3LUOA

Crystal structure and functional characterization of the thermophilic prolyl isomerase and chaperone slyd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
145
Chain Sequence
b'MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 28
structure length 145
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3luoA00
4DH0A 1Q6UA 4TNSA 3KACA 5HWBA 2F21A 3TDBA 2DG4A 2LJ4A 1Y0OA 2ITKA 4N19A 3UI6A 4ODLA 5HW8A 3O5IA 1EQ3A 4DRMA 2RSEA 2XP5A 4JFMA 2KR7A 2FAPA 1U79A 4DRIA 3VAWA 2MLXA 4GGQA 3RGCA 1FKRA 2D9FA 1HXVA 5DIVA 3PA7A 4ITZA 1C9HA 1YW5A 1J4IA 1M5YA 1Q6IA 1Q1CA 1FKSA 4DROA 1F40A 1FKFA 4DT4A 4DRPA 1ZK6A 2XP7A 2LGOA 4TX0A 2F2DA 3O5RA 2KFWA 2PBCA 2VCDA 2PV3A 4G2PA 2Q5AA 3B7XA 1D7IA 4LAXA 4MSPA 2JZVA 2PPPA 2PV2A 4QT2A 1JNSA 1PBKA 5DIUA 3H9RB 4TW6A 2M08A 3OOBA 5HT1A 3EY6A 5HW7A 1KT0A 4C02B 1T11A 2FKEA 2MLYA 2MF9A 2MLZA 2PPOA 3NTPA 3UQAA 1FAPA 1FKDA 2KE0A 2LKNA 1FKKA 2ZQSA 2L2SA 2ZR5A 3GPKA 1KT1A 3O5KA 3O5FA 1ZCNA 1FKGA 1FKJA 1B6CA 1NMVA 3IKDA 4R0XA 4TW7A 3UI4A 3KAIA 2ZQUA 2KGJA 1JNTA 2Y78A 4G50A 3ODKA 2M2AA 1D6OA 1ROTA 3MDYB 4ODMA 4U85A 4W9OA 4J4NA 3IK8A 4ODKA 2ZR4A 3UQBA 2KO7A 4DZ2A 2N87A 2XP9A 4ODOA 1QZ2A 2XPAA 1A7XA 3JXVA 1L1PA 2RUDA 4DZ3A 5DITA 3NI6A 4DRKA 3O5DA 2KI3A 3LUOA 3O5GA 4IQCA 4ODPA 4ODNA 3KAFA 4BF8A 4DRNA 4DRHA 2MNTA 4FAPA 3JYMA 3KABA 3WH0A 3O5OA 3NRKA 5B8IC 4GIVA 4ODRA 2IF4A 1BL4A 4JFIA 4DRJA 1NSGA 3KAGA 4JFLA 3CGMA 2M1IA 3FAPA 3O5LA 4QT3A 1Q6HA 1FKHA 4DRQA 5HWCA 5HKGA 5HUAA 2XP8A 3O5EA 3O5JA 3TCZA 2XP4A 2DG9A 2RUQA 4DIPA 1JVWA 2PPNA 3CGNA 3O5QA 1N1AA 2ZR6A 4ODQA 2ZQVA 1W26A 1F8AB 4FN2A 1J4RA 1FKBA 1FKIA 2UZ5A 1YATA 3KCEA 5I98A 5J6EA 3O5PA 2LPVA 4J4OA 3IHZA 1FJDA 4IQ2A 4QIBA 1J6YA 2XP6A 1FD9A 3TC5A 1FKLA 4MGVA 4U84A 5HTGA 1BKFA 1TCOC 2AWGA 1QPLA 4LAVA 3KADA 2ZQTA 4LAWA 3UI5A 1EYMA 2XPBA 2DG3A 5GPGA 5D75A 1ROUA 5BXJA 4O2TA 1FKTA 2XP3A 1PINA 4JFJA 4TW8A 5HW6A 3I6CA 2K8IA 3JYJA 3PRBA 4U86A 4W9QA 4JYSA 4TYOA 2VN1A 2MPHA 1D7JA 2RQSA 4LAYA 1D7HA 1NMWA 2OFNA 3KAHA 4IPXA 4W9PA 3UF8A 1J4HA 4NNRA 3RFWA 2RUCA 3O5MA 3KZ7A 3UQIA 3IKGA 1QPFA 1P5QA 2F4EA 2RURA 3PRDA 1R9HA 2PV1A 4JFKA
chains in the Genus database with same CATH superfamily
1H0IA 1RD6A 1ZL1A 1ZBKA 2A3CA 4Z2KA 1GRJA 2RSEA 4JFMA 2FAPA 4XAKA 4DRIA 3VAWA 4R5EA 4ITZA 1C9HA 4MNJA 1F40A 4ZPTR 1FKFA 3WKZA 1LL7A 2ESCA 3O5RA 1JNEA 2VCDA 4Z2JA 1D7IA 2JZVA 2PV2A 2YBUA 1LQ0A 1ZBVA 1KT0A 3ARSA 2MLYA 1FAPA 3AQUA 1FKDA 2KE0A 1FKKA 2ZQSA 2ZR5A 2WLZA 4HARA 1ZCNA 1NMVA 4R0XA 3UI4A 2KGJA 1ZB5A 1O6IA 1E44A 4MTVA 4ODMA 3IK8A 3RM9A 2XP9A 1E6PA 2XPAA 1A7XA 3CHFA 1W1PA 3LUOA 4IQCA 4W5UA 4IT6A 4BF8A 3ARRA 1BL4A 4DRJA 4Z2HA 2F23A 4JFLA 3RMEA 