3LTWA

The structure of mycobacterium marinum arylamine n-acetyltransferase in complex with hydralazine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylamine N-acetyltransferase Nat
publication title Probing the architecture of the Mycobacterium marinum arylamine N-acetyltransferase active site
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 83
structure length 272
sequence length 272
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 3ltwA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 3ltwA01
2BSZA 1W6FA 4B55A 1W5RA 4GUZA 4BGFA 3LTWA 4NV8A 2VFBA 4C5PA 1E2TA 1GX3A 1W4TA 3D9WA 2VFCA 4NV7A
chains in the Genus database with same CATH superfamily
2ACPX 4OEMA 4CSBA 2RTAA 1A57A 2F01A 2OFMX 1DV9A 3B2JA 5CYBA 1RLBE 1PBOA 4OELA 5BVSA 2WPUA 3BRNA 1MVGA 4CDDA 3BY0A 1SXUA 1EI5A 2FKGA 3NPOA 3FW4A 4I3CA 5B2AO 1LIEA 4BCSA 4MVEA 3ZW2A 1LFOA 1EALA 3BLGA 1N0SA 5B10O 2QMIA 2OFBA 1LCZA 3NQKA 2RTJA 3FDCA 2K62A 1SLDB 2X45A 4GGTA 4U46A 3VPJE 4AYHA 1ZNGA 3EW1A 1WBIA 1HMSA 4NW4A 5LJHA 1ZRYA 2IZHB 2W2BA 3P6HA 4ALBA 1MDCA 1HN2A 5F6BA 4NV8A 1VWAB 5LJGA 3I17A 1HQPA 1ICMA 4IABA 1VPRA 4GJVA 4JGLA 4YFQA 2RTOB 2OYBO 4CDFA 4GRJA 3SLJA 2MO5A 1TXLA 3PQSA 1BSQA 1VWEB 1L6MA 1PMPA 1EPAA 1SWTA 3EMMA 3KFGA 2RN4A 1RSUB 2IZLB 2IZCB 3RZYA 4KH8A 5IXGA 4XMHA 3S26A 2Y3EA 1VWJB 1SWBA 4TQ2A 5HA0A 1E06A 1HXZA 1XKIA 2X4MA 2AT3X 3APUA 3TGAA 4ZH6A 3WOVA 2ACOA 2X8SA 5LJKA 4OS0A 3IFBA 1OBQA 3Q34A 1VYGA 1BM5A 3MG5A 1D3SA 1G85A 5F1EA 1T8VA 2HMBA 3G7XA 2IJAA 4OKAA 1CRBA 5FENA 2IZGB 5CSEA 1NBXA 3ZQ3A 3RY2A 4ZHGA 3ELZA 1N7YA 4BX6A 5L3YA 2ZAGA 2RTCB 1I78A 1KZXA 3O22A 3VG4A 1QQSA 4O3XB 3RE5A 4Z6JA 4YKMA 1GX3A 1EIOA 2VFCA 2XSTA 1TOWA 1JZUA 1EW3A 2RTPB 1CBRA 3X00A 1VWDB 4ZHDA 4Z2OA 3C78X 5FQ8E 5AEOA 4YDAA 5KHPA 4BX5A 1DZMA 3TGBA 3WBGA 3F6ZB 1NGLA 1VWPB 2IZBA 2IZEB 2RTRB 4L1NA 4O4UA 4QRLA 1GM6A 3SOTA 1ACDA 2GTFX 1B4MA 4DQ4A 1QFVA 2RTFB 2ZSCA 2VFBA 4IB7A 4N7CA 3LNBA 3RDMA 2RTLA 3FEPA 2QO5A 2WQ9A 4O4SA 1VWMB 5IRUA 1K24A 1LIFA 2NNEA 1ADLA 1GT4A 1SWPA 2K23A 2G7BA 3APWA 3FA7A 2VDFA 1KL3A 3SAOA 3SLTA 2IZIA 2PI3O 1MX8A 4DCBA 4OMXA 1JYJA 2ASNX 3FIDA 1PTSA 3C77X 1SRFA 2AT8X 4AZPA 1SY0A 1JMZA 1OEEA 1B0OA 1OEJA 1VWHB 2A5CA 3B2KA 2BC3A 2Q2MA 3HTYA 4M7MA 3TF6A 4CPFA 4U9CA 1KOIA 4ZH9A 4PSQA 3FENA 1N9YA 3KQ0A 2AVIA 3WZPA 1OBPA 2FHNX 5B5GA 3WYPA 1LIDA 3KZAA 4YVBA 1QFTA 2JMBA 4LKPA 1T68X 1DF3A 4I9RA 1GT1A 1TVQA 2OVSA 4CDEA 5B11O 3GAQA 5D48A 4BX7A 2RTNB 1SMPI 3WYQA 5EDBA 1SWQA 3FLLA 1YWAA 1SWOA 3MVFA 4IB8A 4TJZA 2RD7C 3V8UA 3F9DA 1I9HA 3HPEA 5HTEA 1X8OA 5H8TA 4BOEA 5FQ6E 2WR6A 1ICNA 5C0NA 4R0BA 3VHHA 5HZ5A 4WHIA 4GGZA 5EEDA 2CAMA 4QGXA 1SY2A 3BDRA 1W6FA 3STMX 3WZNA 3ZW1B 3JSQA 4NYQA 5F6ZA 2HZQA 2C1QA 4K19A 3CR6A 1G7NA 4O3WA 4PJ2A 2RTGB 1PM1X 4Y5DA 3VG5A 3ZI8A 1D2UA 3HWDA 1VWBB 4O4OA 2A13A 2I5ZO 2Y3FA 5HZ8A 1KZWA 2CBRA 5IO6A 3HWGA 4TKBA 1JYDA 4TKHA 4WFVA 2OFAA 1W4TA 2OF8A 1SWEA 3P6GA 4TKJA 4ARHA 3TGCA 3RDQA 2RA6A 2AT0X 5JD2A 3ZUOA 4YBPA 1Y55X 4ORRA 5KICA 2G78A 1STRB 3VE2A 3AKNA 3FELA 5LKEA 4B55A 2GJ5A 1FEMA 5LJDA 1SRHA 2RTBB 2G8CO 2IZJA 4YCHA 5HCDC 2LFOA 1ZNDA 3D4RA 4L3RA 4CPEA 2RTKA 2X55A 5HZ9A 1BRQA 1VWKB 2RTEB 4I3BA 1GX8A 1K3BA 1KFFA 2X34A 2Q2PA 1W5RA 3C76X 2FHLA 2GH7A 2A2UA 