3LTWA

The structure of mycobacterium marinum arylamine n-acetyltransferase in complex with hydralazine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
b'DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylamine N-acetyltransferase Nat
publication title Probing the architecture of the Mycobacterium marinum arylamine N-acetyltransferase active site
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 83
structure length 272
sequence length 272
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 3ltwA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 3ltwA01
1W5RA 3LTWA 2VFBA 4NV8A 4C5PA 1W6FA 3D9WA 1W4TA 4B55A 2VFCA 4BGFA 1GX3A 1E2TA 2BSZA 4NV7A 4GUZA
chains in the Genus database with same CATH superfamily
1SRGA 1JMXA 4KC7A 1KT7A 5H9KA 5JD2A 2X34A 4KH8A 4AZMA 1QFVA 3VHMA 4EXZA 5D4AA 2OFAA 2AT0X 1W4TA 3PP6A 3BY0A 3MBTA 1T0VA 4GGZA 3ZW0B 4JGLA 4I3CA 4QGWA 2X46A 4EFGA 1GT3A 3UEUA 4IAXA 3P6HA 3BU9A 1FDQA 1PBYA 1N9MA 1STPA 4YFPA 5DG4A 3VG4A 5HZ9A 4RUNA 2G78A 1OPAA 1VWKB 4FGIB 4NLIA 4QYPA 4Y0PA 3RE6A 4A8ZA 1MX8A 1RBPA 1SXUA 1U0XA 4O4UA 3RDSA 3K3LA 1SRHA 1SY3A 2WQAE 4ORWA 1ZNHA 3WVMA 4CDDA 3P02A 4MISA 2X45A 4L3RA 1ICMA 2GJ5A 2Q4NA 2Z4IA 4ML7B 4WBKA 4TKHA 2MM3A 4TKBA 3S60A 1KT6A 2K62A 3WJGA 3WZPA 1KQWA 3C78X 2MJIA 4GUZA 1VWRB 2Q9SA 1VWIB 2POAA 2IZHB 4YGGA 1TXLA 4GGTA 2C1QA 3SZJA 3FW4A 2OVDA 1GKAA 5LJHA 5B11O 2L5PA 3IA8A 1WBIA 5EDBA 2FT9A 4GGRA 1CBSA 1S7DA 4BX7A 1OEKA 2R56A 3D97A 5FAZA 1AQBA 1SWCA 1I04A 2X8TA 1RSUB 3B2IA 5AQ6A 2AF5A 4RUUA 4Y0RA 3WOVA 3ZW1B 1RXHA 2RTIB 2RTAA 4OELA 3D4RA 2QO6A 4U3QA 1KQXA 3HPEA 2RTEB 4BBOA 1VWBB 2IZFB 2Q2PA 3EBWA 3VE2A 3APVA 4EQAC 1IKEA 4KT5A 4DQ4A 1R0UA 5L3YA 1ICNA 1QABE 1SWPA 4IB7A 1Y55X 4XMEA 2RTFB 3STMX 4C5PA 3FMZA 3SOTA 4ID2A 2KW1A 5HZ6A 1X8UA 3RDMA 1X89A 5B27A 1MX7A 1TOUA 1A2DA 1SREA 2BSZA 3DSZA 2Y3EA 3T6LA 5IO5A 4Z2PA 4JNJA 1MVGA 5KIDA 2QOSC 4BX7B 4B55A 3APXA 4BX6A 5IO6A 4Z27A 5B29A 3CR6A 5D45A 3FA6A 4CV7A 3GAQA 1VYFA 1YP7A 2X8SA 2OY7A 1EUOA 2GTLN 1EIOA 4Y0QA 1JYDA 2ALLX 3BS2A 4O49A 2A2UA 2C4IA 2Q2MA 1GXAA 1ERXA 1SWRA 4ZH6A 3P6EA 2X55A 5IO7A 2DJGA 1KT4A 1FJ1E 2FR3A 3BX7A 1DF8A 3UEXA 1OBPA 2RTJA 1IFCA 3BLGA 2RN4A 1BSOA 4ZHGA 3LNBA 3HWEA 4HPBA 5CE4A 1CBRA 3WBGA 4GJSA 3KFGA 3ZI8A 4CDEA 2RTHB 4LKPA 4QZUA 4XMCA 3RDOA 1NQMA 2IZLB 2FKGA 1E06A 1KFFA 5HTEA 2FHLA 4ZGFA 3KQ0A 1LKEA 1KXOA 4UU2A 4ZHFA 1E00A 4Y5DA 3MM0A 1UZ2X 3C76X 1E02A 4OMWA 1JQPA 1OPBA 5F58A 3LHNA 1MUPA 1I4UA 3QKGA 4YGHA 4CK4A 2OF9A 4WHIA 2LFOA 4NNSA 3KFHA 3STKA 1DZPA 3EBKA 2VDFA 2QCBA 3NQ3A 3F8AA 4GE1A 2IZCB 4YKMA 3RY2A 2HZQA 4A1YA 3TZSA 2G79A 3APUA 2GTFX 1MDCA 1LDQA 2A8GA 2YG2A 1AELA 2PY1A 1SLFB 1GGLA 1N4JA 5BVTA 5L8NA 4ALBA 5CYBA 3NADA 4MEEA 3BX8A 4MVIA 3PECA 2X4MA 4O9SA 5LKEA 1A57A 1QQSA 1QY2A 3B2HA 4BCSA 1JJXA 4U8UM 1S2PA 1SRIA 1SY2A 1NBXA 2QOMA 1HBPA 1MM9A 4U8UO 2RCTA 2AT3X 2BHVA 3ZZVA 3JQOA 2FRSA 4YDAA 1YP6A 2XSTA 5LJBA 3T1DA 1UYNX 4Z6JA 2GC9A 1SY0A 2GH7A 2A5CA 4GZVA 3WXQA 1EALA 4Z28A 2RTPB 2WEXA 1JYJA 2IFBA 2OVEA 3NPOA 1SRFA 1XKIA 2KD2A 2RTGB 1KZXA 4GKCA 3VG7A 2JMBA 1EQDA 1BSYA 4M7MA 1VWNB 2K23A 2NNDA 4CPHA 4ZGUA 2G7BA 1JBHA 1YWAA 1Y52X 2IZJA 1B4MA 3TGAA 1BEBA 1VWAB 1JMZA 3SZHA 3TF6A 3WYPA 3D95A 3VE1A 5HCEC 3WYQA 