3LTWA

The structure of mycobacterium marinum arylamine n-acetyltransferase in complex with hydralazine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
b'DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the architecture of the Mycobacterium marinum arylamine N-acetyltransferase active site
pubmed doi rcsb
molecule keywords Arylamine N-acetyltransferase Nat
source organism Mycobacterium marinum
molecule tags Transferase
total genus 83
structure length 272
sequence length 272
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 3ltwA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 3ltwA01
1W4TA 1W6FA 2VFBA 2VFCA 4C5PA 1W5RA 4NV8A 3LTWA 4B55A 1GX3A 4NV7A 4GUZA 2BSZA 4BGFA 3D9WA 1E2TA
chains in the Genus database with same CATH superfamily
5HZ5A 1TOWA 4QAEA 1GT5A 3WJDA 1XCAA 5FAZA 5AQ6A 2L5PA 3CKGA 3RDOA 3T6LA 1CJ5A 4LZVA 1SWPA 1VYOA 2ALLX 3EBKA 4CDDA 2Q2MA 1OBUA 1ERXA 1SRJA 3VG7A 1U17A 3ZUIA 3HWGA 1SWSA 1EW3A 1O8VA 4GDAA 1ZNDA 1VPRA 3Q6LA 1T0VA 4HPBA 1X8PA 2YG2A 5AJCA 2PFRA 4WBKA 4COTA 4HPCA 3GE2A 2OL7A 2LA7A 1GKAB 5HBSA 1SWBA 2MWHA 4OELA 4YMYA 2MJIA 3ELXA 3FELA 4Y0PA 1GM6A 3P6DA 2RCTA 1Y53X 3QQ2A 1LF7A 2XSTA 4NYQA 1MVGA 3P24A 1ZNEA 3CBCA 4KT5A 4Z2OA 4LZUA 5HZQA 2C4IA 4ALBA 1VWMB 2OL6O 5H9NA 3VHMA 4I3CA 4Z2PA 2EU7X 3D95A 4CDFA 1N0SA 2C1SA 3SZHA 4MVLA 1SLFB 4ORRA 4XMFA 4AZOA 2WR6A 3KZAA 2VDFA 1LUQA 1P6PA 1EALA 1AVDA 3ELZA 3EW2A 3FLLA 2RTPB 3P02A 2WQAE 4ARHA 2C1QA 2AKQA 3GAQA 2LKKA 4MVEA 2G7BA 4ON1A 1EXSA 4JHQA 3F9DA 5H9KA 1ICMA 4INNA 4I6SA 1KT7A 2FLJA 1OEJA 1VWJB 2KTSA 4I9SA 1VWQB 3WZNA 2ZSCA 4IB6A 4ALOA 4BX7A 4IB7A 5EDCA 1SY2A 2IZCB 4ORUA 1U18A 4QZTA 3S60A 5AEOA 1SWEA 5B2AO 1O1UA 4AW8A 4QQ1A 3RWXA 1SRIA 5F1EA 3AUMO 2ZAGA 1H91A 1X71A 4GGTA 3SZIA 3CWKA 1OBQA 2RTIB 1JIWI 4CPHB 3NBXX 4HPAA 2CZTA 2G8CO 2RTRB 3AKMA 3NR3A 1KL4A 1ZNGA 4YKMA 1NGLA 5D45A 1GT3A 4YCEA 3ZI8A 5LJCA 3SLTA 4TQ2A 2E4JA 1SWDA 1STSB 1X8UA 2NP1A 1GX3A 3L4RA 3WOVA 3S5XA 1KZXA 3Q34A 1A2DA 1HN2A 4O4UA 4FBOA 4KIIA 5F7GA 2WEXA 1DV9A 1DZKA 1UZ2X 1N7YA 1EPAA 1VWNB 4GJSA 2WSJA 4Z28A 5HAEA 1CBIA 1I06A 4ZGFA 5IRUA 1Y9TA 5EDBA 3PK2A 1HMSA 1NDJA 1VWEB 4YDBA 4FQBB 1JYDA 1YP6A 1SWCA 2PQTA 1LPJA 1G74A 5LJHA 2ACOA 2OVSA 4HFOA 2QCBA 2BS6A 1HY2A 4IBAA 3FMZA 5JD2A 3BRNA 2XKLA 3RDUA 4CV7A 3VHHA 1HQPA 1O1VA 3ZW1A 1EI5A 2NNDA 1CBRA 1MK5A 1B0OA 2RTKA 1PBOA 1DZJA 5K06A 2RTBB 2BHVA 1DZMA 1FJ1E 1BBPA 2Z4IA 1IJ8A 2FR3A 1U0XA 2K62A 1D2UA 4D6AA 1EUOA 5HWZA 3FA6A 1BSYA 1FELA 1MX8A 4NLJA 2F01A 1G5WA 1JYJA 1SWTA 3ZZVA 2PY1A 2IZHB 2GTFX 4AZNA 4RUNA 4A1HA 4ZGUA 1QG5A 3U0DA 1DF3A 3VG5A 2BT9A 1I9HA 4Y0SA 1CBQA 5LJEA 1MX7A 4FGIB 3BLGA 2AT0X 5IO6A 4NV8A 1IKEA 1BEBA 2AH7X 3FDCA 1SWUA 1W4TA 4YH0A 2ACPX 4Z27A 1A3YA 1KFFA 3V8UA 2W2FA 2F73A 3KFHA 3P6HA 1RLBE 5D48A 1NP4A 5KHPA 3LV4A 4ZFXA 3FA8A 4KCAA 2QO5A 2RTHB 2Q4NA 3EMMA 4IMNA 5FFHA 3SAOA 1E5PA 3S5VA 1RAVA 4U46A 1IFBA 1VWDB 3B2HA 3VGWA 5IRWA 3RKGA 4CK4A 1IW2A 1EQDA 4GKCA 4NP1A 4ZH9A 1UREA 1B8EA 1NQNA 2RA6A 4OS8A 1KL3A 2X56A 3EBWA 3HK1A 3D9WA 4YFPA 1GX8A 3DTQA 1NC9A 3FEPA 2W2BA 3O2YA 1SY0A 3IFBA 3VG4A 1DFVA 1FENA 1STPA 2RTMA 3MBTA 1HBQA 3MX7A 3HWEA 4R0BA 5AJBA 3RBYA 2X34A 1Y0GA 2HKDA 3EW1A 3I0AA 5HA0A 3NX2A 4YVBA 2JMBA 2OFRX 1JQPA 1S7DA 4MISA 