3LV5A

Crystal structure of the mutant i199e of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
218
structure length
218
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAEIVGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 82
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lv5A00
1JUEA 2FB2A 4PFMA 2W6RA 4ML9A 3C2RA 4AVFA 5I3IA 4POCA 5K4ZA 4NXSA 2V5LA 1KBIA 1VH7A 4PA8A 5F4WA 2VEKA 5K4XA 1OK6A 1I2RA 3HGRA 3HBLA 3T44A 4XZ9A 3UY8A 3W2KA 8TIMA 4BF9A 3C2EA 1W5PA 3VKJA 1NVMA 1GTHA 4IOTA 3O8AA 4M6PA 4A22A 3LHUA 5AHNA 4FB7A 3M5XA 4BK9A 2A6LA 1SZEA 1K3UA 2C13A 4EF9A 4IMFA 2EGZA 3S42A 2A21A 2E09A 4RK8A 4DXVA 2P1FA 1FWWA 3TSDA 2CZFA 4MJMA 3A24A 3VFLA 4HHPA 2XN1A 1ME7A 3IVSA 1W1ZA 3Q37A 3BLEA 2CZ5A 2NXHA 3L0NA 3M5YA 4CCCA 5HWNA 1WX0A 3KRZA 5LNUA 3QQ1A 3TX9A 3OVPA 3TIMA 2E5DA 4UMBA 3P82A 3P67A 4LVAA 3ELFA 4NNCA 1JULA 1XCFA 3KAOA 5G5IA 3M1ZA 3STCA 4PL2A 3EWYA 1FDZA 4S2BA 6TIMA 2E6DA 4QITA 1K7FA 1YDVA 1K02A 1GOXA 2G97A 1H63A 2A2IA 2V2DA 2X30A 2VFDA 4G1KA 1LP6A 1IGSA 3STGA 3OA3A 1WOAA 1YYAA 1SZNA 2V9DA 3QPYA 4JIPA 2CU0A 2GUUA 3TW7A 4JYDA 2EKCA 3BG9A 2E6AA 5LNSA 1LOLA 1KV8A 3W1TA 1FWRA 1S5WA 3AJXA 3M7WA 4IMEA 4Y9AA 5A8GA 1TPEA 3USBA 4YCOA 2C15A 2E1DA 1I2OA 3PUDA 4AF0A 1LCOA 4O8RA 3TROA 3MO7A 1X6UA 4DF2A 3FKKA 1GVRA 3LB0A 2Q8ZA 1VJIA 3KVJA 4E0CA 3DH7A 4O12A 1PL9A 2WOQA 2FPTA 3PAJA 1WA3A 2R14A 1YXCA 3JRKA 3W1LA 3W23A 4O53A 1KM6A 1EX5A 3DFSA 5HJLA 1A5CA 2YDAA 2V30A 1T96A 1EP1A 1RV8A 3QEZA 1FCVA 2CFFA 3QH2A 1LLZA 3THQA 3SZ8A 2YPIA 1HFBA 4N9CA 4O0KA 2Z0IA 2F7FA 3NM1A 3W87A 3P84A 3MP5A 3LM7A 1ZAJA 2C16A 5F2IA 3U8GA 1OVDA 3W7EA 2FDSA 1G7UA 3U6WA 4UTWA 1B3OA 2PE4A 2JKPA 