3LUOA

Crystal structure and functional characterization of the thermophilic prolyl isomerase and chaperone slyd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
145
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 28
structure length 145
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3luoA00
4DT4A 3KADA 4MSPA 3O5JA 4LAXA 3O5MA 2XPAA 3ODKA 2RUDA 4R0XA 4C02B 3KAIA 3O5DA 4GIVA 4JFKA 3UI4A 1FKJA 2OFNA 2L2SA 4U86A 4G50A 2M2AA 1JNTA 4ODMA 2RUQA 3O5QA 3O5PA 5B8IC 5GPGA 1Q6HA 4TYOA 4BF8A 5DIUA 4DRQA 1Q1CA 1TCOC 3UI5A 2RURA 4JFLA 2AWGA 2ZQTA 4MGVA 2XP6A 1NMWA 3MDYB 3UF8A 3JYJA 4ODLA 1FD9A 1F8AB 2XP4A 2F21A 3NRKA 4QT3A 1P5QA 1ROUA 2ZQUA 5D75A 2KE0A 2KI3A 4ODRA 4ODOA 1BKFA 3RFWA 3KCEA 3O5GA 3O5FA 1FKGA 2RQSA 2PBCA 2MNTA 4IQ2A 1N1AA 2XP3A 3UQIA 3WH0A 4DRPA 1B6CA 2XP9A 1QPFA 2XP8A 4DRHA 1YATA 2DG9A 2MLYA 3FAPA 1FKIA 4DZ2A 3O5IA 2XP5A 1F40A 2ZR4A 4LAYA 2ITKA 2F4EA 4N19A 2ZR6A 1FKTA 4DRMA 5HWBA 2JZVA 3IK8A 4TW6A 1HXVA 4J4OA 5J6EA 3IHZA 5HWCA 4O2TA 4DRJA 1J6YA 4JFIA 2LGOA 3B7XA 4G2PA 3KZ7A 2F2DA 4DIPA 1D7HA 2LPVA 1YW5A 1M5YA 3RGCA 4ODNA 2MPHA 2KGJA 4FAPA 2KO7A 1PINA 4QT2A 4TW8A 3UI6A 1T11A 3JYMA 5DITA 5HW7A 2K8IA 3O5OA 1KT1A 4DRNA 1JVWA 4IQCA 4JYSA 4DH0A 5HTGA 4W9QA 5I98A 2FAPA 3IKGA 4GGQA 5HUAA 4ODPA 3NTPA 2KFWA 4U84A 1FAPA 1J4RA 4LAVA 2PV3A 5HW8A 4W9OA 3KAGA 3KABA 4DRKA 1BL4A 1FKLA 4ODQA 5HT1A 4DRIA 5HW6A 2PPPA 2DG4A 1KT0A 2PV1A 4TX0A 3GPKA 1FKBA 2RUCA 1EYMA 5DIVA 4NNRA 4U85A 3TDBA 1Q6IA 3H9RB 3UQAA 2FKEA 1FKRA 4JFJA 1NSGA 2IF4A 2PPNA 3VAWA 1FJDA 1ROTA 2M1IA 3OOBA 4LAWA 1NMVA 4ODKA 1W26A 1J4HA 1FKFA 3UQBA 1Q6UA 1A7XA 2Q5AA 3O5KA 3PRDA 3KAFA 4ITZA 1EQ3A 1D7IA 2XPBA 2MLZA 5HKGA 2RSEA 4QIBA 2M08A 2N87A 3LUOA 3O5EA 4J4NA 1U79A 4TW7A 1ZK6A 4W9PA 2UZ5A 2VN1A 3CGNA 2PV2A 2VCDA 2ZQVA 4FN2A 1D6OA 1QZ2A 3TCZA 2LJ4A 3O5RA 4IPXA 1FKSA 3O5LA 3PA7A 1FKKA 3KAHA 1QPLA 2ZQSA 2MF9A 1D7JA 2DG3A 1FKDA 1Y0OA 2MLXA 2ZR5A 1R9HA 3CGMA 5BXJA 1FKHA 1ZCNA 3EY6A 2XP7A 1PBKA 3JXVA 3I6CA 2Y78A 1JNSA 1C9HA 1J4IA 4JFMA 3IKDA 1L1PA 3NI6A 3TC5A 4DZ3A 2D9FA 3PRBA 4TNSA 2LKNA 4DROA 2PPOA 3KACA 2KR7A
chains in the Genus database with same CATH superfamily
4MSPA 3RM9A 4C02B 4Z2LA 4HARA 3UI4A 1E15A 2RUQA 1W1YA 3O5QA 3ARSA 4WKAA 1Q6HA 2YBTA 4HBEA 3FY1A 2XP6A 3ARTA 3UF8A 3JYJA 2F21A 3AS3A 4QT3A 2KI3A 4QZVB 3O5GA 3O5FA 1FKGA 2RQSA 2PBCA 3UQIA 4DRPA 4WIWA 2PI6A 1QPFA 2XP8A 2DG9A 4IT4A 1LQ0A 4N19A 1FKTA 1OGGA 1JCHB 4TW6A 5J6EA 4P8UA 3B7XA 3KZ7A 3WIJA 3RGCA 2MPHA 1PINA 4QT2A 3UI6A 4NSBA 2K8IA 1OGBA 5DF0A 4DH0A 3ARVA 1ZBKA 2DSUA 3WD4A 4Z2HA 2DSWA 4U84A 5HW8A 4WK9A 5HW6A 4DRIA 1XHGA 5GPRA 3G6MA 4P8XA 4W5UA 3B8SA 1JNEA 4DWSB 