4DWSA 4NSBA 3CGMA 2M1IA 4NZCA 4DRQA 5HUAA 2XP8A 4DIPA 2PPNA 3CGNA 4AY1A 1N1AA 1HKMA 1W26A 1FKIA 4L3NA 3IHZA 4ZS6A 1J6YA 4U84A 5HTGA 1BKFA 4P8VA 1NWTA 2XPBA 2DG3A 5JH8A 5GPGA 1FFRA 3WD1A 1VF8A 1FKTA 4O2TA 4TW8A 4WJXA 2DSZA 1EIBA 1LL4A 3CHCA 4TYOA 1D7JA 2IUZA 1W1TA 2YBTA 2OLHA 4NNRA 3AS1A 3UQIA 1QPFA 4KQZA 1FKSA 3OOBA 3TDBA 2DG4A 3UI6A 5HW8A 1W1VA 3O5IA 4PTMA 3FXYA 2XP5A 3ARPA 3G6MA 2MLXA 4GGQA 4HBEA 1XRVA 5DIVA 1NWSA 1IX5A 1J4IA 1D2KA 4DT4A 3FY1A 2XP7A 2KFWA 4LAXA 4MSPA 3B7XA 1JCHB 4S3KA 1JNSA 1TFVA 5DIUA 2A3EA 3ARYA 2M08A 4MAVA 1FFQA 5HT1A 3WQVA 5HW7A 1T11A 1E6NA 2PPOA 2DT2A 3NTPA 4IT4A 3WD3A 2L2SA 3O5FA 1KT1A 1GUVA 1FKGA 1B6CA 3W4RA 1JNTA 2Y78A 4G50A 2M2AA 1D6OA 3MDYB 4W9OA 4U85A 4J4NA 3UQBA 4ODKA 2KO7A 4MNKA 4DZ2A 3JXVA 1W1YA 3NI6A 3O5DA 2KI3A 4ODPA 4ODNA 4DWSD 4DRHA 1W9PA 3ARUA 3JYMA 2DPEA 2B5UB 4GIVA 3ALFA 1HJVA 1LG2A 1X6NA 2FDMA 3FAPA 3WL0A 4QT3A 1FKHA 1EHNA 1WAWA 2B31A 3ARVA 3ARZA 5HKGA 3O5EA 2DG9A 1JVWA 3WQWA 3AROA 1WB0A 1J4RA 5HBFA 1FKBA 2DSWA 1FJDA 3CHDA 3WL1A 2XP6A 1FKLA 2A3BA 4MPKA 1OGBA 3PRAA 5D75A 1ROUA 2WK2A 1PINA 4KR0B 3JYJA 4JYSA 2PI6A 2RQSA 4Q7NA 1E6ZA 1HKIA 1D7HA 4W9PA 5DO2A 1OWQA 1UR8A 1XHGA 2PN0A 1J4HA 3RFWA 2F4EA 4LAWA 3PRDA 1R9HA 1Q6UA 3KACA 2F21A 1KFWA 1EQ3A 1NH6A 1E6RA 3AS3A 3BXWA 3RGCA 1FKRA 1HXVA 3PA7A 1M5YA 1Q6IA 4DROA 3GU0A 4DRPA 1ZK6A 2LGOA 2O92A 4P8UA 4G2PA 2Q5AA 4ML4A 4WKHA 2DT0A 3WD2A 4ZPVR 1HJXA 3H9RB 5DEZA 1ZBCA 1H0GA 3UQAA 2LKNA 4N19A 3GPKA 1CTNA 2DT1A 1FKJA 1LL6A 4TW7A 3KAIA 1ROTA 2ZR4A 3CZ8A 2N87A 1QZ2A 1E15A 2DT3A 3WD4A 4DZ3A 2DSVA 4DRKA 3O5GA 3B9DA 4HBOA 4LGXA 3KAFA 2MNTA 3NRKA 5B8IC 3CHEA 3CH9A 4ODRA 2QF8A 2EULA 1NSGA 4QZVB 2P4VA 1SYTA 5HWCA 4WKAA 4DWSC 2RUQA 1SR0A 2ZR6A 1WNOA 4ODQA 3RM4A 3ARWA 3KCEA 1YATA 5I98A 3B9EA 5J6EA 2LPVA 4J4OA 3B8SA 1FD9A 3TC5A 4S3JA 1LJYA 3OA5A 1NWUA 1W9UA 1TCOC 1K9TA 1OGGA 1QPLA 2ZQTA 1EYMA 5BXJA 4JFJA 2XP3A 3I6CA 4U86A 1HKJA 3WD0A 2G41A 2OFNA 3KAHA 3BMBA 2A3AA 3IKGA 2DSUA 4FAPA 2RURA 4TNSA 3ARQA 5HWBA 2LJ4A 1Y0OA 2ITKA 4ODLA 1ZBWA 4DRMA 1ZU8A 2KR7A 1U79A 1HKKA 2D9FA 4DWSB 4P8XA 1YW5A 1Q1CA 4P8WA 4TX0A 2F2DA 4Q22A 2PBCA 2PV3A 1GPFA 2PPPA 4QT2A 1PBKA 4TW6A 3QOKA 3WIJA 1EDQA 2G8ZA 3EY6A 4C02B 2FKEA 2O9OA 2MF9A 4WKFA 2MLZA 4MNMA 1ITXA 1X6LA 3O5KA 5HW6A 4WK9A 4DH0A 3IKDA 1UR9A 2ZQUA 4WIWA 3RM8A 3ODKA 4Z2IA 3GTYX 4Z2GA 1JNDA 3ARTA 3AS2A 4ODOA 4L72B 1L1PA 2RUDA 5DITA 3ARXA 4DRNA 1NWRA 1W9VA 1E9LA 3KABA 3WH0A 3O5OA 2IF4A 4JFIA 4URIA 3KAGA 2WLYA 4MNLA 1LG1A 3O5LA 1Q6HA 5DF0A 4UDMA 3O5JA 3TCZA 2XP4A 3EIPA 3O5QA 2ZQVA 1F8AB 5GPRA 4FN2A 1GOIA 2UZ5A 3O5PA 4IQ2A 4ZPWR 4QIBA 3B9AA 4MGVA 3ALGA 3G6LA 2AWGA 5GQBA 4LAVA 3KADA 3UI5A 3AS0A 1HJWA 2K8IA 2WM0A 3PRBA 4W9QA 2VN1A 3PR9A 2MPHA 4LAYA 1NMWA 4IPXA 3UF8A 2ETNA 2AOSA 2RUCA 3O5MA 3KZ7A 4Z2LA 1P5QA 2PV1A 4JFKA
