3LUOA

Crystal structure and functional characterization of the thermophilic prolyl isomerase and chaperone slyd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
145
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 28
structure length 145
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3luoA00
1C9HA 1Q1CA 5GPGA 1D6OA 2IF4A 3PRBA 4W9QA 4ODLA 3GPKA 2KGJA 2JZVA 2MNTA 2ZQTA 1F40A 2LPVA 2M2AA 2F4EA 3JYMA 2DG4A 3UQBA 2K8IA 4JYSA 4QT2A 5HT1A 2KFWA 2VN1A 3UF8A 2KO7A 2MLYA 5HW7A 1L1PA 2MF9A 4G2PA 2DG9A 2XP5A 2XPAA 1JVWA 1D7HA 1PINA 2RURA 3TC5A 3KZ7A 2MLXA 1J4RA 3KAFA 2M08A 1B6CA 4MSPA 1FKTA 3RFWA 1PBKA 1NMVA 3IKDA 4R0XA 3NTPA 5HWBA 1HXVA 1ROTA 2ZR5A 4JFMA 3UQAA 1FD9A 3O5OA 2PPOA 4ODPA 5HW6A 4DRJA 5HKGA 1EYMA 2XP8A 2ZQVA 1Y0OA 2UZ5A 4C02B 4DH0A 2RUCA 4TW8A 1U79A 4TW7A 4O2TA 1FKIA 2RSEA 3CGMA 1QPFA 4J4OA 5HW8A 3ODKA 2Y78A 3EY6A 4ODQA 2ITKA 5I98A 5J6EA 2ZQUA 2LGOA 3O5IA 4JFJA 2OFNA 3TDBA 1EQ3A 1FKJA 4DROA 2VCDA 2ZR4A 4GIVA 3O5MA 3O5DA 2XPBA 3O5EA 3PA7A 1FKDA 3IHZA 1R9HA 2XP4A 3CGNA 4DZ3A 4TNSA 2PBCA 3KAIA 4LAYA 4QT3A 1M5YA 3JYJA 4ODKA 4TYOA 2ZQSA 4DZ2A 3H9RB 2DG3A 1FAPA 3O5KA 5HUAA 3NRKA 1D7JA 2F2DA 1YW5A 3O5PA 3KABA 1FKFA 4FAPA 3JXVA 1BKFA 4DRIA 2PV3A 1T11A 2RUQA 2AWGA 2L2SA 1FKGA 1NSGA 3LUOA 3NI6A 4IQ2A 1FKHA 5BXJA 2KI3A 3O5GA 1FKBA 5HWCA 1ROUA 2Q5AA 3VAWA 4J4NA 4DT4A 4DRPA 5DIUA 4TW6A 1ZK6A 2PV2A 3UI4A 4FN2A 2FKEA 1N1AA 4U84A 1Q6UA 2MPHA 4N19A 3MDYB 4W9OA 1QZ2A 5DITA 3PRDA 2F21A 1FKRA 3IK8A 2N87A 3I6CA 3UI5A 2PV1A 2PPPA 4JFKA 4NNRA 1FJDA 3IKGA 4DIPA 1KT1A 1FKSA 1W26A 1J4IA 3KCEA 1JNSA 3RGCA 3O5LA 1FKLA 2FAPA 3UQIA 2XP7A 1BL4A 4QIBA 1ZCNA 4BF8A 3UI6A 2XP9A 5DIVA 5HTGA 2KR7A 3KACA 3O5JA 1KT0A 1J4HA 2XP6A 1JNTA 2PPNA 4IPXA 4ODOA 4TX0A 2XP3A 1P5QA 1Q6HA 4DRHA 2LKNA 4U86A 1D7IA 4LAWA 1QPLA 3KAGA 3OOBA 4GGQA 3O5FA 4JFIA 3FAPA 4LAXA 4DRNA 4ODMA 3KAHA 1TCOC 3KADA 4ODNA 2MLZA 1F8AB 2KE0A 4LAVA 1Q6IA 4IQCA 4JFLA 4DRQA 1J6YA 4G50A 5B8IC 4MGVA 2M1IA 4ITZA 4W9PA 3B7XA 3O5QA 1YATA 3WH0A 1A7XA 5D75A 3TCZA 1FKKA 2D9FA 4DRMA 1NMWA 2RUDA 3O5RA 4U85A 2RQSA 4DRKA 4ODRA 2LJ4A 2ZR6A
chains in the Genus database with same CATH superfamily
1Q1CA 5GPGA 3PRBA 4ODLA 2DT3A 1LQ0A 1GOIA 3GPKA 2YBTA 1E6ZA 3WL1A 3JYMA 2F4EA 2DG4A 2G8ZA 4ZPTR 4JYSA 3GTYX 4QT2A 5HT1A 3WD4A 2KO7A 1L1PA 2MF9A 1XHGA 3TC5A 3KAFA 3RFWA 4S3KA 3IKDA 3NTPA 3FY1A 3UQAA 3O5OA 4ODPA 3CHCA 2WM0A 5HKGA 1HKIA 3BXWA 1E6PA 4UDMA 4HBOA 1NWTA 4KR0B 4O2TA 3CGMA 3EY6A 5I98A 3O5IA 2VCDA 4GIVA 4R5EA 1E15A 3O5DA 2XPBA 4WKAA 3ARWA 3IHZA 4AY1A 4IT4A 2XP4A 2YBUA 3W4RA 4DZ3A 1M5YA 3JYJA 2ZQSA 4WK9A 2PI6A 1IX5A 5HUAA 2WK2A 3NRKA 2F2DA 3O5PA 3JXVA 1BKFA 