2IF4A 2QF8A 1LL6A 1E6ZA 4LAWA 1NMVA 4ODKA 1W26A 1FKFA 4IT6A 1Q6UA 3O5KA 4Q22A 4ITZA 4Z2GA 1GOIA 2M08A 4J4NA 1U79A 4TW7A 3CHCA 1VF8A 1GRJA 4MAVA 2DT3A 1OWQA 4QIBA 2AOSA 1FKDA 3W4RA 3JXVA 3RM8A 3I6CA 1C9HA 3NI6A 4TNSA 4DROA 2LKNA 2PPOA 3QOKA 4XAKA 4DT4A 3AROA 1LG2A 2XPAA 2RUDA 2DSZA 1SYTA 1NWRA 4G50A 4U86A 4ODMA 5B8IC 5DIUA 1TCOC 3UI5A 2AWGA 1FD9A 1F8AB 3CHFA 1P5QA 3AS0A 3ARWA 1W9UA 2ZQUA 2KE0A 4ODOA 1BKFA 3RFWA 3WH0A 2G41A 2ESCA 4DRHA 2MLYA 3ALFA 1FKIA 3WD1A 1O6IA 2DT0A 3O5IA 2F4EA 4DRMA 5HWBA 4MNMA 1E6RA 3PRAA 3IHZA 4O2TA 4DRJA 4JFIA 2LGOA 4G2PA 5DEZA 1M5YA 3GU0A 3ARPA 3BMBA 4ZPTR 1E44A 1T11A 1W9VA 4PTMA 3JYMA 3O5OA 1NWUA 4L3NA 1E9LA 1E6NA 5HBFA 3IKGA 3RMEA 1J4RA 2PV3A 4W9OA 3WQWA 1BL4A 3PR9A 4ODQA 4DWSC 4WKHA 1KT0A 2PV1A 4TX0A 1FKBA 2WLZA 4U85A 3TDBA 1Q6IA 2FKEA 1EHNA 2DPEA 1FJDA 4DWSA 3WKZA 1WB0A 1A7XA 4KR0B 4ZS6A 3KAFA 4MNLA 1EQ3A 1D7IA 1WNOA 2MLZA 2O9OA 2RSEA 4LGXA 2N87A 3AS1A 4P8WA 1ZK6A 2UZ5A 2VN1A 1LL4A 2O92A 1D6OA 1LG1A 4NZCA 4IPXA 1FKSA 3O5LA 1NWSA 3PA7A 3ARRA 1HXVA 2ZQSA 3B9DA 1D7JA 1IX5A 2MLXA 1UR8A 3CGMA 1PBKA 4ML4A 1JNSA 1J4IA 3CH9A 1H0IA 3IKDA 2DT2A 4JFMA 4DZ3A 1HKMA 3KACA 2KR7A 2PN0A 4LAXA 3O5MA 4URIA 1D2KA 3AQUA 3KAIA 3O5DA 3FXYA 1FKJA 2OFNA 4ZPVR 2A3BA 2A3EA 2B31A 2FDMA 3MDYB 1NWTA 4ODLA 3NRKA 1ROUA 1HKJA 3WL1A 4IQ2A 2MNTA 2G8ZA 1B6CA 4DZ2A 1ZU8A 2XP5A 1X6LA 1W1TA 2ZR4A 4LAYA 2EULA 5GQBA 2JZVA 3IK8A 4MNJA 4Q7NA 2P4VA 4WKFA 3WD2A 1J6YA 3BXWA 2F2DA 1D7HA 1E6PA 1RD6A 2LPVA 4MPKA 3WQVA 2KGJA 1TFVA 4FAPA 4TW8A 1KFWA 3ALGA 3CHEA 1H0GA 1LJYA 5HTGA 4GGQA 5HUAA 1FAPA 1ZBCA 4ZPWR 3KABA 4DRKA 4HBOA 5HT1A 2PPPA 2DG4A 3ARXA 3GPKA 1EYMA 5DIVA 4AY1A 4NNRA 3H9RB 3UQAA 4JFJA 1NSGA 1ROTA 2M1IA 3OOBA 1ZBWA 2OLHA 3UQBA 2Q5AA 4MNKA 3G6LA 1GUVA 3LUOA 4W9PA 2F23A 3CGNA 4FN2A 2VCDA 2ZQVA 3TCZA 3ARZA 1W9PA 1FKKA 1QPLA 2MF9A 2ZR5A 1HJXA 1Y0OA 2DG3A 2IUZA 1R9HA 5BXJA 4R5EA 1FKHA 3EY6A 3AS2A 5JH8A 2Y78A 3TC5A 2D9FA 3B9EA 4L72B 2A3AA 4UDMA 3KADA 3O5JA 1X6NA 3ODKA 4R0XA 1FFQA 4GIVA 4JFKA 4Z2JA 2L2SA 1ZL1A 3GTYX 2M2AA 1JNTA 3O5PA 5GPGA 4TYOA 4DRQA 1Q1CA 2RURA 4JFLA 2ZQTA 4MGVA 1K9TA 1NMWA 2XP4A 1HKKA 5D75A 3WL0A 4DWSD 4ODRA 3KCEA 4MTVA 1UR9A 1N1AA 2XP3A 2YBUA 2XP9A 1NH6A 1YATA 3FAPA 1EDQA 1LL7A 1F40A 1HJWA 2ITKA 2ZR6A 1EIBA 3CHDA 4J4OA 5HWCA 2WLYA 4DIPA 1YW5A 1W1PA 4ODNA 1SR0A 2KO7A 5DITA 5HW7A 1CTNA 3OA5A 1KT1A 4DRNA 1JVWA 4IQCA 4JYSA 4Z2KA 3WD0A 5DO2A 4W9QA 5I98A 2FAPA 2DT1A 2ETNA 2WK2A 4ODPA 3NTPA 2KFWA 3CZ8A 1JNDA 4LAVA 3KAGA 1FKLA 2RUCA 4Z2IA 2A3CA 3EIPA 1ZBVA 2B5UB 1FKRA 2PPNA 3VAWA 2DSVA 2WM0A 4KQZA 1J4HA 1XRVA 3PRDA 1FFRA 1W1VA 3ARQA 3ARYA 4WJXA 2XPBA 5HKGA 4P8VA 3O5EA 1HJVA 4S3JA 1WAWA 2PV2A 3WD3A 1QZ2A 1HKIA 2LJ4A 3O5RA 1GPFA 3KAHA 1ZB5A 3B9AA 1ZCNA 3ARUA 2XP7A 1ITXA 1L1PA 3RM4A 3PRBA 4S3KA 4BF8A