chains in the Genus database with same CATH topology
1H0IA 1RD6A 1ZL1A 1ZBKA 2A3CA 4Z2KA 2RSEA 4JFMA 2FAPA 4XAKA 4DRIA 3VAWA 4R5EA 4ITZA 1C9HA 4MNJA 1F40A 4ZPTR 1FKFA 3WKZA 1LL7A 2ESCA 3O5RA 1JNEA 2VCDA 4Z2JA 1D7IA 2JZVA 2PV2A 2YBUA 1LQ0A 1ZBVA 1KT0A 3ARSA 2MLYA 1FAPA 3AQUA 1FKDA 2KE0A 1FKKA 2ZQSA 2ZR5A 2WLZA 4HARA 1ZCNA 1NMVA 4R0XA 3UI4A 2KGJA 1ZB5A 1O6IA 4MTVA 4ODMA 3IK8A 3RM9A 2XP9A 1E6PA 2XPAA 1A7XA 3CHFA 1W1PA 3LUOA 4IQCA 4W5UA 4IT6A 4BF8A 3ARRA 1BL4A 4DRJA 4Z2HA 4JFLA 3RMEA 4DWSA 4NSBA 3CGMA 2M1IA 4NZCA 4DRQA 5HUAA 2XP8A 4DIPA 2PPNA 3CGNA 4AY1A 1N1AA 1HKMA 1W26A 1FKIA 4L3NA 3IHZA 4ZS6A 1J6YA 4U84A 5HTGA 1BKFA 4P8VA 1NWTA 2XPBA 2DG3A 5JH8A 5GPGA 1FFRA 3WD1A 1VF8A 1FKTA 4O2TA 4TW8A 4WJXA 2DSZA 1EIBA 1LL4A 3CHCA 4TYOA 1D7JA 2IUZA 1W1TA 2YBTA 2OLHA 4NNRA 3AS1A 3UQIA 1QPFA 4KQZA 1FKSA 3OOBA 3TDBA 2DG4A 3UI6A 5HW8A 1W1VA 3O5IA 4PTMA 3FXYA 2XP5A 3ARPA 3G6MA 2MLXA 4GGQA 4HBEA 1XRVA 5DIVA 1NWSA 1IX5A 1J4IA 1D2KA 4DT4A 3FY1A 2XP7A 2KFWA 4LAXA 4MSPA 3B7XA 4S3KA 1JNSA 1TFVA 5DIUA 2A3EA 3ARYA 2M08A 4MAVA 1FFQA 5HT1A 3WQVA 5HW7A 1T11A 1E6NA 2PPOA 2DT2A 3NTPA 4IT4A 3WD3A 2L2SA 3O5FA 1KT1A 1GUVA 1FKGA 1B6CA 3W4RA 1JNTA 2Y78A 4G50A 2M2AA 1D6OA 3MDYB 4W9OA 4U85A 4J4NA 3UQBA 4ODKA 2KO7A 4MNKA 4DZ2A 3JXVA 1W1YA 3NI6A 3O5DA 2KI3A 4ODPA 4ODNA 4DWSD 4DRHA 1W9PA 3ARUA 3JYMA 2DPEA 4GIVA 3ALFA 1HJVA 1LG2A 1X6NA 2FDMA 3FAPA 3WL0A 4QT3A 1FKHA 1EHNA 1WAWA 2B31A 3ARVA 3ARZA 5HKGA 3O5EA 2DG9A 1JVWA 3WQWA 3AROA 1WB0A 1J4RA 5HBFA 1FKBA 2DSWA 1FJDA 3CHDA 3WL1A 2XP6A 1FKLA 2A3BA 4MPKA 1OGBA 3PRAA 5D75A 1ROUA 2WK2A 1PINA 4KR0B 3JYJA 4JYSA 2PI6A 2RQSA 4Q7NA 1E6ZA 1HKIA 1D7HA 4W9PA 5DO2A 1OWQA 1UR8A 1XHGA 1J4HA 3RFWA 2F4EA 4LAWA 3PRDA 1R9HA 1Q6UA 3KACA 2F21A 1KFWA 1EQ3A 1NH6A 1E6RA 3AS3A 3BXWA 3RGCA 1FKRA 1HXVA 3PA7A 1M5YA 1Q6IA 4DROA 4DRPA 1ZK6A 2LGOA 2O92A 4P8UA 4G2PA 2Q5AA 4ML4A 4WKHA 2DT0A 3WD2A 4ZPVR 1HJXA 3H9RB 5DEZA 1ZBCA 1H0GA 3UQAA 2LKNA 4N19A 3GPKA 1CTNA 2DT1A 1FKJA 1LL6A 4TW7A 3KAIA 1ROTA 2ZR4A 3CZ8A 2N87A 1QZ2A 1E15A 2DT3A 3WD4A 4DZ3A 2DSVA 4DRKA 3O5GA 3B9DA 4HBOA 4LGXA 3KAFA 2MNTA 3NRKA 5B8IC 3CHEA 3CH9A 4ODRA 2QF8A 1NSGA 4QZVB 1SYTA 5HWCA 4WKAA 4DWSC 2RUQA 1SR0A 2ZR6A 1WNOA 4ODQA 3RM4A 3ARWA 3KCEA 1YATA 5I98A 3B9EA 5J6EA 2LPVA 4J4OA 3B8SA 1FD9A 3TC5A 4S3JA 1LJYA 3OA5A 1NWUA 1W9UA 1TCOC 1K9TA 1OGGA 1QPLA 2ZQTA 1EYMA 5BXJA 4JFJA 2XP3A 3I6CA 4U86A 1HKJA 3WD0A 2G41A 2OFNA 3KAHA 2A3AA 3IKGA 2DSUA 4FAPA 2RURA 4TNSA 3ARQA 5HWBA 2LJ4A 1Y0OA 2ITKA 4ODLA 1ZBWA 4DRMA 1ZU8A 2KR7A 