D9W A;  2RTH B;  1N9Y A;  2N93 A;  2YMS A;  3APW A;  1DZJ A;  1O8V A;  3F8A A;  2Y3E A;  3P6D A;  4FBO A;  4NV7 A;  4XMD A;  3V8U A;  4ZHH A;  2CAM A;  1IW2 A;  4KC7 A;  4ON1 A;  3OE3 A;  3RZY A;  4IB6 A;  2X8S A;  4I95 A;  1JJX A;  2A8G A;  1Y53 X;  4YGH A;  1LPJ A;  4U8U O;  4BX7 A;  4GET A;  1LCV A;  1AVG I;  1T68 X;  1IFC A;  2GH7 A;  2RTE B;  1UYN X;  4JHQ A;  1JMX A;  1HBQ A;  2FHL A;  4IAX A;  2OVA A;  4A60 A;  3WOV A;  4EFG A;  2FT9 A;  5HZQ A;  4WFU A;  2X8F A;  4IMN A;  2CZT A;  4ES7 A;  2WQA E;  2RTD B;  2UYW A;  4TQ2 A;  3S5X A;  1YP7 A;  4BX5 B;  1MDC A;  3B2K A;  1K24 A;  3FLL A;  1I06 A;  5LKF A;  2WPU A;  2P8G A;  3AKM A;  3SLO A;  1TOU A;  3APU A;  3WJF A;  3FEP A;  4ZHC A;  3RDO A;  5F58 A;  5HZ5 A;  2GTL O;  4QGW A;  1SLE B;  3IFB A;  4TKJ A;  3P6H A;  3KFI A;  3STM X;  1RAV A;  4MVL A;  4XMH A;  4Z6J A;  2G7B A;  4TJZ A;  1I04 A;  3S60 A;  1K3B A;  1I78 A;  1VWO B;  2Q9S A;  2OFR X;  1E00 A;  2Q39 A;  4FQB B;  4OEM A;  5EEE A;  3ZZV A;  1DFV A;  2MHD A;  1HMT A;  1IFB A;  1PTS A;  2LFO A;  2MM3 A;  3X00 A;  1JZU A;  3SLT A;  2A0A A;  2OVS A;  3NQ3 A;  4GZV A;  5HZ8 A;  4O3Y A;  5HZ9 A;  4INN A;  2Q4N A;  4IB9 A;  4I3B A;  4O3W A;  1SRI A;  5IRU A;  4OMX A;  1YIV A;  2JW1 A;  4HPD A;  4TLJ A;  3UEU A;  1JQP A;  2OFA A;  4OKA A;  3LV4 A;  3WJG A;  3IA8 A;  1NP4 A;  3B2H A;  1STR B;  3BY0 A;  1MX8 A;  4AZQ A;  1QG5 A;  3WZN A;  1STS B;  3FEN A;  2F73 A;  5F6Z A;  5B5G A;  4EDE A;  4IAW A;  5BYP A;  5LJC A;  5IRW A;  1LID A;  2AT3 X;  2OFB A;  3ZW1 B;  3U9P C;  4PSQ A;  2PQT A;  4WHI A;  1SRH A;  1GX9 A;  3P6F A;  2AT0 X;  1HXZ A;  2RTF B;  2NND A;  3P6G A;  2FRS A;  4YMY A;  4CSB A;  3ZUO A;  2QOM A;  3CBC A;  4YDA A;  1PM1 X;  1LCZ A;  4EXZ A;  3KFG A;  5EDC A;  1YWB A;  2JU8 A;  1NGL A;  4PJ2 A;  4DNE A;  1SWN A;  3ZWE A;  1OPA A;  3HOL A;  2E4J A;  1DZP A;  4XMC A;  1SWP A;  2JU7 A;  3PEC A;  1OEE A;  4QGV A;  1KZX A;  2IZJ A;  4LKT A;  1G5W A;  2ASN X;  2IJA A;  4ARH A;  4GJV A;  5D48 A;  2KD2 A;  2XKL A;  1E2T A;  1EI5 A;  2IZL B;  1LEL A;  3L4R A;  2NNQ A;  5H9K A;  1ERB A;  1B0O A;  1R0U A;  2XST A;  1AVD A;  4DCB A;  2JU3 A;  4HPB