2OVAA 3TGAA 2ASNX 3CQNA 5C0NA 1KQXA 4TKJA 1LDQA 3BDRA 2AVIA 3TF6A 2G78A 3PPTA 4LQZA 2Q9SA 1GX9A 2X8SA 1L6MA 4CDCA 2RTDB 1FTPA 5HZ9A 4BX7B 3PP6A 4YGGA 4PJ2A 2AMMX 2BC3A 4ZHGA 1JZUA 4CSBA 3BU9A 4I9RA 1VWGB 2HMBA 5IO7A 4ML7B 4BCSA 1HBPA 1SWFA 1I04A 3TZSA 2FS7A 3P6EA 5L8IA 4IMOA 1DC9A 1TOUA 3PQSA 4DCBA 1T8VA 1VWOB 3HOEA 3HOLA 2HLVA 4JNJA 2IZJA 4QZUA 1VWAB 2GC9A 3KFFA 3LNBA 2X8FA 1UYNX 1K3BA 3KVNA 1KT5A 4WFUA 2DJGA 3WJFA 4AZQA 2KW1A 1JBHA 3NPOA 2OY1O 5DG4A 1SWNA 2JGSA 1WUBA 2FRSA 3WYPA 4B55A 1GT1A 5DPQA 1I78A 3B2KA 2FS6A 2ZAIA 2A5CA 2MF6A 3BY0A 3PH6A 3BX7A 3CKFA 1RSTB 3HWFA 1E06A 5B27A 2RD7C 1LCZA 1KT6A 3RSWA 5EZ2A 1OPAA 1K24A 4YFQA 1T68X 1ADLA 2OF9A 4GH7A 1BSOA 1IIUA 1NP1A 3SZJA 4BX5A 3UEWA 2IZEB 3MG5A 5FQ8E 4GETA 5H9LA 4HWMA 1SLDB 3T6FA 1LFOA 2A13A 3OJYC 4QGXA 4Y59A 3VHIA 3STKA 3FYFA 3B2IA 3VG6A 3RDXA 3VG3A 1BM5A 1W5RA 3P6GA 3T1DA 1SY3A 2OF8A 4ID2A 2GTLN 1MUPA 4O4OA 4KC8A 2BSZA 1OBPA 4YGHA 1FE3A 2KD2A 3PEDA 2OFAA 2CBRA 1KGLA 4ZJ0A 4OMXA 3WZPA 3ZW0B 1DF8A 2IZIA 4ZR2A 1CBSA 2ANSA 5LJDA 2X46A 5LJKA 2RQ0A 1JJJA 1HXLA 3PQUA 1VWLB 4JO6A 4A1YA 1GKAA 1QWDA 1VWRB 2GJ5A 1AQBA 1PMPA 4O49A 3S26A 2A2GA 4FBRA 3C76X 4AZPA 1SWQA 1PM1X 2R74A 3NP1A 4U8UN 3PECA 2POAA 3EM0A 3CMPA 1KXOA 1QFVA 2UYWA 4QYPA 4UU3A 4YKOA 5EEDA 4BX6B 5L8NA 1PTSA 2FWVA 1JJXA 5LJBA 4NV7A 3CQRA 5IXGA 1E2TA 2LFOA 3PDFA 1YIVA 3B2LA 3WJGA 2WQ9A 1KZWA 1SRFA 1FEMA 2AT6X 2JOZA 4ORYA 4XMEA 4ZH6A 2QO4A 4ZHDA 2W2AA 1LCVA 2OL8O 3D97A 4QRLA 5B5GA 1VWHB 3FEKA 3F6ZB 4O3XB 5F2BA 5FQ6E 5K67A 4TKBA 3JS1A 1OEEA 3FR4A 5L8OA 1R0UA 1BJ7A 4RUUA 3D96A 1RXJA 2LBVA 4I3DA 2IFBA 5HCDC 1N43A 4IABA 2LBAA 4U3QA 2K23A 4CPEA 4EKVA 2QM9A 3F8AA 3EYCA 1AVEA 1Y55X 4GJVA 3APUA 2Z4HA 1LELA 3O22A 4CPHA 1BWYA 3FR2A 2Y32A 3RE6A 4ZHFA 3ZUOA 1MOYA 1S2PA 4BQUA 3P6FA 5BVSA 1LIEA 4TLJA 1EIIA 1STRB 2CAMA 4IAXA 2IZKA 4KC7A 2OY7A 2BLGA 1G85A 1ML7A 1RXHA 1VWPB 3P6CA 5CSEA 4C5PA 2OY5O 4CDEA 4IB9A 3APVA 2OZQA 4FBVA 5B3MO 4BBOA 3U03A 3WZQA 2RTQB 2BS5A 2PI3O 4O4SA 1B4MA 1VWKB 1SWOA 1VYGA 1LIDA 2JU8A 1A57A 3VE1A 5HTDA 1ACDA 1NQMA 4BVMA 4XMDA 5HTEA 1IFCA 1JJUA 3BSZE 5H8TA 4XMGA 3BU1A 1YUPA 5LKFA 5D47A 3FR5A 2X4MA 1LCWA 3O19A 1SXYA 3D4RA 5HCCC 2QOSC 3LTWA 4A8ZA 1X8NA 4MEEA 3JQOA 1HXZA 2AL0X 3C78X 1SWJA 4Z2VA 2KTDA 4DQ4A 3H3IA 4IB8A 1TVQA 1D3SA 2A2UA 2RTNB 3AEHA 4L3RA 4K19A 2G5LA 1VWBB 2DJFA 2OFBA 4MIRA 3RY2A 4QGVA 1ERBA 4DMOA 5CYBA 3E3CA 1AB0A 1PEEA 4CPFA 5IO5A 3FA9A 2QO6A 4GGZA 2WWPA 1A18A 4O3YA 4EQAC 3VE2A 5HZ6A 1YWAA 5H9AA 4ORXA 1W6FA 3HWDA 2IZGB 3FW4A 3EC5A 4GE1A 3QKGA 4OS3A 2RTJA 3APXA 3CR6A 1JMZA 2IZFB 4XMHA 1N9MA 4MVKA 3X00A 4ZHHA 4GUZA 4BOEA 2WPUA 3NQ3A 4JGLA 4M7MA 2O62A 4NW4A 5D8JA 2FKGA 3WJCA 1SWRA 4EFGA 1OPBA 5FQ7E 3WZOA 2L9CA 4BJ8A 4NLIA 1Z24A 1I05A 1LIBA 1QY1A 2L67A 3OBLA 1S44A 1N9YA 2R73A 4NNTA 2IZLB 3NADA 1OSPO 4O3WA 3WVMA 4YFRA 4YCHA 5JR8A 3UEUA 2AT5X 4KH8A 4A60A 4DQ3A 1SWHA 1LKEA 2FT9A 3MM0A 2CZUA 3FW5A 3RE5A 3RDSA 2VFBA 3VG2A 5B29A 2GTLO 1BSQA 1VWFB 1SA8A 1SLGB 1YWBA 2A0AA 2FHLA 2GTLM 2JU7A 2LB6A 3UAQA 3WXQA 1BRPA 4GRJA 3SLJA 2RTEB 5B11O 2AT8X 3BX8A 4WFVA 5KICA 4N7CA 2JN3A 2HZQA 4ORSA 2FKJA 2FTBA 3JSQA 5HA1A 3NX1A 1SWLA 4OS0A 1HMTA 2FGSA 2X8TA 3TGCA 1KOIA 2NNEA 1KL5A 4NYRA 4ZCBA 1KQWA 1VWIB 2MHDA 2MO5A 3ZW1B 