3LTWA

The structure of mycobacterium marinum arylamine n-acetyltransferase in complex with hydralazine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the architecture of the Mycobacterium marinum arylamine N-acetyltransferase active site
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
molecule keywords Arylamine N-acetyltransferase Nat
total genus 83
structure length 272
sequence length 272
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 3ltwA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 3ltwA01
4NV8A 4NV7A 1GX3A 4B55A 1E2TA 2VFCA 4C5PA 3D9WA 1W4TA 2BSZA 3LTWA 4GUZA 1W6FA 1W5RA 4BGFA 2VFBA
chains in the Genus database with same CATH superfamily
2A13A 1YIVA 1SWDA 1EUOA 3NQKA 4IABA 2X46A 3EBKA 3HTYA 1IFCA 1LCWA 2Y3EA 4GGRA 4IRWA 1CBSA 5HZ6A 5LJGA 3MBTA 2QO6A 1LCVA 5AJBA 3SZJA 1WUBA 4U8UM 1S2PA 3VE2A 4XMFA 3CQRA 3HPEA 4GDAA 4GK9A 1QQSA 5B10O 4ALOA 1YWBA 2ANSA 2BS6A 2MO5A 2IZAA 5EEEA 2C1SA 3KFIA 2IZCB 4L3RA 4OELA 3VG3A 1VYGA 1HXLA 1JJJA 3D95A 1IFBA 1SWJA 2HLVA 3UEUA 2WPUA 2QM9A 2AT3X 3FR5A 3P6DA 3TGCA 1NP4A 3SLTA 1GM6A 4I3BA 4COTA 2WEWA 4CPHB 4O3XB 1VWKB 1VWCB 4BX7A 2AT0X 3VG6A 3P6HA 1SWBA 3C77X 5EEDA 1T68X 1HXZA 4MVLA 4ORWA 3UEWA 4QZUA 3D97A 1VWMB 1FEMA 1MX7A 1K3BA 4Y5DA 2JMBA 4O4UA 4YBUA 4ZJ0A 1GT3A 1KT6A 2GJ5A 1PMPA 4KH8A 1VPRA 4FGIB 5B27A 1MUPA 2AH7X 1I4UA 2FTBA 2R74A 3DSZA 3FENA 4MVIA 4QZTA 4TNNA 1B8EA 2X32A 3QKGA 3TGAA 4Y0SA 1KGLA 2RD7C 2X45A 4XMCA 2RTBB 2RTLA 4HWMA 1A57A 1T0VA 1LELA 1HQPA 2NNDA 2OY1O 3FA6A 2MJIA 2RTPB 4FBVA 4ZFXA 4EEJA 1E02A 1E00A 2MHDA 2X56A 1SWPA 3CQNA 3FEKA 4GNYA 1L6MA 3RDSA 1KL5A 3D4RA 4A1YA 3BRNA 3ZWEA 4ZHFA 1GX3A 1QFVA 2RTHB 3RDXA 1JIWI 1SXWA 4LKPA 3ZQ3A 1SY0A 3JSQA 3RDMA 5LJKA 2RTGB 3SLOA 1RSUB 3ZZVA 3WZOA 1RLBE 2N93A 3EW2A 4LZVA 5LKFA 2OY8A 5IO6A 1U18A 4ORRA 4QGXA 4KT5A 3CBCA 3E3CA 1QWDA 2GTFX 1SWOA 1N9YA 4GETA 1VYOA 4WFVA 4ORYA 3KZAA 1AB0A 1XKIA 2HKDA 5BVTA 3IA8A 1O1VA 1SWQA 1CRBA 2A0AA 2IZLB 1W4TA 4IB8A 4MEEA 3ELXA 1GX8A 2WQAE 4N7DA 3S60A 2Q2PA 3VG7A 4CPFA 5CHKA 1IKJA 1I9HA 4U9CA 1UYNX 1SA8A 4DMOA 2OFMX 1X71A 3ZI8A 4UU2A 1UZ2X 4YDBA 1CBRA 4QRLA 1SWHA 4GGTA 2Q4NA 3P6FA 4TKJA 3I0AA 4RUUA 4WFUA 3WVMA 4BBOA 4EFGA 1LCZA 2RTCB 1GT4A 1NQNA 2PI3O 4I6SA 1ERBA 5B2AO 5B5GA 2ZAIA 1LICA 1BRQA 3CWKA 3NP1A 3WBGA 4Z2OA 3EM0A 4U3QA 2OY7A 3T2XA 2RTEB 2ACOA 1ZNDA 2IJAA 5LJEA 4Z6JA 1PBYA 2X8SA 3LNBA 1NC9A 3UEVA 5FQ6E 1SWGA 3WJGA 1SMPI 3FA7A 1Y9LA 1SY1A 3O2YA 1EI5A 1GKAB 2LBVA 4XMEA 2VDFA 1BM5A 4K19A 1N7YA 5IRUA 2JU3A 3AKNA 2CM4A 1O1UA 4ZHDA 2AL0X 1QY0A 5AJCA 4CPEA 4OS0A 1G7NA 1WBIA 1W6FA 3RDOA 2LA7A 2JOZA 3BSZE 3DTQA 1I05A 4NYQA 4GNWA 4YFPA 3SZIA 1MX8A 1SREA 1HMSA 1EW3A 2POAA 4MIRA 2M4LA 2RQ0A 1Y53X 1ICNA 2CAMA 2X55A 1X8NA 1S7DA 1SWUA 3EYCA 1Y9TA 3WOVA 5B5FA 3WXQA 3FA8A 3PQSA 2LFOA 3HK1A 5FQ8E 1QG5A 1RBPA 1STRB 2IZJA 3B2LA 4FQBB 3RSWA 5D47A 2OVAA 2RTRB 2CBRA 2MWHA 4QNIA 4QAEA 1FJ1E 5HBSA 4O4XA 1EIOA 1BJ7A 4HPAA 2RTAA 4AW8A 1VYFA 4BX6B 1U17A 4CDFA 3KQ0A 4AZRA 3T6FA 5HTEA 1P6PA 1DF8A 1KQWA 2GTLM 1VWPB 2DM5A 2PY1A 1SLGB 2FLJA 5D4AA 1G5WA 1ALBA 1KZXA 1SWSA 1VWDB 2QO4A 4DNEA 2QMIA 3MM0A 1R0UA 3FIQA 2JN3A 5EZ2A 1KFFA 2HZRA 4TLJA 4NLJA 2AKQA 1MK5A 2GC9A 4EQAC 4I95A 4O4OA 4ZHGA 1DFVA 1S44A 