2RUQA 2AWGA 3EIPA 3VAWA 3ALFA 4J4NA 4DRPA 1SR0A 1NWSA 2PV2A 2FKEA 4P8XA 3MDYB 3IK8A 3AS2A 1FJDA 1NH6A 1W26A 3KCEA 3CH9A 3RGCA 5JH8A 3O5LA 4QIBA 4DWSD 2KR7A 4S3JA 3WD3A 2A3AA 1JNTA 2PPNA 4ODOA 2XP3A 3WD2A 5DF0A 4Z2KA 2F23A 4U86A 1E6RA 4JFIA 2DSVA 4GGQA 4LAXA 4P8UA 3FAPA 4ODMA 3CHEA 1WNOA 4LAVA 2DSWA 3WIJA 1TFVA 1W9VA 2FDMA 3WQVA 3CHFA 4G50A 2OLHA 4MGVA 1HJVA 3RM8A 4MPKA 4W9PA 3WH0A 1A7XA 4HBEA 4DRMA 2RUDA 4ODRA 3WL0A 3ARRA 2LJ4A 5DITA 2ZR6A 2IF4A 3B9AA 1W9UA 4WKFA 3RM9A 2A3BA 2M2AA 3AS3A 3UF8A 2KFWA 2VN1A 3ARVA 3AROA 1RD6A 4G2PA 2ESCA 3PR9A 2RURA 1J4RA 1GUVA 1LL4A 1W1PA 1HJXA 1PBKA 1ROTA 4JFMA 3ARSA 2XP8A 4MNLA 2RUCA 4TW8A 4TW7A 1GPFA 2Y78A 4Q22A 5J6EA 1CTNA 2ZQUA 4URIA 4DWSA 1FKJA 3O5MA 1JCHB 1HKMA 1FKDA 1HKJA 3CGNA 4W5UA 4LAYA 1JNDA 2WLYA 2DG3A 1FAPA 4IQ2A 2G41A 3AS0A 1W1VA 1ROUA 1WB0A 1XRVA 5DEZA 1WAWA 5DIUA 1W9PA 4TW6A 2DT0A 1EHNA 4Z2LA 4FN2A 4DWSC 2MPHA 4N19A 4W9OA 3ALGA 2PV1A 4JFKA 4DIPA 1KT1A 1JNSA 1J4IA 4NSBA 3UQIA 1BL4A 1ZCNA 4BF8A 5HTGA 2XP9A 1ZBWA 1FFQA 4IPXA 4TX0A 2DT1A 3ARUA 2LKNA 4MNMA 4LAWA 3KAGA 4DRNA 3O5FA 3KAHA 2MLZA 4MTVA 1F8AB 1GRJA 2KE0A 3QOKA 4DWSB 4L3NA 4DRQA 4HARA 5B8IC 1YATA 2D9FA 1NMWA 4U85A 3WKZA 2DT2A 1SYTA 2ETNA 4W9QA 1ZBVA 4LGXA 4Z2JA 2JZVA 1F40A 2ZQTA 1NWUA 2LPVA 3UQBA 2MLYA 5HW7A 1OWQA 4MNKA 2XP5A 4WIWA 2DPEA 2IUZA 2A3CA 1B6CA 1FKTA 1LL6A 1ITXA 5GPRA 2ZR5A 1FD9A 4MAVA 2PPOA 5HW6A 1EYMA 4L72B 3GU0A 1Y0OA 2UZ5A 1U79A 5HW8A 2RSEA 3ODKA 2DSZA 3B9DA 2A3EA 4P8WA 3O5EA 1HJWA 3KAIA 3RMEA 4ODKA 4TYOA 4DZ2A 3ARXA 3O5KA 3ARQA 4PTMA 4ZPVR 2B5UB 2PV3A 1LG1A 1FKGA 3NI6A 1FKHA 1D2KA 2KI3A 3O5GA 5HWCA 1LG2A 2Q5AA 3ARPA 2P4VA 3AQUA 4ML4A 2WLZA 1NWRA 3RM4A 1N1AA 4U84A 1ZBCA 1VF8A 1EIBA 4NZCA 1Q6UA 3FXYA 2F21A 1FKRA 1JNEA 3I6CA 2PPPA 4NNRA 3IKGA 1KFWA 1FKSA 2FAPA 2XP7A 3ARZA 1EDQA 3UI6A 5DIVA 3O5JA 3OA5A 4QZVB 2XP6A 1E44A 1Q6HA 4DRHA 3PRAA 3WQWA 1D7IA 1QPLA 1E9LA 1X6NA 4ZS6A 3KADA 4ODNA 1K9TA 4Q7NA 4IQCA 4JFLA 1J6YA 5D75A 3O5RA 2O92A 2RQSA 1UR8A 4P8VA 4DRKA 3B9EA 3ARYA 1C9HA 1D6OA 1W1YA 3G6LA 4XAKA 2KGJA 2MNTA 3B8SA 2B31A 1H0IA 2K8IA 4Z2HA 2DG9A 2XPAA 1JVWA 1D7HA 2PN0A 1PINA 3KZ7A 2MLXA 2M08A 3ARTA 4MSPA 1X6LA 1NMVA 4R0XA 5HWBA 5HBFA 1HXVA 1ZL1A 2O9OA 4DRJA 2ZQVA 4C02B 4DH0A 1H0GA 1FKIA 1LJYA 4J4OA 1QPFA 4WJXA 1OGGA 1FFRA 1O6IA 4ODQA 2ITKA 4JFJA 2LGOA 3TDBA 1EQ3A 2OFNA 1ZBKA 4DROA 2ZR4A 3WD1A 3G6MA 3PA7A 5GQBA 2DSUA 1R9HA 1OGBA 4KQZA 4TNSA 2PBCA 4QT3A 4IT6A 2EULA 3H9RB 1D7JA 4Z2IA 1YW5A 4FAPA 3KABA 1FKFA 1UR9A 4DRIA 1T11A 3LUOA 1ZB5A 2L2SA 5BXJA 1NSGA 1FKBA 4DT4A 4Z2GA 3AS1A 1ZK6A 1W1TA 3CHDA 1LL7A 3UI4A 3CZ8A 4MNJA 1ZU8A 1QZ2A 4ZPWR 3PRDA 2N87A 3UI5A 4WKHA 5DO2A 1FKLA 3KACA 1KT0A 1J4HA 1P5QA 1E6NA 3OOBA 1TCOC 1Q6IA 2M1IA 4ITZA 2AOSA 3B7XA 3O5QA 3TCZA 1FKKA 1HKKA 3BMBA 3WD0A 2QF8A