1ZNKA 3RY1A 2Q2PA 1G7NA 2N93A 2I5VO 2OVDA 3FIDA 4U8UO 4AZRA 5L3YA 2OY8A 4U8UM 2Q39A 2QMIA 5EPQA 1QABE 3NQKA 1SRHA 5CHKA 1KT3A 5HCEC 1SRGA 2OFMX 3KFIA 2GH7A 4I3BA 3SLOA 1SY1A 2AT3X 2M4LA 3FIQA 5D4AA 4NNSA 1LICA 3OE3A 3RDMA 5BYPA 4Y0QA 1SLEB 4OKAA 5BVQA 1VWCB 1HMRA 2OYBO 3UEXA 1LDOA 2CM4A 2FR2A 3STNA 3I17A 4O4XA 4MVIA 3WJBA 1IKJA 1QQSA 1SREA 2RTOB 4GU8A 3WBGA 4QNIA 4Y5DA 1E00A 1NBXA 1HQQA 2G79A 4OMWA 4GDZA 1SMPI 4YGZA 3C77X 1E02A 3PH5A 4PSQA 5F6ZA 3KQ0A 3FENA 1Y52X 3ZQ3A 1GT4A 5KIDA 2IZAA 3T2WA 5EEEA 1CRBA 2CM9A 2RTAA 4GZVA 3FA7A 1ZNHA 3CBSA 1LIFA 2OVEA 2FHNX 2Y3EA 2YMSA 3SOTA 1TXLA 1OEKA 5F58A 1MM9A 5LKEA 2HNXA 4ORWA 4QGWA 3G7XA 1ALBA 3WYQA 1ZRYA 3DSZA 3OD9A 1X8OA 2RTLA 1LNMA 1YWCA 3TGBA 2IZBA 4LKPA 3T2XA 4DNEA 2QOMA 4GK9A 5B10O 4Y0RA 5F6BA 1I4UA 4I95A 4EEJA 3ZWEA 4EXZA 1FDQA 4O3ZA 5HZ8A 1MEPA 1AELA 4GD9A 4O9SA 4ZHCA 3VPJE 1PBYA 2WEWA 3UEVA 1GXAA 1QY2A 2NNQA 3STMX 1YWDA 1VYFA 2A5BA 1EPBA 1DZPA 3VU1A 1QFTA 3K3LA 5LJGA 1RSUB 2KT4B 3ZW0A 1JV4A 1Y9LA 1ZNLA 2X55A 4HPDA 3APWA 1YP7A 4YDAA 3RZYA 4M6SA 1GGLA 2F09A 5IRAA 4D6BA 1SXXA 2RTCB 4I60A 4L1NA 1JMXA 1SXUA 1KT4A 2A3FX 2X32A 4OEMA 3WJEA 3RDQA 2X45A 2JU3A 4XMCA 1SWAA 5K68A 3B2JA 3NQ9A 4GNWA 4LKTA 4ODDA 4U9CA 2CBSA 4IAWA 3KFGA 4GGRA 2RN4A 2L68A 1SWKA 1SXWA 1RXKA 2RTFB 1B56A 3MVFA 4TJZA 3ZW2A 1N4JA 2VFCA 2I5ZO 2JW1A 1TW4A 4BX6A 4UU2A 4YBPA 2IJAA 4GNYA 2P8GA 1UYOX 3AKNA 4QYNA 4YBUA 3HPEA 4EDEA 1AVGI 1ICNA 1X89A 2UZ2A 4CPIA 5BVTA 5FENA 5B5FA 5CE4A 3HTYA 3IA8A 2R56A 3U9PC 4AYHA 4Z6JA 2Y3FA 1EIOA 1XKIA 2AF5A 4TNNA 1RBPA 4N7DA 4WHIA 4IRWA 3LHNA 1QY0A 2MM3A 1BRQA 1SWGA 1BLRA 4TKHA 1WBIA 2IZDB 1X8QA 2A8GA 2HZRA 2RTGB 4BX5B 4AZMA 4ES7A 2DM5A 2WUTA 2RCQA 1MDCA 3N91A 2HYSA 4BGFA 3BS2A
chains in the Genus database with same CATH topology
1SP4B 4YYWA 1AIMA 3BWKA 4I04A 3O0UA 2OZ2A 4BPVA 4MSXA 2DC9A 3CH3X 4P6GA 1ATKA 1U5IA 4WA6A 2P86A 1NB5A 4XR7A 4Q8HA 2AS8A 1MHWA 3N4CA 2DCCA 3ERVA 2R9CA 1PE6A 4XUIA 2WBFX 2FO5A 1U9QX 1EWLA 1CPJA 1ITOA 2PREA 4PADA 3WXGA 1F2BA 3LFYA 3OF8A 4I05A 4QRVA 3K9MA 1KHPA 4QRGA 4BS6A 1MEGA 5CVNB 1M6DA 3HWNA 2JQGR 3MHHA 2E01A 3BOWA 3AI8A 1CTEA 1ME4A 5CVOB 1TL9A 4CDEB 1X9YA 1PADA 1TLOA 3QSDA 4YYQA 1GX3A 2PNSA 1KFXL 2R6NA 1KXRA 3S3QA 1SNKA 2YJCA 1KFUL 4X6JA 5JA7A 2B1NA 2G8JA 2F7DA 3P5WA 4MZOA 5CHVA 1BY8A 2XU3A 3BC3A 2DJFB 2PBHA 3H6SA 4QRXA 2IPPB 4DMYA 4N4ZA 2XU1A 2NQGA 3IMAA 1Q6KA 4CDDB 1GMYA 4NV8A 2VHSA 2ATOA 5K16A 1W4TA 3IOQA 5CVMA 1HUCB 3QT4A 4KLBA 3KWZA 1FH0A 3P5XA 3RVWA 3F5VA 1BQIA 2ACTA 3H89A 1NPZA 1QOLA 3N3GA 2AU1A 1YALA 4QH6A 3KWBX 3D9WA 2OP3A 1PXVA 3P5VA 1YVBA 1EWOA 1JQPA 1AU2A 1AU0A 3CH2X 2ARYA 3H8BA 4YYUA 1NQCA 4YV8A 2DC6A 2R9MA 1U9WA 1TU6A 2FRAA 3BCNA 2YJBA 1MEMA 3S3RA 1Y08A 1S4VA 2G8EA 4RY2A 2HD5A 4B55A 3U8EA 3PBHA 3HHAA 5CHTA 1VSNA 1MIRA 7PCKA 2R9OA 4AXMA 1POPA 4DMXA 3OF9A 2DC8A 3CBJA 1W5RA 4YYRA 1QMYA 3P5UA 3PNRA 2PADA 2BSZA 5EGWA 3IHPA 2Y5BA 1GCBA 4X6IA 1U9XA 2IBIA 4FJCA 1F2AA 4MZSA 2AVWA 3KX1A 1A6RA 2DCDA 1CS8A 1AYVA 2P7UA 1AECA 1ICFA 4CZWA 2R9FA 3CBKA 3O1GA 2DC7A 1CSBB 4HWYA 3IEJA 2DZZA 4NV7A 1QDQA 3H7DA 1E2TA 3PDFA 2C0YA 3HHIA 3K24A 5J94A 3D6SA 2XU4A 1DF0A 2BDZA 4W5BA 1Y4HA 1QXPA 2O6XA 2AUZA 3M99A 2P0RA 3TNXA 2OULA 2VHFA 1PPPA 2AUXA 4CDCB 3IV2A 2AYNA 3WXEA 2FTDA 