4A60A 1OEKA 3CKFA 1EXSA 4I9RA 1AVEA 3RE5A 5KHPA 4JGLA 2OYBO 1SRHA 3U03A 1YWDA 3STKA 1U0XA 3P6GA 1IKEA 1EPBA 3VHIA 4ALBA 1RAVA 1VWRB 4YKMA 2RTNB 1LIFA 1N9MA 3HWGA 3NBXX 5CSEA 2KT4B 3RY2A 4ZGUA 5DG4A 1ICMA 1LIBA 1VWEB 2C1QA 4HPCA 4YCEA 3APUA 4Y0RA 5IXGA 2RTJA 2OFAA 4HPDA 4ZR2A 3O19A 3VU1A 4N7CA 5LJCA 2FT9A 3AUMO 4ZHHA 4DCBA 4FBOA 3PQUA 4Y0PA 1DZKA 3D96A 2BT9A 2BSZA 4YDAA 5AQ6A 2RCQA 1MEPA 3APWA 4GRJA 5BVSA 2RTQB 1NP1A 2OVDA 3KFFA 1XCAA 4GE1A 4INNA 4XMHA 3F6ZB 2W2AA 2W2FA 3BU9A 5HZ8A 2JGSA 5LJBA 1VWJB 2FKJA 1OBQA 3ELZA 1MOYA 3APXA 3Q34A 4O3ZA 2Y32A 3VPJE 5HWZA 5H9LA 2F73A 3B2KA 2XSTA 4HPBA 2AVIA 2RTFB 2IZEB 3OJYC 4QQ1A 2A3FX 1ML7A 1SRJA 1I78A 2OFRX 1FDQA 4GH7A 3FR2A 3EC5A 4YGZA 3RZYA 2ZAGA 4BX7B 4AZMA 1SWKA 2NP1A 2EU7X 3BY0A 1LNMA 1VWFB 4GUZA 5FQ7E 2IZGB 2OF8A 5LJHA 2Z4HA 2MM3A 3RE6A 4QGWA 4FBRA 3S5XA 3NX1A 4OKAA 2K62A 1A3YA 2GH7A 4XMGA 1KT3A 2Z4IA 3MVFA 4IAWA 1O8VA 3EMMA 3RY1A 4DQ3A 3JS1A 1KXOA 4O3YA 2RA6A 2GTLO 4ES7A 3B2JA 4I60A 3UAQA 1X8UA 5LKEA 2X8FA 3WZQA 1OBUA 2MF6A 3CMPA 2WSJA 5HZQA 1JZUA 1TXLA 2R56A 3BX7A 4BVMA 1KT7A 4O4SA 3NPOA 1BSOA 4M7MA 1PTSA 2OVSA 3UEXA 5H9KA 2OL7A 2AF5A 2A2UA 4OMXA 4YMYA 4ZCBA 4EDEA 3PH6A 1AQBA 2QOMA 1SXUA 2CM9A 1ERXA 1Y0GA 2QOSC 4I3DA 4EKVA 1E06A 5IO5A 1VWOB 1QY2A 3VHHA 4DQ4A 3CR6A 1AVGI 2RTIB 4WBKA 4BGFA 4KC7A 5HZ9A 3WYPA 5K06A 4OS8A 5D48A 2FWVA 1JJUA 1ACDA 3FELA 1BSQA 5F2BA 4YVBA 3RBYA 2OF9A 1EPAA 2UYWA 4O3WA 1CJ5A 5K68A 1KT5A 1LF7A 4AZOA 3AEHA 1MDCA 2UZ2A 1PM1X 1SWTA 3BDRA 4NNSA 1IJ8A 4BX6A 4O9SA 3RDUA 4Z27A 1FELA 3OD9A 2FR3A 3T2WA 1A18A 2ALLX 1TOUA 2RCTA 4OS3A 1B4MA 1G85A 5F58A 4QYNA 1QABE 3BX8A 3HOEA 4MVKA 3HOLA 1BEBA 2X4MA 3B2IA 4YH0A 1IIUA 1ZRYA 3RKGA 5HAEA 4D6AA 2G8CO 5IRWA 1HMRA 3P6EA 2L67A 3FW5A 3N91A 3CBSA 1K24A 3NQ3A 1AELA 1SWEA 2IZHB 5LJDA 3BLGA 5JR8A 2W2BA 1UREA 2CZUA 3I17A 1BBPA 3MG5A 1SXYA 1OSPO 1Y55X 2RTDB 3FYFA 1ZNLA 4YKOA 1A2DA 3CKGA 1GKAA 3OBLA 2CZTA 4IMNA 3ZW2A 5FENA 4GD9A 4BOEA 4Z2VA 1D2UA 2ASNX 4UU3A 5CYBA 1JV4A 1KOIA 3FR4A 3K3LA 3LHNA 3F8AA 1LIDA 4KCAA 3S26A 3VE1A 4CSBA 1OEJA 1GX9A 3FMZA 5F6BA 3SOTA 1YUPA 4TKBA 2AT8X 1DZJA 2Q9SA 4Z28A 1LKEA 1X89A 3EW1A 4IB9A 3B2HA 4TQ2A 2LKKA 4IB7A 1OEEA 1QY1A 1UYOX 4JO6A 4LZUA 4PJ2A 2CBSA 3D9WA 2DJGA 5L3YA 2IFBA 2ACPX 2G7BA 2WUTA 3P02A 1I04A 3P24A 1E5PA 1VWQB 4YGGA 3KVNA 1DV9A 3FDCA 4AZQA 4O49A 2LB6A 3JQOA 1X8QA 4LQZA 2L5PA 1KZWA 4TJZA 5HCCC 3WZPA 3VG2A 5AEOA 2G79A 1G74A 4EXZA 1GGLA 2HYSA 3FW4A 4GU8A 1FENA 2OY5O 4NV8A 4ML7B 4ODDA 4TKHA 5L8NA 5BVQA 2PQTA 3T6LA 3FA9A 5B11O 1DZMA 5CE4A 4A8ZA 2WR6A 3GE2A 4I3CA 3ZW1B 1VWBB 1T8VA 1KT4A 1Y52X 2KD2A 2GTLN 4ZHCA 4QGVA 4ZH6A 1H91A 4CDEA 4GJVA 1DZPA 4YBPA 5F6ZA 1JYJA 2X8TA 1SWCA 3MX7A 4R0BA 2NNQA 1EQDA 2WQ9A 3HWEA 3FEPA 1QFTA 5KICA 1CBIA 3SZHA 3EBWA 3IFBA 3NX2A 2E4JA 1VWIB 2FRSA 5EDCA 1X8PA 2OL8O 4NYRA 4M6SA 4BCSA 1ZNHA 3U0DA 4U46A 4GGZA 4Y59A 2AT6X 1PBOA 1SXXA 1VWHB 3H3IA 4KC8A 2G5LA 2Q2MA 2A2GA 2KTDA 2RTMA 4BX5B 1OBPA 1SRIA 2R73A 5HA0A 1HMTA 5DPQA 1X8OA 2FKGA 2X34A 4IAXA 1LUQA 3BU1A 1BWYA 1NDJA 3PK2A 2NNEA 2L68A 4YFQA 1VWGB 2AT5X 2HZQA 1SLFB 2VFCA 4L1NA 1HQQA 1JYDA 3NADA 4GKCA 3VGWA 3KFGA 1ZNEA 3PEDA 4PSQA 2FGSA 2RN4A 4LKTA 5FFHA 1LDQA 4IB6A 5HA1A 4KIIA 1ADLA 4ON1A 3NR3A 4ORSA 5IO7A 2Y3FA 