chains in the Genus database with same CATH topology
4MSPA 3RM9A 4C02B 4Z2LA 4HARA 3UI4A 1E15A 2RUQA 1W1YA 3O5QA 3ARSA 4WKAA 1Q6HA 2YBTA 4HBEA 3FY1A 2XP6A 3ARTA 3UF8A 3JYJA 2F21A 3AS3A 4QT3A 2KI3A 4QZVB 3O5GA 3O5FA 1FKGA 2RQSA 2PBCA 3UQIA 4DRPA 4WIWA 2PI6A 1QPFA 2XP8A 2DG9A 4IT4A 1LQ0A 4N19A 1FKTA 1OGGA 4TW6A 5J6EA 4P8UA 3B7XA 3KZ7A 3WIJA 3RGCA 2MPHA 1PINA 4QT2A 3UI6A 4NSBA 2K8IA 1OGBA 5DF0A 4DH0A 3ARVA 1ZBKA 2DSUA 3WD4A 4Z2HA 2DSWA 4U84A 5HW8A 4WK9A 5HW6A 4DRIA 1XHGA 5GPRA 3G6MA 4P8XA 4W5UA 3B8SA 1JNEA 4DWSB 2IF4A 2QF8A 1LL6A 1E6ZA 4LAWA 1NMVA 4ODKA 1W26A 1FKFA 4IT6A 1Q6UA 3O5KA 4Q22A 4ITZA 4Z2GA 1GOIA 2M08A 4J4NA 1U79A 4TW7A 3CHCA 1VF8A 4MAVA 2DT3A 1OWQA 4QIBA 2AOSA 1FKDA 3W4RA 3JXVA 3RM8A 3I6CA 1C9HA 3NI6A 4TNSA 4DROA 2LKNA 2PPOA 3QOKA 4XAKA 4DT4A 3AROA 1LG2A 2XPAA 2RUDA 2DSZA 1SYTA 1NWRA 4G50A 4U86A 4ODMA 5B8IC 5DIUA 1TCOC 3UI5A 2AWGA 1FD9A 1F8AB 3CHFA 1P5QA 3AS0A 3ARWA 1W9UA 2ZQUA 2KE0A 4ODOA 1BKFA 3RFWA 3WH0A 2G41A 2ESCA 4DRHA 2MLYA 3ALFA 1FKIA 3WD1A 1O6IA 2DT0A 3O5IA 2F4EA 4DRMA 5HWBA 4MNMA 1E6RA 3PRAA 3IHZA 4O2TA 4DRJA 4JFIA 2LGOA 4G2PA 5DEZA 1M5YA 3ARPA 4ZPTR 1T11A 1W9VA 4PTMA 3JYMA 3O5OA 1NWUA 4L3NA 1E9LA 1E6NA 5HBFA 3IKGA 3RMEA 1J4RA 2PV3A 4W9OA 3WQWA 1BL4A 3PR9A 4ODQA 4DWSC 4WKHA 1KT0A 2PV1A 4TX0A 1FKBA 2WLZA 4U85A 3TDBA 1Q6IA 2FKEA 1EHNA 2DPEA 1FJDA 4DWSA 3WKZA 1WB0A 1A7XA 4KR0B 4ZS6A 3KAFA 4MNLA 1EQ3A 1D7IA 1WNOA 2MLZA 2O9OA 2RSEA 4LGXA 2N87A 3AS1A 4P8WA 1ZK6A 2UZ5A 2VN1A 1LL4A 2O92A 1D6OA 1LG1A 4NZCA 4IPXA 1FKSA 3O5LA 1NWSA 3PA7A 3ARRA 1HXVA 2ZQSA 3B9DA 1D7JA 1IX5A 2MLXA 1UR8A 3CGMA 1PBKA 4ML4A 1JNSA 1J4IA 3CH9A 1H0IA 3IKDA 2DT2A 4JFMA 4DZ3A 1HKMA 3KACA 2KR7A 4LAXA 3O5MA 4URIA 1D2KA 3AQUA 3KAIA 3O5DA 3FXYA 1FKJA 2OFNA 4ZPVR 2A3BA 2A3EA 2B31A 2FDMA 3MDYB 1NWTA 4ODLA 3NRKA 1ROUA 1HKJA 3WL1A 4IQ2A 2MNTA 2G8ZA 1B6CA 4DZ2A 1ZU8A 2XP5A 1X6LA 1W1TA 2ZR4A 4LAYA 5GQBA 2JZVA 3IK8A 4MNJA 4Q7NA 4WKFA 3WD2A 1J6YA 3BXWA 2F2DA 1D7HA 1E6PA 1RD6A 2LPVA 4MPKA 3WQVA 2KGJA 1TFVA 4FAPA 4TW8A 1KFWA 3ALGA 3CHEA 1H0GA 1LJYA 5HTGA 4GGQA 5HUAA 1FAPA 1ZBCA 4ZPWR 3KABA 4DRKA 4HBOA 5HT1A 2PPPA 2DG4A 3ARXA 3GPKA 1EYMA 5DIVA 4AY1A 4NNRA 3H9RB 3UQAA 4JFJA 1NSGA 1ROTA 2M1IA 3OOBA 1ZBWA 2OLHA 3UQBA 2Q5AA 4MNKA 3G6LA 1GUVA 3LUOA 4W9PA 3CGNA 4FN2A 2VCDA 2ZQVA 3TCZA 3ARZA 1W9PA 1FKKA 1QPLA 2MF9A 2ZR5A 1HJXA 1Y0OA 2DG3A 2IUZA 1R9HA 5BXJA 4R5EA 1FKHA 3EY6A 3AS2A 5JH8A 2Y78A 3TC5A 2D9FA 3B9EA 4L72B 2A3AA 3KADA 3O5JA 1X6NA 3ODKA 4R0XA 1FFQA 4GIVA 4JFKA 4Z2JA 2L2SA 1ZL1A 2M2AA 1JNTA 3O5PA 