3O63A 3P7YA 3W86A 3W2UA 4MVAA 3EX2A 1OFBA 1IF2A 4NZFA 3CQ0A 1H7NA 3C4UA 1KM2A 1K8YA 1TJRA 4AHQA 1L2UA 3PY2A 4B5NA 1G6CA 1QO2A 2WO5A 4FF7A 2DZSA 2QCLA 4OV9A 2FJKA 2LLEA 3GX9A 3THAA 4BWLA 2OT0A 4O15A 4UTTC 4LOCA 3EWWA 4PCFA 1V5XA 3TJLA 3W1QA 3MYOA 5G1TA 2H8XA 4UFMA 5G4EA 2D73A 1BKSA 2WJZA 4BI6A 2O7QA 5HUPA 4QNWA 3INPA 1F74A 4UFLA 3T55A 1OYCA 1T0OA 3NZRA 3KX6A 4K7YA 1CW2A 1SO4A 3FJLA 3NQEA 3U2OA 3IV3A 2C19A 3C0JA 4C1LA 3O07A 4GRSA 1VLIA 1KM0A 2VFEA 2WPBA 1W56A 4UFKA 5F1VA 1B4EA 3W7NA 2G5WA 5D33A 2FIQA 3CIWA 1ZY9A 3MMTA 4A2RA 3R89A 2OT1A 5AC6A 2ATMA 4RZ4A 4FHAA 4DPQA 2QCGA 3TSBA 4I7UA 1VYSX 1W54A 3CC1A 4O54A 1ME9A 1FQ0A 1ML1A 3HPXA 1VPXA 3G8EA 1SFJA 3C52A 1VZWA 3RLUA 3IRDA 3QYQA 4O1BA 4JR5A 3ZWSA 2Y63A 3PB0A 5C55A 3EX4A 1GVFA 4IQLA 3STFA 2H90A 2YZRA 2J88A 1UUMA 4HNNA 1IXPA 5FF0A 5F2MA 2CW6A 3NO5A 1ZAIA 4Z0SA 2PRLA 2TPSA 4DBDA 2QCDA 4ZL1A 4O50A 3HGOA 1RR2A 3G0SA 5SWUA 2QUUA 1DHPA 1SSGA 2JKAA 5AHIA 1TJPA 3QFEA 1LOSA 3IGXA 4P61A 5LNRA 1L9WA 3W83A 4OV4A 3E12A 5I3GA 5CPNA 1JCYA 1SQ7A 4CCEA 3O1NA 1U5JA 3GNDA 3LHWA 4Y90A 3W7KA 4BFAA 3QF0A 2FQIA 1QPQA 1LYXA 2GJNA 3IIOA 4Z1AA 1DJNA 1AL8A 3TC6A 1T8XA 4ONVA 4FIRA 1DL3A 1JVNA 4FNTA 1F5ZA 2NX3A 1GVQA 3NL2A 2BWGA 5EA9A 2UV8G 3LHTA 4JTEA 4ZQPA 3TAOA 1F73A 4GFSA 4JX6A 1I4NA 3F4WA 3S1XA 1TSIA 3TQVA 3TFCA 3CB8A 4GUIA 3W73A 2ZQ0A 3EWUA 4UTUA 3S5ZA 3KVMA 3DI0A 3L67A 4ICNA 5HWMA 3O6DA 1ZALA 5AYXA 2CLMA 3GXTA 4JX5A 5LNWA 1TTJA 4MY9A 2QCHA 3ABRA 3LTSA 5GVJA 2GQ9A 3G3DA 2RFGA 4A29A 1HUVA 1OX6A 1QPOA 2NXGA 4NUWA 1N55A 4IX0A 3W88A 2NZLA 1FBAA 4FEZA 4XWUA 3CM4A 5DCEA 4IGHA 4AMAA 1BEUA 3SJ3A 2JGYA 3A21A 1KM1A 1BWKA 5BW6A 3SIZA 4XKYA 1RPXA 3QM3A 