4GJSA 1LPJA 4AYHA 4CDCA 1DC9A 3TZSA 4GDZA 1TW4A 2LBAA 4QYPA 5HCDC 3U9PC 4BJ8A 1HBPA 3PH5A 2DJFA 4I9SA 4JNJA 1HN2A 3APVA 3FLLA 4ID2A 5EPQA 4CK4A 3OE3A 2I5ZO 1VWLB 2A8GA 4JHQA 3PPTA 5HTDA 5D45A 1NBXA 3Q6LA 1B0OA 2P8GA 1I06A 5L8IA 3HWDA 2OVEA 4Z2PA 4ARHA 5KIDA 1VWNB 2F09A 1SRGA 2IZBA 2IZIA 3ZUIA 2YG2A 3SLJA 1STPA 4OEMA 3VHMA 3WJBA 1EIIA 4AZNA 3SAOA 2A5CA 1JQPA 4U8UN 2OZQA 1NQMA 1TVQA 2JU8A 1OPAA 1RXHA 2IZKA 2OL6O 2WWPA 3F9DA 3ZW0A 3PDFA 1ZNGA 4B55A 3TGBA 5FAZA 4D6BA 2HMBA 3WYQA 5B3MO 1MVGA 1SLEB 4CV7A 2FR2A 4YCHA 2JW1A 5H9NA 3KFHA 1GT1A 3C76X 1KL3A 2QO5A 4NNTA 5F1EA 5F7GA 4A1HA 3O22A 4CDDA 3GAQA 5HZ5A 4MVEA 4XMDA 3G7XA 3PECA 5EDBA 3WJFA 4CPHA 3BS2A 1LFOA 1N43A 2KTSA 3QQ2A 1LDOA 4OMWA 4ORUA 5H8TA 5IRAA 3HWFA 3T1DA 2C4IA 2F01A 3NQ9A 1PEEA 4U8UO 1CBQA 1SRFA 5H9AA 2IZDB 1YWAA 1RSTB 1LIEA 2G78A 1FE3A 1NGLA 1SWLA 3C78X 1VWAB 5HCEC 3STNA 3V8UA 5BYPA 2QCBA 5L8OA 4ZGFA 3TF6A 1EALA 2BS5A 2L9CA 2K23A 5D8JA 3VG5A 1KL4A 1YWCA 1STSB 1RXJA 4RUNA 4AZPA 1SY3A 1BRPA 3AKMA 1BSYA 2PFRA 3LTWA 3S5VA 1W5RA 2I5VO 4CPIA 3ZUOA 2Q39A 3ZW0B 3WJDA 2A5BA 1SWAA 5B29A 4NW4A 1SY2A 4GZVA 3STMX 4IBAA 4Y0QA 4BQUA 1IW2A 1HBQA 2VFBA 1KQXA 1YP6A 1DF3A 3L4RA 5JD2A 1ZNKA 3X00A 5C0NA 1SWRA 1GXAA 2ZSCA 2KW1A 1BLRA 2OFBA 1MM9A 1OPBA 4YGHA 2WEXA 3WJEA 4BX5A 2FS7A 5K67A 1FTPA 3PP6A 4ORXA 1JMXA 4WHIA 3WZNA 3RWXA 3P6CA 2RTOB 4ZH9A 1YP7A 3LV4A 1GT5A 1N0SA 1Z24A 3VG4A 1D3SA 1JJXA 2FHLA 1SLDB 3FIDA 4IMOA 4NLIA 1AVDA 1N4JA 2RTKA 4NP1A 2BHVA 3ZW1A 2YMSA 1RXKA 3RDQA 1SWNA 2JU7A 2AMMX 4C5PA 4MISA 2BLGA 2FS6A 1HY2A 1TOWA 2BC3A 3WJCA 2O62A 4YFRA 1SWFA 2FHNX 1E2TA 1JMZA 2XKLA 1JBHA 1B56A 4NV7A 4HFOA 2IZFB 2HNXA
chains in the Genus database with same CATH topology
2BDLA 4I07A 2DCCA 1U9QX 2XU5A 2AU1A 2YJCA 3V6CA 1YK8A 1KFUL 2VHSA 1SP4B 2FRAA 1THEA 1NQCA 3DF0A 1VJVA 4OELA 2HHNA 1CPJA 1PE6A 4P6GA 2FYEA 3WXEA 2E03A 1TL9A 2OULA 3H7DA 3O1GA 3OISA 4N8WA 3KFQA 3N3KA 3QSDA 3BCNA 4CDFB 2AYNA 1F2CA 2CB5A 2PBHA 3CBJA 5J94A 1GX3A 1F2BA 1TU6A 3V6EA 1EWOA 1KFXL 1QDQA 2P0RA 3IUTA 2ACTA 1QMYA 1BQIA 3WXFA 1QXPA 3KKUA 1GMYA 3S3QA 1CVZA 1W4TA 1CS8A 1GLOA 4W4UA 5JA7A 1O0EA 3I06A 2VHFA 2P7UA 3E1ZB 2DZYA 3P5WA 1ITOA 2IPPB 2CIOA 2DC7A 3IV2A 1KXRA 2GFOA 4YYQA 2YJ8A 1YALA 2E01A 2GHUA 3ZUAA 4X6IA 4KLBA 2AYOA 2FTDA 2DZZA 4MSXA 3PNRA 1AU2A 1DEUA 1ME4A 1VSNA 2O6XA 3KWBX 3KSEA 5CVNB 1W6FA 4QH6A 3LFYA 1SNKA 2HXZA 2E00A 1AECA 3K9MA 1NL6A 4YVAA 1EF7A 4RY2A 2R6NA 3K8UA 1TLOA 2PNSA 1GCBA 1MIRA 3M99A 6PADA 2F7DA 1EWLA 2FUDA 1AU4A 1PCIA 2DCDA 2R9NA 3MTNA 4ZUXU 5CVOB 2B1NA 2DC6A 3OVZA 5JH3A 2YJ2A 2AS8A 2XU3A 2P86A 4PI3A 3CH3X 3IOQA 2YJ9A 3MORA 3QJ3A 2OZ2A 3BC3A 2G6DA 2G8EA 4QRXA 3U8EA 3HHAA 3F75A 4FK5A 1MEMA 3H8BA 2PREA 3MHHA 1ICFA 1MDWA 2NQDB 3CH2X 1CQDA 4PP1A 2BSZA 3PBHA 2ARYA 1EWPA 2R9OA 4DMXA 1DF0A 1PPOA 1Y4HA 1PPPA 8PCHA 1IWDA 3P5XA 1Q6KA 4PP2E 1AYWA 1F2AA 1PPNA 2HH5A 4BS5A 3NHEA 2R9CA 3KW9A 1YT7A 1BP4A 1Y08A 4GUZA 3CBKA 2JQGR 3MHSA 3BWKA 2R9MA 2OP3A 1NB5A 5EF4A 1ME3A 3F5VA 1U9WA 1ZCMA 1ZIVA 3RVXA 3ERVA 2DC8A 2Y6EA 5K16A 1MHWA 1GECE 1XKGA 2R9FA 5CHTA 7PCKA 4BGFA 4WA6A 1U5IA 4YYRA 3N4CA 4N4ZA 3H89A 3GCBA 1NPZA 4Q8GA 4P6EA 5CHVA 1FH0A 1PIPA 3BPMA 3BOWA 4YV8A 1QOLA 4CZWA 4DMYA 3KX1A 3OF9A 4YYWA 1KHPA 2PADA 4HWYA 