5GPGA 4TYOA 4DRQA 1Q1CA 2RURA 4JFLA 2ZQTA 4MGVA 1K9TA 1NMWA 2XP4A 1HKKA 5D75A 3WL0A 4DWSD 4ODRA 3KCEA 4MTVA 1UR9A 1N1AA 2XP3A 2YBUA 2XP9A 1NH6A 1YATA 3FAPA 1EDQA 1LL7A 1F40A 1HJWA 2ITKA 2ZR6A 1EIBA 3CHDA 4J4OA 5HWCA 2WLYA 4DIPA 1YW5A 1W1PA 4ODNA 1SR0A 2KO7A 5DITA 5HW7A 1CTNA 3OA5A 1KT1A 4DRNA 1JVWA 4IQCA 4JYSA 4Z2KA 3WD0A 5DO2A 4W9QA 5I98A 2FAPA 2DT1A 2WK2A 4ODPA 3NTPA 2KFWA 3CZ8A 1JNDA 4LAVA 3KAGA 1FKLA 2RUCA 4Z2IA 2A3CA 1ZBVA 1FKRA 2PPNA 3VAWA 2DSVA 2WM0A 4KQZA 1J4HA 1XRVA 3PRDA 1FFRA 1W1VA 3ARQA 3ARYA 4WJXA 2XPBA 5HKGA 4P8VA 3O5EA 1HJVA 4S3JA 1WAWA 2PV2A 3WD3A 1QZ2A 1HKIA 2LJ4A 3O5RA 1GPFA 3KAHA 1ZB5A 3B9AA 1ZCNA 3ARUA 2XP7A 1ITXA 1L1PA 3RM4A 3PRBA 4S3KA 4BF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DT4 A;  3KAD A;  4MSP A;  3O5J A;  4LAX A;  3O5M A;  2XPA A;  3ODK A;  2RUD A;  4R0X A;  4C02 B;  3KAI A;  3O5D A;  4GIV A;  4JFK A;  3UI4 A;  1FKJ A;  2OFN A;  2L2S A;  4U86 A;  4G50 A;  2M2A A;  1JNT A;  4ODM A;  2RUQ A;  3O5Q A;  3O5P A;  5B8I C;  5GPG A;  1Q6H A;  4TYO A;  4BF8 A;  5DIU A;  4DRQ A;  1Q1C A;  1TCO C;  3UI5 A;  2RUR A;  4JFL A;  2AWG A;  2ZQT A;  4MGV A;  2XP6 A;  1NMW A;  3MDY B;  3UF8 A;  3JYJ A;  4ODL A;  1FD9 A;  1F8A B;  2XP4 A;  2F21 A;  3NRK A;  4QT3 A;  1P5Q A;  1ROU A;  2ZQU A;  5D75 A;  2KE0 A;  2KI3 A;  4ODR A;  4ODO A;  1BKF A;  3RFW A;  3KCE A;  3O5G A;  3O5F A;  1FKG A;  2RQS A;  2PBC A;  2MNT A;  4IQ2 A;  1N1A A;  2XP3 A;  3UQI A;  3WH0 A;  4DRP A;  1B6C A;  2XP9 A;  1QPF A;  2XP8 A;  4DRH A;  1YAT A;  2DG9 A;  2MLY A;  3FAP A;  1FKI A;  4DZ2 A;  3O5I A;  2XP5 A;  1F40 A;  2ZR4 A;  4LAY A;  2ITK A;  2F4E A;  4N19 A;  2ZR6 A;  1FKT A;  4DRM A;  5HWB A;  2JZV A;  3IK8 A;  4TW6 A;  1HXV A;  4J4O A;  5J6E A;  3IHZ A;  5HWC A;  4O2T A;  4DRJ A;  1J6Y A;  4JFI A;  2LGO A;  3B7X A;  4G2P A;  3KZ7 A;  2F2D A;  4DIP A;  1D7H A;  2LPV A;  1YW5 A;  1M5Y A;  3RGC A;  4ODN A;  2MPH A;  2KGJ A;  4FAP A;  2KO7 A;  1PIN A;  4QT2 A;  4TW8 A;  3UI6 A;  1T11 A;  3JYM A;  5DIT A;  5HW7 A;  2K8I A;  3O5O A;  1KT1 A;  4DRN A;  1JVW A;  4IQC A;  4JYS A;  4DH0 A;  5HTG A;  4W9Q A;  5I98 A;  2FAP A;  3IKG A;  4GGQ A;  5HUA A;  4ODP A;  3NTP A;  2KFW A;  4U84 A;  1FAP A;  1J4R A;  4LAV A;  2PV3 A;  5HW8 A;  4W9O A;  3KAG A;  3KAB A;  4DRK A;  1BL4 A;  1FKL A;  4ODQ A;  5HT1 A;  4DRI A;  5HW6 A;  2PPP A;  2DG4 A;  1KT0 A;  2PV1 A;  4TX0 A;  3GPK A;  1FKB A;  2RUC A;  1EYM A;  5DIV A;  4NNR A;  4U85 A;  3TDB A;  1Q6I A;  3H9R B;  3UQA A;  2FKE A;  1FKR A;  4JFJ A;  1NSG A;  2IF4 A;  2PPN A;  3VAW A;  1FJD A;  1ROT A;  2M1I A;  3OOB A;  4LAW A;  1NMV A;  4ODK A;  1W26 A;  1J4H A;  1FKF A;  3UQB A;  1Q6U A;  1A7X A;  2Q5A A;  3O5K A;  3PRD A;  3KAF A;  4ITZ A;  1EQ3 A;  1D7I A;  2XPB A;  2MLZ A;  5HKG A;  2RSE A;  4QIB A;  2M08 A;  2N87 A;  3LUO A;  3O5E A;  4J4N A;  1U79 A;  4TW7 A;  1ZK6 A;  4W9P A;  2UZ5 A;  2VN1 A;  3CGN A;  2PV2 A;  2VCD A;  2ZQV A;  4FN2 A;  1D6O A;  1QZ2 A;  3TCZ A;  2LJ4 A;  3O5R A;  4IPX A;  1FKS A;  3O5L A;  3PA7 A;  1FKK A;  3KAH A;  1QPL A;  2ZQS A;  2MF9 A;  1D7J A;  2DG3 A;  1FKD A;  1Y0O A;  2MLX A;  2ZR5 A;  1R9H A;  3CGM A;  5BXJ A;  1FKH A;  1ZCN A;  3EY6 A;  2XP7 A;  1PBK A;  3JXV A;  3I6C A;  2Y78 A;  1JNS A;  1C9H A;  1J4I A;  4JFM A;  3IKD A;  1L1P A;  3NI6 A;  3TC5 A;  4DZ3 A;  2D9F A;  3PRB A;  4TNS A;  2LKN A;  4DRO A;  2PPO A;  3KAC A;  2KR7 A; 
#chains in the Genus database with same CATH topology
 4MSP A;  3RM9 A;  4C02 B;  4Z2L A;  4HAR A;  3UI4 A;  1E15 A;  2RUQ A;  1W1Y A;  3O5Q A;  3ARS A;  4WKA A;  1Q6H A;  2YBT A;  4HBE A;  3FY1 A;  2XP6 A;  3ART A;  3UF8 A;  3JYJ A;  2F21 A;  3AS3 A;  4QT3 A;  2KI3 A;  4QZV B;  3O5G A;  3O5F A;  1FKG A;  2RQS A;  2PBC A;  3UQI A;  4DRP A;  4WIW A;  2PI6 A;  1QPF A;  2XP8 A;  2DG9 A;  4IT4 A;  1LQ0 A;  4N19 A;  1FKT A;  1OGG A;  1JCH B;  4TW6 A;  5J6E A;  4P8U A;  3B7X A;  3KZ7 A;  3WIJ A;  3RGC A;  2MPH A;  1PIN A;  4QT2 A;  3UI6 A;  4NSB A;  2K8I A;  1OGB A;  5DF0 A;  4DH0 A;  3ARV A;  1ZBK A;  2DSU A;  3WD4 A;  4Z2H A;  2DSW A;  4U84 A;  5HW8 A;  4WK9 A;  5HW6 A;  4DRI A;  1XHG A;  5GPR A;  3G6M A;  4P8X A;  4W5U A;  3B8S A;  1JNE A;  4DWS B;  2IF4 A;  2QF8 A;  1LL6 A;  1E6Z A;  4LAW A;  1NMV A;  4ODK A;  1W26 A;  1FKF A;  4IT6 A;  1Q6U A;  3O5K A;  4Q22 A;  4ITZ A;  4Z2G A;  1GOI A;  2M08 A;  4J4N A;  1U79 A;  4TW7 A;  3CHC A;  1VF8 A;  1GRJ A;  4MAV A;  2DT3 A;  1OWQ A;  4QIB A;  2AOS A;  1FKD A;  3W4R A;  3JXV A;  3RM8 A;  3I6C A;  1C9H A;  3NI6 A;  4TNS A;  4DRO A;  2LKN A;  2PPO A;  3QOK A;  4XAK A;  4DT4 A;  3ARO A;  1LG2 A;  2XPA A;  2RUD A;  2DSZ A;  1SYT A;  1NWR A;  4G50 A;  4U86 A;  4ODM A;  5B8I C;  5DIU A;  1TCO C;  3UI5 A;  2AWG A;  1FD9 A;  1F8A B;  3CHF A;  1P5Q A;  3AS0 A;  3ARW A;  1W9U A;  2ZQU A;  2KE0 A;  4ODO A;  1BKF A;  3RFW A;  3WH0 A;  2G41 A;  2ESC A;  4DRH A;  2MLY A;  3ALF A;  1FKI A;  3WD1 A;  1O6I A;  2DT0 A;  3O5I A;  2F4E A;  4DRM A;  5HWB A;  4MNM A;  1E6R A;  3PRA A;  3IHZ A;  4O2T A;  4DRJ A;  4JFI A;  2LGO A;  4G2P A;  5DEZ A;  1M5Y A;  3GU0 A;  3ARP A;  3BMB A;  4ZPT R;  1E44 A;  1T11 A;  1W9V A;  4PTM A;  3JYM A;  3O5O A;  1NWU A;  4L3N A;  1E9L A;  1E6N A;  5HBF A;  3IKG A;  3RME A;  1J4R A;  2PV3 A;  4W9O A;  3WQW