2VOMA 3NA8A 5DBTA 2GVGA 3I7SA 3W7LA 3BARA 3N9RA 2V5BA 1VCFA 4YLWA 3B05A 3EKLA 3B06A 2VXNA 4FX7A 5F4XA 4HPXA 1DJQA 3UPBA 2V81A 1D3GA 3WFAA 1OX4B 1SZGA 3W72A 2ZZ7A 2QCNA 4MFEA 1F6KA 1FWSA 2QCDB 3NM3A 5LZLA 3N3MA 1SW0A 4OU1A 4RXFA 4Y6GA 1AW2A 1QNVA 2Y6ZA 4N9BA 3DKJA 3NGJA 4GNJA 3DZ1A 3GLCA 2RDTA 2CLHA 3CU2A 5MHBA 2I1OA 5G2WA 1Z42A 1CI1A 3PSVA 3QC3A 3HPSA 5AHLA 4UMCA 3UNDA 1YXYA 3NQMA 1L6WA 2DP3A 5KTLA 4JNMA 2V2HA 2WV8A 2W0UA 2DJLA 3TDFA 1TPB1 3A9IA 5D05A 5LKYA 1IXNA 2VELA 1LM1A 4HNUA 2PC4A 1QWGA 4LUIA 1VCGA 4Q33A 3IEBA 1XUZA 2OJPA 1OG0A 4O17A 2DU2A 3DI1A 1XXXA 3E9AA 4RKAA 1W3TA 4UTMA 3LX9A 1MSSA 3L5AA 1R30A 3SGUA 4JX4A 2ZFAA 5AC8A 4AHPA 3HG3A 3W7RA 2BXVA 5AYZA 1H1YA 2QAPA 5J5DA 1TPVA 3G1SA 4PEKA 3GDTA 1A5SA 2TYSA 4WOQA 5K7JA 4UC5A 3W3OA 3W7HA 4N4QA 4PH6A 2BLEA 3NNTA 4I7VA 2J6XA 4O10A 1NAL1 4UFJA 4DELA 1G69A 4O13A 1XDMA 1N7KA 1W8SA 3DFQA 2WQPA 2ZA1A 2WSYA 1L6SA 3OVRA 3CEPA 4IMDA 1LOQA 1SSDA 1Q3NA 5EBUA 4J9JA 3BV4A 3WK2A 1Q6OA 3PC0A 1DQXA 4QIUA 2H8ZA 2JGQA 2Z1BA 2ZRYA 1F2JA 3KOFA 3UWZA 3W7DA 5E1QA 3W74A 4MOZA 3A5VA 1XI3A 3LRMA 2B7OA 1WBHA 4XKYB 1OFDA 3WK0A 5CSSA 4WOZA 1Z41A 4K6AA 3PM6A 1W5NA 2RH9A 3GZ3A 3P8JA 1N8FA 3FFSA 3UYCA 4NT0A 2X1SA 3NQCA 5HINA 1YADA 1UCWA 5FF7A 4N6EA 5I3HA 3LHVA 1Q6RA 1KFJA 1R2TA 3CPRA 2FTPA 3LLFA 1XBVA 3G1VA 4IUOA 2X1UA 3UPWA 4N9EA 1LTDA 2HMCA 1GWJA 1M7OA 2Y70A 1YPFA 3G22A 3BVJA 3W7QA 1KW1A 4FX6M 3W1PA 1AK5A 4NZJA 3MI2A 5F2LA 1NF7A 2TSYA 5IM51 4UUIA 3KHJA 4AH7A 1ZJIA 1MZHA 2GPTA 3PUOA 5T26A 2I14A 3TCEA 5G2IA 2FLIA 5FEZA 4O16A 1G4EA 2P0OA 5ABTA 3B04A 4LC6A 2A0NA 4JTTA 1TV8A 4GJ1A 4KFOA 4LT9A 2Y7GA 2VKZG 3HG5A 3SR7A 5KZEA 2YCEA 1K8XA 1EP3A 1OJXA 1HTIA 