1LPJA 5BYPA 1LDOA 3RZYA 4ORSA 1H91A 1CBQA 1SWTA 1DF3A 3FR5A 2WSJA 1I78A 1VWEB 1IKJA 2OF8A 1NDJA 1BBPA 1YIVA 3BSZE 3L4RA 1OEJA 3AKNA 4IMNA 4XMFA 5FQ6E 2FWVA 1L6MA 4KCAA 4JO6A 1RAVA 1Y53X 2FGSA 1SLGB 2AT5X 3WJCA 4O3XB 1N7YA 3CWKA 5B5FA 4NV8A 4I3BA 4BX5B 1YUPA 4GJVA 4XMGA 3P6DA 5FQ7E 1HMSA 1FEMA 4UU3A 2GTLM 3FDCA 1ZNGA 1LFOA 4OKAA 4YFQA 2KT4B 5HAEA 4HPCA 3JSQA 4HPAA 4I3DA 1ZNLA 2QO4A 4AW8A 3MVFA 3PEDA 1AVGI 2M4LA 5B3MO 2IZAA 1ZNKA 3WJFA 2OFRX 2WPUA 2A3FX 3S5XA 1DFVA 5KHPA 3RDXA 4IRWA 1DC9A 2P8GA 5LKFA 1LUQA 1B56A 1SWBA 1EIIA 1KL4A 4R0BA 5F6ZA 1HBQA 1RSTB 3RBYA 4YVBA 1JJJA 1N0SA 2IZEB 4PJ2A 4DQ3A 1G74A 1P6PA 5K67A 3WJEA 1ERBA 3EYCA 2OVAA 4NYRA 3UAQA 1VWFB 1KL3A 2G8CO 4DMOA 2RTQB 3FA9A 4LZUA 3STNA 5AEOA 3RSWA 2ZAGA 2IZDB 2RTBB 2XKLA 2I5VO 3SLJA 4GU8A 1SA8A 1RLBE 4O3YA 4ON1A 1SY1A 3P6CA 4WFUA 5HA1A 3KFIA 2HLVA 1MK5A 4DNEA 3D9WA 2QMIA 3SLTA 4CPFA 1JJUA 2I5ZO 3ZUOA 2HNXA 3WJBA 1LIEA 1ALBA 4OEMA 4ORRA 3TGCA 3RE5A 1GKAB 1GT5A 5HZQA 2FR2A 1VWMB 3P6GA 1U17A 1SWHA 5CSEA 3HOLA 4OS0A 5D8JA 3FELA 5HCCC 3FEPA 2G5LA 1KOIA 3HOEA 2ACOA 1LCWA 1SXYA 4HWMA 2HZRA 1I9HA 5IRUA 3JS1A 1SLEB 3VU1A 2RA6A 2X56A 3VGWA 4A60A 1X8NA 2HMBA 4BJ8A 4TQ2A 4ZHCA 4QGXA 2AMMX 2OL8O 1SWNA 1T8VA 1VWPB 1HMTA 2CM4A 3NX2A 5HZ8A 1SXWA 3CKFA 1PM1X 5IRWA 4GETA 1DV9A 1SMPI 3EW1A 1LICA 1A3YA 1CBIA 2MWHA 3FIQA 4CSBA 2R74A 1DZJA 1VWHB 4Y0SA 4YH0A 2RTRB 2Y32A 4BOEA 2PFRA 3FA7A 4YKOA 1QFTA 2RTNB 3O22A 1LIBA 1QWDA 3CKGA 1D2UA 1O1UA 3VG6A 2L9CA 1WUBA 3FENA 3PH6A 3VPJE 4BX6B 3B2LA 2AT6X 2NNEA 4FBOA 1LCVA 1VYOA 2RTLA 3MX7A 5B5GA 1GT1A 3SLOA 2RQ0A 3F6ZB 3FIDA 2ZSCA 5F7GA 3SZIA 2BLGA 4YCEA 1VWJB 2LB6A 1SWSA 2ZAIA 3FYFA 3LV4A 4ALOA 3RWXA 4L1NA 4QNIA 4YBUA 3IFBA 1X8PA 4QQ1A 3Q34A 1SWFA 2PQTA 5EDCA 4ZH9A 3NR3A 3I0AA 4KIIA 3WZOA 1NQNA 2BT9A 5D48A 3U03A 4ORXA 4NW4A 3HWDA 4YBPA 2R73A 1SWDA 1UYOX 3BRNA 4NYQA 5FFHA 1VWDB 2JU8A 1HN2A 4GDZA 2DM5A 1D3SA 3D96A 3EW2A 4FQBB 3KFFA 4U46A 3AUMO 3FA8A 1OBQA 1EPAA 2FHNX 3N91A 3APWA 2KTDA 2OYBO 5K06A 2OFMX 1YWCA 1LCZA 2RCQA 4WFVA 1VWGB 3P6FA 2O62A 4AZNA 3RY1A 2CM9A 1RXJA 4I6SA 4XMDA 4Y59A 1SWUA 3S26A 1VPRA 4TJZA 3PK2A 4YCHA 1Y9LA 3TGBA 1JIWI 2OVSA 4U9CA 3VG2A 3ZQ3A 3FEKA 4INNA 4O4OA 2HKDA 4COTA 3AEHA 2KTSA 4GK9A 4I95A 2RTMA 3E3CA 3FR4A 2CZTA 3T2XA 2F09A 3V8UA 2Z4HA 1STRB 4O3ZA 5H9LA 2ACPX 3UEVA 3VG3A 1FENA 1LIDA 2OL6O 1NGLA 4DCBA 5FQ8E 2IZKA 2WWPA 3B2JA 1ADLA 4TLJA 5AJCA 4CPIA 5JR8A 2F73A 1SWOA 1MOYA 1QY0A 2RD7C 4IBAA 5D47A 2UYWA 2E4JA 3CQRA 3EC5A 3CQNA 3HK1A 1QG5A 3NQ9A 1FE3A 3Q6LA 1ZNEA 3C77X 1G7NA 1CRBA 3FR2A 4FBVA 4YGZA 3O2YA 4AYHA 1U18A 5CHKA 2CBSA 2W2AA 5B2AO 3UEWA 1B8EA 1GT4A 4CDFA 2LBAA 5LJKA 2LA7A 1O1VA 3T2WA 4AZRA 2QM9A 3I17A 2FS7A 4IB8A 4OMXA 4MVKA 2DJFA 4PSQA 1GX3A 1NP1A 2AKQA 2OL7A 1BSQA 5EZ2A 1KL5A 1AVEA 3BU1A 4BQUA 3AKMA 2ANSA 4AZPA 2AL0X 4LZVA 4EKVA 2OZQA 1X8OA 1XCAA 2OFBA 1X71A 2BS5A 2IZIA 2GTLO 4D6AA 2RTDB 1STSB 2YMSA 1EPBA 3WJDA 4Z2VA 3KZAA 4TKJA 4O3WA 3CBCA 4CPHB 3ZW1A 3LTWA 4QGVA 5KICA 4O4SA 1IFBA 4CPEA 1I06A 2AH7X 1ACDA 1BRQA 2A0AA 1GM6A 4IAWA 1VYGA 4ODDA 2X8FA 4QYNA 5AJBA 1IJ8A 3S5VA 4ZR2A 5LJEA 4OS3A 1OEEA 2IZBA 1VWOB 2JN3A 2X32A 4EEJA 1LIFA 3T6FA 3HTYA 1W5RA 2IJAA 1FTPA 2LBVA 3DTQA 1K3BA 1YWDA 4LKTA 4U8UN 1N9YA 3WZQA 3FLLA 2NNQA 