4C5PA 2BDLA 4AXLA 1EWPA 4P6EA 1K3BB 2DZYA 2FRQA 3DF0A 2FT2A 5PADA 4CDFB 2CB5A 1CV8A 1O0EA 3LTWA 3PW3A 3B79A 2FYEA 3C9EA 3H8CA 8PCHA 3V6EA 1AYUA 4N79A 4PI3A 3WXFA 2H7JA 1YK7A 4W5CA 1PIPA 1W6FA 3N3KA 4PP2E 1EF7A 4YYVA 1AU3A 5JH3A 2HH5A 2DCBA 4GUZA 2JQFR 3IUTA 3V6CA 2G6DA 1DEUA 1GECE 2G7YA 1F2CA 1THEA 1CB5A 1NLJA 3OVZA 4YYSA 1ZCMA 2VFBA 2FQ9A 3F75A 1YK8A 1ZIVA 4N8WA 5F02A 6PADA 2NQAA 1VJVA 9PAPA 3NHEA 1XKGA 3BPFA 3KW9A 3I3TA 4G54A 1F29A 2B1MA 2HXZA 5EF4A 2GHUA 3RVXA 2NQDB 1MDWA 4ZUXU 1PPDA 3E1ZB 1KHQA 1NB3A 4FK5A 2AYOA 3RVVA 4BSQA 1BGOA 2YJ8A 3KKUA 3OVXA 1CJLA 2E00A 1PBHA 5A24A 4I07A 3GCBA 4FIPA 4BS5A 1PCIA 3K8UA 4PP1A 2F1GA 3USVA 2E03A 1EWMA 1AYWA 1STFE 3BPMA 1U9VA 4YVAA 1CVZA 2GFOA 3ZUAA 3HD3A 3MHSA 4X6HA 1YT7A 1NL6A 2FUDA 3I06A 2XU5A 5FPWA 2AIMA 1MS6A 3OISA 4Q8GA 4W4UA 1BP4A 4QBBA 3KSEA 2YJ2A 4BQVA 1ME3A 3MORA 2CIOA 4OEMA 1IWDA 1CQDA 2HHNA 1PPOA 2NQIA 2DCAA 2DJGB 2VFCA 1PPNA 3LXSA 4K7CA 2R9NA 2Y6EA 2YJ9A 3MTNA 1GLOA 2E02A 1AU4A 3QJ3A 3KFQA 4BGFA 4OELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4T A;  1W6F A;  2VFB A;  2VFC A;  4C5P A;  1W5R A;  4NV8 A;  3LTW A;  4B55 A;  1GX3 A;  4NV7 A;  4GUZ A;  2BSZ A;  4BGF A;  3D9W A;  1E2T A; 
#chains in the Genus database with same CATH topology
 5HZ5 A;  1TOW A;  4QAE A;  1GT5 A;  3WJD A;  1XCA A;  5FAZ A;  5AQ6 A;  2L5P A;  3CKG A;  3RDO A;  3T6L A;  1CJ5 A;  4LZV A;  1SWP A;  1VYO A;  2ALL X;  3EBK A;  4CDD A;  2Q2M A;  1OBU A;  1ERX A;  1SRJ A;  3VG7 A;  1U17 A;  3ZUI A;  3HWG A;  1SWS A;  1EW3 A;  1O8V A;  4GDA A;  1ZND A;  1VPR A;  3Q6L A;  1T0V A;  4HPB A;  1X8P A;  2YG2 A;  5AJC A;  2PFR A;  4WBK A;  4COT A;  4HPC A;  3GE2 A;  2OL7 A;  2LA7 A;  1GKA B;  5HBS A;  1SWB A;  2MWH A;  4OEL A;  4YMY A;  2MJI A;  3ELX A;  3FEL A;  4Y0P A;  1GM6 A;  3P6D A;  2RCT A;  1Y53 X;  3QQ2 A;  1LF7 A;  2XST A;  4NYQ A;  1MVG A;  3P24 A;  1ZNE A;  3CBC A;  4KT5 A;  4Z2O A;  4LZU A;  5HZQ A;  2C4I A;  4ALB A;  1VWM B;  2OL6 O;  5H9N A;  3VHM A;  4I3C A;  4Z2P A;  2EU7 X;  3D95 A;  4CDF A;  1N0S A;  2C1S A;  3SZH A;  4MVL A;  1SLF B;  4ORR A;  4XMF A;  4AZO A;  2WR6 A;  3KZA A;  2VDF A;  1LUQ A;  1P6P A;  1EAL A;  1AVD A;  3ELZ A;  3EW2 A;  3FLL A;  2RTP B;  3P02 A;  2WQA E;  4ARH A;  2C1Q A;  2AKQ A;  3GAQ A;  2LKK A;  4MVE A;  2G7B A;  4ON1 A;  1EXS A;  4JHQ A;  3F9D A;  5H9K A;  1ICM A;  4INN A;  4I6S A;  1KT7 A;  2FLJ A;  1OEJ A;  1VWJ B;  2KTS A;  4I9S A;  1VWQ B;  3WZN A;  2ZSC A;  4IB6 A;  4ALO A;  4BX7 A;  4IB7 A;  5EDC A;  1SY2 A;  2IZC B;  4ORU A;  1U18 A;  4QZT A;  3S60 A;  5AEO A;  1SWE A;  5B2A O;  1O1U A;  4AW8 A;  4QQ1 A;  3RWX A;  1SRI A;  5F1E A;  3AUM O;  2ZAG A;  1H91 A;  1X71 A;  4GGT A;  3SZI A;  3CWK A;  1OBQ A;  2RTI B;  1JIW I;  4CPH B;  3NBX X;  4HPA A;  2CZT A;  2G8C O;  2RTR B;  3AKM A;  3NR3 A;  1KL4 A;  1ZNG A;  4YKM A;  1NGL A;  5D45 A;  1GT3 A;  4YCE A;  3ZI8 A;  5LJC A;  3SLT A;  4TQ2 A;  2E4J A;  1SWD A;  1STS B;  1X8U A;  2NP1 A;  1GX3 A;  3L4R A;  3WOV A;  3S5X A;  1KZX A;  3Q34 A;  1A2D A;  1HN2 A;  4O4U A;  4FBO A;  4KII A;  5F7G A;  2WEX A;  1DV9 A;  1DZK A;  1UZ2 X;  1N7Y A;  1EPA A;  1VWN B;  4GJS A;  2WSJ A;  4Z28 A;  5HAE A;  1CBI A;  1I06 A;  4ZGF