3LUNA

Structure of ulilysin mutant m290c
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
b'EIVKIPVVVHVVWNEEEENISDAQIQSQIDILNKDFRKLNSDVSQVPSVWSNLIADLGIEFFLATKDPNGNQTTGITRTQTSVTFFTTSDEVKFASSGGEDAWPADRYLNIWVCHVLKSEIGQDILGYAQFPGGPAETDGVVIVDAAFGTTGTALPPFDKGRTATHEIGHWLNLYHIWGDELRFEDPCSRSDEVDDTPNQADPNFGCPSYPHVSCSNGPNGDMFMNYCDYVDDKCMVMFTQGQATRVNACLDGPRSSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ulilysin
publication title On the relevance of the Met-turn methionine in metzincins.
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Hydrolase
total genus 85
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lunA00
2X3AA 4CTHA 3SHIA 1IADA 1WNIA 1QIAA 3UVCA 2JT5A 3EDHA 4PKTA 1OS2A 1EAKA 3CKIA 4JA1A 1QIBA 3TVCA 3LUNA 2OW2A 4J4MA 4WKIA 4XM7A 1OM6A 3ELMA 1R55A 4H76A 1PWQA 1GKCA 2HU6A 5D7WA 1ZTQA 1JH1A 4WZVA 3ZVSA 4JIJA 1UMTA 2OW9A 1BM6A 3OHOA 3B92A 2V4BA 1SRPA 3HY9A 2D1NA 5L7FA 4DPEA 2MLSA 4AIGA 5B5PA 4L63A 4H30A 1Y93A 2ERPA 3F16A 2X3CA 3LILA 1JANA 4JP4A 5BPAA 2USNA 5I4OA 2J83A 2TCLA 1SU3A 5I0LA 1CQRA 1D8FA 4R3VA 1HY7A 2D1OA 5BOYA 3RTSA 4GR3A 1CIZA 4GQLA 5BOTA 2OY4A 3VI1A 3LGPA 3LIRA 1MNCA 1KBCA 2O3EA 3EDZA 2DW0A 2OVZA 1KUFA 4WKEA 3O2XA 3AYUA 3F1AA 3P1VA 1YOUA 1XUDA 1L6JA 2OXZA 2XS3A 1YP1A 1UTTA 1FM1A 1CXVA 3LK8A 4DF9A 2KRJA 1BUDA 1SLMA 4H49A 2Z2DA 3AIGA 2MZEA 5I43A 5LABA 1OS9A 3K7LA 2CLTA 3E8RA 4HX3A 4AXQA 3EDIA 1HOVA 1ATLA 1KUHA 1BKCA 4GWMA 3KEKA 3WV3A 3O64A 4I03A 1G9KA 2OVXA 1CAQA 5I3MA 1JAOA 1CGFA 1FBLA 1SLNA 1K7GA 1PWWA 1R1JA 2A8HA 1GE5A 4XM8A 3I7IA 1CGEA 4AYKA 1BQQM 3WV1A 4AUOA 2OXUA 1FLSA 3HDAP 3K7NA 3HDBA 5I12A 1MMBA 1BQOA 2X7MA 1G05A 1JAPA 2EROA 3LEAA 1ZXCA 2E3XA 1IABA 4GR0A 5B5OA 1USNA 2OXWA 1JKYA 4XBHA 1BZSA 2J0TA 2QPJA 3N2UA 3F17A 3LQBA 3KEJA 2MZHA 1JIZA 4ON1A 1ASTA 1JK3A 2AYKA 1KUKA 2MLRA 4IJOA 4L19A 5D1SA 5I2ZA 1GO8P 5H8XA 1Z3JA 1IAGA 1I1IP 1C3IA 4GUYA 1Y8JA 3I7GA 1JAQA 1PWPA 3KWVC 1OMJA 1O0QA 3U1RA 3LMCA 2L0RA 3LIKA 2JNPA 3GBOA 1XFZA 2E2DA 2XS4A 3DNGA 1XFWA 3LJZA 3TS4A 4FVLA 4WF6A 1JJ9A 4GR8A 4EFSA 1QJIA 1D7XA 1AYKA 2DDYA 4H3XA 1R54A 3G5CA 2DDFA 1GE7A 3L0VA 3ZUKA 4FXYP 1A85A 1IAAA 3B8ZA 4XM6A 4FU4A 4PKWA 2Y6DA 1G49A 1MMRA 1EB6A 1J7NA 5D2BA 3P24A 1SATA 4HMAA 3USNA 1SMPA 3TT4A 2AIGP 3WV2A 1RM8A 1ND1A 3HBVP 3MA2A 3HYGA 1ZVXA 4A3WA 1YCMA 4GF1A 3ZXHA 4JQGA 1BKCI 1GKDA 4ZR5A 3OHLA 2MZIA 4DD8A 3V96B 2N8RA 3Q2HA 1OM7A 2YB9A 3HBUP 2W0DA 1DTHA 5D1UA 1D5JA 4Q1LA 4A7BA 3LQ0A 1ZS0A 1ZXVA 1G12A 5D1TA 3LJGA 1KUIA 1D8MA 1B8YA 1Q3AA 4DV8A 4I35A 4H2EA 456CA 1R1HA 1XFVA 1XFUA 3LKAA 3F18A 4PKSA 1GE6A 1BKCE 2DW2A 3KRYA 5CZMA 1OO9A 3AYKA 1CK7A 3KMEA 1R1IA 4H82A 2FV9A 3EHXA 5CXAA 5D3CA 3Q2GA 2YIGA 2W12A 4IUWA 3DSLA 5CUHA 2FV5A 3EHYA 3B2ZA 2WO8A 3RTTA 1EUBA 1AF0A 1XUCA 1S4BP 1PWUA 2JT6A 4XCTA 1UTZA 1UEAA 3NX7A 2K9CA 1DMTA 2DW1A 