3EX3A 4CQAA 2NWSA 4KWWA 2QF7A 4WQ6A 1FY6A 2Y61A 3UQNA 4NU7A 4GUJA 1TTIA 4WJEA 1OFQA 1W3IA 1W5OA 2E5BA 2AGKA 2ISSA 1JCXA 2G95A 1A53A 4N2YA 3QJAA 5EYWA 1CX9A 3W75A 4IMGA 2YFOA 3BPWA 3SGZA 3T40A 3FYPA 3PUEA 1FXQA 3NQFA 3GB6A 2GOUA 4LS0A 3C56A 3H53A 3DFTA 3GDRA 4H3DA 3VNDA 1WAUA 3W07A 1QFEA 2B0MA 1EIXA 3R12A 3GNNA 4HSNA 5KINA 5G2HA 1VS1A 4Y96A 3NR0A 3FEMA 3GAKA 1C9DA 4QQ3A 1PCWA 1TMHA 5AC7A 2Y7EA 2C18A 1Q6QA 2E6FA 4MLJA 4UR7A 3VE7A 3CIXA 2WSRA 1GZGA 3G3MA 1H61A 1XUUA 3HPZA 4IXXA 4R33A 3LHZA 3P74A 5I3FA 4ADUA 3DHFA 4UTJA 4UTHA 1RD5A 3NPVA 1TREA 4OGZA 3MI3A 1J4EA 2ZRVA 4OT7A 1X7FA 1TV7A 3EKZA 3LV5A 1FDYA 1YTEA 4XBKA 4P2VA 4ORIA 3NQVA 4MYAA 3QRHA 6ALDA 1PHQA 1KTBA 3O6YX 3NPXA 3QSRA 1LDCA 1F7BA 3QPZA 1RQEA 4DPPA 1BTMA 3NPWA 4O1CA 3KVLA 3TQ0A 2A4AA 4IMCA 3W1RA 3DBPA 2B7QA 5HMSA 2PRHA 3SI9A 2ZZ2A 5DELA 4DBEA 5AFDA 3GR8A 5F4SA 4M6VA 2R8WA 2A5HA 1UB3A 3FIGA 3GDKA 2Y62A 2ZCGA 2VFHA 4K8HA 3NEVA 1TTQA 4UTLA 1O95A 1W0MA 1OYBA 1TV5A 4XBSA 2CWNA 5CZTA 2CLLA 1W5QA 1ADOA 3RMJA 3DAQA 5FF3A 4BI5A 3L9CA 5AYYA 4RX0A 4JYEA 1Z44A 1V7YA 4XQ6A 2QJIA 4JYFA 4JTKA 3F1QA 3G1HA 3M43A 3FOKA 4JTLA 3UWUA 5D03A 3QMTA 3FA5A 2NUYA 1SO5A 1W3NA 3ZFHA 4UTIA 3M9YA 3R5EA 2EAWA 1TPUA 3NQAA 1GQNA 3S1UA 1RZMA 4ZZ9A 1AMKA 2IQTA 2A1YA 3NQDA 4MJZA 1FUYA 4LVFA 1XKYA 2A7PA 3UWWA 3GDMA 5K9XA 3DKLA 1G4TA 1VYRA 2CLEA 3PG8A 1GYLA 1XFBA 2C14A 2VFIA 5HR7A 4LU0A 4O11A 1QPRA 2V82A 1O5XA 3M44A 4RLIA 3SFKA 3ZS4A 2G96A 3GKFA 4OWGA 1BWLA 1H51A 1TQXA 3CTLA 4LC8A 5D04C 1P5BA 2RDWA 2H3BA 2ZTJA 4I9AA 4AHOA 1WQ5A 2Y7FA 1VGAA 2ZRXA 2HSAA 4UTWC 1TRDA 3LCHA 4JDBA 5D09A 3T78A 3L0GA 1YLVA 4DF1A 1SW7A 3NXFA 2W79A 2EHHA 4LY8A 1HO4A 1ZENA 