3LUIA

Crystal structure of the snx17 px domain with bound sulphate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
104
Chain Sequence
HFSIPETESRSSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-17
publication title Phox homology band 4.1/ezrin/radixin/moesin-like proteins function as molecular scaffolds that interact with cargo receptors and Ras GTPases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 34
structure length 104
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 3luiA00
1H6HA 2RAJA 4HASA 2V6VA 4ON3A 4PQPA 2REDA 3P0CA 1XTEA 2REAA 2CZOA 3FOGA 3LUIA 1OCUA 1KMDA 1O7KA 2RAIA 2V14A 2ETTA 2IWLX 4IKDA 4AKVA 4IKBA 1GD5A 4P2IA 2CSKA 2I4KA 4OXWA 4IKBB 2L73A 2DYBA 3IQ2A 4PQOA 1KQ6A 2RAKA 2WWEA 3DYTA 2YPSA 4P2JA 3HPCX 1XTNA 3HPBA 4BGJA 4PZGA 1OCSA 2AR5A 4AZ9A
chains in the Genus database with same CATH superfamily
1H6HA 2RAJA 4HASA 2V6VA 4ON3A 4PQPA 2REDA 3P0CA 1XTEA 2REAA 2CZOA 3FOGA 3LUIA 1OCUA 1KMDA 1O7KA 2RAIA 2V14A 2ETTA 2IWLX 4IKDA 4AKVA 4IKBA 1GD5A 4P2IA 2CSKA 2I4KA 4OXWA 4IKBB 2L73A 2DYBA 3IQ2A 4PQOA 1KQ6A 2RAKA 2WWEA 3DYTA 2YPSA 4P2JA 3HPCX 1XTNA 3HPBA 4BGJA 4PZGA 1OCSA 2AR5A 4AZ9A
chains in the Genus database with same CATH topology
1H6HA 2RAJA 4HASA 2V6VA 4ON3A 4PQPA 2REDA 3P0CA 1XTEA 2REAA 2CZOA 3FOGA 3LUIA 1OCUA 1KMDA 1O7KA 2RAIA 2V14A 2ETTA 2IWLX 4IKDA 4AKVA 4IKBA 1GD5A 4P2IA 2CSKA 2I4KA 4OXWA 4IKBB 2L73A 2DYBA 3IQ2A 4PQOA 1KQ6A 2RAKA 2WWEA 3DYTA 2YPSA 4P2JA 3HPCX 1XTNA 3HPBA 4BGJA 4PZGA 1OCSA 2AR5A 4AZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6H A;  2RAJ A;  4HAS A;  2V6V A;  4ON3 A;  4PQP A;  2RED A;  3P0C A;  1XTE A;  2REA A;  2CZO A;  3FOG A;  3LUI A;  1OCU A;  1KMD A;  1O7K A;  2RAI A;  2V14 A;  2ETT A;  2IWL X;  4IKD A;  4AKV A;  4IKB A;  1GD5 A;  4P2I A;  2CSK A;  2I4K A;  4OXW A;  4IKB B;  2L73 A;  2DYB A;  3IQ2 A;  4PQO A;  1KQ6 A;  2RAK A;  2WWE A;  3DYT A;  2YPS A;  4P2J A;  3HPC X;  1XTN A;  3HPB A;  4BGJ A;  4PZG A;  1OCS A;  2AR5 A;  4AZ9 A; 
#chains in the Genus database with same CATH topology
 1H6H A;  2RAJ A;  4HAS A;  2V6V A;  4ON3 A;  4PQP A;  2RED A;  3P0C A;  1XTE A;  2REA A;  2CZO A;  3FOG A;  3LUI A;  1OCU A;  1KMD A;  1O7K A;  2RAI A;  2V14 A;  2ETT A;  2IWL X;  4IKD A;  4AKV A;  4IKB A;  1GD5 A;  4P2I A;  2CSK A;  2I4K A;  4OXW A;  4IKB B;  2L73 A;  2DYB A;  3IQ2 A;  4PQO A;  1KQ6 A;  2RAK A;  2WWE A;  3DYT A;  2YPS A;  4P2J A;  3HPC X;  1XTN A;  3HPB A;  4BGJ A;  4PZG A;  1OCS A;  2AR5 A;  4AZ9 A; 
#chains in the Genus database with same CATH homology
 1H6H A;  2RAJ A;  4HAS A;  2V6V A;  4ON3 A;  4PQP A;  2RED A;  3P0C A;  1XTE A;  2REA A;  2CZO A;  3FOG A;  3LUI A;  1OCU A;  1KMD A;  1O7K A;  2RAI A;  2V14 A;  2ETT A;  2IWL X;  4IKD A;  4AKV A;  4IKB A;  1GD5 A;  4P2I A;  2CSK A;  2I4K A;  4OXW A;  4IKB B;  2L73 A;  2DYB A;  3IQ2 A;  4PQO A;  1KQ6 A;  2RAK A;  2WWE A;  3DYT A;  2YPS A;  4P2J A;  3HPC X;  1XTN A;  3HPB A;  4BGJ A;  4PZG A;  1OCS A;  2AR5 A;  4AZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...