2ERQA 1UMSA 2I47A 3VTGA 1C7KA 3KMCA 3DWBA 2WO9A 3KECA 2K2GA 3F19A 830CA 1ZP5A 2JIHA 4GWNA 4JPAA 4FXQA 1ROSA 2PJTA 1O0TA 3HY7A 4H1QA 3LUMA 1OM8A 1I73A 2JSDA 2Y6CA 1K7QA 2OZRA 1KUGA 1JIWP 5JMYA 3TSKA 4IN9A 4ILWD 1QJJA 3EDGA 1KAPP 3LE9A 3HB2P 1GO7P 2X3BA 4WK7A 4G9LA 4PKVA 1IAEA 2W14A 1QICA 1XFXA 1B3DA 3EWJA 4H84A 2WOAA 1MMQA 3G42A 1YQYA 3F15A 3KHIA 4QKZA 1PWVA 4PKUA 1XURA 2OW1A 1IACA 1XFYA 4PKRA 1G4KA 2OI0A 1HTDA 1A86A 2RJPA 1MMPA 3DPFA 1C8TA 1H71P 1HFCA 3DPEA 2CKIA 1BUVM 1QUAA 2SRTA 1HFSA 2RJQA 2W13A 2OW0A 1I76A 3LJTA 966CA 1RMZA 1GXDA 4G0DA 1AKLA 1BSWA 1HV5A 1K7IA 4PKQA 2O36A 3L0TA 2POJA 1Y0VA 3N2VA 3BA0A 4L6TA 2OY2A 2W15A 5L79A 1CGLA 3DL1A 1BIWA
chains in the Genus database with same CATH superfamily
2X3AA 4CTHA 3SHIA 1IADA 1WNIA 1QIAA 3UVCA 2JT5A 3EDHA 1XAXA 4PKTA 1OS2A 1EAKA 3CKIA 4JA1A 1QIBA 3TVCA 3LUNA 2OW2A 4J4MA 4WKIA 4XM7A 1OM6A 3ELMA 1R55A 4H76A 1PWQA 1GKCA 2HU6A 5D7WA 1ZTQA 1JH1A 4WZVA 3ZVSA 4JIJA 1UMTA 2OW9A 1BM6A 3OHOA 3B92A 2V4BA 1SRPA 3HY9A 2D1NA 5L7FA 4DPEA 2MLSA 4AIGA 5B5PA 4L63A 4H30A 1Y93A 2ERPA 3F16A 2X3CA 3LILA 1JANA 4JP4A 5BPAA 2USNA 5I4OA 2J83A 2TCLA 1SU3A 5I0LA 1CQRA 1D8FA 4R3VA 1HY7A 2D1OA 5BOYA 3RTSA 4GR3A 1CIZA 2YUFA 4GQLA 5BOTA 2OY4A 3VI1A 3LGPA 3LIRA 1MNCA 1KBCA 2O3EA 3EDZA 2DW0A 2OVZA 1KUFA 4WKEA 3O2XA 3AYUA 3F1AA 3P1VA 1YOUA 1XUDA 1L6JA 2OXZA 2XS3A 1YP1A 1UTTA 1FM1A 1CXVA 3LK8A 4DF9A 2KRJA 1BUDA 1SLMA 4H49A 3DTEA 2Z2DA 3AIGA 2MZEA 5I43A 5LABA 1OS9A 3K7LA 2CLTA 1OZ9A 3E8RA 4HX3A 4AXQA 3EDIA 1HOVA 1ATLA 1KUHA 1BKCA 4GWMA 3KEKA 1TVIA 3WV3A 3O64A 4I03A 1G9KA 2OVXA 1CAQA 5I3MA 1JAOA 1CGFA 1FBLA 1SLNA 1K7GA 1PWWA 1R1JA 2A8HA 1GE5A 4XM8A 3I7IA 1CGEA 4AYKA 1BQQM 3WV1A 4AUOA 2OXUA 1FLSA 3HDAP 3K7NA 3HDBA 5I12A 1MMBA 1BQOA 2X7MA 1G05A 1JAPA 2EROA 3LEAA 1ZXCA 2E3XA 1IABA 4GR0A 5B5OA 1USNA 2OXWA 1JKYA 4XBHA 1BZSA 2J0TA 2QPJA 3N2UA 3F17A 3LQBA 3KEJA 2MZHA 1JIZA 3DTKA 4ON1A 4L7AA 1ASTA 1JK3A 2AYKA 1KUKA 2MLRA 4IJOA 4L19A 5D1SA 5I2ZA 1GO8P 5H8XA 1Z3JA 1IAGA 1I1IP 1C3IA 4GUYA 1Y8JA 3I7GA 1JAQA 1PWPA 3KWVC 1OMJA 1O0QA 3U1RA 3LMCA 2L0RA 3LIKA 2JNPA 3GBOA 1XFZA 2E2DA 2XS4A 3DNGA 1XFWA 3LJZA 3TS4A 4FVLA 4WF6A 1JJ9A 4GR8A 4EFSA 1QJIA 1D7XA 1AYKA 2DDYA 4H3XA 1R54A 3G5CA 2DDFA 1GE7A 3L0VA 3ZUKA 4FXYP 1A85A 1IAAA 3B8ZA 4XM6A 4FU4A 4PKWA 2Y6DA 1G49A 1MMRA 1EB6A 1J7NA 5D2BA 3P24A 1SATA 4HMAA 3USNA 1SMPA 3TT4A 2AIGP 3WV2A 1RM8A 1ND1A 3HBVP 3MA2A 3HYGA 1ZVXA 4A3WA 1YCMA 4GF1A 3ZXHA 4JQGA 1BKCI 1GKDA 4ZR5A 3OHLA 2MZIA 4DD8A 3V96B 2N8RA 3Q2HA 1OM7A 2YB9A 3HBUP 2W0DA 1DTHA 5D1UA 1D5JA 4Q1LA 4A7BA 3LQ0A 1ZS0A 1ZXVA 1G12A 5D1TA 1KUIA 1D8MA 1B8YA 1Q3AA 3LJGA 4DV8A 4I35A 4H2EA 456CA 1R1HA 1XM5A 1XFVA 1XFUA 3LKAA 3F18A 4PKSA 1GE6A 1BKCE 2DW2A 3KRYA 5CZMA 1OO9A 3AYKA 1CK7A 3KMEA 1R1IA 4H82A 2FV9A 3EHXA 5CXAA 5D3CA 3Q2GA 2YIGA 