3K3LA 5HAEA 3NR3A 5IRWA 4IB6A 1O1UA 4IMNA 2JOZA 2JN3A 5JR8A 5K67A 2GTLO 3S5VA 1LCVA 1KQXA 2YMSA 5H9LA 4Y0PA 3BU1A 4U8UN 1CBIA 1IFCA 1IJ8A 1VWLB 2A3FX 3B2IA 3KVNA 2LBAA 1G74A 1Y52X 3L4RA 4I60A 1VWOB 4ZHCA 4NV7A 1STPA 4YCEA 2EU7X 4KT5A 3KFFA 4TLJA 2MJIA 5KIDA 1GX9A 2CM4A 4BGFA 4CV7A 5L8OA 2FLJA 1NP1A 4GH7A 2R74A 4IAXA 5CHKA 3VE1A 5D47A 5FQ7E 5BVTA 1BBPA 2RTMA 5IO5A 2JU8A 1VWCB 1Y53X 3D95A 2RCTA 3FR4A 3N91A 2AT5X 3PH6A 4I3DA 2HNXA 2MM3A 1U0XA 2RCQA 1SWNA 2Z4IA 4MVKA 2X8FA 2QOSC 4YGZA 1GKAB 3MM0A 2ANSA 2FGSA 4GKCA 3OBLA 2A2GA 1ZNEA 3EYCA 5H9KA 5IRAA 3TZSA 4GGRA 1NC9A 1JV4A 1RXHA 2AF5A 2FS7A 1HXLA 3RDSA 1MK5A 1MUPA 4AZRA 3CWKA 2HYSA 1VWRB 3FR2A 2WEWA 4N7DA 3U9PC 3RKGA 1SWCA 4ZHHA 5EDCA 3JQOA 5HCEC 3B2HA 4HPBA 4O9SA 4YFRA 4IB9A 4CK4A 1SRJA 2PY1A 1S2PA 3DSZA 1CBSA 2OFRX 2WSJA 3UAQA 4FQBB 5D4AA 5CE4A 4ML7B 5FFHA 2G5LA 1EPBA 1HBQA 3ZW1A 3FA8A 5H9AA 1VWGB 3HK1A 3AUMO 1SXYA 1DZJA 1IIUA 1CJ5A 1DZPA 1SWRA 4ZFXA 1TOUA 3ZW0B 1HBPA 1JQPA 1WUBA 3CBSA 2CZUA 3O19A 4RUNA 4U8UM 2OY5O 4GETA 5IO7A 3WVMA 4KC8A 1BRPA 1SWDA 2WWPA 2XKLA 1KQWA 1O8VA 1I06A 1SWUA 3EM0A 4ORSA 4JO6A 1BSOA 1KT4A 1UREA 2L5PA 3KFHA 4LZUA 3RDOA 2QM9A 1FDQA 2OL7A 2DM5A 2WEXA 3P02A 4KIIA 1DF8A 4EKVA 1X8NA 2CZTA 2OVAA 4GK9A 4Y0RA 2OZQA 2E4JA 2IZDB 3OJYC 2BT9A 1YIVA 2O62A 1T0VA 4KCAA 4XMEA 3RDUA 1TW4A 3ZWEA 3NX1A 1EIIA 2I5VO 4QQ1A 1BWYA 5AJBA 1PBYA 1LNMA 2LB6A 3CQNA 3D9WA 3S60A 1FJ1E 4NNSA 4D6BA 2Q9SA 2FR3A 1YWBA 1OBUA 4HPAA 4ORXA 3STNA 3P24A 1NDJA 4NYRA 4EEJA 1HMRA 4MIRA 3BU9A 2A8GA 1ZNLA 5K06A 2L68A 4GNYA 2YG2A 4JNJA 2IFBA 3BX8A 3EW2A 4EFGA 3BX7A 5HCCC 5B29A 4YGHA 2CBSA 4ORYA 1MOYA 4MVLA 1Z24A 4YDBA 2OF9A 1I05A 4AW8A 1KL5A 2BLGA 3NP1A 4ZJ0A 5F7GA 3DTQA 2HLVA 4EXZA 4Z2VA 4LQZA 3QQ2A 1SRGA 2FT9A 4AZNA 4I95A 1SY1A 2KT4B 3P6EA 5D8JA 4A60A 2PQTA 1N43A 3QKGA 4ODDA 3HWFA 4QGWA 4AZMA 4YMYA 1RXKA 2N93A 2L67A 1N9MA 5LJEA 1DZKA 1PEEA 4EDEA 4GE1A 5HZ6A 1X8PA 1YUPA 1JMXA 3FR5A 2GC9A 3D97A 4HPCA 3RDXA 1S44A 4EQAC 2WQAE 1LUQA 2LKKA 3PK2A 4ORUA 1RBPA 4HPDA 2P8GA 3FA6A 3LTWA 2OY1O 4O3ZA 5FAZA 4A1YA 4Z27A 4GJSA 4LKTA 2RTDB 3FIQA 3SZJA 4FBVA 4BX6B 3T6FA 3VHIA 1SREA 2OL6O 1AELA 4JHQA 1XCAA 2RTIB 2OVDA 2R56A 3KFIA 1AB0A 1Y0GA 1GGLA 1LKEA 3VG6A 1SLEB 4CDCA 2M4LA 1X8UA 3CKFA 3PPTA 1GT3A 3GE2A 3NX2A 4IMOA 1GXAA 1BLRA 3F8AA 3WJEA 4ZCBA 4ES7A 3VG7A 3B2LA 1SRIA 4D6AA 4QZUA 5B5FA 1KT6A 4O3YA 1JJUA 2JU3A 4HFOA 2X32A 3RSWA 1VWIB 3ZW0A 1MEPA 1ZNHA 2RTHB 3PDFA 4Y0SA 3HOLA 4GZVA 1NQMA 3ELXA 1LCWA 2FWVA 2JW1A 2LBVA 1KL4A 4Z28A 3STKA 1AVEA 1E02A 5EPQA 4KC7A 1KGLA 2G79A 1A3YA 1I4UA 1YWCA 3PH5A 2FTBA 3VG3A 3U0DA 1OPBA 1B8EA 2AT6X 4ZHFA 3WJDA 1JJXA 1I04A 2X46A 1KT7A 3ZZVA 1SWAA 1RSTB 4NLIA 5HTDA 1SXWA 1YP7A 2NP1A 3HOEA 4RUUA 4COTA 5B3MO 2KTSA 3Q6LA 4XMDA 3FEKA 4OS3A 2BHVA 1OPAA 1OSPO 4WBKA 2JGSA 3EBWA 2OVEA 1ML7A 1RAVA 2QOMA 1ALBA 3D96A 4UU3A 2ZAIA 1U18A 4IBAA 4QZTA 1CBQA 1QY1A 3AEHA 3BS2A 4Y59A 4CPHB 1ZNKA 2UYWA 4QYNA 1VYOA 4OS8A 1NP4A 1R0UA 3NQ3A 3P6DA 1EQDA 3FA9A 3PP6A 2BS5A 4ZGFA 2UZ2A 3MBTA 3LV4A 4QGVA 1SWFA 1N4JA 1BEBA 1ERXA 1FELA 1SWHA 2AMMX 1A2DA 3APVA 5F2BA 3SZIA 1IW2A 1HMTA 1AVGI 4QNIA 1U17A 4AZQA 4ORWA 4YH0A 1O1VA 3OD9A 3UEUA 1SWSA 2Z4HA 2X56A 4XMFA 4NNTA 1SA8A 3AKMA 5L8NA 1LDOA 5L8IA 1IFBA 