2MO5A 2UZ2A 4ARHA 3NP1A 5HBSA 1E5PA 5HZ5A 3F9DA 1BRPA 1A18A 1B0OA 2PI3O 4IB9A 2W2FA 2AVIA 1SWGA 3B2KA 1AB0A 3NQKA 5DPQA 5C0NA 1VWLB 2CZUA 4CDCA 1HXZA 1E2TA 1ZNDA 5EEDA 1PEEA 5LJCA 2NP1A 1SRJA 2WQ9A 1Y9TA 4IMOA 2MHDA 5H9NA 2ASNX 4GRJA 1DZKA 2JU3A 2Y3FA 5HA0A 3U0DA 2VFBA 4MVEA 4AZQA 1TVQA 1O8VA 1EW3A 1SLDB 2JU7A 5IRAA 1HQPA 2BS6A 1PBOA 1G85A 3EMMA 1VWQB 4KC8A 1MEPA 1IIUA 1YWBA 2CAMA 4A1HA 1T68X 3X00A 1PTSA 3WZNA 2IZGB 5FENA 2FTBA 2L67A 2VFCA 1OSPO 1TW4A 3VG5A 3ZWEA 4AZOA 4MIRA 4JHQA 1EI5A 2Q39A 4ORYA 5B10O 3OJYC 5H9AA 5HCDC 4QRLA 4GDAA 4IABA 4Z2OA 2BC3A 4QAEA 4BVMA 4FBRA 1ZRYA 2JGSA 1SWJA 1LELA 2MF6A 3ZUIA 1TOWA 4O4XA 1X8QA 1DZMA 2WEWA 3PQSA 3OE3A 4NV7A 3ZW2A 3MG5A 3P24A 1N43A 2JW1A 1JZUA 1HMRA 4HFOA 5EPQA 4NP1A 1UREA 2FS6A 2N93A 4YFRA 2W2BA 1CJ5A 2L68A 3RDQA 2CBRA 3RKGA 4ES7A 5BVQA 1NC9A 1W6FA 4GNYA 5EEEA 4YDBA 2WUTA 4NLJA 1ML7A 4QZTA 3SAOA 5L8OA 1Y0GA 2WR6A 5F1EA 3O19A 2OY1O 4ZHHA 3OBLA 3RDUA 1G5WA 1EXSA 5L8IA 2RTKA 2LKKA 2HYSA 1GX9A 4M6SA 1SWAA 1RXKA 1BM5A 3ELXA 4ZJ0A 1SWEA 3HWFA 3VHIA 1SWKA 2QO5A 2JOZA 1I05A 2AT8X 3GE2A 3CMPA 4ZFXA 5F6BA 1HXLA 2EU7X 2FKJA 1KT5A 1SWQA 4N7DA 1HY2A 4EDEA 1VWCB 2RTCB 1KT3A 3H3IA 2A5BA 4N7CA 1LF7A 5BVSA 1QY1A 3PDFA 3ZW0A 4YMYA 5IXGA 4I60A 2RTOB 1SXXA 2FLJA 2OY8A 3NBXX 1BJ7A 4MVLA 4XMHA 3BDRA 1OBUA 1JV4A 4TNNA 3G7XA 2A13A 2A2GA 3VHHA 4NNTA 4GH7A 4I9RA 1SWLA 4LQZA 4ZCBA 3OD9A 4GD9A 1S44A 5H8TA 4D6BA 3EM0A 3KVNA 4BGFA 3PH5A 4I9SA 3ELZA 1LNMA 5LJDA 1K24A 1FELA 1Z24A 3HWGA 1GX8A 3PQUA 4K19A 4HPDA 4ORUA 4ZHDA 1KZWA 1KGLA 3QQ2A 1IW2A 1PMPA 5F2BA 4BX5A 3CBSA 5HWZA 1BLRA 3U9PC 1NP4A 3PPTA 4GNWA 2F01A 4IB6A 5HTDA 5K68A 4OS8A 1AVDA 2OY5O 5LJGA 2C1SA 1BWYA 1HQQA 3NX1A 3FW5A
chains in the Genus database with same CATH topology
4RY2A 1KFXL 3PNRA 2FQ9A 2NQIA 1TL9A 4P6EA 5CHTA 1W4TA 3USVA 3LFYA 2FYEA 3IMAA 2C0YA 3HHIA 2R9MA 3BOWA 2E02A 3E1ZB 3TNXA 4YV8A 1KXRA 1IWDA 3AI8A 1YK8A 3H7DA 4CDFB 1STFE 2FRAA 3F75A 4GUZA 2DJFB 2R9FA 1NLJA 2IPPB 1AU2A 4Q8GA 2GFOA 1SNKA 2PBHA 1PBHA 4OELA 3B79A 3S3RA 4MSXA 4X6HA 2ACTA 1QMYA 1BY8A 1CS8A 1CJLA 2O6XA 2H7JA 1AYVA 4C5PA 1MEMA 3P5UA 4FIPA 1K3BB 2FT2A 2BSZA 1U9WA 1QXPA 5F02A 1MHWA 1EF7A 4B55A 3CBJA 3RVWA 1CSBB 1AU0A 5J94A 3OISA 4W5BA 1Q6KA 2DZYA 1CTEA 2FTDA 1ZIVA 2HD5A 1PPOA 1U5IA 1EWPA 4N8WA 1NL6A 3KW9A 3OF9A 1QDQA 1Y08A 3CH3X 1JQPA 1PPDA 1GECE 2DCAA 2AYOA 4ZUXU 2VHFA 1GCBA 1XKGA 3KFQA 4YYVA 3NHEA 1A6RA 2ATOA 2F1GA 3ERVA 1Y4HA 2ARYA 4FK5A 4MZOA 4N79A 1POPA 2HXZA 3HWNA 3I3TA 3BPFA 4HWYA 2YJCA 5CVNB 4I04A 3D6SA 1PIPA 1PPPA 1KHPA 1CV8A 3IUTA 2AU1A 4QH6A 4BPVA 3DF0A 2JQFR 2G8EA 1NB5A 1PE6A 1YK7A 1KFUL 4NV8A 3BCNA 1F29A 1AYWA 3H8BA 2CB5A 3PBHA 3RVVA 4FJCA 4XUIA 2AVWA 2XU1A 2FUDA 5PADA 4WA6A 4G54A 3MHHA 4QRVA 4I05A 1BGOA 3H8CA 4CDDB 1YT7A 1F2AA 2OP3A 2PREA 2VHSA 1VJVA 3D9WA 2XU5A 1ME4A 8PCHA 3CBKA 1M6DA 4OEMA 4YYSA 1ZCMA 1MEGA 3ZUAA 3K24A 3O0UA 3QT4A 2P0RA 2AUZA 2BDZA 3MORA 1F2CA 1U9QX 5EF4A 4AXLA 2DCBA 2F7DA 3KX1A 1YVBA 2R6NA 3N3KA 2B1NA 4PADA 5FPWA 1ICFA 1YALA 1S4VA 4N4ZA 4X6IA 2IBIA 4PI3A 2AS8A 1CPJA 2JQGR 4K7CA 1MS6A 2FO5A 2P86A 3K8UA 2YJ8A 2PADA 1QOLA 4Q8HA 2E01A 2BDLA 1CB5A 5K16A 2DJGB 1BQIA 1X9YA 4MZSA 4YYWA 3WXGA 4CDEB 5CVOB 1EWOA 1U9XA 4YYRA 3F5VA 2XU3A 1KHQA 4P6GA 5JA7A 1BP4A 