9PAPA 2FT2A 3B79A 1YVBA 3D6SA 4QRVA 2DC9A 1BY8A 1YK7A 1S4VA 3K24A 3IHPA 4AXLA 3D9WA 1HUCB 1U9VA 2E02A 2NQIA 1PPDA 1X9YA 3P5VA 4CDCB 4K7CA 3RVWA 1KHQA 2F1GA 2B1MA 1CB5A 4YYVA 1CSBB 4NV8A 4XR7A 3C9EA 4G54A 2XU4A 4BQVA 1F29A 1EWMA 4I05A 5FPWA 4N79A 2FRQA 1AYUA 4BS6A 5CVMA 1NB3A 1AU3A 2C0YA 2G7YA 1CJLA 2Y5BA 2DJFB 4XUIA 1POPA 3HWNA 4BPVA 3USVA 5PADA 2AUZA 2NQAA 3IEJA 1AIMA 4CDDB 2XU1A 3OVXA 3OF8A 3S3RA 2VFCA 2NQGA 2WBFX 3AI8A 4QRGA 1K3BB 4FJCA 3WXGA 3LXSA 2FO5A 3KWZA 2DCAA 3IMAA 4PADA 3RVVA 3TNXA 4FIPA 2BDZA 1ATKA 4OEMA 2ATOA 1JQPA 2HD5A 4QBBA 4Q8HA 3PDFA 5A24A 2AVWA 4I04A 4B55A 1MS6A 4AXMA 1BGOA 3O0UA 3HHIA 1A6RA 1U9XA 4W5CA 1PADA 1M6DA 4BSQA 2IBIA 4YYSA 3H8CA 3PW3A 1AU0A 4W5BA 3P5UA 2JQFR 2G8JA 3LTWA 1CTEA 1W5RA 2DCBA 4X6JA 3HD3A 4CDEB 1STFE 3N3GA 3QT4A 1CV8A 2YJBA 2VFBA 2H7JA 2AIMA 4MZSA 2AUXA 4MZOA 2FQ9A 1PXVA 4X6HA 1PBHA 3BPFA 5F02A 1AYVA 4YYUA 3H6SA 4C5PA 1MEGA 2DJGB 1E2TA 5EGWA 1NLJA 3I3TA 4NV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NV8 A;  4NV7 A;  1GX3 A;  4B55 A;  1E2T A;  2VFC A;  4C5P A;  3D9W A;  1W4T A;  2BSZ A;  3LTW A;  4GUZ A;  1W6F A;  1W5R A;  4BGF A;  2VFB A; 
#chains in the Genus database with same CATH topology
 2A13 A;  1YIV A;  1SWD A;  1EUO A;  3NQK A;  4IAB A;  2X46 A;  3EBK A;  3HTY A;  1IFC A;  1LCW A;  2Y3E A;  4GGR A;  4IRW A;  1CBS A;  5HZ6 A;  5LJG A;  3MBT A;  2QO6 A;  1LCV A;  5AJB A;  3SZJ A;  1WUB A;  4U8U M;  1S2P A;  3VE2 A;  4XMF A;  3CQR A;  3HPE A;  4GDA A;  4GK9 A;  1QQS A;  5B10 O;  4ALO A;  1YWB A;  2ANS A;  2BS6 A;  2MO5 A;  2IZA A;  5EEE A;  2C1S A;  3KFI A;  2IZC B;  4L3R A;  4OEL A;  3VG3 A;  1VYG A;  1HXL A;  1JJJ A;  3D95 A;  1IFB A;  1SWJ A;  2HLV A;  3UEU A;  2WPU A;  2QM9 A;  2AT3 X;  3FR5 A;  3P6D A;  3TGC A;  1NP4 A;  3SLT A;  1GM6 A;  4I3B A;  4COT A;  2WEW A;  4CPH B;  4O3X B;  1VWK B;  1VWC B;  4BX7 A;  2AT0 X;  3VG6 A;  3P6H A;  1SWB A;  3C77 X;  5EED A;  1T68 X;  1HXZ A;  4MVL A;  4ORW A;  3UEW A;  4QZU A;  3D97 A;  1VWM B;  1FEM A;  1MX7 A;  1K3B A;  4Y5D A;  2JMB A;  4O4U A;  4YBU A;  4ZJ0 A;  1GT3 A;  1KT6 A;  2GJ5 A;  1PMP A;  4KH8 A;  1VPR A;  4FGI B;  5B27 A;  1MUP A;  2AH7 X;  1I4U A;  2FTB A;  2R74 A;  3DSZ A;  3FEN A;  4MVI A;  4QZT A;  4TNN A;  1B8E A;  2X32 A;  3QKG A;  3TGA A;  4Y0S A;  1KGL A;  2RD7 C;  2X45 A;  4XMC A;  2RTB B;  2RTL A;  4HWM A;  1A57 A;  1T0V A;  1LEL A;  1HQP A;  2NND A;  2OY1 O;  3FA6 A;  2MJI A;  2RTP B;  4FBV A;  4ZFX A;  4EEJ A;  1E02 A;  1E00 A;  2MHD A;  2X56 A;  1SWP A;  3CQN A;  3FEK A;  4GNY A;  1L6M A;  3RDS A;  1KL5 A;  3D4R A;  4A1Y A;  3BRN A;  3ZWE A;  4ZHF A;  1GX3 A;  1QFV A;  2RTH B;  3RDX A;  1JIW I;  1SXW A;  4LKP A;  3ZQ3 A;  1SY0 A;  3JSQ A;  3RDM A;  5LJK A;  2RTG B;  3SLO A;  1RSU B;  3ZZV A;  3WZO A;  1RLB E;  2N93 A;  3EW2 A;  4LZV A;  5LKF A;  2OY8 A;  5IO6 A;  1U18 A;  4ORR A;  4QGX A;  4KT5 A;  3CBC A;  3E3C A;  1QWD A;  2GTF X;  1SWO A;  1N9Y A;  4GET A;  1VYO A;  4WFV A;  4ORY A;  3KZA A;  1AB0 A;  1XKI A;  2HKD A;  5BVT A;  3IA8 A;  1O1V A;  1SWQ A;  1CRB A;  2A0A A;  2IZL B;  1W4T A;  4IB8 A;  4MEE A;  3ELX A;  1GX8 A;  2WQA E;  4N7D A;  3S60 A;  2Q2P A;  3VG7 A;  4CPF A;  5CHK A;  1IKJ A;  1I9H A;  4U9C A;  1UYN X;  1SA8 A;  4DMO A;  2OFM X;  1X71 A;  3ZI8 A;  4UU2 A;  1UZ2 X;  4YDB A;  1CBR A;  4QRL A;  1SWH A;  4GGT A;  2Q4N A;  3P6F A;  4TKJ A;  3I0A A;  4RUU A;  4WFU A;  3WVM A;  4BBO A;  4EFG A;  1LCZ A;  2RTC B;  1GT4 A;  1NQN A;  2PI3 O;  4I6S A;  1ERB A;  5B2A O;  5B5G A;  2ZAI A;  1LIC A;  1BRQ A;  3CWK A;  3NP1 A;  3WBG A;  4Z2O A;  3EM0 A;  4U3Q A;  2OY7 A;  3T2X A;  2RTE B;  2ACO A;  1ZND A;  2IJA A;  5LJE A;  4Z6J A;  1PBY A;  2X8S A;  3LNB A;  1NC9 A;  3UEV A;  5FQ6 E;  1SWG A;  3WJG A;  1SMP I;  3FA7 A;  1Y9L A;  1SY1 A;  3O2Y A;  1EI5 A;  1GKA B;  2LBV A;  4XME A;  2VDF A;  1BM5 A;  4K19 A;  1N7Y A;  5IRU A;  2JU3 A;  3AKN A;  2CM4 A;  1O1U A;  4ZHD A;  2AL0 X;  1QY0 A;  5AJC A;  4CPE A;  4OS0 A;  1G7N A;  1WBI A;  1W6F A;  3RDO A;  2LA7 A;  2JOZ A;  3BSZ E;  3DTQ A;  1I05 A;  4NYQ A;  4GNW A;  4YFP A;  3SZI A;  1MX8 A;  1SRE A;  1HMS A;  1EW3 A;  2POA A;  4MIR A;  2M4L A;  2RQ0 A;  1Y53 X;  1ICN A;  2CAM A;  2X55 A;  1X8N A;  1S7D A;  1SWU A;  3EYC A;  1Y9T A;  3WOV A;  5B5F A;  3WXQ A;  3FA8 A;  3PQS A;  2LFO A;  3HK1 A;  5FQ8 E;  1QG5 A;  1RBP A;  1STR B;  2IZJ A;  3B2L A;  4FQB B;  3RSW A;  5D47 A;  2OVA A;  2RTR B;  2CBR A;  2MWH A;  4QNI A;  4QAE A;  1FJ1 E;  5HBS A;  4O4X A;  1EIO A;  1BJ7 A;  4HPA A;  2RTA A;  4AW8 A;  1VYF A;  4BX6 B;  1U17 A;  4CDF A;  3KQ0 A;  4AZR A;  3T6F A;  5HTE A;  1P6P A;  1DF8 A;  1KQW A;  2GTL M;  1VWP B;  2DM5 A;  2PY1 A;  1SLG B;  2FLJ A;  5D4A A;  1G5W A;  1ALB A;  1KZX A;  1SWS A;  1VWD B;  2QO4 A;  4DNE A;  2QMI A;  3MM0 A;  1R0U A;  3FIQ A;  2JN3 A;  5EZ2 A;  1KFF A;  2HZR A;  4TLJ A;  4NLJ A;  2AKQ A;  1MK5 A;  2GC9 A;  4EQA C;  4I95 A;  4O4O A;  4ZHG A;  1DFV A;  1S44 A;  4A60 A;  1OEK A;  3CKF A;  1EXS A;  4I9R A;  1AVE A;  3RE5 A;  5KHP A;  4JGL A;  2OYB O;  1SRH A;  3U03 A;  1YWD A;  3STK A;  1U0X A;  3P6G A;  1IKE A;  1EPB A;  3VHI A;  4ALB A;  1RAV A;  1VWR B;  4YKM A;  2RTN B;  1LIF A;  1N9M A;  3HWG A;  3NBX X;  5CSE A;  2KT4 B;  3RY2 A;  4ZGU A;  5DG4 A;  1ICM A;  1LIB A;  1VWE B;  2C1Q A;  4HPC A;  4YCE A;  3APU A;  4Y0R A;  5IXG A;  2RTJ A;  2OFA A;  4HPD A;  4ZR2 A;  3O19 A;  3VU1 A;  4N7C A;  5LJC A;  2FT9 A;  3AUM O;  4ZHH A;  4DCB A;  4FBO A;  3PQU A;  4Y0P A;  1DZK A;  3D96 A;  2BT9 A;  2BSZ A;  4YDA A;  5AQ6 A;  2RCQ A;  1MEP A;  3APW A;  4GRJ A;  5BVS A;  2RTQ B;  1NP1 A;  2OVD A;  3KFF A;  1XCA A;  4GE1 A;  4INN A;  4XMH A;  3F6Z B;  2W2A A;  2W2F A;  3BU9 A;  5HZ8 A;  2JGS A;  5LJB A;  1VWJ B;  2FKJ A;  1OBQ A;  3ELZ A;  1MOY A;  3APX A;  3Q34 A;  4O3Z A;  2Y32 A;  3VPJ E;  5HWZ A;  5H9L A;  2F73 A;  3B2K A;  2XST A;  4HPB A;  2AVI A;  2RTF B;  2IZE B;  3OJY C;  4QQ1 A;  2A3F X;  1ML7 A;  1SRJ A;  1I78 A;  2OFR X;  1FDQ A;  4GH7 A;  3FR2 A;  3EC5 A;  4YGZ A;  3RZY A;  2ZAG A;  4BX7 B;  4AZM A;  1SWK A;  2NP1 A;  2EU7 X;  3BY0 A;  1LNM A;  1VWF B;  4GUZ A;  5FQ7 E;  2IZG B;  2OF8 A;  5LJH A;  2Z4H A;  2MM3 A;  3RE6 A;  4QGW A;  4FBR A;  3S5X A;  3NX1 A;  4OKA A;  2K62 A;  1A3Y A;  2GH7 A;  4XMG A;  1KT3 A;  2Z4I A;  3MVF A;  4IAW A;  1O8V A;  3EMM A;  3RY1 A;  4DQ3 A;  3JS1 A;  1KXO A;  4O3Y A;  2RA6 A;  2GTL O;  4ES7 