1U79A 1HKKA 2D9FA 4DWSB 4P8XA 1YW5A 1Q1CA 4P8WA 4TX0A 2F2DA 4Q22A 2PBCA 2PV3A 1GPFA 2PPPA 4QT2A 1PBKA 4TW6A 3QOKA 3WIJA 1EDQA 2G8ZA 3EY6A 4C02B 2FKEA 2O9OA 2MF9A 4WKFA 2MLZA 4MNMA 1ITXA 1X6LA 3O5KA 5HW6A 4WK9A 4DH0A 3IKDA 1UR9A 2ZQUA 4WIWA 3RM8A 3ODKA 4Z2IA 4Z2GA 1JNDA 3ARTA 3AS2A 4ODOA 4L72B 1L1PA 2RUDA 5DITA 3ARXA 4DRNA 1NWRA 1W9VA 1E9LA 3KABA 3WH0A 3O5OA 2IF4A 4JFIA 4URIA 3KAGA 2WLYA 4MNLA 1LG1A 3O5LA 1Q6HA 5DF0A 3O5JA 3TCZA 2XP4A 3O5QA 2ZQVA 1F8AB 5GPRA 4FN2A 1GOIA 2UZ5A 3O5PA 4IQ2A 4ZPWR 4QIBA 3B9AA 4MGVA 3ALGA 3G6LA 2AWGA 5GQBA 4LAVA 3KADA 3UI5A 3AS0A 1HJWA 2K8IA 2WM0A 3PRBA 4W9QA 2VN1A 3PR9A 2MPHA 4LAYA 1NMWA 4IPXA 3UF8A 2AOSA 2RUCA 3O5MA 3KZ7A 4Z2LA 1P5QA 2PV1A 4JFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DH0 A;  1Q6U A;  4TNS A;  3KAC A;  5HWB A;  2F21 A;  3TDB A;  2DG4 A;  2LJ4 A;  1Y0O A;  2ITK A;  4N19 A;  3UI6 A;  4ODL A;  5HW8 A;  3O5I A;  1EQ3 A;  4DRM A;  2RSE A;  2XP5 A;  4JFM A;  2KR7 A;  2FAP A;  1U79 A;  4DRI A;  3VAW A;  2MLX A;  4GGQ A;  3RGC A;  1FKR A;  2D9F A;  1HXV A;  5DIV A;  3PA7 A;  4ITZ A;  1C9H A;  1YW5 A;  1J4I A;  1M5Y A;  1Q6I A;  1Q1C A;  1FKS A;  4DRO A;  1F40 A;  1FKF A;  4DT4 A;  4DRP A;  1ZK6 A;  2XP7 A;  2LGO A;  4TX0 A;  2F2D A;  3O5R A;  2KFW A;  2PBC A;  2VCD A;  2PV3 A;  4G2P A;  2Q5A A;  3B7X A;  1D7I A;  4LAX A;  4MSP A;  2JZV A;  2PPP A;  2PV2 A;  4QT2 A;  1JNS A;  1PBK A;  5DIU A;  3H9R B;  4TW6 A;  2M08 A;  3OOB A;  5HT1 A;  3EY6 A;  5HW7 A;  1KT0 A;  4C02 B;  1T11 A;  2FKE A;  2MLY A;  2MF9 A;  2MLZ A;  2PPO A;  3NTP A;  3UQA A;  1FAP A;  1FKD A;  2KE0 A;  2LKN A;  1FKK A;  2ZQS A;  2L2S A;  2ZR5 A;  3GPK A;  1KT1 A;  3O5K A;  3O5F A;  1ZCN A;  1FKG A;  1FKJ A;  1B6C A;  1NMV A;  3IKD A;  4R0X A;  4TW7 A;  3UI4 A;  3KAI A;  2ZQU A;  2KGJ A;  1JNT A;  2Y78 A;  4G50 A;  3ODK A;  2M2A A;  1D6O A;  1ROT A;  3MDY B;  4ODM A;  4U85 A;  4W9O A;  4J4N A;  3IK8 A;  4ODK A;  2ZR4 A;  3UQB A;  2KO7 A;  4DZ2 A;  2N87 A;  2XP9 A;  4ODO A;  1QZ2 A;  2XPA A;  1A7X A;  3JXV A;  1L1P A;  2RUD A;  4DZ3 A;  5DIT A;  3NI6 A;  4DRK A;  3O5D A;  2KI3 A;  3LUO A;  3O5G A;  4IQC A;  4ODP A;  4ODN A;  3KAF A;  4BF8 A;  4DRN A;  4DRH A;  2MNT A;  4FAP A;  3JYM A;  3KAB A;  3WH0 A;  3O5O A;  3NRK A;  5B8I C;  4GIV A;  4ODR A;  2IF4 A;  1BL4 A;  4JFI A;  4DRJ A;  1NSG A;  3KAG A;  4JFL A;  3CGM A;  2M1I A;  3FAP A;  3O5L A;  4QT3 A;  1Q6H A;  1FKH A;  4DRQ A;  5HWC A;  5HKG A;  5HUA A;  2XP8 A;  3O5E A;  3O5J A;  3TCZ A;  2XP4 A;  2DG9 A;  2RUQ A;  4DIP A;  1JVW A;  2PPN A;  3CGN A;  3O5Q A;  1N1A A;  2ZR6 A;  4ODQ A;  2ZQV A;  1W26 A;  1F8A B;  