1KM5A 3GXPA 3LI1A 1MXSA 2A7RA 3LXCA 3VE9A 2PURA 2TMDA 4K8EA 4DO4A 4MY8A 1AL7A 4RCXA 2VFFA 1DVJA 3O6CA 2DORA 4RZ5A 4IX2A 1OF8A 4AWUA 3M41A 4BWLC 1I2QA 3TV8A 2ZBTA 2ALDA 3TNOA 1UUOA 5CZ0A 5CPLA 1TPDA 5LSMA 1FX6A 1OX4A 3ANYA 4ZQOA 3I65A 3TFXA 4A3UA 5F2GA 1IIHA 1EB3A 5E93A 3KRUA 4FNQA 4Y8FA 2X16A 2JKEA 1SO6A 3HMJG 5CSRA 3BK0A 2E68A 3GXNA 3NDOA 4LVDA 4N9DA 3M16A 5D30A 2ZZ3A 4DO5A 1FWNA 4A2SA 5C2XA 1DORA 3W2MA 3BO9A 3M6YA 5H91A 3C61A 1EUNA 1JRCA 4MPQA 2Z2UA 1OABA 4L4LA 3S5NA 5D2TA 2QR6A 2ZRZA 3SW6A 2WSQA 4NVTA 3LCLA 1KTCA 4H4IA 4WX2A 3IVTA 2OCZA 3IIZA 1I2NA 5EKYA 4JTUA 4K39A 2E77A 1JCJA 3MW7A 3WJYA 3W2LA 5C54A 5FF4A 1R47A 3NL6A 1ALDA 2QEZA 4Z1CA 3TXZA 1UBSA 3W7MA 4MYXA 3L5MA 1H7PA 4CLMA 4BR1A 3W7PA 3DENA 4HKPA 3EX1A 4Z1DA 2CLIA 1K03A 4MLRA 3MYPA 2YFNA 4O4VA 3P62A 2FPVA 3FKRA 3ZR4A 2YGYA 2QKFA 1TPC1 2ZDRA 3WJZA 5D2VA 3MBFA 2FB3A 3RK8A 4NXKA 3LTPA 1B57A 2QCCA 3W6YA 2YYTA 1G67A 5C5YA 3PG9A 3TW6A 1A50A 3E96A 1GG0A 3HQ1A 2RHGA 4KFPA 3MWAA 4QAIA 1FCQA 4FO4A 2ZZ6A 5BNKA 3W7JA 4EIVA 2AQWA 2CZEA 2DJXA 3QW4B 3TQKA 5C6MA 1WDWA 5LGZA 3LCGA 5HWJA 1DBTA 4JY9A 3S1WA 1QOQA 4NQ1A 2A85A 1OX5A 3UY7A 3H55A 4LV9A 3QZEA 3A5FA 4EF8A 4JY8A 1EPXA 5L6UA 5KZMA 2WNNA 2BX7A 3S0CA 1F76A 3STEA 3RF9A 4IPIA 3MP3A 1A5BA 2OMAA 2ZZ4A 3PS7A 4JS3A 1VRDA 1OFPA 2A7NA 1VHCA 3DFPA 3NZ1A 3OIXA 3K30A 3S8HA 1SFLA 3N73A 1ZHAA 3HJZA 3W1XA 2I9EA 4M6QA 3N34A 4GUFA 2P10A 1HG3A 3G18A 3G0UA 5E0KA 5LGXA 3G1FA 1JR1A 1H7XA 1O60A 4NJIA 4MUZA 1Z48A 5I3KA 4CQ9A 5AHEA 1I8JA 2XFWA 5FI8A 1ZNNA 4HIBA 2J27A 3EXRA 3QSTA 1SO3A 5D2XA 5CGQA 4TX9A 5L9FA 1OYAA 3NQ8A 4OE7A 1O4UA 2Y7DA 3C2OA 2QUVA 1LLWA 2Y89A 4LS2A 5G1YA 2ZZ5A 1OFEA 2VEIA 