1QY0A 4I9SA 4O49A 4BX7B 2IZAA 4OMWA 1MM9A 4ON1A 1LPJA 1SWJA 5D45A 3T6LA 3T2XA 3RY1A 4CPIA 5HA1A 3NADA 2DJFA 5B27A 1VYFA 2CM9A 3SLOA 4A1HA 1MX7A 1DFVA 3CMPA 3FMZA 4I6SA 5AJCA 4ZGUA 2MWHA 4INNA 1X89A 4GNWA 3BSZE 2JU7A 4GD9A 2KTDA 3P6FA 4BBOA 1IKEA 3MX7A 3S5XA 1Y9LA 2HKDA 3VHMA 3OE3A 2QO6A 1ERBA 4ALOA 1UYNX 1FENA 5DPQA 4DNEA 4XMCA 2MF6A 4LZVA 4DQ3A 2BS6A 1QWDA 3UEXA 4Z2PA 2ALLX 4BJ8A 4ID2A 3ZUIA 2QCBA 2AKQA 2F73A 4IRWA 3WXQA 2OL8O 4A8ZA 1NQNA 2FR2A 3UEWA 1GT5A 4XMGA 4DMOA 2FRSA 1G5WA 3PQUA 3T1DA 1UZ2X 1X8QA 3IA8A 1SLFB 1E2TA 2HZRA 1YP6A 3APXA 3I0AA 4AZOA 1JIWI 2NNQA 2GTLN 3EBKA 4FBOA 3CBCA 1KT5A 4YKOA 2KW1A 1E5PA 3LHNA 3U03A 4C5PA 1LDQA 1KXOA 1SY3A 4IAWA 1LELA 2QO4A 3UEVA 1P6PA 5LJCA 4U3QA 3RBYA 1OEKA 2OY8A 5K68A 1SWGA 4GU8A 2Q4NA 4GUZA 3WJFA 1QY2A 2PFRA 1AQBA 3EC5A 1Y9TA 2X8TA 3FW5A 2LA7A 3WJBA 5LJBA 3CKGA 1X71A 2A5BA 4NP1A 4UU2A 5AQ6A 4GDAA 1A18A 5HZQA 1HQQA 3O2YA 4BVMA 4U8UO 2NNDA 1DC9A 4FGIB 2F09A 2R73A 2RQ0A 5EEEA 5LKFA 5HBSA 4MEEA 1RXJA 2W2FA 1SWKA 2Q39A 2IZFB 2AH7X 1FE3A 2W2AA 3T2WA 4CPHA 1GKAA 4M6SA 1E00A 3WJGA 2OY7A 4QYPA 4YFPA 2AL0X 3CQRA 1SXXA 1VWNB 5HWZA 5F58A 1QABE 3RE6A 4BQUA 1YWDA 2DJGA 3H3IA 3NBXX 1BSYA 3PEDA 1SWLA 1EUOA 1FTPA 2IZKA 3RWXA 1QG5A 2Y32A 3VU1A 1H91A 2FKJA 2KD2A 2MHDA 2C4IA 4O4XA 1VWQB 1B56A 2C1SA 4GDZA 2FS6A 3NQ9A 4WFUA 1LF7A 5BVQA 1EXSA 3PECA 3WZOA 3VG2A 1LIBA 3HWEA 4HWMA 4Y0QA 4MVIA 3VGWA 1UYOX 2RTQB 2WUTA 3P6CA 2POAA 1HY2A 5H9NA 2GTLM 2BSZA 2L9CA 4MISA 1IKJA 1AVDA 3WJCA 4BX5B 1KT3A 4YGGA 5DG4A 4YBUA 1VWFB 4ZR2A 5BYPA 1STSB 1S7DA 3WZQA 3JS1A 4NLJA 1JBHA 1LICA 4FBRA 3E3CA 3FYFA 1BJ7A 2A0AA 1JJJA 4TNNA 5EZ2A 3SZHA 4QAEA 1SLGB
chains in the Genus database with same CATH topology
2HHNA 1ZCMA 2G8EA 4OEMA 2JQGR 1F29A 3IEJA 4QRXA 1QDQA 4OELA 2DCAA 2Y6EA 3CBJA 2E01A 1BGOA 7PCKA 1BY8A 5FPWA 1IWDA 4CZWA 1CB5A 1KFXL 9PAPA 3CH3X 4AXLA 4NV8A 1CTEA 5JA7A 3HWNA 4BQVA 4BS6A 1GECE 3H8CA 1Y4HA 2WBFX 3MHSA 4MSXA 3P5VA 5J94A 4FIPA 1MDWA 1KXRA 1U5IA 2AS8A 2R9OA 1YK8A 1ICFA 3LXSA 4G54A 2FRAA 1TLOA 3RVXA 2AIMA 1ATKA 3LFYA 1GX3A 2VFCA 5CVOB 4CDCB 3OVXA 4KLBA 1AYWA 3H7DA 3WXGA 2XU3A 4YYSA 2HD5A 4QH6A 2CIOA 4YYWA 1MEMA 2PREA 3H6SA 3MORA 3USVA 4YYQA 3WXFA 2VFBA 1QXPA 3P5XA 4K7CA 3O0UA 1CPJA 3IV2A 1U9QX 1CV8A 2ACTA 2DZZA 3KX1A 1AU4A 3OVZA 1POPA 4QRVA 2AUXA 1KFUL 3F75A 3P5WA 2FUDA 4W5BA 3N3KA 3V6CA 5F02A 2DCBA 3RVWA 3KSEA 2ATOA 1AU2A 2FT2A 1ME4A 3AI8A 3BPMA 1GMYA 2DCDA 2XU5A 4PADA 3C9EA 2PADA 2DJFB 3K24A 2GFOA 1W6FA 5CVMA 3KKUA 4BPVA 3HHIA 5CHVA 1YVBA 4AXMA 5PADA 4X6JA 2F7DA 1W4TA 3E1ZB 3M99A 3BPFA 2P86A 4B55A 1TU6A 1QOLA 2CB5A 2YJ9A 3I06A 5K16A 1W5RA 3NHEA 4I07A 3I3TA 1O0EA 3PBHA 1STFE 3S3RA 5JH3A 2C0YA 1BQIA 2ARYA 5CHTA 4NV7A 4XUIA 4BS5A 1YT7A 2FO5A 2OZ2A 4BGFA 2XU1A 1Q6KA 2NQAA 2G8JA 3IMAA 3S3QA 1A6RA 4YYUA 3IUTA 1PXVA 1PADA 2DC7A 2YJCA 1DF0A 4Q8HA 2AYOA 1MEGA 1AIMA 3ZUAA 2B1MA 1F2CA 1NQCA 2NQIA 5CVNB 3OF8A 1AYVA 2VHSA 4ZUXU 1PPPA 2E02A 1PIPA 3KW9A 2OULA 3CH2X 4PP2E 3HD3A 1HUCB 4DMYA 1JQPA 1EWPA 1U9VA 1NB3A 3CBKA 1U9XA 1NPZA 1CQDA 1F2AA 1AECA 2R9FA 1SP4B 2F1GA 2AUZA 3GCBA 2AYNA 4N4ZA 4CDDB 4Q8GA 3TNXA 3V6EA 3D9WA 1KHQA 4HWYA 5EF4A 2AU1A 2DC6A 4YYRA 4MZSA 4DMXA 1EWMA 2FQ9A 2AVWA 4RY2A 4CDFB 1GCBA 5EGWA 1CS8A 1M6DA 