4FN2 A;  1J4R A;  1FKB A;  1FKI A;  2UZ5 A;  1YAT A;  3KCE A;  5I98 A;  5J6E A;  3O5P A;  2LPV A;  4J4O A;  3IHZ A;  1FJD A;  4IQ2 A;  4QIB A;  1J6Y A;  2XP6 A;  1FD9 A;  3TC5 A;  1FKL A;  4MGV A;  4U84 A;  5HTG A;  1BKF A;  1TCO C;  2AWG A;  1QPL A;  4LAV A;  3KAD A;  2ZQT A;  4LAW A;  3UI5 A;  1EYM A;  2XPB A;  2DG3 A;  5GPG A;  5D75 A;  1ROU A;  5BXJ A;  4O2T A;  1FKT A;  2XP3 A;  1PIN A;  4JFJ A;  4TW8 A;  5HW6 A;  3I6C A;  2K8I A;  3JYJ A;  3PRB A;  4U86 A;  4W9Q A;  4JYS A;  4TYO A;  2VN1 A;  2MPH A;  1D7J A;  2RQS A;  4LAY A;  1D7H A;  1NMW A;  2OFN A;  3KAH A;  4IPX A;  4W9P A;  3UF8 A;  1J4H A;  4NNR A;  3RFW A;  2RUC A;  3O5M A;  3KZ7 A;  3UQI A;  3IKG A;  1QPF A;  1P5Q A;  2F4E A;  2RUR A;  3PRD A;  1R9H A;  2PV1 A;  4JFK A; 
#chains in the Genus database with same CATH topology
 1H0I A;  1RD6 A;  1ZL1 A;  1ZBK A;  2A3C A;  4Z2K A;  1GRJ A;  2RSE A;  4JFM A;  2FAP A;  4XAK A;  4DRI A;  3VAW A;  4R5E A;  4ITZ A;  1C9H A;  4MNJ A;  1F40 A;  4ZPT R;  1FKF A;  3WKZ A;  1LL7 A;  2ESC A;  3O5R A;  1JNE A;  2VCD A;  4Z2J A;  1D7I A;  2JZV A;  2PV2 A;  2YBU A;  1LQ0 A;  1ZBV A;  1KT0 A;  3ARS A;  2MLY A;  1FAP A;  3AQU A;  1FKD A;  2KE0 A;  1FKK A;  2ZQS A;  2ZR5 A;  2WLZ A;  4HAR A;  1ZCN A;  1NMV A;  4R0X A;  3UI4 A;  2KGJ A;  1ZB5 A;  1O6I A;  1E44 A;  4MTV A;  4ODM A;  3IK8 A;  3RM9 A;  2XP9 A;  1E6P A;  2XPA A;  1A7X A;  3CHF A;  1W1P A;  3LUO A;  4IQC A;  4W5U A;  4IT6 A;  4BF8 A;  3ARR A;  1BL4 A;  4DRJ A;  4Z2H A;  2F23 A;  4JFL A;  3RME A;  4DWS A;  4NSB A;  3CGM A;  2M1I A;  4NZC A;  4DRQ A;  5HUA A;  2XP8 A;  4DIP A;  2PPN A;  3CGN A;  4AY1 A;  1N1A A;  1HKM A;  1W26 A;  1FKI A;  4L3N A;  3IHZ A;  4ZS6 A;  1J6Y A;  4U84 A;  5HTG A;  1BKF A;  4P8V A;  1NWT A;  2XPB A;  2DG3 A;  5JH8 A;  5GPG A;  1FFR A;  3WD1 A;  1VF8 A;  1FKT A;  4O2T A;  4TW8 A;  4WJX A;  2DSZ A;  1EIB A;  1LL4 A;  3CHC A;  4TYO A;  1D7J A;  2IUZ A;  1W1T A;  2YBT A;  2OLH A;  4NNR A;  3AS1 A;  3UQI A;  1QPF A;  4KQZ A;  1FKS A;  3OOB A;  3TDB A;  2DG4 A;  3UI6 A;  5HW8 A;  1W1V A;  3O5I A;  4PTM A;  3FXY A;  2XP5 A;  3ARP A;  3G6M A;  2MLX A;  4GGQ A;  4HBE A;  1XRV A;  5DIV A;  1NWS A;  1IX5 A;  1J4I A;  1D2K A;  4DT4 A;  3FY1 A;  2XP7 A;  2KFW A;  4LAX A;  4MSP A;  3B7X A;  1JCH B;  4S3K A;  1JNS A;  1TFV A;  5DIU A;  2A3E A;  3ARY A;  2M08 A;  4MAV A;  1FFQ A;  5HT1 A;  3WQV A;  5HW7 A;  1T11 A;  1E6N A;  2PPO A;  2DT2 A;  3NTP A;  4IT4 A;  3WD3 A;  2L2S A;  3O5F A;  1KT1 A;  1GUV A;  1FKG A;  1B6C A;  3W4R A;  1JNT A;  2Y78 A;  4G50 A;  2M2A A;  1D6O A;  3MDY B;  4W9O A;  4U85 A;  4J4N A;  3UQB A;  