A;  3B2J A;  4I60 A;  3UAQ A;  1X8U A;  5LKE A;  2X8F A;  3WZQ A;  1OBU A;  2MF6 A;  3CMP A;  2WSJ A;  5HZQ A;  1JZU A;  1TXL A;  2R56 A;  3BX7 A;  4BVM A;  1KT7 A;  4O4S A;  3NPO A;  1BSO A;  4M7M A;  1PTS A;  2OVS A;  3UEX A;  5H9K A;  2OL7 A;  2AF5 A;  2A2U A;  4OMX A;  4YMY A;  4ZCB A;  4EDE A;  3PH6 A;  1AQB A;  2QOM A;  1SXU A;  2CM9 A;  1ERX A;  1Y0G A;  2QOS C;  4I3D A;  4EKV A;  1E06 A;  5IO5 A;  1VWO B;  1QY2 A;  3VHH A;  4DQ4 A;  3CR6 A;  1AVG I;  2RTI B;  4WBK A;  4BGF A;  4KC7 A;  5HZ9 A;  3WYP A;  5K06 A;  4OS8 A;  5D48 A;  2FWV A;  1JJU A;  1ACD A;  3FEL A;  1BSQ A;  5F2B A;  4YVB A;  3RBY A;  2OF9 A;  1EPA A;  2UYW A;  4O3W A;  1CJ5 A;  5K68 A;  1KT5 A;  1LF7 A;  4AZO A;  3AEH A;  1MDC A;  2UZ2 A;  1PM1 X;  1SWT A;  3BDR A;  4NNS A;  1IJ8 A;  4BX6 A;  4O9S A;  3RDU A;  4Z27 A;  1FEL A;  3OD9 A;  2FR3 A;  3T2W A;  1A18 A;  2ALL X;  1TOU A;  2RCT A;  4OS3 A;  1B4M A;  1G85 A;  5F58 A;  4QYN A;  1QAB E;  3BX8 A;  3HOE A;  4MVK A;  3HOL A;  1BEB A;  2X4M A;  3B2I A;  4YH0 A;  1IIU A;  1ZRY A;  3RKG A;  5HAE A;  4D6A A;  2G8C O;  5IRW A;  1HMR A;  3P6E A;  2L67 A;  3FW5 A;  3N91 A;  3CBS A;  1K24 A;  3NQ3 A;  1AEL A;  1SWE A;  2IZH B;  5LJD A;  3BLG A;  5JR8 A;  2W2B A;  1URE A;  2CZU A;  3I17 A;  1BBP A;  3MG5 A;  1SXY A;  1OSP O;  1Y55 X;  2RTD B;  3FYF A;  1ZNL A;  4YKO A;  1A2D A;  3CKG A;  1GKA A;  3OBL A;  2CZT A;  4IMN A;  3ZW2 A;  5FEN A;  4GD9 A;  4BOE A;  4Z2V A;  1D2U A;  2ASN X;  4UU3 A;  5CYB A;  1JV4 A;  1KOI A;  3FR4 A;  3K3L A;  3LHN A;  3F8A A;  1LID A;  4KCA A;  3S26 A;  3VE1 A;  4CSB A;  1OEJ A;  1GX9 A;  3FMZ A;  5F6B A;  3SOT A;  1YUP A;  4TKB A;  2AT8 X;  1DZJ A;  2Q9S A;  4Z28 A;  1LKE A;  1X89 A;  3EW1 A;  4IB9 A;  3B2H A;  4TQ2 A;  2LKK A;  4IB7 A;  1OEE A;  1QY1 A;  1UYO X;  4JO6 A;  4LZU A;  4PJ2 A;  2CBS A;  3D9W A;  2DJG A;  5L3Y A;  2IFB A;  2ACP X;  2G7B A;  2WUT A;  3P02 A;  1I04 A;  3P24 A;  1E5P A;  1VWQ B;  4YGG A;  3KVN A;  1DV9 A;  3FDC A;  4AZQ A;  4O49 A;  2LB6 A;  3JQO A;  1X8Q A;  4LQZ A;  2L5P A;  1KZW A;  4TJZ A;  5HCC C;  3WZP A;  3VG2 A;  5AEO A;  2G79 A;  1G74 A;  4EXZ A;  1GGL A;  2HYS A;  3FW4 A;  4GU8 A;  1FEN A;  2OY5 O;  4NV8 A;  4ML7 B;  4ODD A;  4TKH A;  5L8N A;  5BVQ A;  2PQT A;  3T6L A;  3FA9 A;  5B11 O;  1DZM A;  5CE4 A;  4A8Z A;  2WR6 A;  3GE2 A;  4I3C A;  3ZW1 B;  1VWB B;  1T8V A;  1KT4 A;  1Y52 X;  2KD2 A;  2GTL N;  4ZHC A;  4QGV A;  4ZH6 A;  1H91 A;  4CDE A;  4GJV A;  1DZP A;  4YBP A;  5F6Z A;  1JYJ A;  2X8T A;  1SWC A;  3MX7 A;  4R0B A;  2NNQ A;  1EQD A;  2WQ9 A;  3HWE A;  3FEP A;  1QFT A;  5KIC A;  1CBI A;  3SZH A;  3EBW A;  3IFB A;  3NX2 A;  2E4J A;  1VWI B;  2FRS A;  5EDC A;  1X8P A;  2OL8 O;  4NYR A;  4M6S A;  4BCS A;  1ZNH A;  3U0D A;  4U46 A;  4GGZ A;  4Y59 A;  2AT6 X;  1PBO A;  1SXX A;  1VWH B;  3H3I A;  4KC8 A;  2G5L A;  2Q2M A;  2A2G A;  2KTD A;  2RTM A;  4BX5 B;  1OBP A;  1SRI A;  2R73 A;  5HA0 A;  1HMT A;  5DPQ A;  1X8O A;  2FKG A;  2X34 A;  4IAX A;  1LUQ A;  3BU1 A;  1BWY A;  1NDJ A;  3PK2 A;  2NNE A;  2L68 A;  4YFQ A;  1VWG B;  2AT5 X;  2HZQ A;  1SLF B;  2VFC A;  4L1N A;  1HQQ A;  1JYD A;  3NAD A;  4GKC A;  3VGW A;  3KFG A;  1ZNE A;  