2W12A 4IUWA 3DSLA 5CUHA 2FV5A 3EHYA 3B2ZA 2WO8A 3RTTA 1EUBA 1AF0A 1XUCA 3DTIA 1S4BP 1PWUA 2JT6A 4XCTA 1UTZA 1UEAA 3NX7A 2K9CA 1DMTA 2DW1A 2ERQA 1UMSA 2I47A 3VTGA 1C7KA 3KMCA 3DWBA 2WO9A 3KECA 2K2GA 3F19A 830CA 1ZP5A 2JIHA 4GWNA 4JPAA 4FXQA 1ROSA 2PJTA 1O0TA 3HY7A 4H1QA 3LUMA 1OM8A 1I73A 2JSDA 2Y6CA 1K7QA 2OZRA 1KUGA 1JIWP 5JMYA 3TSKA 4IN9A 4ILWD 1QJJA 3EDGA 1KAPP 3LE9A 3HB2P 1GO7P 2X3BA 4WK7A 4G9LA 4PKVA 1IAEA 2W14A 1QICA 1XFXA 1B3DA 3EWJA 4H84A 2WOAA 1MMQA 3G42A 1YQYA 3F15A 3KHIA 4QKZA 1PWVA 4PKUA 1XURA 2OW1A 1IACA 1XFYA 4PKRA 1G4KA 2OI0A 1HTDA 1A86A 2RJPA 1MMPA 3DPFA 1C8TA 1H71P 1HFCA 3DPEA 2CKIA 1BUVM 1QUAA 2SRTA 1HFSA 2RJQA 2W13A 2OW0A 1I76A 3LJTA 966CA 1RMZA 1GXDA 4G0DA 1AKLA 1BSWA 1HV5A 1K7IA 4PKQA 2O36A 3L0TA 2POJA 1Y0VA 3N2VA 3BA0A 4L6TA 2OY2A 2W15A 5L79A 1CGLA 3DL1A 1BIWA
chains in the Genus database with same CATH topology
2X3AA 4CTHA 3SHIA 1IADA 1WNIA 1QIAA 3UVCA 2JT5A 3EDHA 4PKTA 1OS2A 1EAKA 3CKIA 4JA1A 1QIBA 3TVCA 3LUNA 2OW2A 4J4MA 4WKIA 4XM7A 1OM6A 3ELMA 1R55A 4H76A 1PWQA 1GKCA 2HU6A 5D7WA 1ZTQA 1JH1A 4WZVA 3ZVSA 4JIJA 1UMTA 2OW9A 1BM6A 3OHOA 3B92A 2V4BA 1SRPA 3HY9A 2D1NA 5L7FA 4DPEA 2MLSA 4AIGA 5B5PA 4L63A 4H30A 1Y93A 2ERPA 3F16A 2X3CA 3LILA 1JANA 4JP4A 5BPAA 2USNA 5I4OA 2J83A 2TCLA 1SU3A 5I0LA 1CQRA 1D8FA 4R3VA 1HY7A 2D1OA 5BOYA 3RTSA 4GR3A 1CIZA 2YUFA 4GQLA 5BOTA 2OY4A 3VI1A 3LGPA 3LIRA 1MNCA 1KBCA 2O3EA 3EDZA 2DW0A 2OVZA 1KUFA 4WKEA 3O2XA 3AYUA 3F1AA 3P1VA 1YOUA 1XUDA 1L6JA 2OXZA 2XS3A 1YP1A 1UTTA 1FM1A 1CXVA 3LK8A 4DF9A 2KRJA 1BUDA 1SLMA 4H49A 3DTEA 2Z2DA 3AIGA 2MZEA 5I43A 5LABA 1OS9A 3K7LA 2CLTA 3E8RA 4HX3A 4AXQA 3EDIA 1HOVA 1ATLA 1KUHA 1BKCA 4GWMA 3KEKA 3WV3A 3O64A 4I03A 1G9KA 2OVXA 1CAQA 5I3MA 1JAOA 1CGFA 1FBLA 1SLNA 1K7GA 1PWWA 1R1JA 2A8HA 1GE5A 4XM8A 3I7IA 1CGEA 4AYKA 1BQQM 3WV1A 4AUOA 2OXUA 1FLSA 3HDAP 3K7NA 3HDBA 5I12A 1MMBA 1BQOA 2X7MA 1G05A 1JAPA 2EROA 3LEAA 1ZXCA 2E3XA 1IABA 4GR0A 5B5OA 1USNA 2OXWA 1JKYA 4XBHA 1BZSA 2J0TA 2QPJA 3N2UA 3F17A 3LQBA 3KEJA 2MZHA 1JIZA 3DTKA 4ON1A 4L7AA 1ASTA 1JK3A 2AYKA 1KUKA 2MLRA 4IJOA 4L19A 5D1SA 5I2ZA 1GO8P 5H8XA 1Z3JA 1IAGA 1I1IP 1C3IA 4GUYA 1Y8JA 3I7GA 1JAQA 1PWPA 3KWVC 1OMJA 1O0QA 3U1RA 3LMCA 2L0RA 3LIKA 2JNPA 3GBOA 1XFZA 2E2DA 2XS4A 3DNGA 1XFWA 3LJZA 3TS4A 4FVLA 4WF6A 1JJ9A 4GR8A 4EFSA 1QJIA 1D7XA 1AYKA 2DDYA 4H3XA 1R54A 3G5CA 2DDFA 1GE7A 3L0VA 3ZUKA 4FXYP 1A85A 1IAAA 3B8ZA 4XM6A 4FU4A 4PKWA 2Y6DA 1G49A 1MMRA 1EB6A 1J7NA 5D2BA 3P24A 1SATA 4HMAA 3USNA 1SMPA 3TT4A 2AIGP 3WV2A 1RM8A 1ND1A 3HBVP 3MA2A 3HYGA 1ZVXA 4A3WA 1YCMA 4GF1A 3ZXHA 4JQGA 1BKCI 1GKDA 4ZR5A 3OHLA 2MZIA 4DD8A 3V96B 2N8RA 3Q2HA 1OM7A 2YB9A 3HBUP 2W0DA 1DTHA 5D1UA 1D5JA 4Q1LA 4A7BA 3LQ0A 1ZS0A 1ZXVA 1G12A 5D1TA 3LJGA 1KUIA 1D8MA 1B8YA 1Q3AA 4DV8A 4I35A 4H2EA 456CA 1R1HA 1XFVA 1XFUA 3LKAA 3F18A 4PKSA 