chains in the Genus database with same CATH topology
1Q1CA 5GPGA 3PRBA 4ODLA 2DT3A 1LQ0A 1GOIA 3GPKA 2YBTA 1E6ZA 3WL1A 3JYMA 2F4EA 2DG4A 2G8ZA 4ZPTR 4JYSA 4QT2A 5HT1A 3WD4A 2KO7A 1L1PA 2MF9A 1XHGA 3TC5A 3KAFA 3RFWA 4S3KA 3IKDA 3NTPA 3FY1A 3UQAA 3O5OA 4ODPA 3CHCA 2WM0A 5HKGA 1HKIA 3BXWA 1E6PA 4HBOA 1NWTA 4KR0B 4O2TA 3CGMA 3EY6A 5I98A 3O5IA 2VCDA 4GIVA 4R5EA 1E15A 3O5DA 2XPBA 4WKAA 3ARWA 3IHZA 4AY1A 4IT4A 2XP4A 2YBUA 3W4RA 4DZ3A 1M5YA 3JYJA 2ZQSA 4WK9A 2PI6A 1IX5A 5HUAA 2WK2A 3NRKA 2F2DA 3O5PA 3JXVA 1BKFA 2RUQA 2AWGA 3VAWA 3ALFA 4J4NA 4DRPA 1SR0A 1NWSA 2PV2A 2FKEA 4P8XA 3MDYB 3IK8A 3AS2A 1FJDA 1NH6A 1W26A 3KCEA 3CH9A 3RGCA 5JH8A 3O5LA 4QIBA 4DWSD 2KR7A 4S3JA 3WD3A 2A3AA 1JNTA 2PPNA 4ODOA 2XP3A 3WD2A 5DF0A 4Z2KA 4U86A 1E6RA 4JFIA 2DSVA 4GGQA 4LAXA 4P8UA 3FAPA 4ODMA 3CHEA 1WNOA 4LAVA 2DSWA 3WIJA 1TFVA 1W9VA 2FDMA 3WQVA 3CHFA 4G50A 2OLHA 4MGVA 1HJVA 3RM8A 4MPKA 4W9PA 3WH0A 1A7XA 4HBEA 4DRMA 2RUDA 4ODRA 3WL0A 3ARRA 2LJ4A 5DITA 2ZR6A 2IF4A 3B9AA 1W9UA 4WKFA 3RM9A 2A3BA 2M2AA 3AS3A 3UF8A 2KFWA 2VN1A 3ARVA 3AROA 1RD6A 4G2PA 2ESCA 3PR9A 2RURA 1J4RA 1GUVA 1LL4A 1W1PA 1HJXA 1PBKA 1ROTA 4JFMA 3ARSA 2XP8A 4MNLA 2RUCA 4TW8A 4TW7A 1GPFA 2Y78A 4Q22A 5J6EA 1CTNA 2ZQUA 4URIA 4DWSA 1FKJA 3O5MA 1HKMA 1FKDA 1HKJA 3CGNA 4W5UA 4LAYA 1JNDA 2WLYA 2DG3A 1FAPA 4IQ2A 2G41A 3AS0A 1W1VA 1ROUA 1WB0A 1XRVA 5DEZA 1WAWA 5DIUA 1W9PA 4TW6A 2DT0A 1EHNA 4Z2LA 4FN2A 4DWSC 2MPHA 4N19A 4W9OA 3ALGA 2PV1A 4JFKA 4DIPA 1KT1A 1JNSA 1J4IA 4NSBA 3UQIA 1BL4A 1ZCNA 4BF8A 5HTGA 2XP9A 1ZBWA 1FFQA 4IPXA 4TX0A 2DT1A 3ARUA 2LKNA 4MNMA 4LAWA 3KAGA 4DRNA 3O5FA 3KAHA 2MLZA 4MTVA 1F8AB 2KE0A 3QOKA 4DWSB 4L3NA 4DRQA 4HARA 5B8IC 1YATA 2D9FA 1NMWA 4U85A 3WKZA 2DT2A 1SYTA 4W9QA 1ZBVA 4LGXA 4Z2JA 2JZVA 1F40A 2ZQTA 1NWUA 2LPVA 3UQBA 2MLYA 5HW7A 1OWQA 4MNKA 2XP5A 4WIWA 2DPEA 2IUZA 2A3CA 1B6CA 1FKTA 1LL6A 1ITXA 5GPRA 2ZR5A 1FD9A 4MAVA 2PPOA 5HW6A 1EYMA 4L72B 1Y0OA 2UZ5A 1U79A 5HW8A 2RSEA 3ODKA 2DSZA 3B9DA 2A3EA 4P8WA 3O5EA 1HJWA 3KAIA 3RMEA 4ODKA 4TYOA 4DZ2A 3ARXA 3O5KA 3ARQA 4PTMA 4ZPVR 2PV3A 1LG1A 1FKGA 3NI6A 1FKHA 1D2KA 2KI3A 3O5GA 5HWCA 1LG2A 2Q5AA 3ARPA 3AQUA 4ML4A 2WLZA 1NWRA 3RM4A 1N1AA 4U84A 1ZBCA 1VF8A 1EIBA 4NZCA 1Q6UA 3FXYA 2F21A 1FKRA 1JNEA 3I6CA 2PPPA 4NNRA 3IKGA 1KFWA 1FKSA 2FAPA 2XP7A 3ARZA 1EDQA 3UI6A 5DIVA 3O5JA 3OA5A 4QZVB 2XP6A 1Q6HA 4DRHA 3PRAA 3WQWA 1D7IA 1QPLA 1E9LA 1X6NA 4ZS6A 3KADA 4ODNA 1K9TA 4Q7NA 4IQCA 4JFLA 1J6YA 5D75A 3O5RA 2O92A 2RQSA 1UR8A 4P8VA 4DRKA 3B9EA 3ARYA 1C9HA 1D6OA 1W1YA 3G6LA 4XAKA 2KGJA 