2YJ9A 2DC8A 4BS6A 4YYUA 1TU6A 2G6DA 1NPZA 2YJ2A 1NB3A 3IV2A 3HD3A 1CQDA 2CIOA 4DMXA 3OVXA 1DEUA 3KWZA 1AU4A 1DF0A 3CH2X 4QBBA 4QRXA 1FH0A 3MTNA 1GX3A 5EGWA 5JH3A 2B1MA 2NQGA 3BWKA 2E03A 3RVXA 4PP1A 3M99A 3C9EA 1ITOA 3WXFA 3LTWA 4W5CA 1VSNA 3MHSA 2E00A 2DC9A 2DZZA 3OF8A 3IEJA 1AECA 1PCIA 1W5RA 4YYQA 2Y6EA 2DC7A 2WBFX 3HHAA 3WXEA 3N3GA 3BPMA 1MIRA 1ME3A 2HH5A 3OVZA 3N4CA 2G8JA 3BC3A 1TLOA 2XU4A 1F2BA 5CHVA 4YVAA 1E2TA 3P5WA 2NQDB 1GLOA 2VFBA 1NQCA 2HHNA 2NQAA 2OZ2A 3I06A 1O0EA 2GHUA 3QSDA 1MDWA 2VFCA 3IHPA 2Y5BA 2AYNA 3GCBA 4AXMA 2YJBA 4CDCB 4NV7A 1CVZA 4QRGA 1PXVA 1EWLA 2R9OA 3QJ3A 4XR7A 1AU3A 4BQVA 1GMYA 3LXSA 2DC6A 3KKUA 7PCKA 4X6JA 3H89A 1W6FA 3P5XA 2PNSA 3KSEA 4DMYA 1HUCB 3S3QA 2OULA 2R9NA 2P7UA 2R9CA 2AIMA 4BS5A 3U8EA 1AYUA 2AUXA 3V6EA 6PADA 4W4UA 2DCDA 5CVMA 1PPNA 4PP2E 1EWMA 3PDFA 2FRQA 1SP4B 4CZWA 4I07A 9PAPA 1THEA 1PADA 3PW3A 3P5VA 4BGFA 3KWBX 1ATKA 3K9MA 4KLBA 5A24A 2G7YA 1U9VA 1AIMA 3H6SA 3IOQA 3O1GA 4BSQA 2DCCA 3V6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5R A;  3LTW A;  2VFB A;  4NV8 A;  4C5P A;  1W6F A;  3D9W A;  1W4T A;  4B55 A;  2VFC A;  4BGF A;  1GX3 A;  1E2T A;  2BSZ A;  4NV7 A;  4GUZ A; 
#chains in the Genus database with same CATH topology
 1SRG A;  1JMX A;  4KC7 A;  1KT7 A;  5H9K A;  5JD2 A;  2X34 A;  4KH8 A;  4AZM A;  1QFV A;  3VHM A;  4EXZ A;  5D4A A;  2OFA A;  2AT0 X;  1W4T A;  3PP6 A;  3BY0 A;  3MBT A;  1T0V A;  4GGZ A;  3ZW0 B;  4JGL A;  4I3C A;  4QGW A;  2X46 A;  4EFG A;  1GT3 A;  3UEU A;  4IAX A;  3P6H A;  3BU9 A;  1FDQ A;  1PBY A;  1N9M A;  1STP A;  4YFP A;  5DG4 A;  3VG4 A;  5HZ9 A;  4RUN A;  2G78 A;  1OPA A;  1VWK B;  4FGI B;  4NLI A;  4QYP A;  4Y0P A;  3RE6 A;  4A8Z A;  1MX8 A;  1RBP A;  1SXU A;  1U0X A;  4O4U A;  3RDS A;  3K3L A;  1SRH A;  1SY3 A;  2WQA E;  4ORW A;  1ZNH A;  3WVM A;  4CDD A;  3P02 A;  4MIS A;  2X45 A;  4L3R A;  1ICM A;  2GJ5 A;  2Q4N A;  2Z4I A;  4ML7 B;  4WBK A;  4TKH A;  2MM3 A;  4TKB A;  3S60 A;  1KT6 A;  2K62 A;  3WJG A;  3WZP A;  1KQW A;  3C78 X;  2MJI A;  4GUZ A;  1VWR B;  2Q9S A;  1VWI B;  2POA A;  2IZH B;  4YGG A;  1TXL A;  4GGT A;  2C1Q A;  3SZJ A;  3FW4 A;  2OVD A;  1GKA A;  5LJH A;  5B11 O;  2L5P A;  3IA8 A;  1WBI A;  5EDB A;  2FT9 A;  4GGR A;  1CBS A;  1S7D A;  4BX7 A;  1OEK A;  2R56 A;  3D97 A;  5FAZ A;  1AQB A;  1SWC A;  1I04 A;  2X8T A;  1RSU B;  3B2I A;  5AQ6 A;  2AF5 A;  4RUU A;  4Y0R A;  3WOV A;  3ZW1 B;  1RXH A;  2RTI B;  2RTA A;  4OEL A;  3D4R A;  2QO6 A;  4U3Q A;  1KQX A;  3HPE A;  2RTE B;  4BBO A;  1VWB B;  2IZF B;  2Q2P A;  3EBW A;  3VE2 A;  3APV A;  4EQA C;  1IKE A;  4KT5 A;  4DQ4 A;  1R0U A;  5L3Y A;  1ICN A;  1QAB E;  1SWP A;  4IB7 A;  1Y55 X;  4XME A;  2RTF B;  3STM X;  4C5P A;  3FMZ A;  3SOT A;  4ID2 A;  2KW1 A;  5HZ6 A;  1X8U A;  3RDM A;  1X89 A;  5B27 A;  1MX7 A;  1TOU A;  1A2D A;  1SRE A;  2BSZ A;  3DSZ A;  2Y3E A;  3T6L A;  5IO5 A;  4Z2P A;  4JNJ A;  1MVG A;  5KID A;  2QOS C;  4BX7 B;  4B55 A;  3APX A;  4BX6 A;  5IO6 A;  4Z27 A;  5B29 A;  3CR6 A;  5D45 A;  3FA6 A;  4CV7 A;  3GAQ A;  1VYF A;  1YP7 A;  2X8S A;  2OY7 A;  1EUO A;  2GTL N;  1EIO A;  4Y0Q A;  1JYD A;  2ALL X;  3BS2 A;  4O49 A;  2A2U A;  2C4I A;  2Q2M A;  1GXA A;  1ERX