4ODK A;  2KO7 A;  4MNK A;  4DZ2 A;  3JXV A;  1W1Y A;  3NI6 A;  3O5D A;  2KI3 A;  4ODP A;  4ODN A;  4DWS D;  4DRH A;  1W9P A;  3ARU A;  3JYM A;  2DPE A;  2B5U B;  4GIV A;  3ALF A;  1HJV A;  1LG2 A;  1X6N A;  2FDM A;  3FAP A;  3WL0 A;  4QT3 A;  1FKH A;  1EHN A;  1WAW A;  2B31 A;  3ARV A;  3ARZ A;  5HKG A;  3O5E A;  2DG9 A;  1JVW A;  3WQW A;  3ARO A;  1WB0 A;  1J4R A;  5HBF A;  1FKB A;  2DSW A;  1FJD A;  3CHD A;  3WL1 A;  2XP6 A;  1FKL A;  2A3B A;  4MPK A;  1OGB A;  3PRA A;  5D75 A;  1ROU A;  2WK2 A;  1PIN A;  4KR0 B;  3JYJ A;  4JYS A;  2PI6 A;  2RQS A;  4Q7N A;  1E6Z A;  1HKI A;  1D7H A;  4W9P A;  5DO2 A;  1OWQ A;  1UR8 A;  1XHG A;  2PN0 A;  1J4H A;  3RFW A;  2F4E A;  4LAW A;  3PRD A;  1R9H A;  1Q6U A;  3KAC A;  2F21 A;  1KFW A;  1EQ3 A;  1NH6 A;  1E6R A;  3AS3 A;  3BXW A;  3RGC A;  1FKR A;  1HXV A;  3PA7 A;  1M5Y A;  1Q6I A;  4DRO A;  3GU0 A;  4DRP A;  1ZK6 A;  2LGO A;  2O92 A;  4P8U A;  4G2P A;  2Q5A A;  4ML4 A;  4WKH A;  2DT0 A;  3WD2 A;  4ZPV R;  1HJX A;  3H9R B;  5DEZ A;  1ZBC A;  1H0G A;  3UQA A;  2LKN A;  4N19 A;  3GPK A;  1CTN A;  2DT1 A;  1FKJ A;  1LL6 A;  4TW7 A;  3KAI A;  1ROT A;  2ZR4 A;  3CZ8 A;  2N87 A;  1QZ2 A;  1E15 A;  2DT3 A;  3WD4 A;  4DZ3 A;  2DSV A;  4DRK A;  3O5G A;  3B9D A;  4HBO A;  4LGX A;  3KAF A;  2MNT A;  3NRK A;  5B8I C;  3CHE A;  3CH9 A;  4ODR A;  2QF8 A;  2EUL A;  1NSG A;  4QZV B;  2P4V A;  1SYT A;  5HWC A;  4WKA A;  4DWS C;  2RUQ A;  1SR0 A;  2ZR6 A;  1WNO A;  4ODQ A;  3RM4 A;  3ARW A;  3KCE A;  1YAT A;  5I98 A;  3B9E A;  5J6E A;  2LPV A;  4J4O A;  3B8S A;  1FD9 A;  3TC5 A;  4S3J A;  1LJY A;  3OA5 A;  1NWU A;  1W9U A;  1TCO C;  1K9T A;  1OGG A;  1QPL A;  2ZQT A;  1EYM A;  5BXJ A;  4JFJ A;  2XP3 A;  3I6C A;  4U86 A;  1HKJ A;  3WD0 A;  2G41 A;  2OFN A;  3KAH A;  3BMB A;  2A3A A;  3IKG A;  2DSU A;  4FAP A;  2RUR A;  4TNS A;  3ARQ A;  5HWB A;  2LJ4 A;  1Y0O A;  2ITK A;  4ODL A;  1ZBW A;  4DRM A;  1ZU8 A;  2KR7 A;  1U79 A;  1HKK A;  2D9F A;  4DWS B;  4P8X A;  1YW5 A;  1Q1C A;  4P8W A;  4TX0 A;  2F2D A;  4Q22 A;  2PBC A;  2PV3 A;  1GPF A;  2PPP A;  4QT2 A;  1PBK A;  4TW6 A;  3QOK A;  3WIJ A;  1EDQ A;  2G8Z A;  3EY6 A;  4C02 B;  2FKE A;  2O9O A;  2MF9 A;  4WKF A;  2MLZ A;  4MNM A;  1ITX A;  1X6L A;  3O5K A;  5HW6 A;  4WK9 A;  4DH0 A;  3IKD A;  1UR9 A;  2ZQU A;  4WIW A;  3RM8 A;  3ODK A;  4Z2I A;  3GTY X;  4Z2G A;  1JND A;  3ART A;  3AS2 A;  4ODO A;  4L72 B;  1L1P A;  2RUD A;  5DIT A;  3ARX A;  4DRN A;  1NWR A;  1W9V A;  1E9L A;  3KAB A;  3WH0 A;  3O5O A;  2IF4 A;  4JFI A;  4URI A;  3KAG A;  2WLY A;  4MNL A;  1LG1 A;  3O5L A;  1Q6H A;  5DF0 A;  4UDM A;  3O5J