A;  5IRU A;  1Y9T A;  5EDB A;  3PK2 A;  1HMS A;  1NDJ A;  1VWE B;  4YDB A;  4FQB B;  1JYD A;  1YP6 A;  1SWC A;  2PQT A;  1LPJ A;  1G74 A;  5LJH A;  2ACO A;  2OVS A;  4HFO A;  2QCB A;  2BS6 A;  1HY2 A;  4IBA A;  3FMZ A;  5JD2 A;  3BRN A;  2XKL A;  3RDU A;  4CV7 A;  3VHH A;  1HQP A;  1O1V A;  3ZW1 A;  1EI5 A;  2NND A;  1CBR A;  1MK5 A;  1B0O A;  2RTK A;  1PBO A;  1DZJ A;  5K06 A;  2RTB B;  2BHV A;  1DZM A;  1FJ1 E;  1BBP A;  2Z4I A;  1IJ8 A;  2FR3 A;  1U0X A;  2K62 A;  1D2U A;  4D6A A;  1EUO A;  5HWZ A;  3FA6 A;  1BSY A;  1FEL A;  1MX8 A;  4NLJ A;  2F01 A;  1G5W A;  1JYJ A;  1SWT A;  3ZZV A;  2PY1 A;  2IZH B;  2GTF X;  4AZN A;  4RUN A;  4A1H A;  4ZGU A;  1QG5 A;  3U0D A;  1DF3 A;  3VG5 A;  2BT9 A;  1I9H A;  4Y0S A;  1CBQ A;  5LJE A;  1MX7 A;  4FGI B;  3BLG A;  2AT0 X;  5IO6 A;  4NV8 A;  1IKE A;  1BEB A;  2AH7 X;  3FDC A;  1SWU A;  1W4T A;  4YH0 A;  2ACP X;  4Z27 A;  1A3Y A;  1KFF A;  3V8U A;  2W2F A;  2F73 A;  3KFH A;  3P6H A;  1RLB E;  5D48 A;  1NP4 A;  5KHP A;  3LV4 A;  4ZFX A;  3FA8 A;  4KCA A;  2QO5 A;  2RTH B;  2Q4N A;  3EMM A;  4IMN A;  5FFH A;  3SAO A;  1E5P A;  3S5V A;  1RAV A;  4U46 A;  1IFB A;  1VWD B;  3B2H A;  3VGW A;  5IRW A;  3RKG A;  4CK4 A;  1IW2 A;  1EQD A;  4GKC A;  4NP1 A;  4ZH9 A;  1URE A;  1B8E A;  1NQN A;  2RA6 A;  4OS8 A;  1KL3 A;  2X56 A;  3EBW A;  3HK1 A;  3D9W A;  4YFP A;  1GX8 A;  3DTQ A;  1NC9 A;  3FEP A;  2W2B A;  3O2Y A;  1SY0 A;  3IFB A;  3VG4 A;  1DFV A;  1FEN A;  1STP A;  2RTM A;  3MBT A;  1HBQ A;  3MX7 A;  3HWE A;  4R0B A;  5AJB A;  3RBY A;  2X34 A;  1Y0G A;  2HKD A;  3EW1 A;  3I0A A;  5HA0 A;  3NX2 A;  4YVB A;  2JMB A;  2OFR X;  1JQP A;  1S7D A;  4MIS A;  2OVA A;  3TGA A;  2ASN X;  3CQN A;  5C0N A;  1KQX A;  4TKJ A;  1LDQ A;  3BDR A;  2AVI A;  3TF6 A;  2G78 A;  3PPT A;  4LQZ A;  2Q9S A;  1GX9 A;  2X8S A;  1L6M A;  4CDC A;  2RTD B;  1FTP A;  5HZ9 A;  4BX7 B;  3PP6 A;  4YGG A;  4PJ2 A;  2AMM X;  2BC3 A;  4ZHG A;  1JZU A;  4CSB A;  3BU9 A;  4I9R A;  1VWG B;  2HMB A;  5IO7 A;  4ML7 B;  4BCS A;  1HBP A;  1SWF A;  1I04 A;  3TZS A;  2FS7 A;  3P6E A;  5L8I A;  4IMO A;  1DC9 A;  1TOU A;  3PQS A;  4DCB A;  1T8V A;  1VWO B;  3HOE A;  3HOL A;  2HLV A;  4JNJ A;  2IZJ A;  4QZU A;  1VWA B;  2GC9 A;  3KFF A;  3LNB A;  2X8F A;  1UYN X;  1K3B A;  3KVN A;  1KT5 A;  4WFU A;  2DJG A;  3WJF A;  4AZQ A;  2KW1 A;  1JBH A;  3NPO A;  2OY1 O;  5DG4 A;  1SWN A;  2JGS A;  1WUB A;  2FRS A;  3WYP A;  4B55 A;  1GT1 A;  5DPQ A;  1I78 A;  3B2K A;  2FS6 A;  2ZAI A;  2A5C A;  2MF6 A;  3BY0 A;  3PH6 A;  3BX7 A;  3CKF A;  1RST B;  3HWF A;  1E06 A;  5B27 A;  2RD7 C;  1LCZ A;  1KT6 A;  3RSW A;  5EZ2 A;  1OPA A;  1K24 A;  4YFQ A;  1T68 X;  1ADL A;  2OF9 A;  4GH7 A;  1BSO A;  1IIU A;  1NP1 A;  3SZJ A;  4BX5 A;  3UEW A;  2IZE B;  3MG5 A;  5FQ8 E;  4GET A;  5H9L A;  4HWM A;  1SLD B;  3T6F A;  1LFO A;  2A13 A;  3OJY C;  4QGX A;  4Y59 A;  3VHI A;  3STK A;  3FYF A;  3B2I A;  3VG6 A;  3RDX A;  3VG3 A;  1BM5 A;  1W5R A;  3P6G A;  3T1D A;  1SY3 A;  2OF8 A;  4ID2 A;  2GTL N;  1MUP A;  4O4O A;  4KC8 A;  2BSZ A;  1OBP A;  4YGH A;  1FE3 A;  2KD2 A;  3PED A;  2OFA A;  2CBR A;  1KGL A;  4ZJ0 A;  4OMX A;  3WZP A;  3ZW0 B;  1DF8 A;  2IZI A;  4ZR2 A;  