2MNTA 3B8SA 2B31A 1H0IA 2K8IA 4Z2HA 2DG9A 2XPAA 1JVWA 1D7HA 1PINA 3KZ7A 2MLXA 2M08A 3ARTA 4MSPA 1X6LA 1NMVA 4R0XA 5HWBA 5HBFA 1HXVA 1ZL1A 2O9OA 4DRJA 2ZQVA 4C02B 4DH0A 1H0GA 1FKIA 1LJYA 4J4OA 1QPFA 4WJXA 1OGGA 1FFRA 1O6IA 4ODQA 2ITKA 4JFJA 2LGOA 3TDBA 1EQ3A 2OFNA 1ZBKA 4DROA 2ZR4A 3WD1A 3G6MA 3PA7A 5GQBA 2DSUA 1R9HA 1OGBA 4KQZA 4TNSA 2PBCA 4QT3A 4IT6A 3H9RB 1D7JA 4Z2IA 1YW5A 4FAPA 3KABA 1FKFA 1UR9A 4DRIA 1T11A 3LUOA 1ZB5A 2L2SA 5BXJA 1NSGA 1FKBA 4DT4A 4Z2GA 3AS1A 1ZK6A 1W1TA 3CHDA 1LL7A 3UI4A 3CZ8A 4MNJA 1ZU8A 1QZ2A 4ZPWR 3PRDA 2N87A 3UI5A 4WKHA 5DO2A 1FKLA 3KACA 1KT0A 1J4HA 1P5QA 1E6NA 3OOBA 1TCOC 1Q6IA 2M1IA 4ITZA 2AOSA 3B7XA 3O5QA 3TCZA 1FKKA 1HKKA 3WD0A 2QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9H A;  1Q1C A;  5GPG A;  1D6O A;  2IF4 A;  3PRB A;  4W9Q A;  4ODL A;  3GPK A;  2KGJ A;  2JZV A;  2MNT A;  2ZQT A;  1F40 A;  2LPV A;  2M2A A;  2F4E A;  3JYM A;  2DG4 A;  3UQB A;  2K8I A;  4JYS A;  4QT2 A;  5HT1 A;  2KFW A;  2VN1 A;  3UF8 A;  2KO7 A;  2MLY A;  5HW7 A;  1L1P A;  2MF9 A;  4G2P A;  2DG9 A;  2XP5 A;  2XPA A;  1JVW A;  1D7H A;  1PIN A;  2RUR A;  3TC5 A;  3KZ7 A;  2MLX A;  1J4R A;  3KAF A;  2M08 A;  1B6C A;  4MSP A;  1FKT A;  3RFW A;  1PBK A;  1NMV A;  3IKD A;  4R0X A;  3NTP A;  5HWB A;  1HXV A;  1ROT A;  2ZR5 A;  4JFM A;  3UQA A;  1FD9 A;  3O5O A;  2PPO A;  4ODP A;  5HW6 A;  4DRJ A;  5HKG A;  1EYM A;  2XP8 A;  2ZQV A;  1Y0O A;  2UZ5 A;  4C02 B;  4DH0 A;  2RUC A;  4TW8 A;  1U79 A;  4TW7 A;  4O2T A;  1FKI A;  2RSE A;  3CGM A;  1QPF A;  4J4O A;  5HW8 A;  3ODK A;  2Y78 A;  3EY6 A;  4ODQ A;  2ITK A;  5I98 A;  5J6E A;  2ZQU A;  2LGO A;  3O5I A;  4JFJ A;  2OFN A;  3TDB A;  1EQ3 A;  1FKJ A;  4DRO A;  2VCD A;  2ZR4 A;  4GIV A;  3O5M A;  3O5D A;  2XPB A;  3O5E A;  3PA7 A;  1FKD A;  3IHZ A;  1R9H A;  2XP4 A;  3CGN A;  4DZ3 A;  4TNS A;  2PBC A;  3KAI A;  4LAY A;  4QT3 A;  1M5Y A;  3JYJ A;  4ODK A;  4TYO A;  2ZQS A;  4DZ2 A;  3H9R B;  2DG3 A;  1FAP A;  3O5K A;  5HUA A;  3NRK A;  1D7J A;  2F2D A;  1YW5 A;  3O5P A;  3KAB A;  1FKF A;  4FAP A;  3JXV A;  1BKF A;  4DRI A;  2PV3 A;  1T11 A;  2RUQ A;  2AWG A;  2L2S A;  1FKG A;  1NSG A;  3LUO A;  3NI6 A;  4IQ2 A;  1FKH A;  5BXJ A;  2KI3 A;  3O5G A;  1FKB A;  5HWC A;  1ROU A;  2Q5A A;  3VAW A;  4J4N A;  4DT4 A;  4DRP A;  5DIU A;  4TW6 A;  1ZK6 A;  2PV2 A;  3UI4 A;  4FN2 A;  2FKE A;  1N1A A;  4U84 A;  1Q6U A;  2MPH A;  4N19 A;  3MDY B;  4W9O A;  1QZ2 A;  5DIT A;  3PRD A;  2F21 A;  1FKR A;  3IK8 A;  2N87 A;  3I6C A;  3UI5 A;  2PV1 A;  2PPP A;  4JFK A;  4NNR A;  1FJD A;  3IKG A;  4DIP A;  1KT1 A;  1FKS A;  1W26 A;  1J4I A;  3KCE A;  1JNS