A;  1BL4 A;  3PR9 A;  4ODQ A;  4DWS C;  4WKH A;  1KT0 A;  2PV1 A;  4TX0 A;  1FKB A;  2WLZ A;  4U85 A;  3TDB A;  1Q6I A;  2FKE A;  1EHN A;  2DPE A;  1FJD A;  4DWS A;  3WKZ A;  1WB0 A;  1A7X A;  4KR0 B;  4ZS6 A;  3KAF A;  4MNL A;  1EQ3 A;  1D7I A;  1WNO A;  2MLZ A;  2O9O A;  2RSE A;  4LGX A;  2N87 A;  3AS1 A;  4P8W A;  1ZK6 A;  2UZ5 A;  2VN1 A;  1LL4 A;  2O92 A;  1D6O A;  1LG1 A;  4NZC A;  4IPX A;  1FKS A;  3O5L A;  1NWS A;  3PA7 A;  3ARR A;  1HXV A;  2ZQS A;  3B9D A;  1D7J A;  1IX5 A;  2MLX A;  1UR8 A;  3CGM A;  1PBK A;  4ML4 A;  1JNS A;  1J4I A;  3CH9 A;  1H0I A;  3IKD A;  2DT2 A;  4JFM A;  4DZ3 A;  1HKM A;  3KAC A;  2KR7 A;  2PN0 A;  4LAX A;  3O5M A;  4URI A;  1D2K A;  3AQU A;  3KAI A;  3O5D A;  3FXY A;  1FKJ A;  2OFN A;  4ZPV R;  2A3B A;  2A3E A;  2B31 A;  2FDM A;  3MDY B;  1NWT A;  4ODL A;  3NRK A;  1ROU A;  1HKJ A;  3WL1 A;  4IQ2 A;  2MNT A;  2G8Z A;  1B6C A;  4DZ2 A;  1ZU8 A;  2XP5 A;  1X6L A;  1W1T A;  2ZR4 A;  4LAY A;  2EUL A;  5GQB A;  2JZV A;  3IK8 A;  4MNJ A;  4Q7N A;  2P4V A;  4WKF A;  3WD2 A;  1J6Y A;  3BXW A;  2F2D A;  1D7H A;  1E6P A;  1RD6 A;  2LPV A;  4MPK A;  3WQV A;  2KGJ A;  1TFV A;  4FAP A;  4TW8 A;  1KFW A;  3ALG A;  3CHE A;  1H0G A;  1LJY A;  5HTG A;  4GGQ A;  5HUA A;  1FAP A;  1ZBC A;  4ZPW R;  3KAB A;  4DRK A;  4HBO A;  5HT1 A;  2PPP A;  2DG4 A;  3ARX A;  3GPK A;  1EYM A;  5DIV A;  4AY1 A;  4NNR A;  3H9R B;  3UQA A;  4JFJ A;  1NSG A;  1ROT A;  2M1I A;  3OOB A;  1ZBW A;  2OLH A;  3UQB A;  2Q5A A;  4MNK A;  3G6L A;  1GUV A;  3LUO A;  4W9P A;  2F23 A;  3CGN A;  4FN2 A;  2VCD A;  2ZQV A;  3TCZ A;  3ARZ A;  1W9P A;  1FKK A;  1QPL A;  2MF9 A;  2ZR5 A;  1HJX A;  1Y0O A;  2DG3 A;  2IUZ A;  1R9H A;  5BXJ A;  4R5E A;  1FKH A;  3EY6 A;  3AS2 A;  5JH8 A;  2Y78 A;  3TC5 A;  2D9F A;  3B9E A;  4L72 B;  2A3A A;  4UDM A;  3KAD A;  3O5J A;  1X6N A;  3ODK A;  4R0X A;  1FFQ A;  4GIV A;  4JFK A;  4Z2J A;  2L2S A;  1ZL1 A;  3GTY X;  2M2A A;  1JNT A;  3O5P A;  5GPG A;  4TYO A;  4DRQ A;  1Q1C A;  2RUR A;  4JFL A;  2ZQT A;  4MGV A;  1K9T A;  1NMW A;  2XP4 A;  1HKK A;  5D75 A;  3WL0 A;  4DWS D;  4ODR A;  3KCE A;  4MTV A;  1UR9 A;  1N1A A;  2XP3 A;  2YBU A;  2XP9 A;  1NH6 A;  1YAT A;  3FAP A;  1EDQ A;  1LL7 A;  1F40 A;  1HJW A;  2ITK A;  2ZR6 A;  1EIB A;  3CHD A;  4J4O A;  5HWC A;  2WLY A;  4DIP A;  1YW5 A;  1W1P A;  4ODN A;  1SR0 A;  2KO7 A;  5DIT A;  5HW7 A;  1CTN A;  3OA5 A;  1KT1 A;  4DRN A;  1JVW A;  4IQC A;  4JYS A;  4Z2K A;  3WD0 A;  5DO2 A;  4W9Q A;  5I98 A;  2FAP A;  2DT1 A;  2ETN A;  2WK2 A;  4ODP A;  3NTP A;  2KFW A;  3CZ8 A;  1JND A;  4LAV A;  3KAG A;  1FKL A;  2RUC A;  