1CBS A;  2ANS A;  5LJD A;  2X46 A;  5LJK A;  2RQ0 A;  1JJJ A;  1HXL A;  3PQU A;  1VWL B;  4JO6 A;  4A1Y A;  1GKA A;  1QWD A;  1VWR B;  2GJ5 A;  1AQB A;  1PMP A;  4O49 A;  3S26 A;  2A2G A;  4FBR A;  3C76 X;  4AZP A;  1SWQ A;  1PM1 X;  2R74 A;  3NP1 A;  4U8U N;  3PEC A;  2POA A;  3EM0 A;  3CMP A;  1KXO A;  1QFV A;  2UYW A;  4QYP A;  4UU3 A;  4YKO A;  5EED A;  4BX6 B;  5L8N A;  1PTS A;  2FWV A;  1JJX A;  5LJB A;  4NV7 A;  3CQR A;  5IXG A;  1E2T A;  2LFO A;  3PDF A;  1YIV A;  3B2L A;  3WJG A;  2WQ9 A;  1KZW A;  1SRF A;  1FEM A;  2AT6 X;  2JOZ A;  4ORY A;  4XME A;  4ZH6 A;  2QO4 A;  4ZHD A;  2W2A A;  1LCV A;  2OL8 O;  3D97 A;  4QRL A;  5B5G A;  1VWH B;  3FEK A;  3F6Z B;  4O3X B;  5F2B A;  5FQ6 E;  5K67 A;  4TKB A;  3JS1 A;  1OEE A;  3FR4 A;  5L8O A;  1R0U A;  1BJ7 A;  4RUU A;  3D96 A;  1RXJ A;  2LBV A;  4I3D A;  2IFB A;  5HCD C;  1N43 A;  4IAB A;  2LBA A;  4U3Q A;  2K23 A;  4CPE A;  4EKV A;  2QM9 A;  3F8A A;  3EYC A;  1AVE A;  1Y55 X;  4GJV A;  3APU A;  2Z4H A;  1LEL A;  3O22 A;  4CPH A;  1BWY A;  3FR2 A;  2Y32 A;  3RE6 A;  4ZHF A;  3ZUO A;  1MOY A;  1S2P A;  4BQU A;  3P6F A;  5BVS A;  1LIE A;  4TLJ A;  1EII A;  1STR B;  2CAM A;  4IAX A;  2IZK A;  4KC7 A;  2OY7 A;  2BLG A;  1G85 A;  1ML7 A;  1RXH A;  1VWP B;  3P6C A;  5CSE A;  4C5P A;  2OY5 O;  4CDE A;  4IB9 A;  3APV A;  2OZQ A;  4FBV A;  5B3M O;  4BBO A;  3U03 A;  3WZQ A;  2RTQ B;  2BS5 A;  2PI3 O;  4O4S A;  1B4M A;  1VWK B;  1SWO A;  1VYG A;  1LID A;  2JU8 A;  1A57 A;  3VE1 A;  5HTD A;  1ACD A;  1NQM A;  4BVM A;  4XMD A;  5HTE A;  1IFC A;  1JJU A;  3BSZ E;  5H8T A;  4XMG A;  3BU1 A;  1YUP A;  5LKF A;  5D47 A;  3FR5 A;  2X4M A;  1LCW A;  3O19 A;  1SXY A;  3D4R A;  5HCC C;  2QOS C;  3LTW A;  4A8Z A;  1X8N A;  4MEE A;  3JQO A;  1HXZ A;  2AL0 X;  3C78 X;  1SWJ A;  4Z2V A;  2KTD A;  4DQ4 A;  3H3I A;  4IB8 A;  1TVQ A;  1D3S A;  2A2U A;  2RTN B;  3AEH A;  4L3R A;  4K19 A;  2G5L A;  1VWB B;  2DJF A;  2OFB A;  4MIR A;  3RY2 A;  4QGV A;  1ERB A;  4DMO A;  5CYB A;  3E3C A;  1AB0 A;  1PEE A;  4CPF A;  5IO5 A;  3FA9 A;  2QO6 A;  4GGZ A;  2WWP A;  1A18 A;  4O3Y A;  4EQA C;  3VE2 A;  5HZ6 A;  1YWA A;  5H9A A;  4ORX A;  1W6F A;  3HWD A;  2IZG B;  3FW4 A;  3EC5 A;  4GE1 A;  3QKG A;  4OS3 A;  2RTJ A;  3APX A;  3CR6 A;  1JMZ A;  2IZF B;  4XMH A;  1N9M A;  4MVK A;  3X00 A;  4ZHH A;  4GUZ A;  4BOE A;  2WPU A;  3NQ3 A;  4JGL A;  4M7M A;  2O62 A;  4NW4 A;  5D8J A;  2FKG A;  3WJC A;  1SWR A;  4EFG A;  1OPB A;  5FQ7 E;  3WZO A;  2L9C A;  4BJ8 A;  4NLI A;  1Z24 A;  1I05 A;  1LIB A;  1QY1 A;  2L67 A;  3OBL A;  1S44 A;  1N9Y A;  2R73 A;  4NNT A;  2IZL B;  3NAD A;  1OSP O;  4O3W A;  3WVM A;  4YFR A;  4YCH A;  5JR8 A;  3UEU A;  2AT5 X;  4KH8 A;  4A60 A;  4DQ3 A;  1SWH A;  1LKE A;  2FT9 A;  3MM0 A;  2CZU A;  3FW5 A;  3RE5 A;  3RDS A;  2VFB A;  3VG2 A;  5B29 A;  2GTL O;  1BSQ A;  1VWF B;  1SA8 A;  1SLG B;  1YWB A;  2A0A A;  2FHL A;  2GTL M;  2JU7 A;  2LB6 A;  3UAQ A;  3WXQ A;  1BRP A;  4GRJ A;  3SLJ A;  2RTE B;  5B11 O;  2AT8 X;  3BX8 A;  4WFV A;  5KIC A;  4N7C A;  2JN3 A;  2HZQ A;  4ORS A;  2FKJ A;  2FTB A;  3JSQ A;  5HA1 A;  3NX1 A;  1SWL A;  4OS0 A;  1HMT A;  2FGS A;  2X8T A;  3TGC A;  1KOI A;  2NNE A;  1KL5 