3HGJA 1Q45A 4R7JA 2BTMA 4WD0A 5IBXA 3W1AA 1LORA 4MKNA 3EWZA 2J24A 3TSMA 5FF2A 2NUWA 5CZJA 3HG2A 4DO6A 3R2GA 3L21A 3LOTA 1LBMA 1XDLA 3EWXA 3NQ6A 3OBKA 1VC4A 2CLKA 4N4PA 3F03K 3OVQA 3E0IA 3NQ2A 2QCEA 1UASA 4JGDA 1FCBA 3L66A 2DZPA 4FNSA 3G1XA 4BI7A 2ZRUA 3H54A 5DXXA 1AW5A 2YX0A 5AB3A 1VHNA 3ABOA 5U7SA 4DF0A 1A5AA 2QDHA 4UFIA 1H62A 3CWNA 1H7OA 3CEUA 3IVUA 2E5CA 3FJ6A 2QCFA 2OZ0A 3UD6A 2Y85A 3DFNA 2B7PA 3LLDA 1GJPA 2GVJA 2DZVA 4X3ZA 1H5YA 4I7WA 2FFCA 1OK4A 3KRSA 1ICQA 1RVGA 3LCIA 4TO8A 1Y0EA 1ZCOA 3MP4A 1OF6A 3AO0A 1TPFA 3PVFA 1PCKA 4EWND 2H6RA 1G4PA 1F05A 1XBXA 1TQJA 2VENA 4JTIA 4UR8A 1IIGA 1M6JA 1TYGA 3ATZA 5BOOA 4HSOA 5G4WA 3V75A 2DZXA 1OHLA 3R8RA 3EB2A 2WNZA 1DOSA 3UZ5A 2FPYA 2QJGA 4TR9A 1LZOA 3UXDA 1QAPA 3ZWTA 3BW3A 5KZDA 3GYEA 4LWWA 4JICA 1SR9A 1ME8A 3NPUA 1PS9A 3IGUA 3P5ZA 4FNPA 4UFHA 3EEGA 2ABAA 4GE8A 7TIMA 5DN1A 2J9YA 3PR2A 2R91A 2NXIA 4WXZA 5BMXA 4WZHA 3N2MA 4ADSA 2E6YA 1PVNA 3Q2DA 1TB3A 4W9TA 4XUGA 1EWDA 4ZMGA 3M0ZA 4N6FA 5CPOA 4NJKA 3HOJA 4ZQRA 4NNAA 3P8IA 4M5PA 4XTDA 5CG7A 3VI2A 3O15A 5K3VA 4QM1A 4ZQNA 3L0KA 4TU1A 3B4UA 3P60A 2QJHA 4O14A 4MFDA 4H6KA 3O06A 1YDOA 2H3DA 5K9DA 3NG3A 5BRBA 1O94A 4MIMA 4HPJA 3L68A 4O1AA 4LVGA 2BSLA 1AW1A 3UXAA 3SY5A 1OFOA 4HN4A 2OX1A 1FCUA 3GIYA 5A5WA 2CLFA 1SUXA 3PSWA 1O5KA 4LRSA 4OHQA 2NUXA 4JTGA 1OFAA 1KLZA 3T7VA 4EVZA 3QMRA 2ZZ1A 3B0VC 4KFNA 3TA6A 4CQ8A 4PC8A 1PHWA 1Q6LA 1ZFJA 4JIQA 5BMWA 4AEOA 3PWAA 3OHIA 5AHMA 3A23A 3A22A 4FXRA 2Q8LA 5DXYA 1EWEA 3NOEA 1WV2A 1GVSA 1WOBA 1FXPA 1SU5A 1XC4A 5TQLA 2GQAA 4OQVA 3W76A 5FEXA 3ABQA 2YXGA 1MEHA 4JXCA 3HO8A 1SW3A 4O19A 3NL5A 2ISVA 3BLFA 4UTKA 4JTHA 1MO0A 1VYPX 1KFEA 1W31A 3IIVA 1GTEA 