A;  1SWR A;  4ZH6 A;  3P6E A;  2X55 A;  5IO7 A;  2DJG A;  1KT4 A;  1FJ1 E;  2FR3 A;  3BX7 A;  1DF8 A;  3UEX A;  1OBP A;  2RTJ A;  1IFC A;  3BLG A;  2RN4 A;  1BSO A;  4ZHG A;  3LNB A;  3HWE A;  4HPB A;  5CE4 A;  1CBR A;  3WBG A;  4GJS A;  3KFG A;  3ZI8 A;  4CDE A;  2RTH B;  4LKP A;  4QZU A;  4XMC A;  3RDO A;  1NQM A;  2IZL B;  2FKG A;  1E06 A;  1KFF A;  5HTE A;  2FHL A;  4ZGF A;  3KQ0 A;  1LKE A;  1KXO A;  4UU2 A;  4ZHF A;  1E00 A;  4Y5D A;  3MM0 A;  1UZ2 X;  3C76 X;  1E02 A;  4OMW A;  1JQP A;  1OPB A;  5F58 A;  3LHN A;  1MUP A;  1I4U A;  3QKG A;  4YGH A;  4CK4 A;  2OF9 A;  4WHI A;  2LFO A;  4NNS A;  3KFH A;  3STK A;  1DZP A;  3EBK A;  2VDF A;  2QCB A;  3NQ3 A;  3F8A A;  4GE1 A;  2IZC B;  4YKM A;  3RY2 A;  2HZQ A;  4A1Y A;  3TZS A;  2G79 A;  3APU A;  2GTF X;  1MDC A;  1LDQ A;  2A8G A;  2YG2 A;  1AEL A;  2PY1 A;  1SLF B;  1GGL A;  1N4J A;  5BVT A;  5L8N A;  4ALB A;  5CYB A;  3NAD A;  4MEE A;  3BX8 A;  4MVI A;  3PEC A;  2X4M A;  4O9S A;  5LKE A;  1A57 A;  1QQS A;  1QY2 A;  3B2H A;  4BCS A;  1JJX A;  4U8U M;  1S2P A;  1SRI A;  1SY2 A;  1NBX A;  2QOM A;  1HBP A;  1MM9 A;  4U8U O;  2RCT A;  2AT3 X;  2BHV A;  3ZZV A;  3JQO A;  2FRS A;  4YDA A;  1YP6 A;  2XST A;  5LJB A;  3T1D A;  1UYN X;  4Z6J A;  2GC9 A;  1SY0 A;  2GH7 A;  2A5C A;  4GZV A;  3WXQ A;  1EAL A;  4Z28 A;  2RTP B;  2WEX A;  1JYJ A;  2IFB A;  2OVE A;  3NPO A;  1SRF A;  1XKI A;  2KD2 A;  2RTG B;  1KZX A;  4GKC A;  3VG7 A;  2JMB A;  1EQD A;  1BSY A;  4M7M A;  1VWN B;  2K23 A;  2NND A;  4CPH A;  4ZGU A;  2G7B A;  1JBH A;  1YWA A;  1Y52 X;  2IZJ A;  1B4M A;  3TGA A;  1BEB A;  1VWA B;  1JMZ A;  3SZH A;  3TF6 A;  3WYP A;  3D95 A;  3VE1 A;  5HCE C;  3WYQ A;  1LPJ A;  5BYP A;  1LDO A;  3RZY A;  4ORS A;  1H91 A;  1CBQ A;  1SWT A;  1DF3 A;  3FR5 A;  2WSJ A;  1I78 A;  1VWE B;  1IKJ A;  2OF8 A;  1NDJ A;  1BBP A;  1YIV A;  3BSZ E;  3L4R A;  1OEJ A;  3AKN A;  4IMN A;  4XMF A;  5FQ6 E;  2FWV A;  1L6M A;  4KCA A;  4JO6 A;  1RAV A;  1Y53 X;  2FGS A;  1SLG B;  2AT5 X;  3WJC A;  4O3X B;  1N7Y A;  3CWK A;  5B5F A;  4NV8 A;  4I3B A;  4BX5 B;  1YUP A;  4GJV A;  4XMG A;  3P6D A;  5FQ7 E;  1HMS A;  1FEM A;  4UU3 A;  2GTL M;  3FDC A;  1ZNG A;  1LFO A;  4OKA A;  4YFQ A;  2KT4 B;  5HAE A;  4HPC A;  3JSQ A;  4HPA A;  4I3D A;  1ZNL A;  2QO4 A;  4AW8 A;  3MVF A;  3PED A;  1AVG I;  2M4L A;  5B3M O;  2IZA A;  1ZNK A;  3WJF A;  2OFR X;  2WPU A;  2A3F X;  3S5X A;  1DFV A;  5KHP A;  3RDX A;  4IRW A;  1DC9 A;  2P8G A;  5LKF A;  1LUQ A;  1B56 A;  1SWB A;  1EII A;  1KL4 A;  4R0B A;  5F6Z A;  1HBQ A;  1RST B;  3RBY A;  4YVB A;  1JJJ A;  1N0S A;  2IZE B;  4PJ2 A;  4DQ3 A;  1G74 A;  1P6P A;  5K67 A;  3WJE A;  1ERB A;  3EYC A;  2OVA A;  4NYR A;  3UAQ A;  1VWF B;  1KL3 A;  2G8C O;  4DMO A;  2RTQ B;  3FA9 A;  4LZU A;  3STN A;  5AEO A;  3RSW A;  2ZAG A;  2IZD B;  2RTB B;  2XKL A;  2I5V O;  3SLJ A;  4GU8 A;  1SA8 A;  1RLB E;  4O3Y A;  4ON1 A;  1SY1 A;  3P6C A;  4WFU A;  5HA1 A;  3KFI A;  2HLV A;  1MK5 A;  4DNE A;  3D9W A;  2QMI A;  3SLT A;  4CPF A;  1JJU A;  2I5Z O;  3ZUO A;  2HNX A;  3WJB A;  1LIE A;  1ALB A;  4OEM A;  4ORR A;  3TGC A;  3RE5 A;  1GKA B;  1GT5 A;  5HZQ A;  2FR2 A;  1VWM B;  3P6G A;  1U17 A;  1SWH