1GE6A 1BKCE 2DW2A 3KRYA 5CZMA 1OO9A 3AYKA 1CK7A 3KMEA 1R1IA 4H82A 2FV9A 3EHXA 5CXAA 5D3CA 3Q2GA 2YIGA 2W12A 4IUWA 3DSLA 5CUHA 2FV5A 3EHYA 3B2ZA 2WO8A 3RTTA 1EUBA 1AF0A 1XUCA 3DTIA 1S4BP 1PWUA 2JT6A 4XCTA 1UTZA 1UEAA 3NX7A 2K9CA 1DMTA 2DW1A 2ERQA 1UMSA 2I47A 3VTGA 1C7KA 3KMCA 3DWBA 2WO9A 3KECA 2K2GA 3F19A 830CA 1ZP5A 2JIHA 4GWNA 4JPAA 4FXQA 1ROSA 2PJTA 1O0TA 3HY7A 4H1QA 3LUMA 1OM8A 1I73A 2JSDA 2Y6CA 1K7QA 2OZRA 1KUGA 1JIWP 5JMYA 3TSKA 4IN9A 4ILWD 1QJJA 3EDGA 1KAPP 3LE9A 3HB2P 1GO7P 2X3BA 4WK7A 4G9LA 4PKVA 1IAEA 2W14A 1QICA 1XFXA 1B3DA 3EWJA 4H84A 2WOAA 1MMQA 3G42A 1YQYA 3F15A 3KHIA 4QKZA 1PWVA 4PKUA 1XURA 2OW1A 1IACA 1XFYA 4PKRA 1G4KA 2OI0A 1HTDA 1A86A 2RJPA 1MMPA 3DPFA 1C8TA 1H71P 1HFCA 3DPEA 2CKIA 1BUVM 1QUAA 2SRTA 1HFSA 2RJQA 2W13A 2OW0A 1I76A 3LJTA 966CA 1RMZA 1GXDA 4G0DA 1AKLA 1BSWA 1HV5A 1K7IA 4PKQA 2O36A 3L0TA 2POJA 1Y0VA 3N2VA 3BA0A 4L6TA 2OY2A 2W15A 5L79A 1CGLA 3DL1A 1BIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3A A;  4CTH A;  3SHI A;  1IAD A;  1WNI A;  1QIA A;  3UVC A;  2JT5 A;  3EDH A;  4PKT A;  1OS2 A;  1EAK A;  3CKI A;  4JA1 A;  1QIB A;  3TVC A;  3LUN A;  2OW2 A;  4J4M A;  4WKI A;  4XM7 A;  1OM6 A;  3ELM A;  1R55 A;  4H76 A;  1PWQ A;  1GKC A;  2HU6 A;  5D7W A;  1ZTQ A;  1JH1 A;  4WZV A;  3ZVS A;  4JIJ A;  1UMT A;  2OW9 A;  1BM6 A;  3OHO A;  3B92 A;  2V4B A;  1SRP A;  3HY9 A;  2D1N A;  5L7F A;  4DPE A;  2MLS A;  4AIG A;  5B5P A;  4L63 A;  4H30 A;  1Y93 A;  2ERP A;  3F16 A;  2X3C A;  3LIL A;  1JAN A;  4JP4 A;  5BPA A;  2USN A;  5I4O A;  2J83 A;  2TCL A;  1SU3 A;  5I0L A;  1CQR A;  1D8F A;  4R3V A;  1HY7 A;  2D1O A;  5BOY A;  3RTS A;  4GR3 A;  1CIZ A;  4GQL A;  5BOT A;  2OY4 A;  3VI1 A;  3LGP A;  3LIR A;  1MNC A;  1KBC A;  2O3E A;  3EDZ A;  2DW0 A;  2OVZ A;  1KUF A;  4WKE A;  3O2X A;  3AYU A;  3F1A A;  3P1V A;  1YOU A;  1XUD A;  1L6J A;  2OXZ A;  2XS3 A;  1YP1 A;  1UTT A;  1FM1 A;  1CXV A;  3LK8 A;  4DF9 A;  2KRJ A;  1BUD A;  1SLM A;  4H49 A;  2Z2D A;  3AIG A;  2MZE A;  5I43 A;  5LAB A;  1OS9 A;  3K7L A;  2CLT A;  3E8R A;  4HX3 A;  4AXQ A;  3EDI A;  1HOV A;  1ATL A;  1KUH A;  1BKC A;  4GWM A;  3KEK A;  3WV3 A;  3O64 A;  4I03 A;  1G9K A;  2OVX A;  1CAQ A;  5I3M A;  1JAO A;  1CGF A;  1FBL A;  1SLN A;  1K7G A;  1PWW A;  1R1J A;  2A8H A;  1GE5 A;  4XM8 A;  3I7I A;  1CGE A;  4AYK A;  1BQQ M;  3WV1 A;  4AUO A;  2OXU A;  1FLS A;  3HDA P;  3K7N A;  3HDB A;  5I12 A;  1MMB A;  1BQO A;  2X7M A;  1G05 A;  1JAP A;  2ERO A;  3LEA A;  1ZXC A;  2E3X A;  1IAB A;  4GR0 A;  5B5O A;  1USN A;  2OXW A;  1JKY A;  4XBH A;  1BZS A;  2J0T A;  2QPJ A;  3N2U A;  3F17 A;  3LQB A;  3KEJ A;  2MZH A;  1JIZ A;  4ON1 A;  1AST A;  1JK3 A;  2AYK A;  1KUK A;  2MLR A;  4IJO A;  4L19 A;  5D1S A;  5I2Z A;  1GO8 P;  5H8X A;  1Z3J A;  1IAG A;  