2O7SA 1HO1A 4R34A 2DZUA 1TPWA 5DY2A 4ALDA 5DY3A 1TTPA 1KFKA 3KVKA 4LUJA 3IGSA 1FDJA 3TMQA 1YDNA 4NJGA 1K7XA 2GVLA 4Z08A 4JTJA 4QNEA 3C6CA 1W37A 1MEIA 1PV8A 3W7IA 2NX9A 1KM3A 5K2ZA 3B0UX 5EL1A 3S1VA 4UTTA 5LHEA 3E02A 3L65A 2QDGA 2J9XA 3MHFA 1H7WA 3WK1A 1XL9A 3V1PA 1TRIA 1GYNA 1XM3A 2XN2A 4QSHA 1P0KA 1SZFA 1X8FA 3LCFA 3W1NA 3W71A 3CWOX 3FYOA 3BG3A 3P5YA 1D9EA 4M19A 3RU6A 1QOPA 3LV6A 1NEYA 4Q32A 2VEPA 3S6DA 4FNRA 2ISWA 3UWYA 3P61A 3LTYA 3EXSA 1LRTA 1TCDA 2NLIA 4MY1A 3KXQA 4CNPA 3W1MA 4Z1BA 3LCXA 1M5WA 5K9CA 4AB4A 3BW4A 3B8DA 3DU0A 4ZVJA 3BGGA 1LBLA 2VC6A 3ATYA 3PBVA 3LERA 3I7RA 3W7CA 1DV7A 4LVBA 4IPJA 4UMAA 4YMZA 1X1OA 1PE1A 4M7SA 1G4SA 3TAKA 5I3JA 1EEPA 2NV1A 3Q94A 3M5ZA 1KLYA 3TUUA 1G7VA 1H1ZA 5AHFA 2J9ZA 3BLIA 3LRKA 2X2GA 3DHDA 5HUOA 2GJLA 3DFOA 1KV5A 3N14A 2Q3RA 1QDSA 3GR7A 1JQVA 5D32A 4ORMA 3M47A 4ZQMA 2R94A 3TMLA 4E2BA 4X9SA 2V0TA 3IIPA 1QCWA 3HB9A 3PBYA 4FNUA 1LBFA 4O0ZA 1L6YA 5FESA 3G24A 3TR2A 4IWWA 3S5OA 1NSJA 2VFGA 1U83A 1RQBA 2B4GA 5EY5A 1YTKA 4QISA 4CNNA 1XBYA 2ZRWA 3YPIA 2WNQA 2ZA2A 5TIMA 5FEPA 5CKSA 4A21A 2QUTA 5HQEA 4RJEA 2Y88A 1QR7A 2CLOA 3PF3A 3LHYA 2C6QA 5KMYA 2CZDA 1UJPA 4YCPA 2Z6JA 1C8VA 3JS3A 3JR2A 4AF0B 4LW7A 3C2FA 3LDVA 4CNOA 2Z6IA 4KKXA 1M7PA 3HGSA 1PIIA 3TU9A 3MI6A 1ICPA 4MZYA 4E38A 1QO5A 2QCMA 3N2XA 1VLWA 2EPHA 4JD4A 3MBDA 3QMSA 4S2CA 4JDYA 3I7QA 1YXDA 1VCVA 1GT8A 1KFLA 1TO3A 1FWTA 2F84A 4LNYA 3WJWA 4MZ8A 1F6PA 3LBCA 4ZQCA 3TE9A 3BW2A 2PRMA 4IXHA 2YYUA 3OEXA 3B03A 1SPQA 2JK2A 4RV8A 1E51A 1JCMP 3WJXA 3HF3A 4TMBA 2X1RA 4HNTA 3UWQA 4NJJA 1C29A 3S9YA 3EWBX 3PBWA 4WY0A 4MZ1A 4YWIA 3NL3A 1TIMA 4EOUA 2YR1A 4O1DA 2HTMA 3D0CA 3G1DA 3LXAA 3GVGA 4GXMA 