A;  3TCZ A;  2XP4 A;  3EIP A;  3O5Q A;  2ZQV A;  1F8A B;  5GPR A;  4FN2 A;  1GOI A;  2UZ5 A;  3O5P A;  4IQ2 A;  4ZPW R;  4QIB A;  3B9A A;  4MGV A;  3ALG A;  3G6L A;  2AWG A;  5GQB A;  4LAV A;  3KAD A;  3UI5 A;  3AS0 A;  1HJW A;  2K8I A;  2WM0 A;  3PRB A;  4W9Q A;  2VN1 A;  3PR9 A;  2MPH A;  4LAY A;  1NMW A;  4IPX A;  3UF8 A;  2ETN A;  2AOS A;  2RUC A;  3O5M A;  3KZ7 A;  4Z2L A;  1P5Q A;  2PV1 A;  4JFK A; 
#chains in the Genus database with same CATH homology
 1H0I A;  1RD6 A;  1ZL1 A;  1ZBK A;  2A3C A;  4Z2K A;  2RSE A;  4JFM A;  2FAP A;  4XAK A;  4DRI A;  3VAW A;  4R5E A;  4ITZ A;  1C9H A;  4MNJ A;  1F40 A;  4ZPT R;  1FKF A;  3WKZ A;  1LL7 A;  2ESC A;  3O5R A;  1JNE A;  2VCD A;  4Z2J A;  1D7I A;  2JZV A;  2PV2 A;  2YBU A;  1LQ0 A;  1ZBV A;  1KT0 A;  3ARS A;  2MLY A;  1FAP A;  3AQU A;  1FKD A;  2KE0 A;  1FKK A;  2ZQS A;  2ZR5 A;  2WLZ A;  4HAR A;  1ZCN A;  1NMV A;  4R0X A;  3UI4 A;  2KGJ A;  1ZB5 A;  1O6I A;  4MTV A;  4ODM A;  3IK8 A;  3RM9 A;  2XP9 A;  1E6P A;  2XPA A;  1A7X A;  3CHF A;  1W1P A;  3LUO A;  4IQC A;  4W5U A;  4IT6 A;  4BF8 A;  3ARR A;  1BL4 A;  4DRJ A;  4Z2H A;  4JFL A;  3RME A;  4DWS A;  4NSB A;  3CGM A;  2M1I A;  4NZC A;  4DRQ A;  5HUA A;  2XP8 A;  4DIP A;  2PPN A;  3CGN A;  4AY1 A;  1N1A A;  1HKM A;  1W26 A;  1FKI A;  4L3N A;  3IHZ A;  4ZS6 A;  1J6Y A;  4U84 A;  5HTG A;  1BKF A;  4P8V A;  1NWT A;  2XPB A;  2DG3 A;  5JH8 A;  5GPG A;  1FFR A;  3WD1 A;  1VF8 A;  1FKT A;  4O2T A;  4TW8 A;  4WJX A;  2DSZ A;  1EIB A;  1LL4 A;  3CHC A;  4TYO A;  1D7J A;  2IUZ A;  1W1T A;  2YBT A;  2OLH A;  4NNR A;  3AS1 A;  3UQI A;  1QPF A;  4KQZ A;  1FKS A;  3OOB A;  3TDB A;  2DG4 A;  3UI6 A;  5HW8 A;  1W1V A;  3O5I A;  4PTM A;  3FXY A;  2XP5 A;  3ARP A;  3G6M A;  2MLX A;  4GGQ A;  4HBE A;  1XRV A;  5DIV A;  1NWS A;  1IX5 A;  1J4I A;  1D2K A;  4DT4 A;  3FY1 A;  2XP7 A;  2KFW A;  4LAX A;  4MSP A;  3B7X A;  4S3K A;  1JNS A;  1TFV A;  5DIU A;  2A3E A;  3ARY A;  2M08 A;  4MAV A;  1FFQ A;  5HT1 A;  3WQV A;  5HW7 A;  1T11 A;  1E6N A;  2PPO A;  2DT2 A;  3NTP A;  4IT4 A;  3WD3 A;  2L2S A;  3O5F A;  1KT1 A;  1GUV A;  1FKG A;  1B6C A;  3W4R A;  1JNT A;  2Y78 A;  4G50 A;  2M2A A;  1D6O A;  3MDY B;  4W9O A;  4U85 A;  4J4N A;  3UQB A;  4ODK A;  2KO7 A;  4MNK A;  4DZ2 A;  3JXV A;  1W1Y A;  3NI6 A;  3O5D A;  2KI3 A;  4ODP A;  4ODN A;  4DWS D;  4DRH A;  1W9P A;  3ARU A;  3JYM A;  2DPE A;  4GIV A;  3ALF A;  1HJV A;  1LG2 A;  1X6N A;  2FDM A;  3FAP A;  3WL0 A;  4QT3 A;  1FKH A;  1EHN A;  1WAW A;  2B31 A;  3ARV A;  3ARZ A;  5HKG A;  3O5E A;  2DG9 A;  1JVW A;  3WQW A;  3ARO A;  1WB0 A;  1J4R A;  5HBF A;  