1I1I P;  1C3I A;  4GUY A;  1Y8J A;  3I7G A;  1JAQ A;  1PWP A;  3KWV C;  1OMJ A;  1O0Q A;  3U1R A;  3LMC A;  2L0R A;  3LIK A;  2JNP A;  3GBO A;  1XFZ A;  2E2D A;  2XS4 A;  3DNG A;  1XFW A;  3LJZ A;  3TS4 A;  4FVL A;  4WF6 A;  1JJ9 A;  4GR8 A;  4EFS A;  1QJI A;  1D7X A;  1AYK A;  2DDY A;  4H3X A;  1R54 A;  3G5C A;  2DDF A;  1GE7 A;  3L0V A;  3ZUK A;  4FXY P;  1A85 A;  1IAA A;  3B8Z A;  4XM6 A;  4FU4 A;  4PKW A;  2Y6D A;  1G49 A;  1MMR A;  1EB6 A;  1J7N A;  5D2B A;  3P24 A;  1SAT A;  4HMA A;  3USN A;  1SMP A;  3TT4 A;  2AIG P;  3WV2 A;  1RM8 A;  1ND1 A;  3HBV P;  3MA2 A;  3HYG A;  1ZVX A;  4A3W A;  1YCM A;  4GF1 A;  3ZXH A;  4JQG A;  1BKC I;  1GKD A;  4ZR5 A;  3OHL A;  2MZI A;  4DD8 A;  3V96 B;  2N8R A;  3Q2H A;  1OM7 A;  2YB9 A;  3HBU P;  2W0D A;  1DTH A;  5D1U A;  1D5J A;  4Q1L A;  4A7B A;  3LQ0 A;  1ZS0 A;  1ZXV A;  1G12 A;  5D1T A;  3LJG A;  1KUI A;  1D8M A;  1B8Y A;  1Q3A A;  4DV8 A;  4I35 A;  4H2E A;  456C A;  1R1H A;  1XFV A;  1XFU A;  3LKA A;  3F18 A;  4PKS A;  1GE6 A;  1BKC E;  2DW2 A;  3KRY A;  5CZM A;  1OO9 A;  3AYK A;  1CK7 A;  3KME A;  1R1I A;  4H82 A;  2FV9 A;  3EHX A;  5CXA A;  5D3C A;  3Q2G A;  2YIG A;  2W12 A;  4IUW A;  3DSL A;  5CUH A;  2FV5 A;  3EHY A;  3B2Z A;  2WO8 A;  3RTT A;  1EUB A;  1AF0 A;  1XUC A;  1S4B P;  1PWU A;  2JT6 A;  4XCT A;  1UTZ A;  1UEA A;  3NX7 A;  2K9C A;  1DMT A;  2DW1 A;  2ERQ A;  1UMS A;  2I47 A;  3VTG A;  1C7K A;  3KMC A;  3DWB A;  2WO9 A;  3KEC A;  2K2G A;  3F19 A;  830C A;  1ZP5 A;  2JIH A;  4GWN A;  4JPA A;  4FXQ A;  1ROS A;  2PJT A;  1O0T A;  3HY7 A;  4H1Q A;  3LUM A;  1OM8 A;  1I73 A;  2JSD A;  2Y6C A;  1K7Q A;  2OZR A;  1KUG A;  1JIW P;  5JMY A;  3TSK A;  4IN9 A;  4ILW D;  1QJJ A;  3EDG A;  1KAP P;  3LE9 A;  3HB2 P;  1GO7 P;  2X3B A;  4WK7 A;  4G9L A;  4PKV A;  1IAE A;  2W14 A;  1QIC A;  1XFX A;  1B3D A;  3EWJ A;  4H84 A;  2WOA A;  1MMQ A;  3G42 A;  1YQY A;  3F15 A;  3KHI A;  4QKZ A;  1PWV A;  4PKU A;  1XUR A;  2OW1 A;  1IAC A;  1XFY A;  4PKR A;  1G4K A;  2OI0 A;  1HTD A;  1A86 A;  2RJP A;  1MMP A;  3DPF A;  1C8T A;  1H71 P;  1HFC A;  3DPE A;  2CKI A;  1BUV M;  1QUA A;  2SRT A;  1HFS A;  2RJQ A;  2W13 A;  2OW0 A;  1I76 A;  3LJT A;  966C A;  1RMZ A;  1GXD A;  4G0D A;  1AKL A;  1BSW A;  1HV5 A;  1K7I A;  4PKQ A;  2O36 A;  3L0T A;  2POJ A;  1Y0V A;  3N2V A;  3BA0 A;  4L6T A;  2OY2 A;  2W15 A;  5L79 A;  1CGL A;  3DL1 A;  1BIW A; 
#chains in the Genus database with same CATH topology