A;  4NYR A;  4ZCB A;  1KQW A;  1VWI B;  2MHD A;  2MO5 A;  3ZW1 B;  1ZNK A;  3RY1 A;  2Q2P A;  1G7N A;  2N93 A;  2I5V O;  2OVD A;  3FID A;  4U8U O;  4AZR A;  5L3Y A;  2OY8 A;  4U8U M;  2Q39 A;  2QMI A;  5EPQ A;  1QAB E;  3NQK A;  1SRH A;  5CHK A;  1KT3 A;  5HCE C;  1SRG A;  2OFM X;  3KFI A;  2GH7 A;  4I3B A;  3SLO A;  1SY1 A;  2AT3 X;  2M4L A;  3FIQ A;  5D4A A;  4NNS A;  1LIC A;  3OE3 A;  3RDM A;  5BYP A;  4Y0Q A;  1SLE B;  4OKA A;  5BVQ A;  1VWC B;  1HMR A;  2OYB O;  3UEX A;  1LDO A;  2CM4 A;  2FR2 A;  3STN A;  3I17 A;  4O4X A;  4MVI A;  3WJB A;  1IKJ A;  1QQS A;  1SRE A;  2RTO B;  4GU8 A;  3WBG A;  4QNI A;  4Y5D A;  1E00 A;  1NBX A;  1HQQ A;  2G79 A;  4OMW A;  4GDZ A;  1SMP I;  4YGZ A;  3C77 X;  1E02 A;  3PH5 A;  4PSQ A;  5F6Z A;  3KQ0 A;  3FEN A;  1Y52 X;  3ZQ3 A;  1GT4 A;  5KID A;  2IZA A;  3T2W A;  5EEE A;  1CRB A;  2CM9 A;  2RTA A;  4GZV A;  3FA7 A;  1ZNH A;  3CBS A;  1LIF A;  2OVE A;  2FHN X;  2Y3E A;  2YMS A;  3SOT A;  1TXL A;  1OEK A;  5F58 A;  1MM9 A;  5LKE A;  2HNX A;  4ORW A;  4QGW A;  3G7X A;  1ALB A;  3WYQ A;  1ZRY A;  3DSZ A;  3OD9 A;  1X8O A;  2RTL A;  1LNM A;  1YWC A;  3TGB A;  2IZB A;  4LKP A;  3T2X A;  4DNE A;  2QOM A;  4GK9 A;  5B10 O;  4Y0R A;  5F6B A;  1I4U A;  4I95 A;  4EEJ A;  3ZWE A;  4EXZ A;  1FDQ A;  4O3Z A;  5HZ8 A;  1MEP A;  1AEL A;  4GD9 A;  4O9S A;  4ZHC A;  3VPJ E;  1PBY A;  2WEW A;  3UEV A;  1GXA A;  1QY2 A;  2NNQ A;  3STM X;  1YWD A;  1VYF A;  2A5B A;  1EPB A;  1DZP A;  3VU1 A;  1QFT A;  3K3L A;  5LJG A;  1RSU B;  2KT4 B;  3ZW0 A;  1JV4 A;  1Y9L A;  1ZNL A;  2X55 A;  4HPD A;  3APW A;  1YP7 A;  4YDA A;  3RZY A;  4M6S A;  1GGL A;  2F09 A;  5IRA A;  4D6B A;  1SXX A;  2RTC B;  4I60 A;  4L1N A;  1JMX A;  1SXU A;  1KT4 A;  2A3F X;  2X32 A;  4OEM A;  3WJE A;  3RDQ A;  2X45 A;  2JU3 A;  4XMC A;  1SWA A;  5K68 A;  3B2J A;  3NQ9 A;  4GNW A;  4LKT A;  4ODD A;  4U9C A;  2CBS A;  4IAW A;  3KFG A;  4GGR A;  2RN4 A;  2L68 A;  1SWK A;  1SXW A;  1RXK A;  2RTF B;  1B56 A;  3MVF A;  4TJZ A;  3ZW2 A;  1N4J A;  2VFC A;  2I5Z O;  2JW1 A;  1TW4 A;  4BX6 A;  4UU2 A;  4YBP A;  2IJA A;  4GNY A;  2P8G A;  1UYO X;  3AKN A;  4QYN A;  4YBU A;  3HPE A;  4EDE A;  1AVG I;  1ICN A;  1X89 A;  2UZ2 A;  4CPI A;  5BVT A;  5FEN A;  5B5F A;  5CE4 A;  3HTY A;  3IA8 A;  2R56 A;  3U9P C;  4AYH A;  4Z6J A;  2Y3F A;  1EIO A;  1XKI A;  2AF5 A;  4TNN A;  1RBP A;  4N7D A;  4WHI A;  4IRW A;  3LHN A;  1QY0 A;  2MM3 A;  1BRQ A;  1SWG A;  1BLR A;  4TKH A;  1WBI A;  2IZD B;  1X8Q A;  2A8G A;  2HZR A;  2RTG B;  4BX5 B;  4AZM A;  4ES7 A;  2DM5 A;  2WUT A;  2RCQ A;  1MDC A;  3N91 A;  2HYS A;  4BGF A;  3BS2 A; 
#chains in the Genus database with same CATH homology
 1SP4 B;  4YYW A;  1AIM A;  3BWK A;  4I04 A;  3O0U A;  2OZ2 A;  4BPV A;  4MSX A;  2DC9 A;  3CH3 X;  4P6G A;  1ATK A;  1U5I A;  4WA6 A;  2P86 A;  1NB5 A;  4XR7 A;  4Q8H A;  2AS8 A;  1MHW A;  3N4C A;  2DCC A;  3ERV A;  2R9C A;  1PE6 A;  4XUI A;  2WBF X;  2FO5 A;  1U9Q X;  1EWL A;  1CPJ A;  1ITO A;  2PRE A;  4PAD A;  3WXG A;  1F2B A;  3LFY A;  3OF8 A;  4I05 A;  4QRV A;  3K9M A;  1KHP A;  4QRG A;  4BS6 A;  1MEG A;  5CVN B;  1M6D A;  3HWN A;  2JQG R;  3MHH A;  2E01 A;  3BOW A;  3AI8 A;  1CTE A;  