A;  5CSE A;  3HOL A;  4OS0 A;  5D8J A;  3FEL A;  5HCC C;  3FEP A;  2G5L A;  1KOI A;  3HOE A;  2ACO A;  1LCW A;  1SXY A;  4HWM A;  2HZR A;  1I9H A;  5IRU A;  3JS1 A;  1SLE B;  3VU1 A;  2RA6 A;  2X56 A;  3VGW A;  4A60 A;  1X8N A;  2HMB A;  4BJ8 A;  4TQ2 A;  4ZHC A;  4QGX A;  2AMM X;  2OL8 O;  1SWN A;  1T8V A;  1VWP B;  1HMT A;  2CM4 A;  3NX2 A;  5HZ8 A;  1SXW A;  3CKF A;  1PM1 X;  5IRW A;  4GET A;  1DV9 A;  1SMP I;  3EW1 A;  1LIC A;  1A3Y A;  1CBI A;  2MWH A;  3FIQ A;  4CSB A;  2R74 A;  1DZJ A;  1VWH B;  4Y0S A;  4YH0 A;  2RTR B;  2Y32 A;  4BOE A;  2PFR A;  3FA7 A;  4YKO A;  1QFT A;  2RTN B;  3O22 A;  1LIB A;  1QWD A;  3CKG A;  1D2U A;  1O1U A;  3VG6 A;  2L9C A;  1WUB A;  3FEN A;  3PH6 A;  3VPJ E;  4BX6 B;  3B2L A;  2AT6 X;  2NNE A;  4FBO A;  1LCV A;  1VYO A;  2RTL A;  3MX7 A;  5B5G A;  1GT1 A;  3SLO A;  2RQ0 A;  3F6Z B;  3FID A;  2ZSC A;  5F7G A;  3SZI A;  2BLG A;  4YCE A;  1VWJ B;  2LB6 A;  1SWS A;  2ZAI A;  3FYF A;  3LV4 A;  4ALO A;  3RWX A;  4L1N A;  4QNI A;  4YBU A;  3IFB A;  1X8P A;  4QQ1 A;  3Q34 A;  1SWF A;  2PQT A;  5EDC A;  4ZH9 A;  3NR3 A;  3I0A A;  4KII A;  3WZO A;  1NQN A;  2BT9 A;  5D48 A;  3U03 A;  4ORX A;  4NW4 A;  3HWD A;  4YBP A;  2R73 A;  1SWD A;  1UYO X;  3BRN A;  4NYQ A;  5FFH A;  1VWD B;  2JU8 A;  1HN2 A;  4GDZ A;  2DM5 A;  1D3S A;  3D96 A;  3EW2 A;  4FQB B;  3KFF A;  4U46 A;  3AUM O;  3FA8 A;  1OBQ A;  1EPA A;  2FHN X;  3N91 A;  3APW A;  2KTD A;  2OYB O;  5K06 A;  2OFM X;  1YWC A;  1LCZ A;  2RCQ A;  4WFV A;  1VWG B;  3P6F A;  2O62 A;  4AZN A;  3RY1 A;  2CM9 A;  1RXJ A;  4I6S A;  4XMD A;  4Y59 A;  1SWU A;  3S26 A;  1VPR A;  4TJZ A;  3PK2 A;  4YCH A;  1Y9L A;  3TGB A;  1JIW I;  2OVS A;  4U9C A;  3VG2 A;  3ZQ3 A;  3FEK A;  4INN A;  4O4O A;  2HKD A;  4COT A;  3AEH A;  2KTS A;  4GK9 A;  4I95 A;  2RTM A;  3E3C A;  3FR4 A;  2CZT A;  3T2X A;  2F09 A;  3V8U A;  2Z4H A;  1STR B;  4O3Z A;  5H9L A;  2ACP X;  3UEV A;  3VG3 A;  1FEN A;  1LID A;  2OL6 O;  1NGL A;  4DCB A;  5FQ8 E;  2IZK A;  2WWP A;  3B2J A;  1ADL A;  4TLJ A;  5AJC A;  4CPI A;  5JR8 A;  2F73 A;  1SWO A;  1MOY A;  1QY0 A;  2RD7 C;  4IBA A;  5D47 A;  2UYW A;  2E4J A;  3CQR A;  3EC5 A;  3CQN A;  3HK1 A;  1QG5 A;  3NQ9 A;  1FE3 A;  3Q6L A;  1ZNE A;  3C77 X;  1G7N A;  1CRB A;  3FR2 A;  4FBV A;  4YGZ A;  3O2Y A;  4AYH A;  1U18 A;  5CHK A;  2CBS A;  2W2A A;  5B2A O;  3UEW A;  1B8E A;  1GT4 A;  4CDF A;  2LBA A;  5LJK A;  2LA7 A;  1O1V A;  3T2W A;  4AZR A;  2QM9 A;  3I17 A;  2FS7 A;  4IB8 A;  4OMX A;  4MVK A;  2DJF A;  4PSQ A;  1GX3 A;  1NP1 A;  2AKQ A;  2OL7 A;  1BSQ A;  5EZ2 A;  1KL5 A;  1AVE A;  3BU1 A;  4BQU A;  3AKM A;  2ANS A;  4AZP A;  2AL0 X;  4LZV A;  4EKV A;  2OZQ A;  1X8O A;  1XCA A;  2OFB A;  1X71 A;  2BS5 A;  2IZI A;  2GTL O;  4D6A A;  2RTD B;  1STS B;  2YMS A;  1EPB A;  3WJD A;  4Z2V A;  3KZA A;  4TKJ A;  4O3W A;  3CBC A;  4CPH B;  3ZW1 A;  3LTW A;  4QGV A;  5KIC A;  4O4S A;  1IFB A;  4CPE A;  1I06 A;  2AH7 X;  1ACD A;  1BRQ A;  2A0A A;  1GM6 A;  4IAW A;  1VYG A;  4ODD A;  2X8F A;  4QYN A;  5AJB A;  1IJ8 A;  3S5V A;  4ZR2 A;  5LJE A;  4OS3 A;  1OEE A;  2IZB A;  1VWO B;  2JN3 A;  2X32 A;  4EEJ A;  1LIF A;  3T6F A;  3HTY A;  1W5R A;  2IJA A;  1FTP