A;  3RGC A;  3O5L A;  1FKL A;  2FAP A;  3UQI A;  2XP7 A;  1BL4 A;  4QIB A;  1ZCN A;  4BF8 A;  3UI6 A;  2XP9 A;  5DIV A;  5HTG A;  2KR7 A;  3KAC A;  3O5J A;  1KT0 A;  1J4H A;  2XP6 A;  1JNT A;  2PPN A;  4IPX A;  4ODO A;  4TX0 A;  2XP3 A;  1P5Q A;  1Q6H A;  4DRH A;  2LKN A;  4U86 A;  1D7I A;  4LAW A;  1QPL A;  3KAG A;  3OOB A;  4GGQ A;  3O5F A;  4JFI A;  3FAP A;  4LAX A;  4DRN A;  4ODM A;  3KAH A;  1TCO C;  3KAD A;  4ODN A;  2MLZ A;  1F8A B;  2KE0 A;  4LAV A;  1Q6I A;  4IQC A;  4JFL A;  4DRQ A;  1J6Y A;  4G50 A;  5B8I C;  4MGV A;  2M1I A;  4ITZ A;  4W9P A;  3B7X A;  3O5Q A;  1YAT A;  3WH0 A;  1A7X A;  5D75 A;  3TCZ A;  1FKK A;  2D9F A;  4DRM A;  1NMW A;  2RUD A;  3O5R A;  4U85 A;  2RQS A;  4DRK A;  4ODR A;  2LJ4 A;  2ZR6 A; 
#chains in the Genus database with same CATH topology
 1Q1C A;  5GPG A;  3PRB A;  4ODL A;  2DT3 A;  1LQ0 A;  1GOI A;  3GPK A;  2YBT A;  1E6Z A;  3WL1 A;  3JYM A;  2F4E A;  2DG4 A;  2G8Z A;  4ZPT R;  4JYS A;  3GTY X;  4QT2 A;  5HT1 A;  3WD4 A;  2KO7 A;  1L1P A;  2MF9 A;  1XHG A;  3TC5 A;  3KAF A;  3RFW A;  4S3K A;  3IKD A;  3NTP A;  3FY1 A;  3UQA A;  3O5O A;  4ODP A;  3CHC A;  2WM0 A;  5HKG A;  1HKI A;  3BXW A;  1E6P A;  4UDM A;  4HBO A;  1NWT A;  4KR0 B;  4O2T A;  3CGM A;  3EY6 A;  5I98 A;  3O5I A;  2VCD A;  4GIV A;  4R5E A;  1E15 A;  3O5D A;  2XPB A;  4WKA A;  3ARW A;  3IHZ A;  4AY1 A;  4IT4 A;  2XP4 A;  2YBU A;  3W4R A;  4DZ3 A;  1M5Y A;  3JYJ A;  2ZQS A;  4WK9 A;  2PI6 A;  1IX5 A;  5HUA A;  2WK2 A;  3NRK A;  2F2D A;  3O5P A;  3JXV A;  1BKF A;  2RUQ A;  2AWG A;  3EIP A;  3VAW A;  3ALF A;  4J4N A;  4DRP A;  1SR0 A;  1NWS A;  2PV2 A;  2FKE A;  4P8X A;  3MDY B;  3IK8 A;  3AS2 A;  1FJD A;  1NH6 A;  1W26 A;  3KCE A;  3CH9 A;  3RGC A;  5JH8 A;  3O5L A;  4QIB A;  4DWS D;  2KR7 A;  4S3J A;  3WD3 A;  2A3A A;  1JNT A;  2PPN A;  4ODO A;  2XP3 A;  3WD2 A;  5DF0 A;  4Z2K A;  2F23 A;  4U86 A;  1E6R A;  4JFI A;  2DSV A;  4GGQ A;  4LAX A;  4P8U A;  3FAP A;  4ODM A;  3CHE A;  1WNO A;  4LAV A;  2DSW A;  3WIJ A;  1TFV A;  1W9V A;  2FDM A;  3WQV A;  3CHF A;  4G50 A;  2OLH A;  4MGV A;  1HJV A;  3RM8 A;  4MPK A;  4W9P A;  3WH0 A;  1A7X A;  4HBE A;  4DRM A;  2RUD A;  4ODR A;  3WL0 A;  3ARR A;  2LJ4 A;  5DIT A;  2ZR6 A;  2IF4 A;  3B9A A;  1W9U A;  4WKF A;  3RM9 A;  2A3B A;  2M2A A;  3AS3 A;  3UF8 A;  2KFW A;  2VN1 A;  3ARV A;  3ARO A;  1RD6 A;  4G2P A;  2ESC A;  3PR9 A;  2RUR A;  1J4R A;  1GUV A;  1LL4 A;  1W1P A;  1HJX A;  1PBK A;  1ROT A;  4JFM A;  3ARS A;  2XP8 A;  4MNL A;  2RUC A;  4TW8 A;  4TW7 A;  1GPF A;  2Y78 A;  4Q22 A;  5J6E A;  1CTN A;  2ZQU A;  4URI A;  4DWS A;  1FKJ A;  3O5M A;  1JCH B;  1HKM A;  1FKD A;  1HKJ A;  3CGN A;  4W5U A;  4LAY A;  1JND A;  2WLY A;  2DG3 A;  1FAP A;  4IQ2 A;  2G41 A;  3AS0 A;  1W1V A;  1ROU A;  1WB0 A;  1XRV A;  5DEZ A;  1WAW A;  5DIU A;  1W9P A;  4TW6 A;  2DT0 A;  1EHN A;  4Z2L A;  4FN2 A;  4DWS C;  2MPH A;  4N19 A;  4W9O A;  3ALG A;  2PV1 A;  4JFK A;  4DIP A;  1KT1 A;  1JNS A;  1J4I A;  4NSB A;  3UQI A;  1BL4 A;  1ZCN A;  4BF8 A;  5HTG A;  2XP9 A;  1ZBW A;  1FFQ A;  4IPX A;  4TX0 A;  2DT1 A;  3ARU A;  2LKN A;  4MNM A;  4LAW A;  3KAG A;  4DRN A;  3O5F A;  3KAH A;  2MLZ A;  4MTV A;  1F8A B;  1GRJ A;  2KE0 A;  3QOK A;  4DWS B;  4L3N A;  4DRQ A;  4HAR A;  5B8I C;  1YAT A;  2D9F A;  1NMW A;  4U85 A;  3WKZ A;  2DT2 A;  1SYT A;  2ETN A;  4W9Q A;  1ZBV A;  4LGX A;  4Z2J A;  2JZV A;  1F40 A;  2ZQT A;  1NWU A;  2LPV A;  3UQB A;  2MLY A;  5HW7 A;  1OWQ A;  4MNK A;  2XP5 A;  4WIW A;  2DPE A;  2IUZ A;  2A3C A;  1B6C A;  1FKT A;  1LL6 A;  1ITX A;  5GPR A;  2ZR5 A;  1FD9 A;  4MAV A;  2PPO A;  5HW6 A;  1EYM A;  4L72 B;  3GU0 A;  1Y0O A;  2UZ5 A;  1U79 A;  5HW8 A;  2RSE A;  3ODK A;  2DSZ A;  3B9D A;  2A3E A;  4P8W A;  3O5E A;  1HJW A;  3KAI A;  3RME A;  4ODK A;  4TYO A;  4DZ2 A;  3ARX A;  3O5K A;  3ARQ A;  4PTM A;  4ZPV R;  2B5U B;  2PV3 A;  1LG1 A;  1FKG A;  3NI6 A;  1FKH A;  1D2K A;  2KI3 A;  3O5G A;  5HWC A;  1LG2 A;  2Q5A A;  3ARP A;  2P4V A;  3AQU A;  4ML4 A;  2WLZ A;  1NWR A;  3RM4 A;  1N1A A;  4U84 A;  1ZBC A;  1VF8 A;  1EIB A;  4NZC A;  1Q6U A;  3FXY A;  2F21 A;  1FKR A;  1JNE A;  3I6C A;  2PPP A;  4NNR A;  3IKG A;  1KFW A;  1FKS A;  2FAP A;  2XP7 A;  3ARZ A;  1EDQ A;  3UI6 A;  5DIV A;  3O5J A;  3OA5 A;  4QZV B;  2XP6 A;  1E44 A;  1Q6H A;  4DRH A;  3PRA A;  3WQW A;  1D7I A;  1QPL A;  1E9L A;  1X6N A;  4ZS6 A;  3KAD A;  4ODN A;  1K9T A;  4Q7N A;  4IQC A;  4JFL A;  1J6Y A;  5D75 A;  3O5R A;  2O92 A;  2RQS A;  1UR8 A;  4P8V A;  4DRK A;  3B9E A;  3ARY A;  1C9H A;  1D6O A;  1W1Y A;  3G6L A;  4XAK A;  2KGJ A;  2MNT A;  3B8S A;  2B31 A;  1H0I A;  2K8I A;  4Z2H A;  2DG9 A;  2XPA A;  1JVW A;  1D7H A;  2PN0 A;  1PIN A;  3KZ7 A;  2MLX A;  2M08 A;  3ART A;  4MSP A;  1X6L A;  1NMV A;  4R0X A;  5HWB A;  5HBF A;  1HXV A;  1ZL1 A;  2O9O A;  4DRJ A;  2ZQV A;  4C02 B;  4DH0 A;  1H0G A;  1FKI A;  1LJY A;  4J4O A;  1QPF A;  4WJX A;  1OGG A;  1FFR A;  1O6I A;  4ODQ A;  2ITK A;  4JFJ A;  2LGO A;  3TDB A;  1EQ3 A;  2OFN A;  1ZBK A;  4DRO A;  2ZR4 A;  3WD1 A;  3G6M A;  3PA7 A;  5GQB A;  2DSU A;  1R9H A;  1OGB A;  4KQZ A;  4TNS A;  2PBC A;  4QT3 A;  4IT6 A;  2EUL A;  3H9R B;  1D7J A;  4Z2I A;  1YW5 A;  4FAP A;  3KAB A;  1FKF A;  1UR9 A;  4DRI A;  