1ME4 A;  5CVO B;  1TL9 A;  4CDE B;  1X9Y A;  1PAD A;  1TLO A;  3QSD A;  4YYQ A;  1GX3 A;  2PNS A;  1KFX L;  2R6N A;  1KXR A;  3S3Q A;  1SNK A;  2YJC A;  1KFU L;  4X6J A;  5JA7 A;  2B1N A;  2G8J A;  2F7D A;  3P5W A;  4MZO A;  5CHV A;  1BY8 A;  2XU3 A;  3BC3 A;  2DJF B;  2PBH A;  3H6S A;  4QRX A;  2IPP B;  4DMY A;  4N4Z A;  2XU1 A;  2NQG A;  3IMA A;  1Q6K A;  4CDD B;  1GMY A;  4NV8 A;  2VHS A;  2ATO A;  5K16 A;  1W4T A;  3IOQ A;  5CVM A;  1HUC B;  3QT4 A;  4KLB A;  3KWZ A;  1FH0 A;  3P5X A;  3RVW A;  3F5V A;  1BQI A;  2ACT A;  3H89 A;  1NPZ A;  1QOL A;  3N3G A;  2AU1 A;  1YAL A;  4QH6 A;  3KWB X;  3D9W A;  2OP3 A;  1PXV A;  3P5V A;  1YVB A;  1EWO A;  1JQP A;  1AU2 A;  1AU0 A;  3CH2 X;  2ARY A;  3H8B A;  4YYU A;  1NQC A;  4YV8 A;  2DC6 A;  2R9M A;  1U9W A;  1TU6 A;  2FRA A;  3BCN A;  2YJB A;  1MEM A;  3S3R A;  1Y08 A;  1S4V A;  2G8E A;  4RY2 A;  2HD5 A;  4B55 A;  3U8E A;  3PBH A;  3HHA A;  5CHT A;  1VSN A;  1MIR A;  7PCK A;  2R9O A;  4AXM A;  1POP A;  4DMX A;  3OF9 A;  2DC8 A;  3CBJ A;  1W5R A;  4YYR A;  1QMY A;  3P5U A;  3PNR A;  2PAD A;  2BSZ A;  5EGW A;  3IHP A;  2Y5B A;  1GCB A;  4X6I A;  1U9X A;  2IBI A;  4FJC A;  1F2A A;  4MZS A;  2AVW A;  3KX1 A;  1A6R A;  2DCD A;  1CS8 A;  1AYV A;  2P7U A;  1AEC A;  1ICF A;  4CZW A;  2R9F A;  3CBK A;  3O1G A;  2DC7 A;  1CSB B;  4HWY A;  3IEJ A;  2DZZ A;  4NV7 A;  1QDQ A;  3H7D A;  1E2T A;  3PDF A;  2C0Y A;  3HHI A;  3K24 A;  5J94 A;  3D6S A;  2XU4 A;  1DF0 A;  2BDZ A;  4W5B A;  1Y4H A;  1QXP A;  2O6X A;  2AUZ A;  3M99 A;  2P0R A;  3TNX A;  2OUL A;  2VHF A;  1PPP A;  2AUX A;  4CDC B;  3IV2 A;  2AYN A;  3WXE A;  2FTD A;  4C5P A;  2BDL A;  4AXL A;  1EWP A;  4P6E A;  1K3B B;  2DZY A;  2FRQ A;  3DF0 A;  2FT2 A;  5PAD A;  4CDF B;  2CB5 A;  1CV8 A;  1O0E A;  3LTW A;  3PW3 A;  3B79 A;  2FYE A;  3C9E A;  3H8C A;  8PCH A;  3V6E A;  1AYU A;  4N79 A;  4PI3 A;  3WXF A;  2H7J A;  1YK7 A;  4W5C A;  1PIP A;  1W6F A;  3N3K A;  4PP2 E;  1EF7 A;  4YYV A;  1AU3 A;  5JH3 A;  2HH5 A;  2DCB A;  4GUZ A;  2JQF R;  3IUT A;  3V6C A;  2G6D A;  1DEU A;  1GEC E;  2G7Y A;  1F2C A;  1THE A;  1CB5 A;  1NLJ A;  3OVZ A;  4YYS A;  1ZCM A;  2VFB A;  2FQ9 A;  3F75 A;  1YK8 A;  1ZIV A;  4N8W A;  5F02 A;  6PAD A;  2NQA A;  1VJV A;  9PAP A;  3NHE A;  1XKG A;  3BPF A;  3KW9 A;  3I3T A;  4G54 A;  1F29 A;  2B1M A;  2HXZ A;  5EF4 A;  2GHU A;  3RVX A;  2NQD B;  1MDW A;  4ZUX U;  1PPD A;  3E1Z B;  1KHQ A;  1NB3 A;  4FK5 A;  2AYO A;  3RVV A;  4BSQ A;  1BGO A;  2YJ8 A;  3KKU A;  3OVX A;  1CJL A;  2E00 A;  1PBH A;  5A24 A;  4I07 A;  3GCB A;  4FIP A;  4BS5 A;  1PCI A;  3K8U A;  4PP1 A;  2F1G A;  3USV A;  2E03 A;  1EWM A;  1AYW A;  1STF E;  3BPM A;  1U9V A;  4YVA A;  1CVZ A;  2GFO A;  3ZUA A;  3HD3 A;  3MHS A;  4X6H A;  1YT7 A;  1NL6 A;  2FUD A;  3I06 A;  2XU5 A;  5FPW A;  2AIM A;  1MS6 A;  3OIS A;  4Q8G A;  4W4U A;  1BP4 A;  4QBB A;  3KSE A;  2YJ2 A;  4BQV A;  1ME3 A;  3MOR A;  2CIO A;  4OEM A;  1IWD A;  1CQD A;  2HHN A;  1PPO A;  2NQI A;  2DCA A;  2DJG B;  2VFC A;  1PPN A;  3LXS A;  4K7C A;  2R9N A;  2Y6E A;  2YJ9 A;  3MTN A;  1GLO A;  2E02 A;  1AU4 A;  3QJ3 A;  3KFQ A;  4BGF A;  4OEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...