4Z2I A;  2A3C A;  3EIP A;  1ZBV A;  2B5U B;  1FKR A;  2PPN A;  3VAW A;  2DSV A;  2WM0 A;  4KQZ A;  1J4H A;  1XRV A;  3PRD A;  1FFR A;  1W1V A;  3ARQ A;  3ARY A;  4WJX A;  2XPB A;  5HKG A;  4P8V A;  3O5E A;  1HJV A;  4S3J A;  1WAW A;  2PV2 A;  3WD3 A;  1QZ2 A;  1HKI A;  2LJ4 A;  3O5R A;  1GPF A;  3KAH A;  1ZB5 A;  3B9A A;  1ZCN A;  3ARU A;  2XP7 A;  1ITX A;  1L1P A;  3RM4 A;  3PRB A;  4S3K A;  4BF8 A; 
#chains in the Genus database with same CATH homology
 4MSP A;  3RM9 A;  4C02 B;  4Z2L A;  4HAR A;  3UI4 A;  1E15 A;  2RUQ A;  1W1Y A;  3O5Q A;  3ARS A;  4WKA A;  1Q6H A;  2YBT A;  4HBE A;  3FY1 A;  2XP6 A;  3ART A;  3UF8 A;  3JYJ A;  2F21 A;  3AS3 A;  4QT3 A;  2KI3 A;  4QZV B;  3O5G A;  3O5F A;  1FKG A;  2RQS A;  2PBC A;  3UQI A;  4DRP A;  4WIW A;  2PI6 A;  1QPF A;  2XP8 A;  2DG9 A;  4IT4 A;  1LQ0 A;  4N19 A;  1FKT A;  1OGG A;  4TW6 A;  5J6E A;  4P8U A;  3B7X A;  3KZ7 A;  3WIJ A;  3RGC A;  2MPH A;  1PIN A;  4QT2 A;  3UI6 A;  4NSB A;  2K8I A;  1OGB A;  5DF0 A;  4DH0 A;  3ARV A;  1ZBK A;  2DSU A;  3WD4 A;  4Z2H A;  2DSW A;  4U84 A;  5HW8 A;  4WK9 A;  5HW6 A;  4DRI A;  1XHG A;  5GPR A;  3G6M A;  4P8X A;  4W5U A;  3B8S A;  1JNE A;  4DWS B;  2IF4 A;  2QF8 A;  1LL6 A;  1E6Z A;  4LAW A;  1NMV A;  4ODK A;  1W26 A;  1FKF A;  4IT6 A;  1Q6U A;  3O5K A;  4Q22 A;  4ITZ A;  4Z2G A;  1GOI A;  2M08 A;  4J4N A;  1U79 A;  4TW7 A;  3CHC A;  1VF8 A;  4MAV A;  2DT3 A;  1OWQ A;  4QIB A;  2AOS A;  1FKD A;  3W4R A;  3JXV A;  3RM8 A;  3I6C A;  1C9H A;  3NI6 A;  4TNS A;  4DRO A;  2LKN A;  2PPO A;  3QOK A;  4XAK A;  4DT4 A;  3ARO A;  1LG2 A;  2XPA A;  2RUD A;  2DSZ A;  1SYT A;  1NWR A;  4G50 A;  4U86 A;  4ODM A;  5B8I C;  5DIU A;  1TCO C;  3UI5 A;  2AWG A;  1FD9 A;  1F8A B;  3CHF A;  1P5Q A;  3AS0 A;  3ARW A;  1W9U A;  2ZQU A;  2KE0 A;  4ODO A;  1BKF A;  3RFW A;  3WH0 A;  2G41 A;  2ESC A;  4DRH A;  2MLY A;  3ALF A;  1FKI A;  3WD1 A;  1O6I A;  2DT0 A;  3O5I A;  2F4E A;  4DRM A;  5HWB A;  4MNM A;  1E6R A;  3PRA A;  3IHZ A;  4O2T A;  4DRJ A;  4JFI A;  2LGO A;  4G2P A;  5DEZ A;  1M5Y A;  3ARP A;  4ZPT R;  1T11 A;  1W9V A;  4PTM A;  3JYM A;  3O5O A;  1NWU A;  4L3N A;  1E9L A;  1E6N A;  5HBF A;  3IKG A;  3RME A;  1J4R A;  2PV3 A;  4W9O A;  3WQW A;  1BL4 A;  3PR9 A;  4ODQ A;  4DWS C;  4WKH A;  1KT0 A;  2PV1 A;  4TX0 A;  1FKB A;  2WLZ A;  4U85 A;  3TDB A;  1Q6I A;  2FKE A;  1EHN A;  2DPE A;  1FJD A;  4DWS A;  3WKZ A;  1WB0 A;  1A7X A;  4KR0 B;  4ZS6 A;  3KAF A;  4MNL A;  1EQ3 A;  1D7I A;  1WNO A;  2MLZ A;  2O9O A;  2RSE A;  4LGX A;  2N87 A;  3AS1 A;  4P8W A;  1ZK6 A;  2UZ5 A;  2VN1 A;  1LL4 A;  2O92 A;  1D6O A;  