1T11 A;  3LUO A;  1ZB5 A;  2L2S A;  5BXJ A;  1NSG A;  1FKB A;  4DT4 A;  4Z2G A;  3AS1 A;  1ZK6 A;  1W1T A;  3CHD A;  1LL7 A;  3UI4 A;  3CZ8 A;  4MNJ A;  1ZU8 A;  1QZ2 A;  4ZPW R;  3PRD A;  2N87 A;  3UI5 A;  4WKH A;  5DO2 A;  1FKL A;  3KAC A;  1KT0 A;  1J4H A;  1P5Q A;  1E6N A;  3OOB A;  1TCO C;  1Q6I A;  2M1I A;  4ITZ A;  2AOS A;  3B7X A;  3O5Q A;  3TCZ A;  1FKK A;  1HKK A;  3BMB A;  3WD0 A;  2QF8 A; 
#chains in the Genus database with same CATH homology
 1Q1C A;  5GPG A;  3PRB A;  4ODL A;  2DT3 A;  1LQ0 A;  1GOI A;  3GPK A;  2YBT A;  1E6Z A;  3WL1 A;  3JYM A;  2F4E A;  2DG4 A;  2G8Z A;  4ZPT R;  4JYS A;  4QT2 A;  5HT1 A;  3WD4 A;  2KO7 A;  1L1P A;  2MF9 A;  1XHG A;  3TC5 A;  3KAF A;  3RFW A;  4S3K A;  3IKD A;  3NTP A;  3FY1 A;  3UQA A;  3O5O A;  4ODP A;  3CHC A;  2WM0 A;  5HKG A;  1HKI A;  3BXW A;  1E6P A;  4HBO A;  1NWT A;  4KR0 B;  4O2T A;  3CGM A;  3EY6 A;  5I98 A;  3O5I A;  2VCD A;  4GIV A;  4R5E A;  1E15 A;  3O5D A;  2XPB A;  4WKA A;  3ARW A;  3IHZ A;  4AY1 A;  4IT4 A;  2XP4 A;  2YBU A;  3W4R A;  4DZ3 A;  1M5Y A;  3JYJ A;  2ZQS A;  4WK9 A;  2PI6 A;  1IX5 A;  5HUA A;  2WK2 A;  3NRK A;  2F2D A;  3O5P A;  3JXV A;  1BKF A;  2RUQ A;  2AWG A;  3VAW A;  3ALF A;  4J4N A;  4DRP A;  1SR0 A;  1NWS A;  2PV2 A;  2FKE A;  4P8X A;  3MDY B;  3IK8 A;  3AS2 A;  1FJD A;  1NH6 A;  1W26 A;  3KCE A;  3CH9 A;  3RGC A;  5JH8 A;  3O5L A;  4QIB A;  4DWS D;  2KR7 A;  4S3J A;  3WD3 A;  2A3A A;  1JNT A;  2PPN A;  4ODO A;  2XP3 A;  3WD2 A;  5DF0 A;  4Z2K A;  4U86 A;  1E6R A;  4JFI A;  2DSV A;  4GGQ A;  4LAX A;  4P8U A;  3FAP A;  4ODM A;  3CHE A;  1WNO A;  4LAV A;  2DSW A;  3WIJ A;  1TFV A;  1W9V A;  2FDM A;  3WQV A;  3CHF A;  4G50 A;  2OLH A;  4MGV A;  1HJV A;  3RM8 A;  4MPK A;  4W9P A;  3WH0 A;  1A7X A;  4HBE A;  4DRM A;  2RUD A;  4ODR A;  3WL0 A;  3ARR A;  2LJ4 A;  5DIT A;  2ZR6 A;  2IF4 A;  3B9A A;  1W9U A;  4WKF A;  3RM9 A;  2A3B A;  2M2A A;  3AS3 A;  3UF8 A;  2KFW A;  2VN1 A;  3ARV A;  3ARO A;  1RD6 A;  4G2P A;  2ESC A;  3PR9 A;  2RUR A;  1J4R A;  1GUV A;  1LL4 A;  1W1P A;  1HJX A;  1PBK A;  1ROT A;  4JFM A;  3ARS A;  2XP8 A;  4MNL A;  2RUC A;  4TW8 A;  4TW7 A;  1GPF A;  2Y78 A;  4Q22 A;  5J6E A;  1CTN A;  2ZQU A;  4URI A;  4DWS A;  1FKJ A;  3O5M A;  1HKM A;  1FKD A;  1HKJ A;  3CGN A;  4W5U A;  4LAY A;  1JND A;  2WLY A;  2DG3 A;  1FAP A;  4IQ2 A;  2G41 A;  3AS0 A;  1W1V A;  1ROU A;  1WB0 A;  1XRV A;  5DEZ A;  1WAW A;  5DIU A;  1W9P A;  4TW6 A;  2DT0 A;  1EHN A;  4Z2L A;  4FN2 A;  4DWS C;  2MPH A;  4N19 A;  4W9O A;  3ALG A;  2PV1 A;  4JFK A;  4DIP A;  1KT1 A;  1JNS A;  1J4I A;  4NSB A;  3UQI A;  