 2X3A A;  4CTH A;  3SHI A;  1IAD A;  1WNI A;  1QIA A;  3UVC A;  2JT5 A;  3EDH A;  1XAX A;  4PKT A;  1OS2 A;  1EAK A;  3CKI A;  4JA1 A;  1QIB A;  3TVC A;  3LUN A;  2OW2 A;  4J4M A;  4WKI A;  4XM7 A;  1OM6 A;  3ELM A;  1R55 A;  4H76 A;  1PWQ A;  1GKC A;  2HU6 A;  5D7W A;  1ZTQ A;  1JH1 A;  4WZV A;  3ZVS A;  4JIJ A;  1UMT A;  2OW9 A;  1BM6 A;  3OHO A;  3B92 A;  2V4B A;  1SRP A;  3HY9 A;  2D1N A;  5L7F A;  4DPE A;  2MLS A;  4AIG A;  5B5P A;  4L63 A;  4H30 A;  1Y93 A;  2ERP A;  3F16 A;  2X3C A;  3LIL A;  1JAN A;  4JP4 A;  5BPA A;  2USN A;  5I4O A;  2J83 A;  2TCL A;  1SU3 A;  5I0L A;  1CQR A;  1D8F A;  4R3V A;  1HY7 A;  2D1O A;  5BOY A;  3RTS A;  4GR3 A;  1CIZ A;  2YUF A;  4GQL A;  5BOT A;  2OY4 A;  3VI1 A;  3LGP A;  3LIR A;  1MNC A;  1KBC A;  2O3E A;  3EDZ A;  2DW0 A;  2OVZ A;  1KUF A;  4WKE A;  3O2X A;  3AYU A;  3F1A A;  3P1V A;  1YOU A;  1XUD A;  1L6J A;  2OXZ A;  2XS3 A;  1YP1 A;  1UTT A;  1FM1 A;  1CXV A;  3LK8 A;  4DF9 A;  2KRJ A;  1BUD A;  1SLM A;  4H49 A;  3DTE A;  2Z2D A;  3AIG A;  2MZE A;  5I43 A;  5LAB A;  1OS9 A;  3K7L A;  2CLT A;  1OZ9 A;  3E8R A;  4HX3 A;  4AXQ A;  3EDI A;  1HOV A;  1ATL A;  1KUH A;  1BKC A;  4GWM A;  3KEK A;  1TVI A;  3WV3 A;  3O64 A;  4I03 A;  1G9K A;  2OVX A;  1CAQ A;  5I3M A;  1JAO A;  1CGF A;  1FBL A;  1SLN A;  1K7G A;  1PWW A;  1R1J A;  2A8H A;  1GE5 A;  4XM8 A;  3I7I A;  1CGE A;  4AYK A;  1BQQ M;  3WV1 A;  4AUO A;  2OXU A;  1FLS A;  3HDA P;  3K7N A;  3HDB A;  5I12 A;  1MMB A;  1BQO A;  2X7M A;  1G05 A;  1JAP A;  2ERO A;  3LEA A;  1ZXC A;  2E3X A;  1IAB A;  4GR0 A;  5B5O A;  1USN A;  2OXW A;  1JKY A;  4XBH A;  1BZS A;  2J0T A;  2QPJ A;  3N2U A;  3F17 A;  3LQB A;  3KEJ A;  2MZH A;  1JIZ A;  3DTK A;  4ON1 A;  4L7A A;  1AST A;  1JK3 A;  2AYK A;  1KUK A;  2MLR A;  4IJO A;  4L19 A;  5D1S A;  5I2Z A;  1GO8 P;  5H8X A;  1Z3J A;  1IAG A;  1I1I P;  1C3I A;  4GUY A;  1Y8J A;  3I7G A;  1JAQ A;  1PWP A;  3KWV C;  1OMJ A;  1O0Q A;  3U1R A;  3LMC A;  2L0R A;  3LIK A;  2JNP A;  3GBO A;  1XFZ A;  2E2D A;  2XS4 A;  3DNG A;  1XFW A;  3LJZ A;  3TS4 A;  4FVL A;  4WF6 A;  1JJ9 A;  4GR8 A;  4EFS A;  1QJI A;  1D7X A;  1AYK A;  2DDY A;  4H3X A;  1R54 A;  3G5C A;  2DDF A;  1GE7 A;  3L0V A;  3ZUK A;  4FXY P;  1A85 A;  1IAA A;  3B8Z A;  4XM6 A;  4FU4 A;  4PKW A;  2Y6D A;  1G49 A;  1MMR A;  1EB6 A;  1J7N A;  5D2B A;  3P24 A;  1SAT A;  4HMA A;  3USN A;  1SMP A;  3TT4 A;  2AIG P;  3WV2 A;  1RM8 A;  1ND1 A;  3HBV P;  3MA2 A;  3HYG A;  1ZVX A;  4A3W A;  1YCM A;  4GF1 A;  3ZXH A;  4JQG A;  1BKC I;  1GKD A;  4ZR5 A;  3OHL A;  2MZI A;  4DD8 A;  3V96 B;  2N8R A;  3Q2H A;  1OM7 A;  2YB9 A;  3HBU P;  2W0D A;  1DTH A;  5D1U A;  1D5J A;  4Q1L A;  4A7B A;  3LQ0 A;  1ZS0 A;  1ZXV A;  1G12 A;  5D1T A;  1KUI A;  1D8M A;  1B8Y A;  1Q3A A;  3LJG A;  4DV8 A;  4I35 A;  4H2E A;  456C A;  1R1H A;  1XM5 A;  1XFV A;  1XFU A;  3LKA A;  3F18 A;  4PKS A;  1GE6 A;  1BKC E;  2DW2 A;  3KRY A;  5CZM A;  1OO9 A;  3AYK A;  1CK7 A;  3KME A;  1R1I A;  4H82 A;  2FV9 A;  3EHX A;  5CXA A;  5D3C A;  3Q2G A;  2YIG A;  2W12 A;  4IUW A;  3DSL A;  5CUH A;  