1LG1 A;  4NZC A;  4IPX A;  1FKS A;  3O5L A;  1NWS A;  3PA7 A;  3ARR A;  1HXV A;  2ZQS A;  3B9D A;  1D7J A;  1IX5 A;  2MLX A;  1UR8 A;  3CGM A;  1PBK A;  4ML4 A;  1JNS A;  1J4I A;  3CH9 A;  1H0I A;  3IKD A;  2DT2 A;  4JFM A;  4DZ3 A;  1HKM A;  3KAC A;  2KR7 A;  4LAX A;  3O5M A;  4URI A;  1D2K A;  3AQU A;  3KAI A;  3O5D A;  3FXY A;  1FKJ A;  2OFN A;  4ZPV R;  2A3B A;  2A3E A;  2B31 A;  2FDM A;  3MDY B;  1NWT A;  4ODL A;  3NRK A;  1ROU A;  1HKJ A;  3WL1 A;  4IQ2 A;  2MNT A;  2G8Z A;  1B6C A;  4DZ2 A;  1ZU8 A;  2XP5 A;  1X6L A;  1W1T A;  2ZR4 A;  4LAY A;  5GQB A;  2JZV A;  3IK8 A;  4MNJ A;  4Q7N A;  4WKF A;  3WD2 A;  1J6Y A;  3BXW A;  2F2D A;  1D7H A;  1E6P A;  1RD6 A;  2LPV A;  4MPK A;  3WQV A;  2KGJ A;  1TFV A;  4FAP A;  4TW8 A;  1KFW A;  3ALG A;  3CHE A;  1H0G A;  1LJY A;  5HTG A;  4GGQ A;  5HUA A;  1FAP A;  1ZBC A;  4ZPW R;  3KAB A;  4DRK A;  4HBO A;  5HT1 A;  2PPP A;  2DG4 A;  3ARX A;  3GPK A;  1EYM A;  5DIV A;  4AY1 A;  4NNR A;  3H9R B;  3UQA A;  4JFJ A;  1NSG A;  1ROT A;  2M1I A;  3OOB A;  1ZBW A;  2OLH A;  3UQB A;  2Q5A A;  4MNK A;  3G6L A;  1GUV A;  3LUO A;  4W9P A;  3CGN A;  4FN2 A;  2VCD A;  2ZQV A;  3TCZ A;  3ARZ A;  1W9P A;  1FKK A;  1QPL A;  2MF9 A;  2ZR5 A;  1HJX A;  1Y0O A;  2DG3 A;  2IUZ A;  1R9H A;  5BXJ A;  4R5E A;  1FKH A;  3EY6 A;  3AS2 A;  5JH8 A;  2Y78 A;  3TC5 A;  2D9F A;  3B9E A;  4L72 B;  2A3A A;  3KAD A;  3O5J A;  1X6N A;  3ODK A;  4R0X A;  1FFQ A;  4GIV A;  4JFK A;  4Z2J A;  2L2S A;  1ZL1 A;  2M2A A;  1JNT A;  3O5P A;  5GPG A;  4TYO A;  4DRQ A;  1Q1C A;  2RUR A;  4JFL A;  2ZQT A;  4MGV A;  1K9T A;  1NMW A;  2XP4 A;  1HKK A;  5D75 A;  3WL0 A;  4DWS D;  4ODR A;  3KCE A;  4MTV A;  1UR9 A;  1N1A A;  2XP3 A;  2YBU A;  2XP9 A;  1NH6 A;  1YAT A;  3FAP A;  1EDQ A;  1LL7 A;  1F40 A;  1HJW A;  2ITK A;  2ZR6 A;  1EIB A;  3CHD A;  4J4O A;  5HWC A;  2WLY A;  4DIP A;  1YW5 A;  1W1P A;  4ODN A;  1SR0 A;  2KO7 A;  5DIT A;  5HW7 A;  1CTN A;  3OA5 A;  1KT1 A;  4DRN A;  1JVW A;  4IQC A;  4JYS A;  4Z2K A;  3WD0 A;  5DO2 A;  4W9Q A;  5I98 A;  2FAP A;  2DT1 A;  2WK2 A;  4ODP A;  3NTP A;  2KFW A;  3CZ8 A;  1JND A;  4LAV A;  3KAG A;  1FKL A;  2RUC A;  4Z2I A;  2A3C A;  1ZBV A;  1FKR A;  2PPN A;  3VAW A;  2DSV A;  2WM0 A;  4KQZ A;  1J4H A;  1XRV A;  3PRD A;  1FFR A;  1W1V A;  3ARQ A;  3ARY A;  4WJX A;  2XPB A;  5HKG A;  4P8V A;  3O5E A;  1HJV A;  4S3J A;  1WAW A;  2PV2 A;  3WD3 A;  1QZ2 A;  1HKI A;  2LJ4 A;  3O5R A;  1GPF A;  3KAH A;  1ZB5 A;  3B9A A;  1ZCN A;  3ARU A;  2XP7 A;  1ITX A;  1L1P A;  3RM4 A;  3PRB A;  4S3K A;  4BF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...