3PED A;  4PSQ A;  2FGS A;  2RN4 A;  4LKT A;  5FFH A;  1LDQ A;  4IB6 A;  5HA1 A;  4KII A;  1ADL A;  4ON1 A;  3NR3 A;  4ORS A;  5IO7 A;  2Y3F A;  4GJS A;  1LPJ A;  4AYH A;  4CDC A;  1DC9 A;  3TZS A;  4GDZ A;  1TW4 A;  2LBA A;  4QYP A;  5HCD C;  3U9P C;  4BJ8 A;  1HBP A;  3PH5 A;  2DJF A;  4I9S A;  4JNJ A;  1HN2 A;  3APV A;  3FLL A;  4ID2 A;  5EPQ A;  4CK4 A;  3OE3 A;  2I5Z O;  1VWL B;  2A8G A;  4JHQ A;  3PPT A;  5HTD A;  5D45 A;  1NBX A;  3Q6L A;  1B0O A;  2P8G A;  1I06 A;  5L8I A;  3HWD A;  2OVE A;  4Z2P A;  4ARH A;  5KID A;  1VWN B;  2F09 A;  1SRG A;  2IZB A;  2IZI A;  3ZUI A;  2YG2 A;  3SLJ A;  1STP A;  4OEM A;  3VHM A;  3WJB A;  1EII A;  4AZN A;  3SAO A;  2A5C A;  1JQP A;  4U8U N;  2OZQ A;  1NQM A;  1TVQ A;  2JU8 A;  1OPA A;  1RXH A;  2IZK A;  2OL6 O;  2WWP A;  3F9D A;  3ZW0 A;  3PDF A;  1ZNG A;  4B55 A;  3TGB A;  5FAZ A;  4D6B A;  2HMB A;  3WYQ A;  5B3M O;  1MVG A;  1SLE B;  4CV7 A;  2FR2 A;  4YCH A;  2JW1 A;  5H9N A;  3KFH A;  1GT1 A;  3C76 X;  1KL3 A;  2QO5 A;  4NNT A;  5F1E A;  5F7G A;  4A1H A;  3O22 A;  4CDD A;  3GAQ A;  5HZ5 A;  4MVE A;  4XMD A;  3G7X A;  3PEC A;  5EDB A;  3WJF A;  4CPH A;  3BS2 A;  1LFO A;  1N43 A;  2KTS A;  3QQ2 A;  1LDO A;  4OMW A;  4ORU A;  5H8T A;  5IRA A;  3HWF A;  3T1D A;  2C4I A;  2F01 A;  3NQ9 A;  1PEE A;  4U8U O;  1CBQ A;  1SRF A;  5H9A A;  2IZD B;  1YWA A;  1RST B;  1LIE A;  2G78 A;  1FE3 A;  1NGL A;  1SWL A;  3C78 X;  1VWA B;  5HCE C;  3STN A;  3V8U A;  5BYP A;  2QCB A;  5L8O A;  4ZGF A;  3TF6 A;  1EAL A;  2BS5 A;  2L9C A;  2K23 A;  5D8J A;  3VG5 A;  1KL4 A;  1YWC A;  1STS B;  1RXJ A;  4RUN A;  4AZP A;  1SY3 A;  1BRP A;  3AKM A;  1BSY A;  2PFR A;  3LTW A;  3S5V A;  1W5R A;  2I5V O;  4CPI A;  3ZUO A;  2Q39 A;  3ZW0 B;  3WJD A;  2A5B A;  1SWA A;  5B29 A;  4NW4 A;  1SY2 A;  4GZV A;  3STM X;  4IBA A;  4Y0Q A;  4BQU A;  1IW2 A;  1HBQ A;  2VFB A;  1KQX A;  1YP6 A;  1DF3 A;  3L4R A;  5JD2 A;  1ZNK A;  3X00 A;  5C0N A;  1SWR A;  1GXA A;  2ZSC A;  2KW1 A;  1BLR A;  2OFB A;  1MM9 A;  1OPB A;  4YGH A;  2WEX A;  3WJE A;  4BX5 A;  2FS7 A;  5K67 A;  1FTP A;  3PP6 A;  4ORX A;  1JMX A;  4WHI A;  3WZN A;  3RWX A;  3P6C A;  2RTO B;  4ZH9 A;  1YP7 A;  3LV4 A;  1GT5 A;  1N0S A;  1Z24 A;  3VG4 A;  1D3S A;  1JJX A;  2FHL A;  1SLD B;  3FID A;  4IMO A;  4NLI A;  1AVD A;  1N4J A;  2RTK A;  4NP1 A;  2BHV A;  3ZW1 A;  2YMS A;  1RXK A;  3RDQ A;  1SWN A;  2JU7 A;  2AMM X;  4C5P A;  4MIS A;  2BLG A;  2FS6 A;  1HY2 A;  1TOW A;  2BC3 A;  3WJC A;  2O62 A;  4YFR A;  1SWF A;  2FHN X;  1E2T A;  1JMZ A;  2XKL A;  1JBH A;  1B56 A;  4NV7 A;  4HFO A;  2IZF B;  2HNX A; 
#chains in the Genus database with same CATH homology
 2BDL A;  4I07 A;  2DCC A;  1U9Q X;  2XU5 A;  2AU1 A;  2YJC A;  3V6C A;  1YK8 A;  1KFU L;  2VHS A;  1SP4 B;  2FRA A;  1THE A;  1NQC A;  3DF0 A;  1VJV A;  4OEL A;  2HHN A;  1CPJ A;  1PE6 A;  4P6G A;  2FYE A;  3WXE A;  2E03 A;  1TL9 A;  2OUL A;  3H7D A;  3O1G A;  3OIS A;  4N8W A;  3KFQ A;  3N3K A;  3QSD A;  3BCN A;  4CDF B;  2AYN A;  1F2C A;  2CB5 A;  2PBH A;  3CBJ A;  5J94 A;  1GX3 A;  1F2B A;  1TU6 A;  3V6E A;  1EWO A;  1KFX L;  1QDQ A;  2P0R A;  3IUT A;  2ACT A;  1QMY A;  1BQI A;  3WXF A;  1QXP A;  