1TL9A 5A24A 3U8EA 2DC9A 2R9NA 2FRQA 3PW3A 3WXEA 3H89A 2E00A 3LTWA 3K9MA 2BDLA 2OP3A 1VSNA 4N8WA 3KFQA 3N3GA 2PBHA 2B1NA 3OISA 3DF0A 1PPOA 1THEA 2XU4A 1KHPA 4FK5A 3K8UA 3QSDA 4YV8A 3PDFA 3PNRA 3QT4A 3OF9A 4PP1A 2HH5A 1MS6A 3HHAA 1PPDA 1PBHA 4P6GA 3D6SA 2VHFA 2P7UA 1QMYA 1X9YA 1NLJA 2IBIA 1AU3A 2P0RA 1XKGA 2DJGB 4CDEB 2FYEA 3RVVA 4P6EA 1ME3A 3H8BA 1NL6A 4FJCA 1VJVA 3O1GA 4YVAA 3BWKA 2GHUA 4QBBA 2IPPB 4W5CA 4MZOA 4I05A 2G7YA 2JQFR 3MHHA 2FTDA 2DCCA 3F5VA 1YK7A 3KWBX 4W4UA 1DEUA 1E2TA 1PPNA 2NQDB 3BC3A 1K3BB 4C5PA 2R6NA 2NQGA 1S4VA 4GUZA 3BOWA 3N4CA 4XR7A 4X6IA 1U9WA 2PNSA 1PCIA 4N79A 1AYUA 2YJ8A 1AU0A 1NB5A 4QRGA 1EF7A 1YALA 1MIRA 4X6HA 1SNKA 2HXZA 2E03A 2DZYA 8PCHA 4WA6A 4YYVA 2O6XA 3IHPA 4PI3A 1Y08A 3B79A 1FH0A 2Y5BA 1BP4A 1PE6A 3IOQA 3QJ3A 1CSBB 2R9MA 3KWZA 1ZIVA 2H7JA 1EWOA 1MHWA 3MTNA 1EWLA 2R9CA 2BSZA 1F2BA 3P5UA 1CJLA 2G6DA 1ITOA 2YJBA 3BCNA 6PADA 1GLOA 2DC8A 3ERVA 2YJ2A 2BDZA 1CVZA 4I04A 4BSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSZ A;  1W6F A;  4B55 A;  1W5R A;  4GUZ A;  4BGF A;  3LTW A;  4NV8 A;  2VFB A;  4C5P A;  1E2T A;  1GX3 A;  1W4T A;  3D9W A;  2VFC A;  4NV7 A; 
#chains in the Genus database with same CATH topology
 2ACP X;  4OEM A;  4CSB A;  2RTA A;  1A57 A;  2F01 A;  2OFM X;  1DV9 A;  3B2J A;  5CYB A;  1RLB E;  1PBO A;  4OEL A;  5BVS A;  2WPU A;  3BRN A;  1MVG A;  4CDD A;  3BY0 A;  1SXU A;  1EI5 A;  2FKG A;  3NPO A;  3FW4 A;  4I3C A;  5B2A O;  1LIE A;  4BCS A;  4MVE A;  3ZW2 A;  1LFO A;  1EAL A;  3BLG A;  1N0S A;  5B10 O;  2QMI A;  2OFB A;  1LCZ A;  3NQK A;  2RTJ A;  3FDC A;  2K62 A;  1SLD B;  2X45 A;  4GGT A;  4U46 A;  3VPJ E;  4AYH A;  1ZNG A;  3EW1 A;  1WBI A;  1HMS A;  4NW4 A;  5LJH A;  1ZRY A;  2IZH B;  2W2B A;  3P6H A;  4ALB A;  1MDC A;  1HN2 A;  5F6B A;  4NV8 A;  1VWA B;  5LJG A;  3I17 A;  1HQP A;  1ICM A;  4IAB A;  1VPR A;  4GJV A;  4JGL A;  4YFQ A;  2RTO B;  2OYB O;  4CDF A;  4GRJ A;  3SLJ A;  2MO5 A;  1TXL A;  3PQS A;  1BSQ A;  1VWE B;  1L6M A;  1PMP A;  1EPA A;  1SWT A;  3EMM A;  3KFG A;  2RN4 A;  1RSU B;  2IZL B;  2IZC B;  3RZY A;  4KH8 A;  5IXG A;  4XMH A;  3S26 A;  2Y3E A;  1VWJ B;  1SWB A;  4TQ2 A;  5HA0 A;  1E06 A;  1HXZ A;  1XKI A;  2X4M A;  2AT3 X;  3APU A;  3TGA A;  4ZH6 A;  3WOV A;  2ACO A;  2X8S A;  5LJK A;  4OS0 A;  3IFB A;  1OBQ A;  3Q34 A;  1VYG A;  1BM5 A;  3MG5 A;  1D3S A;  1G85 A;  5F1E A;  1T8V A;  2HMB A;  3G7X A;  2IJA A;  4OKA A;  1CRB A;  5FEN A;  2IZG B;  5CSE A;  1NBX A;  3ZQ3 A;  3RY2 A;  4ZHG A;  3ELZ A;  1N7Y A;  4BX6 A;  5L3Y A;  2ZAG A;  2RTC B;  1I78 A;  1KZX A;  3O22 A;  3VG4 A;  1QQS A;  4O3X B;  3RE5 A;  4Z6J A;  4YKM A;  1GX3 A;  1EIO A;  2VFC A;  2XST A;  1TOW A;  1JZU A;  1EW3 A;  2RTP B;  1CBR A;  3X00 A;  1VWD B;  4ZHD A;  4Z2O A;  3C78 X;  5FQ8 E;  5AEO A;  4YDA A;  5KHP A;  4BX5 A;  1DZM A;  3TGB A;  3WBG A;  3F6Z B;  1NGL A;  1VWP B;  2IZB A;  2IZE B;  2RTR B;  4L1N A;  4O4U A;  4QRL A;  1GM6 A;  3SOT A;  1ACD A;  2GTF X;  1B4M A;  4DQ4 A;  1QFV A;  2RTF B;  2ZSC A;  2VFB A;  4IB7 A;  4N7C A;  3LNB A;  3RDM A;  2RTL A;  3FEP A;  2QO5 A;  2WQ9 A;  4O4S A;  1VWM B;  5IRU A;  1K24 A;  1LIF A;  2NNE A;  1ADL A;  1GT4 A;  1SWP A;  2K23 A;  2G7B