A;  1SLF B;  1OEK A;  1NQN A;  4CPH B;  1BJ7 A;  4I9R A;  2RA6 A;  4KC8 A;  1ICM A;  4CK4 A;  2GTL M;  5EDB A;  2A2U A;  4ZH6 A;  1Z24 A;  1SWH A;  4Z2V A;  2Y32 A;  4BCS A;  3P6E A;  5BVQ A;  4BX7 B;  2AT8 X;  1SY0 A;  4NNS A;  4Z2O A;  1I9H A;  1ZNH A;  2Q2P A;  3HTY A;  5HA1 A;  4CDF A;  2LBA A;  2LKK A;  4ORR A;  4O3X B;  1SRF A;  2IZF B;  2K62 A;  2QO5 A;  4GKC A;  1PMP A;  3FW5 A;  2IZH B;  1CBI A;  2I5Z O;  1MX7 A;  2QO6 A;  4GNW A;  3RWX A;  3KQ0 A;  3ZW0 B;  3EYC A;  2OL7 A;  4NYR A;  4FBV A;  1RXK A;  3PQS A;  4GDA A;  1BLR A; 
#chains in the Genus database with same CATH homology
 3LTW A;  3KKU A;  1CJL A;  2C0Y A;  1CS8 A;  3P5U A;  3PNR A;  3PBH A;  1PCI A;  1KXR A;  3MHS A;  1QOL A;  2PBH A;  4G54 A;  4OEL A;  3H6S A;  3OVX A;  4QRV A;  3IEJ A;  3V6E A;  1NLJ A;  1U9Q X;  3S3R A;  5CHV A;  3BPF A;  3CBJ A;  1Y08 A;  5CHT A;  1BP4 A;  2DC7 A;  1CQD A;  3H89 A;  3I3T A;  1GMY A;  2AYO A;  3IUT A;  1THE A;  2E02 A;  1QDQ A;  1ZIV A;  2Y6E A;  2AIM A;  4YVA A;  3I06 A;  4BPV A;  2IPP B;  4YV8 A;  3DF0 A;  1POP A;  1AIM A;  2CB5 A;  2VHS A;  2NQD B;  1W4T A;  2P7U A;  3WXG A;  1F2B A;  1YVB A;  4ZUX U;  2OZ2 A;  2ARY A;  4P6E A;  2PNS A;  3MOR A;  3KX1 A;  4Q8H A;  1MHW A;  2FO5 A;  2AU1 A;  2PAD A;  5CVM A;  4BS6 A;  1AYU A;  1CPJ A;  3V6C A;  5EGW A;  1CVZ A;  3KWB X;  4MZO A;  4BSQ A;  4W4U A;  5FPW A;  1PPD A;  1AU4 A;  3BPM A;  1VJV A;  2FUD A;  3QSD A;  1ITO A;  2WBF X;  3WXF A;  1PPN A;  4WA6 A;  2ACT A;  5K16 A;  9PAP A;  1CV8 A;  2BDZ A;  4QBB A;  1AYW A;  1YK7 A;  2B1N A;  1K3B B;  1GX3 A;  3TNX A;  4I07 A;  3RVW A;  2NQI A;  2DC8 A;  4I05 A;  3H7D A;  2JQF R;  4PP2 E;  2R9F A;  4AXM A;  1KHP A;  1TLO A;  4GUZ A;  1MIR A;  2YJC A;  2P0R A;  1IWD A;  2R9C A;  1AEC A;  2AVW A;  2XU5 A;  3F75 A;  1U9X A;  4MZS A;  1CB5 A;  3KW9 A;  2Y5B A;  3N3K A;  1TL9 A;  3IMA A;  3N3G A;  3BWK A;  1Y4H A;  2HXZ A;  2PRE A;  2VFC A;  3OF9 A;  4BGF A;  1W5R A;  2BDL A;  2HD5 A;  3KFQ A;  3HHA A;  1ATK A;  3NHE A;  4CDE B;  1YAL A;  3ZUA A;  4P6G A;  3H8B A;  4K7C A;  2AUX A;  2XU3 A;  4N4Z A;  2NQG A;  4CDF B;  1PXV A;  1S4V A;  3K9M A;  1BGO A;  4NV8 