A;  2LBV A;  3DTQ A;  1K3B A;  1YWD A;  4LKT A;  4U8U N;  1N9Y A;  3WZQ A;  3FLL A;  2NNQ A;  2MO5 A;  2UZ2 A;  4ARH A;  3NP1 A;  5HBS A;  1E5P A;  5HZ5 A;  3F9D A;  1BRP A;  1A18 A;  1B0O A;  2PI3 O;  4IB9 A;  2W2F A;  2AVI A;  1SWG A;  3B2K A;  1AB0 A;  3NQK A;  5DPQ A;  5C0N A;  1VWL B;  2CZU A;  4CDC A;  1HXZ A;  1E2T A;  1ZND A;  5EED A;  1PEE A;  5LJC A;  2NP1 A;  1SRJ A;  2WQ9 A;  1Y9T A;  4IMO A;  2MHD A;  5H9N A;  2ASN X;  4GRJ A;  1DZK A;  2JU3 A;  2Y3F A;  5HA0 A;  3U0D A;  2VFB A;  4MVE A;  4AZQ A;  1TVQ A;  1O8V A;  1EW3 A;  1SLD B;  2JU7 A;  5IRA A;  1HQP A;  2BS6 A;  1PBO A;  1G85 A;  3EMM A;  1VWQ B;  4KC8 A;  1MEP A;  1IIU A;  1YWB A;  2CAM A;  4A1H A;  1T68 X;  3X00 A;  1PTS A;  3WZN A;  2IZG B;  5FEN A;  2FTB A;  2L67 A;  2VFC A;  1OSP O;  1TW4 A;  3VG5 A;  3ZWE A;  4AZO A;  4MIR A;  4JHQ A;  1EI5 A;  2Q39 A;  4ORY A;  5B10 O;  3OJY C;  5H9A A;  5HCD C;  4QRL A;  4GDA A;  4IAB A;  4Z2O A;  2BC3 A;  4QAE A;  4BVM A;  4FBR A;  1ZRY A;  2JGS A;  1SWJ A;  1LEL A;  2MF6 A;  3ZUI A;  1TOW A;  4O4X A;  1X8Q A;  1DZM A;  2WEW A;  3PQS A;  3OE3 A;  4NV7 A;  3ZW2 A;  3MG5 A;  3P24 A;  1N43 A;  2JW1 A;  1JZU A;  1HMR A;  4HFO A;  5EPQ A;  4NP1 A;  1URE A;  2FS6 A;  2N93 A;  4YFR A;  2W2B A;  1CJ5 A;  2L68 A;  3RDQ A;  2CBR A;  3RKG A;  4ES7 A;  5BVQ A;  1NC9 A;  1W6F A;  4GNY A;  5EEE A;  4YDB A;  2WUT A;  4NLJ A;  1ML7 A;  4QZT A;  3SAO A;  5L8O A;  1Y0G A;  2WR6 A;  5F1E A;  3O19 A;  2OY1 O;  4ZHH A;  3OBL A;  3RDU A;  1G5W A;  1EXS A;  5L8I A;  2RTK A;  2LKK A;  2HYS A;  1GX9 A;  4M6S A;  1SWA A;  1RXK A;  1BM5 A;  3ELX A;  4ZJ0 A;  1SWE A;  3HWF A;  3VHI A;  1SWK A;  2QO5 A;  2JOZ A;  1I05 A;  2AT8 X;  3GE2 A;  3CMP A;  4ZFX A;  5F6B A;  1HXL A;  2EU7 X;  2FKJ A;  1KT5 A;  1SWQ A;  4N7D A;  1HY2 A;  4EDE A;  1VWC B;  2RTC B;  1KT3 A;  3H3I A;  2A5B A;  4N7C A;  1LF7 A;  5BVS A;  1QY1 A;  3PDF A;  3ZW0 A;  4YMY A;  5IXG A;  4I60 A;  2RTO B;  1SXX A;  2FLJ A;  2OY8 A;  3NBX X;  1BJ7 A;  4MVL A;  4XMH A;  3BDR A;  1OBU A;  1JV4 A;  4TNN A;  3G7X A;  2A13 A;  2A2G A;  3VHH A;  4NNT A;  4GH7 A;  4I9R A;  1SWL A;  4LQZ A;  4ZCB A;  3OD9 A;  4GD9 A;  1S44 A;  5H8T A;  4D6B A;  3EM0 A;  3KVN A;  4BGF A;  3PH5 A;  4I9S A;  3ELZ A;  1LNM A;  5LJD A;  1K24 A;  1FEL A;  1Z24 A;  3HWG A;  1GX8 A;  3PQU A;  4K19 A;  4HPD A;  4ORU A;  4ZHD A;  1KZW A;  1KGL A;  3QQ2 A;  1IW2 A;  1PMP A;  5F2B A;  4BX5 A;  3CBS A;  5HWZ A;  1BLR A;  3U9P C;  1NP4 A;  3PPT A;  4GNW A;  2F01 A;  4IB6 A;  5HTD A;  5K68 A;  4OS8 A;  1AVD A;  2OY5 O;  5LJG A;  2C1S A;  1BWY A;  1HQQ A;  3NX1 A;  3FW5 A; 
#chains in the Genus database with same CATH homology
 4RY2 A;  1KFX L;  3PNR A;  2FQ9 A;  2NQI A;  1TL9 A;  4P6E A;  5CHT A;  1W4T A;  3USV A;  3LFY A;  2FYE A;  3IMA A;  2C0Y A;  3HHI A;  2R9M A;  3BOW A;  2E02 A;  3E1Z B;  3TNX A;  4YV8 A;  1KXR A;  1IWD A;  3AI8 A;  1YK8 A;  3H7D A;  4CDF B;  1STF E;  2FRA A;  3F75 A;  4GUZ A;  2DJF B;  2R9F A;  1NLJ A;  2IPP B;  1AU2 A;  4Q8G A;  2GFO A;  1SNK A;  2PBH A;  1PBH A;  4OEL A;  3B79 A;  3S3R A;  4MSX A;  4X6H A;  2ACT A;  1QMY A;  1BY8 A;  1CS8 A;  1CJL A;  2O6X A;  2H7J A;  1AYV A;  4C5P A;  1MEM