A;  3APW A;  3FA7 A;  2VDF A;  1KL3 A;  3SAO A;  3SLT A;  2IZI A;  2PI3 O;  1MX8 A;  4DCB A;  4OMX A;  1JYJ A;  2ASN X;  3FID A;  1PTS A;  3C77 X;  1SRF A;  2AT8 X;  4AZP A;  1SY0 A;  1JMZ A;  1OEE A;  1B0O A;  1OEJ A;  1VWH B;  2A5C A;  3B2K A;  2BC3 A;  2Q2M A;  3HTY A;  4M7M A;  3TF6 A;  4CPF A;  4U9C A;  1KOI A;  4ZH9 A;  4PSQ A;  3FEN A;  1N9Y A;  3KQ0 A;  2AVI A;  3WZP A;  1OBP A;  2FHN X;  5B5G A;  3WYP A;  1LID A;  3KZA A;  4YVB A;  1QFT A;  2JMB A;  4LKP A;  1T68 X;  1DF3 A;  4I9R A;  1GT1 A;  1TVQ A;  2OVS A;  4CDE A;  5B11 O;  3GAQ A;  5D48 A;  4BX7 A;  2RTN B;  1SMP I;  3WYQ A;  5EDB A;  1SWQ A;  3FLL A;  1YWA A;  1SWO A;  3MVF A;  4IB8 A;  4TJZ A;  2RD7 C;  3V8U A;  3F9D A;  1I9H A;  3HPE A;  5HTE A;  1X8O A;  5H8T A;  4BOE A;  5FQ6 E;  2WR6 A;  1ICN A;  5C0N A;  4R0B A;  3VHH A;  5HZ5 A;  4WHI A;  4GGZ A;  5EED A;  2CAM A;  4QGX A;  1SY2 A;  3BDR A;  1W6F A;  3STM X;  3WZN A;  3ZW1 B;  3JSQ A;  4NYQ A;  5F6Z A;  2HZQ A;  2C1Q A;  4K19 A;  3CR6 A;  1G7N A;  4O3W A;  4PJ2 A;  2RTG B;  1PM1 X;  4Y5D A;  3VG5 A;  3ZI8 A;  1D2U A;  3HWD A;  1VWB B;  4O4O A;  2A13 A;  2I5Z O;  2Y3F A;  5HZ8 A;  1KZW A;  2CBR A;  5IO6 A;  3HWG A;  4TKB A;  1JYD A;  4TKH A;  4WFV A;  2OFA A;  1W4T A;  2OF8 A;  1SWE A;  3P6G A;  4TKJ A;  4ARH A;  3TGC A;  3RDQ A;  2RA6 A;  2AT0 X;  5JD2 A;  3ZUO A;  4YBP A;  1Y55 X;  4ORR A;  5KIC A;  2G78 A;  1STR B;  3VE2 A;  3AKN A;  3FEL A;  5LKE A;  4B55 A;  2GJ5 A;  1FEM A;  5LJD A;  1SRH A;  2RTB B;  2G8C O;  2IZJ A;  4YCH A;  5HCD C;  2LFO A;  1ZND A;  3D4R A;  4L3R A;  4CPE A;  2RTK A;  2X55 A;  5HZ9 A;  1BRQ A;  1VWK B;  2RTE B;  4I3B A;  1GX8 A;  1K3B A;  1KFF A;  2X34 A;  2Q2P A;  1W5R A;  3C76 X;  2FHL A;  2GH7 A;  2A2U A;  3K3L A;  5HAE A;  3NR3 A;  5IRW A;  4IB6 A;  1O1U A;  4IMN A;  2JOZ A;  2JN3 A;  5JR8 A;  5K67 A;  2GTL O;  3S5V A;  1LCV A;  1KQX A;  2YMS A;  5H9L A;  4Y0P A;  3BU1 A;  4U8U N;  1CBI A;  1IFC A;  1IJ8 A;  1VWL B;  2A3F X;  3B2I A;  3KVN A;  2LBA A;  1G74 A;  1Y52 X;  3L4R A;  4I60 A;  1VWO B;  4ZHC A;  4NV7 A;  1STP A;  4YCE A;  2EU7 X;  4KT5 A;  3KFF A;  4TLJ A;  2MJI A;  5KID A;  1GX9 A;  2CM4 A;  4BGF A;  4CV7 A;  5L8O A;  2FLJ A;  1NP1 A;  4GH7 A;  2R74 A;  4IAX A;  5CHK A;  3VE1 A;  5D47 A;  5FQ7 E;  5BVT A;  1BBP A;  2RTM A;  5IO5 A;  2JU8 A;  1VWC B;  1Y53 X;  3D95 A;  2RCT A;  3FR4 A;  3N91 A;  2AT5 X;  3PH6 A;  4I3D A;  2HNX A;  2MM3 A;  1U0X A;  2RCQ A;  1SWN A;  2Z4I A;  4MVK A;  2X8F A;  2QOS C;  4YGZ A;  1GKA B;  3MM0 A;  2ANS A;  2FGS A;  4GKC A;  3OBL A;  2A2G A;  1ZNE A;  3EYC A;  5H9K A;  5IRA A;  3TZS A;  4GGR A;  1NC9 A;  1JV4 A;  1RXH A;  2AF5 A;  2FS7 A;  1HXL A;  3RDS A;  1MK5 A;  1MUP A;  4AZR A;  3CWK A;  2HYS A;  1VWR B;  3FR2 A;  2WEW A;  4N7D A;  3U9P C;  3RKG A;  1SWC A;  4ZHH A;  5EDC A;  3JQO A;  5HCE C;  3B2H A;  4HPB A;  4O9S A;  4YFR A;  4IB9 A;  4CK4 A;  1SRJ A;  2PY1 A;  1S2P A;  3DSZ A;  1CBS A;  2OFR X;  2WSJ A;  3UAQ A;  4FQB B;  5D4A A;  5CE4 A;  4ML7 B;  5FFH A;  2G5L A;  1EPB A;  1HBQ A;  3ZW1 A;  3FA8 A;  5H9A A;  1VWG B;  3HK1 A;  3AUM O;  1SXY A;  1DZJ A;  1IIU A;  1CJ5 A;  1DZP A;  1SWR A;  4ZFX A;  1TOU A;  3ZW0 B;  