2FV5 A;  3EHY A;  3B2Z A;  2WO8 A;  3RTT A;  1EUB A;  1AF0 A;  1XUC A;  3DTI A;  1S4B P;  1PWU A;  2JT6 A;  4XCT A;  1UTZ A;  1UEA A;  3NX7 A;  2K9C A;  1DMT A;  2DW1 A;  2ERQ A;  1UMS A;  2I47 A;  3VTG A;  1C7K A;  3KMC A;  3DWB A;  2WO9 A;  3KEC A;  2K2G A;  3F19 A;  830C A;  1ZP5 A;  2JIH A;  4GWN A;  4JPA A;  4FXQ A;  1ROS A;  2PJT A;  1O0T A;  3HY7 A;  4H1Q A;  3LUM A;  1OM8 A;  1I73 A;  2JSD A;  2Y6C A;  1K7Q A;  2OZR A;  1KUG A;  1JIW P;  5JMY A;  3TSK A;  4IN9 A;  4ILW D;  1QJJ A;  3EDG A;  1KAP P;  3LE9 A;  3HB2 P;  1GO7 P;  2X3B A;  4WK7 A;  4G9L A;  4PKV A;  1IAE A;  2W14 A;  1QIC A;  1XFX A;  1B3D A;  3EWJ A;  4H84 A;  2WOA A;  1MMQ A;  3G42 A;  1YQY A;  3F15 A;  3KHI A;  4QKZ A;  1PWV A;  4PKU A;  1XUR A;  2OW1 A;  1IAC A;  1XFY A;  4PKR A;  1G4K A;  2OI0 A;  1HTD A;  1A86 A;  2RJP A;  1MMP A;  3DPF A;  1C8T A;  1H71 P;  1HFC A;  3DPE A;  2CKI A;  1BUV M;  1QUA A;  2SRT A;  1HFS A;  2RJQ A;  2W13 A;  2OW0 A;  1I76 A;  3LJT A;  966C A;  1RMZ A;  1GXD A;  4G0D A;  1AKL A;  1BSW A;  1HV5 A;  1K7I A;  4PKQ A;  2O36 A;  3L0T A;  2POJ A;  1Y0V A;  3N2V A;  3BA0 A;  4L6T A;  2OY2 A;  2W15 A;  5L79 A;  1CGL A;  3DL1 A;  1BIW A; 
#chains in the Genus database with same CATH homology
 2X3A A;  4CTH A;  3SHI A;  1IAD A;  1WNI A;  1QIA A;  3UVC A;  2JT5 A;  3EDH A;  4PKT A;  1OS2 A;  1EAK A;  3CKI A;  4JA1 A;  1QIB A;  3TVC A;  3LUN A;  2OW2 A;  4J4M A;  4WKI A;  4XM7 A;  1OM6 A;  3ELM A;  1R55 A;  4H76 A;  1PWQ A;  1GKC A;  2HU6 A;  5D7W A;  1ZTQ A;  1JH1 A;  4WZV A;  3ZVS A;  4JIJ A;  1UMT A;  2OW9 A;  1BM6 A;  3OHO A;  3B92 A;  2V4B A;  1SRP A;  3HY9 A;  2D1N A;  5L7F A;  4DPE A;  2MLS A;  4AIG A;  5B5P A;  4L63 A;  4H30 A;  1Y93 A;  2ERP A;  3F16 A;  2X3C A;  3LIL A;  1JAN A;  4JP4 A;  5BPA A;  2USN A;  5I4O A;  2J83 A;  2TCL A;  1SU3 A;  5I0L A;  1CQR A;  1D8F A;  4R3V A;  1HY7 A;  2D1O A;  5BOY A;  3RTS A;  4GR3 A;  1CIZ A;  2YUF A;  4GQL A;  5BOT A;  2OY4 A;  3VI1 A;  3LGP A;  3LIR A;  1MNC A;  1KBC A;  2O3E A;  3EDZ A;  2DW0 A;  2OVZ A;  1KUF A;  4WKE A;  3O2X A;  3AYU A;  3F1A A;  3P1V A;  1YOU A;  1XUD A;  1L6J A;  2OXZ A;  2XS3 A;  1YP1 A;  1UTT A;  1FM1 A;  1CXV A;  3LK8 A;  4DF9 A;  2KRJ A;  1BUD A;  1SLM A;  4H49 A;  3DTE A;  2Z2D A;  3AIG A;  2MZE A;  5I43 A;  5LAB A;  1OS9 A;  3K7L A;  2CLT A;  3E8R A;  4HX3 A;  4AXQ A;  3EDI A;  1HOV A;  1ATL A;  1KUH A;  1BKC A;  4GWM A;  3KEK A;  3WV3 A;  3O64 A;  4I03 A;  1G9K A;  2OVX A;  1CAQ A;  5I3M A;  1JAO A;  1CGF A;  1FBL A;  1SLN A;  1K7G A;  1PWW A;  1R1J A;  2A8H A;  1GE5 A;  4XM8 A;  3I7I A;  1CGE A;  4AYK A;  1BQQ M;  3WV1 A;  4AUO A;  2OXU A;  1FLS A;  3HDA P;  3K7N A;  3HDB A;  5I12 A;  1MMB A;  1BQO A;  2X7M A;  1G05 A;  1JAP A;  2ERO A;  3LEA A;  1ZXC A;  