3KKU A;  1GMY A;  3S3Q A;  1CVZ A;  1W4T A;  1CS8 A;  1GLO A;  4W4U A;  5JA7 A;  1O0E A;  3I06 A;  2VHF A;  2P7U A;  3E1Z B;  2DZY A;  3P5W A;  1ITO A;  2IPP B;  2CIO A;  2DC7 A;  3IV2 A;  1KXR A;  2GFO A;  4YYQ A;  2YJ8 A;  1YAL A;  2E01 A;  2GHU A;  3ZUA A;  4X6I A;  4KLB A;  2AYO A;  2FTD A;  2DZZ A;  4MSX A;  3PNR A;  1AU2 A;  1DEU A;  1ME4 A;  1VSN A;  2O6X A;  3KWB X;  3KSE A;  5CVN B;  1W6F A;  4QH6 A;  3LFY A;  1SNK A;  2HXZ A;  2E00 A;  1AEC A;  3K9M A;  1NL6 A;  4YVA A;  1EF7 A;  4RY2 A;  2R6N A;  3K8U A;  1TLO A;  2PNS A;  1GCB A;  1MIR A;  3M99 A;  6PAD A;  2F7D A;  1EWL A;  2FUD A;  1AU4 A;  1PCI A;  2DCD A;  2R9N A;  3MTN A;  4ZUX U;  5CVO B;  2B1N A;  2DC6 A;  3OVZ A;  5JH3 A;  2YJ2 A;  2AS8 A;  2XU3 A;  2P86 A;  4PI3 A;  3CH3 X;  3IOQ A;  2YJ9 A;  3MOR A;  3QJ3 A;  2OZ2 A;  3BC3 A;  2G6D A;  2G8E A;  4QRX A;  3U8E A;  3HHA A;  3F75 A;  4FK5 A;  1MEM A;  3H8B A;  2PRE A;  3MHH A;  1ICF A;  1MDW A;  2NQD B;  3CH2 X;  1CQD A;  4PP1 A;  2BSZ A;  3PBH A;  2ARY A;  1EWP A;  2R9O A;  4DMX A;  1DF0 A;  1PPO A;  1Y4H A;  1PPP A;  8PCH A;  1IWD A;  3P5X A;  1Q6K A;  4PP2 E;  1AYW A;  1F2A A;  1PPN A;  2HH5 A;  4BS5 A;  3NHE A;  2R9C A;  3KW9 A;  1YT7 A;  1BP4 A;  1Y08 A;  4GUZ A;  3CBK A;  2JQG R;  3MHS A;  3BWK A;  2R9M A;  2OP3 A;  1NB5 A;  5EF4 A;  1ME3 A;  3F5V A;  1U9W A;  1ZCM A;  1ZIV A;  3RVX A;  3ERV A;  2DC8 A;  2Y6E A;  5K16 A;  1MHW A;  1GEC E;  1XKG A;  2R9F A;  5CHT A;  7PCK A;  4BGF A;  4WA6 A;  1U5I A;  4YYR A;  3N4C A;  4N4Z A;  3H89 A;  3GCB A;  1NPZ A;  4Q8G A;  4P6E A;  5CHV A;  1FH0 A;  1PIP A;  3BPM A;  3BOW A;  4YV8 A;  1QOL A;  4CZW A;  4DMY A;  3KX1 A;  3OF9 A;  4YYW A;  1KHP A;  2PAD A;  4HWY A;  9PAP A;  2FT2 A;  3B79 A;  1YVB A;  3D6S A;  4QRV A;  2DC9 A;  1BY8 A;  1YK7 A;  1S4V A;  3K24 A;  3IHP A;  4AXL A;  3D9W A;  1HUC B;  1U9V A;  2E02 A;  2NQI A;  1PPD A;  1X9Y A;  3P5V A;  4CDC B;  4K7C A;  3RVW A;  1KHQ A;  2F1G A;  2B1M A;  1CB5 A;  4YYV A;  1CSB B;  4NV8 A;  4XR7 A;  3C9E A;  4G54 A;  2XU4 A;  4BQV A;  1F29 A;  1EWM A;  4I05 A;  5FPW A;  4N79 A;  2FRQ A;  1AYU A;  4BS6 A;  5CVM A;  1NB3 A;  1AU3 A;  2C0Y A;  2G7Y A;  1CJL A;  2Y5B A;  2DJF B;  4XUI A;  1POP A;  3HWN A;  4BPV A;  3USV A;  5PAD A;  2AUZ A;  2NQA A;  3IEJ A;  1AIM A;  4CDD B;  2XU1 A;  3OVX A;  3OF8 A;  3S3R A;  2VFC A;  2NQG A;  2WBF X;  3AI8 A;  4QRG A;  1K3B B;  4FJC A;  3WXG A;  3LXS A;  2FO5 A;  3KWZ A;  2DCA A;  3IMA A;  4PAD A;  3RVV A;  3TNX A;  4FIP A;  2BDZ A;  1ATK A;  4OEM A;  2ATO A;  1JQP A;  2HD5 A;  4QBB A;  4Q8H A;  3PDF A;  5A24 A;  2AVW A;  4I04 A;  4B55 A;  1MS6 A;  4AXM A;  1BGO A;  3O0U A;  3HHI A;  1A6R A;  1U9X A;  4W5C A;  1PAD A;  1M6D A;  4BSQ A;  2IBI A;  4YYS A;  3H8C A;  3PW3 A;  1AU0 A;  4W5B A;  3P5U A;  2JQF R;  2G8J A;  3LTW A;  1CTE A;  1W5R A;  2DCB A;  4X6J A;  3HD3 A;  4CDE B;  1STF E;  3N3G A;  3QT4 A;  1CV8 A;  2YJB A;  2VFB A;  2H7J A;  2AIM A;  4MZS A;  2AUX A;  4MZO A;  2FQ9 A;  1PXV A;  4X6H A;  1PBH A;  3BPF A;  5F02 A;  1AYV A;  4YYU A;  3H6S A;  4C5P A;  1MEG A;  2DJG B;  1E2T A;  5EGW A;  1NLJ A;  3I3T A;  4NV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...