1HBP A;  1JQP A;  1WUB A;  3CBS A;  2CZU A;  3O19 A;  4RUN A;  4U8U M;  2OY5 O;  4GET A;  5IO7 A;  3WVM A;  4KC8 A;  1BRP A;  1SWD A;  2WWP A;  2XKL A;  1KQW A;  1O8V A;  1I06 A;  1SWU A;  3EM0 A;  4ORS A;  4JO6 A;  1BSO A;  1KT4 A;  1URE A;  2L5P A;  3KFH A;  4LZU A;  3RDO A;  2QM9 A;  1FDQ A;  2OL7 A;  2DM5 A;  2WEX A;  3P02 A;  4KII A;  1DF8 A;  4EKV A;  1X8N A;  2CZT A;  2OVA A;  4GK9 A;  4Y0R A;  2OZQ A;  2E4J A;  2IZD B;  3OJY C;  2BT9 A;  1YIV A;  2O62 A;  1T0V A;  4KCA A;  4XME A;  3RDU A;  1TW4 A;  3ZWE A;  3NX1 A;  1EII A;  2I5V O;  4QQ1 A;  1BWY A;  5AJB A;  1PBY A;  1LNM A;  2LB6 A;  3CQN A;  3D9W A;  3S60 A;  1FJ1 E;  4NNS A;  4D6B A;  2Q9S A;  2FR3 A;  1YWB A;  1OBU A;  4HPA A;  4ORX A;  3STN A;  3P24 A;  1NDJ A;  4NYR A;  4EEJ A;  1HMR A;  4MIR A;  3BU9 A;  2A8G A;  1ZNL A;  5K06 A;  2L68 A;  4GNY A;  2YG2 A;  4JNJ A;  2IFB A;  3BX8 A;  3EW2 A;  4EFG A;  3BX7 A;  5HCC C;  5B29 A;  4YGH A;  2CBS A;  4ORY A;  1MOY A;  4MVL A;  1Z24 A;  4YDB A;  2OF9 A;  1I05 A;  4AW8 A;  1KL5 A;  2BLG A;  3NP1 A;  4ZJ0 A;  5F7G A;  3DTQ A;  2HLV A;  4EXZ A;  4Z2V A;  4LQZ A;  3QQ2 A;  1SRG A;  2FT9 A;  4AZN A;  4I95 A;  1SY1 A;  2KT4 B;  3P6E A;  5D8J A;  4A60 A;  2PQT A;  1N43 A;  3QKG A;  4ODD A;  3HWF A;  4QGW A;  4AZM A;  4YMY A;  1RXK A;  2N93 A;  2L67 A;  1N9M A;  5LJE A;  1DZK A;  1PEE A;  4EDE A;  4GE1 A;  5HZ6 A;  1X8P A;  1YUP A;  1JMX A;  3FR5 A;  2GC9 A;  3D97 A;  4HPC A;  3RDX A;  1S44 A;  4EQA C;  2WQA E;  1LUQ A;  2LKK A;  3PK2 A;  4ORU A;  1RBP A;  4HPD A;  2P8G A;  3FA6 A;  3LTW A;  2OY1 O;  4O3Z A;  5FAZ A;  4A1Y A;  4Z27 A;  4GJS A;  4LKT A;  2RTD B;  3FIQ A;  3SZJ A;  4FBV A;  4BX6 B;  3T6F A;  3VHI A;  1SRE A;  2OL6 O;  1AEL A;  4JHQ A;  1XCA A;  2RTI B;  2OVD A;  2R56 A;  3KFI A;  1AB0 A;  1Y0G A;  1GGL A;  1LKE A;  3VG6 A;  1SLE B;  4CDC A;  2M4L A;  1X8U A;  3CKF A;  3PPT A;  1GT3 A;  3GE2 A;  3NX2 A;  4IMO A;  1GXA A;  1BLR A;  3F8A A;  3WJE A;  4ZCB A;  4ES7 A;  3VG7 A;  3B2L A;  1SRI A;  4D6A A;  4QZU A;  5B5F A;  1KT6 A;  4O3Y A;  1JJU A;  2JU3 A;  4HFO A;  2X32 A;  3RSW A;  1VWI B;  3ZW0 A;  1MEP A;  1ZNH A;  2RTH B;  3PDF A;  4Y0S A;  3HOL A;  4GZV A;  1NQM A;  3ELX A;  1LCW A;  2FWV A;  2JW1 A;  2LBV A;  1KL4 A;  4Z28 A;  3STK A;  1AVE A;  1E02 A;  5EPQ A;  4KC7 A;  1KGL A;  2G79 A;  1A3Y A;  1I4U A;  1YWC A;  3PH5 A;  2FTB A;  3VG3 A;  3U0D A;  1OPB A;  1B8E A;  2AT6 X;  4ZHF A;  3WJD A;  1JJX A;  1I04 A;  2X46 A;  1KT7 A;  3ZZV A;  1SWA A;  1RST B;  4NLI A;  5HTD A;  1SXW A;  1YP7 A;  2NP1 A;  3HOE A;  4RUU A;  4COT A;  5B3M O;  2KTS A;  3Q6L A;  4XMD A;  3FEK A;  4OS3 A;  2BHV A;  1OPA A;  1OSP O;  4WBK A;  2JGS A;  3EBW A;  2OVE A;  1ML7 A;  1RAV A;  2QOM A;  1ALB A;  3D96 A;  4UU3 A;  2ZAI A;  1U18 A;  4IBA A;  4QZT A;  1CBQ A;  1QY1 A;  3AEH A;  3BS2 A;  4Y59 A;  4CPH B;  1ZNK A;  2UYW A;  4QYN A;  1VYO A;  4OS8 A;  1NP4 A;  1R0U A;  3NQ3 A;  3P6D A;  1EQD A;  3FA9 A;  3PP6 A;  2BS5 A;  4ZGF A;  2UZ2 A;  3MBT A;  3LV4 A;  4QGV A;  1SWF A;  1N4J A;  1BEB A;  1ERX A;  1FEL A;  1SWH A;  2AMM X;  1A2D A;  3APV A;  5F2B A;  3SZI A;  1IW2 A;  1HMT A;  1AVG I;  4QNI A;  1U17 A;  4AZQ A;  4ORW A;  4YH0 A;  1O1V A;  3OD9 A;  3UEU A;  1SWS A;  2Z4H A;  2X56 A;  4XMF A;  4NNT A;  1SA8 A;  3AKM A;  5L8N A;  1LDO A;  5L8I A;  1IFB A;  1QY0 A;  4I9S A;  4O49 A;  4BX7 B;  2IZA A;  4OMW A;  1MM9 A;  4ON1 A;  1LPJ A;  1SWJ A;  5D45 A;  3T6L A;  3T2X A;  3RY1 A;  4CPI A;  5HA1 A;  3NAD A;  2DJF A;  5B27 A;  1VYF A;  2CM9 A;  3SLO A;  4A1H A;  1MX7 A;  1DFV A;  3CMP A;  3FMZ A;  4I6S A;  5AJC A;  4ZGU A;  2MWH A;  4INN A;  1X89 A;  4GNW A;  3BSZ E;  2JU7 A;  4GD9 A;  2KTD A;  3P6F A;  4BBO A;  1IKE A;  3MX7 A;  3S5X A;  1Y9L A;  2HKD A;  3VHM A;  3OE3 A;  2QO6 A;  1ERB A;  4ALO A;  1UYN X;  1FEN A;  5DPQ A;  4DNE A;  4XMC A;  2MF6 A;  4LZV A;  4DQ3 A;  2BS6 A;  1QWD A;  3UEX A;  4Z2P A;  2ALL X;  4BJ8 A;  4ID2 A;  3ZUI A;  2QCB A;  2AKQ A;  2F73 A;  4IRW A;  3WXQ A;  2OL8 O;  4A8Z A;  1NQN A;  2FR2 A;  3UEW A;  1GT5 A;  4XMG A;  4DMO A;  2FRS A;  1G5W A;  3PQU A;  3T1D A;  1UZ2 X;  1X8Q A;  3IA8 A;  1SLF B;  1E2T A;  2HZR A;  1YP6 A;  3APX A;  3I0A A;  4AZO A;  1JIW I;  2NNQ A;  2GTL N;  3EBK A;  4FBO A;  3CBC A;  1KT5 A;  4YKO A;  2KW1 A;  1E5P A;  3LHN A;  3U03 A;  4C5P A;  1LDQ A;  1KXO A;  1SY3 A;  4IAW A;  1LEL A;  2QO4 A;  3UEV A;  1P6P A;  5LJC A;  4U3Q A;  3RBY A;  1OEK A;  2OY8 A;  5K68 A;  1SWG A;  4GU8 A;  2Q4N A;  4GUZ A;  3WJF A;  1QY2 A;  2PFR A;  1AQB A;  3EC5 A;  1Y9T A;  2X8T A;  3FW5 A;  2LA7 A;  3WJB A;  5LJB A;  3CKG A;  1X71 A;  2A5B A;  4NP1 A;  4UU2 A;  5AQ6 A;  4GDA A;  1A18 A;  5HZQ A;  1HQQ A;  3O2Y A;  4BVM A;  4U8U O;  2NND A;  1DC9 A;  4FGI B;  2F09 A;  2R73 A;  2RQ0 A;  5EEE A;  5LKF A;  5HBS A;  4MEE A;  1RXJ A;  2W2F A;  1SWK A;  2Q39 A;  2IZF B;  2AH7 X;  1FE3 A;  2W2A A;  3T2W A;  4CPH A;  1GKA A;  4M6S A;  1E00 A;  3WJG A;  2OY7 A;  4QYP A;  4YFP A;  2AL0 X;  3CQR A;  1SXX A;  1VWN B;  5HWZ A;  5F58 A;  1QAB E;  3RE6 A;  4BQU A;  1YWD A;  2DJG A;  3H3I A;  3NBX X;  1BSY A;  3PED A;  1SWL A;  1EUO A;  1FTP A;  2IZK A;  3RWX A;  1QG5 A;  2Y32 A;  3VU1 A;  1H91 A;  2FKJ A;  2KD2 A;  2MHD A;  2C4I A;  4O4X A;  1VWQ B;  1B56 A;  2C1S A;  4GDZ A;  2FS6 A;  3NQ9 A;  4WFU A;  1LF7 A;  5BVQ A;  1EXS A;  3PEC A;  3WZO A;  3VG2 A;  1LIB A;  3HWE A;  4HWM A;  4Y0Q A;  4MVI A;  3VGW A;  1UYO X;  2RTQ B;  2WUT A;  3P6C A;  2POA A;  1HY2 A;  5H9N A;  2GTL M;  2BSZ A;  2L9C A;  4MIS A;  1IKJ A;  1AVD A;  3WJC A;  4BX5 B;  1KT3 A;  4YGG A;  5DG4 A;  4YBU A;  1VWF B;  4ZR2 A;  5BYP A;  1STS B;  1S7D A;  3WZQ A;  3JS1 A;  4NLJ A;  1JBH A;  1LIC A;  4FBR A;  3E3C A;  3FYF A;  1BJ7 A;  2A0A A;  1JJJ A;  4TNN A;  5EZ2 A;  3SZH A;  4QAE A;  1SLG B; 
#chains in the Genus database with same CATH homology
 2HHN A;  1ZCM A;  2G8E A;  4OEM A;  2JQG R;  1F29 A;  3IEJ A;  4QRX A;  1QDQ A;  4OEL A;  2DCA A;  2Y6E A;  3CBJ A;  2E01 A;  1BGO A;  7PCK A;  1BY8 A;  5FPW A;  1IWD A;  4CZW A;  1CB5 A;  1KFX L;  9PAP A;  3CH3 X;  4AXL A;  4NV8 A;  1CTE A;  5JA7 A;  3HWN A;  4BQV A;  4BS6 A;  1GEC E;  3H8C A;  1Y4H A;  2WBF X;  3MHS A;  4MSX A;  3P5V A;  5J94 A;  4FIP A;  1MDW A;  1KXR A;  1U5I A;  2AS8 A;  2R9O A;  1YK8 A;  1ICF A;  3LXS A;  4G54 A;  2FRA A;  1TLO A;  3RVX A;  2AIM A;  1ATK A;  3LFY A;  1GX3 A;  2VFC