1FKB A;  2DSW A;  1FJD A;  3CHD A;  3WL1 A;  2XP6 A;  1FKL A;  2A3B A;  4MPK A;  1OGB A;  3PRA A;  5D75 A;  1ROU A;  2WK2 A;  1PIN A;  4KR0 B;  3JYJ A;  4JYS A;  2PI6 A;  2RQS A;  4Q7N A;  1E6Z A;  1HKI A;  1D7H A;  4W9P A;  5DO2 A;  1OWQ A;  1UR8 A;  1XHG A;  1J4H A;  3RFW A;  2F4E A;  4LAW A;  3PRD A;  1R9H A;  1Q6U A;  3KAC A;  2F21 A;  1KFW A;  1EQ3 A;  1NH6 A;  1E6R A;  3AS3 A;  3BXW A;  3RGC A;  1FKR A;  1HXV A;  3PA7 A;  1M5Y A;  1Q6I A;  4DRO A;  4DRP A;  1ZK6 A;  2LGO A;  2O92 A;  4P8U A;  4G2P A;  2Q5A A;  4ML4 A;  4WKH A;  2DT0 A;  3WD2 A;  4ZPV R;  1HJX A;  3H9R B;  5DEZ A;  1ZBC A;  1H0G A;  3UQA A;  2LKN A;  4N19 A;  3GPK A;  1CTN A;  2DT1 A;  1FKJ A;  1LL6 A;  4TW7 A;  3KAI A;  1ROT A;  2ZR4 A;  3CZ8 A;  2N87 A;  1QZ2 A;  1E15 A;  2DT3 A;  3WD4 A;  4DZ3 A;  2DSV A;  4DRK A;  3O5G A;  3B9D A;  4HBO A;  4LGX A;  3KAF A;  2MNT A;  3NRK A;  5B8I C;  3CHE A;  3CH9 A;  4ODR A;  2QF8 A;  1NSG A;  4QZV B;  1SYT A;  5HWC A;  4WKA A;  4DWS C;  2RUQ A;  1SR0 A;  2ZR6 A;  1WNO A;  4ODQ A;  3RM4 A;  3ARW A;  3KCE A;  1YAT A;  5I98 A;  3B9E A;  5J6E A;  2LPV A;  4J4O A;  3B8S A;  1FD9 A;  3TC5 A;  4S3J A;  1LJY A;  3OA5 A;  1NWU A;  1W9U A;  1TCO C;  1K9T A;  1OGG A;  1QPL A;  2ZQT A;  1EYM A;  5BXJ A;  4JFJ A;  2XP3 A;  3I6C A;  4U86 A;  1HKJ A;  3WD0 A;  2G41 A;  2OFN A;  3KAH A;  2A3A A;  3IKG A;  2DSU A;  4FAP A;  2RUR A;  4TNS A;  3ARQ A;  5HWB A;  2LJ4 A;  1Y0O A;  2ITK A;  4ODL A;  1ZBW A;  4DRM A;  1ZU8 A;  2KR7 A;  1U79 A;  1HKK A;  2D9F A;  4DWS B;  4P8X A;  1YW5 A;  1Q1C A;  4P8W A;  4TX0 A;  2F2D A;  4Q22 A;  2PBC A;  2PV3 A;  1GPF A;  2PPP A;  4QT2 A;  1PBK A;  4TW6 A;  3QOK A;  3WIJ A;  1EDQ A;  2G8Z A;  3EY6 A;  4C02 B;  2FKE A;  2O9O A;  2MF9 A;  4WKF A;  2MLZ A;  4MNM A;  1ITX A;  1X6L A;  3O5K A;  5HW6 A;  4WK9 A;  4DH0 A;  3IKD A;  1UR9 A;  2ZQU A;  4WIW A;  3RM8 A;  3ODK A;  4Z2I A;  4Z2G A;  1JND A;  3ART A;  3AS2 A;  4ODO A;  4L72 B;  1L1P A;  2RUD A;  5DIT A;  3ARX A;  4DRN A;  1NWR A;  1W9V A;  1E9L A;  3KAB A;  3WH0 A;  3O5O A;  2IF4 A;  4JFI A;  4URI A;  3KAG A;  2WLY A;  4MNL A;  1LG1 A;  3O5L A;  1Q6H A;  5DF0 A;  3O5J A;  3TCZ A;  2XP4 A;  3O5Q A;  2ZQV A;  1F8A B;  5GPR A;  4FN2 A;  1GOI A;  2UZ5 A;  3O5P A;  4IQ2 A;  4ZPW R;  4QIB A;  3B9A A;  4MGV A;  3ALG A;  3G6L A;  2AWG A;  5GQB A;  4LAV A;  3KAD A;  3UI5 A;  3AS0 A;  1HJW A;  2K8I A;  2WM0 A;  3PRB A;  4W9Q A;  2VN1 A;  3PR9 A;  2MPH A;  4LAY A;  1NMW A;  4IPX A;  3UF8 A;  2AOS A;  2RUC A;  3O5M A;  3KZ7 A;  4Z2L A;  1P5Q A;  2PV1 A;  4JFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...