1BL4 A;  1ZCN A;  4BF8 A;  5HTG A;  2XP9 A;  1ZBW A;  1FFQ A;  4IPX A;  4TX0 A;  2DT1 A;  3ARU A;  2LKN A;  4MNM A;  4LAW A;  3KAG A;  4DRN A;  3O5F A;  3KAH A;  2MLZ A;  4MTV A;  1F8A B;  2KE0 A;  3QOK A;  4DWS B;  4L3N A;  4DRQ A;  4HAR A;  5B8I C;  1YAT A;  2D9F A;  1NMW A;  4U85 A;  3WKZ A;  2DT2 A;  1SYT A;  4W9Q A;  1ZBV A;  4LGX A;  4Z2J A;  2JZV A;  1F40 A;  2ZQT A;  1NWU A;  2LPV A;  3UQB A;  2MLY A;  5HW7 A;  1OWQ A;  4MNK A;  2XP5 A;  4WIW A;  2DPE A;  2IUZ A;  2A3C A;  1B6C A;  1FKT A;  1LL6 A;  1ITX A;  5GPR A;  2ZR5 A;  1FD9 A;  4MAV A;  2PPO A;  5HW6 A;  1EYM A;  4L72 B;  1Y0O A;  2UZ5 A;  1U79 A;  5HW8 A;  2RSE A;  3ODK A;  2DSZ A;  3B9D A;  2A3E A;  4P8W A;  3O5E A;  1HJW A;  3KAI A;  3RME A;  4ODK A;  4TYO A;  4DZ2 A;  3ARX A;  3O5K A;  3ARQ A;  4PTM A;  4ZPV R;  2PV3 A;  1LG1 A;  1FKG A;  3NI6 A;  1FKH A;  1D2K A;  2KI3 A;  3O5G A;  5HWC A;  1LG2 A;  2Q5A A;  3ARP A;  3AQU A;  4ML4 A;  2WLZ A;  1NWR A;  3RM4 A;  1N1A A;  4U84 A;  1ZBC A;  1VF8 A;  1EIB A;  4NZC A;  1Q6U A;  3FXY A;  2F21 A;  1FKR A;  1JNE A;  3I6C A;  2PPP A;  4NNR A;  3IKG A;  1KFW A;  1FKS A;  2FAP A;  2XP7 A;  3ARZ A;  1EDQ A;  3UI6 A;  5DIV A;  3O5J A;  3OA5 A;  4QZV B;  2XP6 A;  1Q6H A;  4DRH A;  3PRA A;  3WQW A;  1D7I A;  1QPL A;  1E9L A;  1X6N A;  4ZS6 A;  3KAD A;  4ODN A;  1K9T A;  4Q7N A;  4IQC A;  4JFL A;  1J6Y A;  5D75 A;  3O5R A;  2O92 A;  2RQS A;  1UR8 A;  4P8V A;  4DRK A;  3B9E A;  3ARY A;  1C9H A;  1D6O A;  1W1Y A;  3G6L A;  4XAK A;  2KGJ A;  2MNT A;  3B8S A;  2B31 A;  1H0I A;  2K8I A;  4Z2H A;  2DG9 A;  2XPA A;  1JVW A;  1D7H A;  1PIN A;  3KZ7 A;  2MLX A;  2M08 A;  3ART A;  4MSP A;  1X6L A;  1NMV A;  4R0X A;  5HWB A;  5HBF A;  1HXV A;  1ZL1 A;  2O9O A;  4DRJ A;  2ZQV A;  4C02 B;  4DH0 A;  1H0G A;  1FKI A;  1LJY A;  4J4O A;  1QPF A;  4WJX A;  1OGG A;  1FFR A;  1O6I A;  4ODQ A;  2ITK A;  4JFJ A;  2LGO A;  3TDB A;  1EQ3 A;  2OFN A;  1ZBK A;  4DRO A;  2ZR4 A;  3WD1 A;  3G6M A;  3PA7 A;  5GQB A;  2DSU A;  1R9H A;  1OGB A;  4KQZ A;  4TNS A;  2PBC A;  4QT3 A;  4IT6 A;  3H9R B;  1D7J A;  4Z2I A;  1YW5 A;  4FAP A;  3KAB A;  1FKF A;  1UR9 A;  4DRI A;  1T11 A;  3LUO A;  1ZB5 A;  2L2S A;  5BXJ A;  1NSG A;  1FKB A;  4DT4 A;  4Z2G A;  3AS1 A;  1ZK6 A;  1W1T A;  3CHD A;  1LL7 A;  3UI4 A;  3CZ8 A;  4MNJ A;  1ZU8 A;  1QZ2 A;  4ZPW R;  3PRD A;  2N87 A;  3UI5 A;  4WKH A;  5DO2 A;  1FKL A;  3KAC A;  1KT0 A;  1J4H A;  1P5Q A;  1E6N A;  3OOB A;  1TCO C;  1Q6I A;  2M1I A;  4ITZ A;  2AOS A;  3B7X A;  3O5Q A;  3TCZ A;  1FKK A;  1HKK A;  3WD0 A;  2QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...