A;  5CVO B;  4CDC B;  3OVX A;  4KLB A;  1AYW A;  3H7D A;  3WXG A;  2XU3 A;  4YYS A;  2HD5 A;  4QH6 A;  2CIO A;  4YYW A;  1MEM A;  2PRE A;  3H6S A;  3MOR A;  3USV A;  4YYQ A;  3WXF A;  2VFB A;  1QXP A;  3P5X A;  4K7C A;  3O0U A;  1CPJ A;  3IV2 A;  1U9Q X;  1CV8 A;  2ACT A;  2DZZ A;  3KX1 A;  1AU4 A;  3OVZ A;  1POP A;  4QRV A;  2AUX A;  1KFU L;  3F75 A;  3P5W A;  2FUD A;  4W5B A;  3N3K A;  3V6C A;  5F02 A;  2DCB A;  3RVW A;  3KSE A;  2ATO A;  1AU2 A;  2FT2 A;  1ME4 A;  3AI8 A;  3BPM A;  1GMY A;  2DCD A;  2XU5 A;  4PAD A;  3C9E A;  2PAD A;  2DJF B;  3K24 A;  2GFO A;  1W6F A;  5CVM A;  3KKU A;  4BPV A;  3HHI A;  5CHV A;  1YVB A;  4AXM A;  5PAD A;  4X6J A;  2F7D A;  1W4T A;  3E1Z B;  3M99 A;  3BPF A;  2P86 A;  4B55 A;  1TU6 A;  1QOL A;  2CB5 A;  2YJ9 A;  3I06 A;  5K16 A;  1W5R A;  3NHE A;  4I07 A;  3I3T A;  1O0E A;  3PBH A;  1STF E;  3S3R A;  5JH3 A;  2C0Y A;  1BQI A;  2ARY A;  5CHT A;  4NV7 A;  4XUI A;  4BS5 A;  1YT7 A;  2FO5 A;  2OZ2 A;  4BGF A;  2XU1 A;  1Q6K A;  2NQA A;  2G8J A;  3IMA A;  3S3Q A;  1A6R A;  4YYU A;  3IUT A;  1PXV A;  1PAD A;  2DC7 A;  2YJC A;  1DF0 A;  4Q8H A;  2AYO A;  1MEG A;  1AIM A;  3ZUA A;  2B1M A;  1F2C A;  1NQC A;  2NQI A;  5CVN B;  3OF8 A;  1AYV A;  2VHS A;  4ZUX U;  1PPP A;  2E02 A;  1PIP A;  3KW9 A;  2OUL A;  3CH2 X;  4PP2 E;  3HD3 A;  1HUC B;  4DMY A;  1JQP A;  1EWP A;  1U9V A;  1NB3 A;  3CBK A;  1U9X A;  1NPZ A;  1CQD A;  1F2A A;  1AEC A;  2R9F A;  1SP4 B;  2F1G A;  2AUZ A;  3GCB A;  2AYN A;  4N4Z A;  4CDD B;  4Q8G A;  3TNX A;  3V6E A;  3D9W A;  1KHQ A;  4HWY A;  5EF4 A;  2AU1 A;  2DC6 A;  4YYR A;  4MZS A;  4DMX A;  1EWM A;  2FQ9 A;  2AVW A;  4RY2 A;  4CDF B;  1GCB A;  5EGW A;  1CS8 A;  1M6D A;  1TL9 A;  5A24 A;  3U8E A;  2DC9 A;  2R9N A;  2FRQ A;  3PW3 A;  3WXE A;  3H89 A;  2E00 A;  3LTW A;  3K9M A;  2BDL A;  2OP3 A;  1VSN A;  4N8W A;  3KFQ A;  3N3G A;  2PBH A;  2B1N A;  3OIS A;  3DF0 A;  1PPO A;  1THE A;  2XU4 A;  1KHP A;  4FK5 A;  3K8U A;  3QSD A;  4YV8 A;  3PDF A;  3PNR A;  3QT4 A;  3OF9 A;  4PP1 A;  2HH5 A;  1MS6 A;  3HHA A;  1PPD A;  1PBH A;  4P6G A;  3D6S A;  2VHF A;  2P7U A;  1QMY A;  1X9Y A;  1NLJ A;  2IBI A;  1AU3 A;  2P0R A;  1XKG A;  2DJG B;  4CDE B;  2FYE A;  3RVV A;  4P6E A;  1ME3 A;  3H8B A;  1NL6 A;  4FJC A;  1VJV A;  3O1G A;  4YVA A;  3BWK A;  2GHU A;  4QBB A;  2IPP B;  4W5C A;  4MZO A;  4I05 A;  2G7Y A;  2JQF R;  3MHH A;  2FTD A;  2DCC A;  3F5V A;  1YK7 A;  3KWB X;  4W4U A;  1DEU A;  1E2T A;  1PPN A;  2NQD B;  3BC3 A;  1K3B B;  4C5P A;  2R6N A;  2NQG A;  1S4V A;  4GUZ A;  3BOW A;  3N4C A;  4XR7 A;  4X6I A;  1U9W A;  2PNS A;  1PCI A;  4N79 A;  1AYU A;  2YJ8 A;  1AU0 A;  1NB5 A;  4QRG A;  1EF7 A;  1YAL A;  1MIR A;  4X6H A;  1SNK A;  2HXZ A;  2E03 A;  2DZY A;  8PCH A;  4WA6 A;  4YYV A;  2O6X A;  3IHP A;  4PI3 A;  1Y08 A;  3B79 A;  1FH0 A;  2Y5B A;  1BP4 A;  1PE6 A;  3IOQ A;  3QJ3 A;  1CSB B;  2R9M A;  3KWZ A;  1ZIV A;  2H7J A;  1EWO A;  1MHW A;  3MTN A;  1EWL A;  2R9C A;  2BSZ A;  1F2B A;  3P5U A;  1CJL A;  2G6D A;  1ITO A;  2YJB A;  3BCN A;  6PAD A;  1GLO A;  2DC8 A;  3ERV A;  2YJ2 A;  2BDZ A;  1CVZ A;  4I04 A;  4BSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...