A;  3PDF A;  4YYS A;  1O0E A;  2FT2 A;  3OVZ A;  1ZCM A;  4AXL A;  3D6S A;  4YYV A;  5JA7 A;  4MSX A;  1GEC E;  1PAD A;  2R9N A;  2VHF A;  3CH2 X;  2YJB A;  4CZW A;  3E1Z B;  1ICF A;  1PPO A;  3KSE A;  3GCB A;  2XU1 A;  1PIP A;  3B79 A;  1AU3 A;  3C9E A;  3OIS A;  3IV2 A;  4CDC B;  2G8E A;  3H8C A;  1ME3 A;  2DCA A;  1GLO A;  1QXP A;  5CVN B;  2DCD A;  3S3Q A;  1PBH A;  1DF0 A;  3O1G A;  3ERV A;  1STF E;  2VFB A;  1AU2 A;  4DMY A;  2GHU A;  2YJ9 A;  4QRX A;  1MEG A;  1NQC A;  2ATO A;  8PCH A;  2FYE A;  1F29 A;  5EF4 A;  4W5B A;  5JH3 A;  2DC6 A;  2DCB A;  1KFX L;  3LXS A;  2HHN A;  2BSZ A;  4QH6 A;  1NPZ A;  4B55 A;  1KFU L;  2AYN A;  1CTE A;  1U9W A;  3P5V A;  1YK8 A;  3AI8 A;  2FRA A;  3IOQ A;  4FIP A;  2FTD A;  1SNK A;  4CDD B;  2DZY A;  4DMX A;  1VSN A;  3MTN A;  4RY2 A;  3CH3 X;  2DCC A;  1BQI A;  2H7J A;  1X9Y A;  2FRQ A;  3KWZ A;  5J94 A;  3CBK A;  4W5C A;  5PAD A;  7PCK A;  3HHI A;  4FK5 A;  3HD3 A;  4XUI A;  4YYW A;  1YT7 A;  2XU4 A;  1CSB B;  1W6F A;  2GFO A;  2OP3 A;  1M6D A;  4X6J A;  1F2C A;  4YYR A;  1NL6 A;  3HWN A;  2AUZ A;  1Q6K A;  4C5P A;  1GCB A;  3OF8 A;  1A6R A;  4YYU A;  4HWY A;  2IBI A;  1MEM A;  3P5W A;  1U5I A;  3D9W A;  1TU6 A;  4XR7 A;  3F5V A;  3QJ3 A;  2NQA A;  2R9O A;  2DJG B;  4NV7 A;  4PI3 A;  2F1G A;  2YJ2 A;  1F2A A;  2P86 A;  4PAD A;  3USV A;  3MHH A;  4I04 A;  2G6D A;  2OUL A;  5F02 A;  1EWP A;  1MS6 A;  2DC9 A;  2G8J A;  3LFY A;  1SP4 B;  1NB3 A;  1NB5 A;  4OEM A;  4X6I A;  3N4C A;  3QT4 A;  2HH5 A;  1FH0 A;  3U8E A;  3P5X A;  1AU0 A;  1QMY A;  4BQV A;  1EF7 A;  3RVV A;  1JQP A;  4BS5 A;  2E03 A;  2G7Y A;  4X6H A;  3O0U A;  6PAD A;  4PP1 A;  2DJF B;  2AS8 A;  2FQ9 A;  1AYV A;  5CVO B;  2B1M A;  2JQG R;  2YJ8 A;  3PW3 A;  1PE6 A;  4YYQ A;  1MDW A;  3BCN A;  2O6X A;  1EWL A;  1U9V A;  2E00 A;  3BOW A;  1ME4 A;  1E2T A;  1DEU A;  2R9M A;  4FJC A;  4KLB A;  1KHQ A;  3IHP A;  1PPP A;  2F7D A;  4N8W A;  3K24 A;  4Q8G A;  1XKG A;  3M99 A;  3WXE A;  4QRG A;  2CIO A;  3K8U A;  1BY8 A;  4N79 A;  2DZZ A;  1HUC B;  3BC3 A;  3RVX A;  1EWM A;  2R6N A;  1EWO A;  2E01 A;  5A24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...