2E3X A;  1IAB A;  4GR0 A;  5B5O A;  1USN A;  2OXW A;  1JKY A;  4XBH A;  1BZS A;  2J0T A;  2QPJ A;  3N2U A;  3F17 A;  3LQB A;  3KEJ A;  2MZH A;  1JIZ A;  3DTK A;  4ON1 A;  4L7A A;  1AST A;  1JK3 A;  2AYK A;  1KUK A;  2MLR A;  4IJO A;  4L19 A;  5D1S A;  5I2Z A;  1GO8 P;  5H8X A;  1Z3J A;  1IAG A;  1I1I P;  1C3I A;  4GUY A;  1Y8J A;  3I7G A;  1JAQ A;  1PWP A;  3KWV C;  1OMJ A;  1O0Q A;  3U1R A;  3LMC A;  2L0R A;  3LIK A;  2JNP A;  3GBO A;  1XFZ A;  2E2D A;  2XS4 A;  3DNG A;  1XFW A;  3LJZ A;  3TS4 A;  4FVL A;  4WF6 A;  1JJ9 A;  4GR8 A;  4EFS A;  1QJI A;  1D7X A;  1AYK A;  2DDY A;  4H3X A;  1R54 A;  3G5C A;  2DDF A;  1GE7 A;  3L0V A;  3ZUK A;  4FXY P;  1A85 A;  1IAA A;  3B8Z A;  4XM6 A;  4FU4 A;  4PKW A;  2Y6D A;  1G49 A;  1MMR A;  1EB6 A;  1J7N A;  5D2B A;  3P24 A;  1SAT A;  4HMA A;  3USN A;  1SMP A;  3TT4 A;  2AIG P;  3WV2 A;  1RM8 A;  1ND1 A;  3HBV P;  3MA2 A;  3HYG A;  1ZVX A;  4A3W A;  1YCM A;  4GF1 A;  3ZXH A;  4JQG A;  1BKC I;  1GKD A;  4ZR5 A;  3OHL A;  2MZI A;  4DD8 A;  3V96 B;  2N8R A;  3Q2H A;  1OM7 A;  2YB9 A;  3HBU P;  2W0D A;  1DTH A;  5D1U A;  1D5J A;  4Q1L A;  4A7B A;  3LQ0 A;  1ZS0 A;  1ZXV A;  1G12 A;  5D1T A;  3LJG A;  1KUI A;  1D8M A;  1B8Y A;  1Q3A A;  4DV8 A;  4I35 A;  4H2E A;  456C A;  1R1H A;  1XFV A;  1XFU A;  3LKA A;  3F18 A;  4PKS A;  1GE6 A;  1BKC E;  2DW2 A;  3KRY A;  5CZM A;  1OO9 A;  3AYK A;  1CK7 A;  3KME A;  1R1I A;  4H82 A;  2FV9 A;  3EHX A;  5CXA A;  5D3C A;  3Q2G A;  2YIG A;  2W12 A;  4IUW A;  3DSL A;  5CUH A;  2FV5 A;  3EHY A;  3B2Z A;  2WO8 A;  3RTT A;  1EUB A;  1AF0 A;  1XUC A;  3DTI A;  1S4B P;  1PWU A;  2JT6 A;  4XCT A;  1UTZ A;  1UEA A;  3NX7 A;  2K9C A;  1DMT A;  2DW1 A;  2ERQ A;  1UMS A;  2I47 A;  3VTG A;  1C7K A;  3KMC A;  3DWB A;  2WO9 A;  3KEC A;  2K2G A;  3F19 A;  830C A;  1ZP5 A;  2JIH A;  4GWN A;  4JPA A;  4FXQ A;  1ROS A;  2PJT A;  1O0T A;  3HY7 A;  4H1Q A;  3LUM A;  1OM8 A;  1I73 A;  2JSD A;  2Y6C A;  1K7Q A;  2OZR A;  1KUG A;  1JIW P;  5JMY A;  3TSK A;  4IN9 A;  4ILW D;  1QJJ A;  3EDG A;  1KAP P;  3LE9 A;  3HB2 P;  1GO7 P;  2X3B A;  4WK7 A;  4G9L A;  4PKV A;  1IAE A;  2W14 A;  1QIC A;  1XFX A;  1B3D A;  3EWJ A;  4H84 A;  2WOA A;  1MMQ A;  3G42 A;  1YQY A;  3F15 A;  3KHI A;  4QKZ A;  1PWV A;  4PKU A;  1XUR A;  2OW1 A;  1IAC A;  1XFY A;  4PKR A;  1G4K A;  2OI0 A;  1HTD A;  1A86 A;  2RJP A;  1MMP A;  3DPF A;  1C8T A;  1H71 P;  1HFC A;  3DPE A;  2CKI A;  1BUV M;  1QUA A;  2SRT A;  1HFS A;  2RJQ A;  2W13 A;  2OW0 A;  1I76 A;  3LJT A;  966C A;  1RMZ A;  1GXD A;  4G0D A;  1AKL A;  1BSW A;  1HV5 A;  1K7I A;  4PKQ A;  2O36 A;  3L0T A;  2POJ A;  1Y0V A;  3N2V A;  3BA0 A;  4L6T A;  2OY2 A;  2W15 A;  5L79 A;  1CGL A;  3DL1 A;  1BIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...