A;  3P5U A;  4FIP A;  1K3B B;  2FT2 A;  2BSZ A;  1U9W A;  1QXP A;  5F02 A;  1MHW A;  1EF7 A;  4B55 A;  3CBJ A;  3RVW A;  1CSB B;  1AU0 A;  5J94 A;  3OIS A;  4W5B A;  1Q6K A;  2DZY A;  1CTE A;  2FTD A;  1ZIV A;  2HD5 A;  1PPO A;  1U5I A;  1EWP A;  4N8W A;  1NL6 A;  3KW9 A;  3OF9 A;  1QDQ A;  1Y08 A;  3CH3 X;  1JQP A;  1PPD A;  1GEC E;  2DCA A;  2AYO A;  4ZUX U;  2VHF A;  1GCB A;  1XKG A;  3KFQ A;  4YYV A;  3NHE A;  1A6R A;  2ATO A;  2F1G A;  3ERV A;  1Y4H A;  2ARY A;  4FK5 A;  4MZO A;  4N79 A;  1POP A;  2HXZ A;  3HWN A;  3I3T A;  3BPF A;  4HWY A;  2YJC A;  5CVN B;  4I04 A;  3D6S A;  1PIP A;  1PPP A;  1KHP A;  1CV8 A;  3IUT A;  2AU1 A;  4QH6 A;  4BPV A;  3DF0 A;  2JQF R;  2G8E A;  1NB5 A;  1PE6 A;  1YK7 A;  1KFU L;  4NV8 A;  3BCN A;  1F29 A;  1AYW A;  3H8B A;  2CB5 A;  3PBH A;  3RVV A;  4FJC A;  4XUI A;  2AVW A;  2XU1 A;  2FUD A;  5PAD A;  4WA6 A;  4G54 A;  3MHH A;  4QRV A;  4I05 A;  1BGO A;  3H8C A;  4CDD B;  1YT7 A;  1F2A A;  2OP3 A;  2PRE A;  2VHS A;  1VJV A;  3D9W A;  2XU5 A;  1ME4 A;  8PCH A;  3CBK A;  1M6D A;  4OEM A;  4YYS A;  1ZCM A;  1MEG A;  3ZUA A;  3K24 A;  3O0U A;  3QT4 A;  2P0R A;  2AUZ A;  2BDZ A;  3MOR A;  1F2C A;  1U9Q X;  5EF4 A;  4AXL A;  2DCB A;  2F7D A;  3KX1 A;  1YVB A;  2R6N A;  3N3K A;  2B1N A;  4PAD A;  5FPW A;  1ICF A;  1YAL A;  1S4V A;  4N4Z A;  4X6I A;  2IBI A;  4PI3 A;  2AS8 A;  1CPJ A;  2JQG R;  4K7C A;  1MS6 A;  2FO5 A;  2P86 A;  3K8U A;  2YJ8 A;  2PAD A;  1QOL A;  4Q8H A;  2E01 A;  2BDL A;  1CB5 A;  5K16 A;  2DJG B;  1BQI A;  1X9Y A;  4MZS A;  4YYW A;  3WXG A;  4CDE B;  5CVO B;  1EWO A;  1U9X A;  4YYR A;  3F5V A;  2XU3 A;  1KHQ A;  4P6G A;  5JA7 A;  1BP4 A;  2YJ9 A;  2DC8 A;  4BS6 A;  4YYU A;  1TU6 A;  2G6D A;  1NPZ A;  2YJ2 A;  1NB3 A;  3IV2 A;  3HD3 A;  1CQD A;  2CIO A;  4DMX A;  3OVX A;  1DEU A;  3KWZ A;  1AU4 A;  1DF0 A;  3CH2 X;  4QBB A;  4QRX A;  1FH0 A;  3MTN A;  1GX3 A;  5EGW A;  5JH3 A;  2B1M A;  2NQG A;  3BWK A;  2E03 A;  3RVX A;  4PP1 A;  3M99 A;  3C9E A;  1ITO A;  3WXF A;  3LTW A;  4W5C A;  1VSN A;  3MHS A;  2E00 A;  2DC9 A;  2DZZ A;  3OF8 A;  3IEJ A;  1AEC A;  1PCI A;  1W5R A;  4YYQ A;  2Y6E A;  2DC7 A;  2WBF X;  3HHA A;  3WXE A;  3N3G A;  3BPM A;  1MIR A;  1ME3 A;  2HH5 A;  3OVZ A;  3N4C A;  2G8J A;  3BC3 A;  1TLO A;  2XU4 A;  1F2B A;  5CHV A;  4YVA A;  1E2T A;  3P5W A;  2NQD B;  1GLO A;  2VFB A;  1NQC A;  2HHN A;  2NQA A;  2OZ2 A;  3I06 A;  1O0E A;  2GHU A;  3QSD A;  1MDW A;  2VFC A;  3IHP A;  2Y5B A;  2AYN A;  3GCB A;  4AXM A;  2YJB A;  4CDC B;  4NV7 A;  1CVZ A;  4QRG A;  1PXV A;  1EWL A;  2R9O A;  3QJ3 A;  4XR7 A;  1AU3 A;  4BQV A;  1GMY A;  3LXS A;  2DC6 A;  3KKU A;  7PCK A;  4X6J A;  3H89 A;  1W6F A;  3P5X A;  2PNS A;  3KSE A;  4DMY A;  1HUC B;  3S3Q A;  2OUL A;  2R9N A;  2P7U A;  2R9C A;  2AIM A;  4BS5 A;  3U8E A;  1AYU A;  2AUX A;  3V6E A;  6PAD A;  4W4U A;  2DCD A;  5CVM A;  1PPN A;  4PP2 E;  1EWM A;  3PDF A;  2FRQ A;  1SP4 B;  4CZW A;  4I07 A;  9PAP A;  1THE A;  1PAD A;  3PW3 A;  3P5V A;  4BGF A;  3KWB X;  1ATK A;  3K9M A;  4KLB A;  5A24 A;  2G7Y A;  1U9V A;  1AIM A;  3H6S A;  3IOQ A;  3O1G A;  4BSQ A;  2DCC A;  3V6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...