4AXKA 1QMLA 2DZWA 1S3HA 4O57A 3LRLA 3BG5A 4GUHA 4R53A 1P1XA 1YTDA 1KM4A 3MUXA 3WK3A 1J2WA 3SECA 5DLCA 1GPWA 1GVOA 1ZAHA 3VCRA 3LCWA 2GQ8A 3M5VA 4PTNA 3W84A 2AAMA 4O28A 1KTNA 4UNLA 3HG4A 5D38A 4Q4KA 3HIJA 3O05A 3UZJA 3Q58A 3MJYA 4DQWA 1QPNA 2NV2A 1KFCA 3P81A 4AWTA 4IJBA 4TMCA 1JQXA 1HL2A 3S5YA 4LS1A 2BZNA 3L5LA 1IXQA 1NFBA 3NQ7A 3IIXA 3N9SA 4JN6A 3CT7A 3GAYA 2YW4A 4NNBA 3MHUA 1B4KA 3W2JA 1EUAA 1EA0A 4LV4A 1JCLA 3RFAA 3PB2A 4O52A 2VEMA 4GUGA 2ZA3A 3QQ0A 5DCBA 4ADTA 1GG1A 4QJ1A 5U4NA 3W7GA 3OG3A 1R2SA 1J5TA 1NF0A 4HT3A 4NX5A 3NVTA 3ABSA 4FXSA 5LHFA 4AAJA 1D3HA 3LI0A 3PBUA 5AOUA 4UXDA 2A6NA 2V2CA 3NQGA 1LRQA 1JRBA 4YL2A 2RKXA 1P0NA 4PL1A 5CZSA 3W2NA 1OFRA 5DBUA 1KA9F 3SSJA 4K36A 3CHVA 3N19B 4FX8A 1R46A 4CCDA 3G1AA 4GWEA 2ZTKA 4UNKA 3LGEA 5H2ZA 3QW3A 1WYIA 4NJHA 1AG1O 3EXTA 4KWVA 4K38A 1H60A 3R13A 2NX1A 4WXYA 3W70A 4JTFA 1YPIA 1VQTA 5CPMA 3I68A 1JUBA 2YW3A 4O18A 1LRNA 2ABBA 5D02A 4S1FA 3GK0A 5HNRA 3DXIA 1R2RA 4WY0B 3LBMA 2HS8A 4LRTA 1XBZA 4N02A 5D2WA 4GBUA 1T99A 1WBJA 4D2JA 4M7TA 3DGRA 1MEWA 3GDLA 5KITA 2ZYFA 5J5RA 4UIOA 3G0XA 5TBOA 4X22A 3TKFA 1TPH1 1EP2A 3T4CA 3W9ZA 5EMUA 3WJSA 1KFBA 2C3ZA 5D37A 4HNVA 2X1TA 1IXOA 5D2YA 1I2PA 3FS2A 4WY0F 2XN0A 2EF9A 4PODA 2B7NA 1W5MA 4L4MA 4XTIA 3TXVA 3F4NA 4FIQA 2C0AA 4JEQA 4K37A 4NX0A 4RZ6A 4X2RA 3TJXA 2PCQA 4RR4A 3TH6A 4C1KA 4K7VA 3LXBA 1S5VA 5F1UA 4DEFA 1JCNA 2QAFA 1K7EA 2V8ZA 3CLMA 3RLVA 2TRSA 1B9BA 2DZTA 5IBXC 4LTSA 3G1YA 1DQWA 2JBMA 2Q3OA 3NAVA 3C2VA 1X1ZA 1S5TA 3I6RA 4E2DA 3W1UA 3G8RA 1P4CA 4OBTA 3W85A 3P80A 3W22A 4TIMA 5LNVA 3GKAA 3KFTA 1H50A 2YSWA 4U4MA 1LROA 1H7RA 3PULA 5AN7A 3B0PA 1JJKA 1ONRA 3W7OA 2C1HA 3E49A 5KSWA 3RNDA 2RDUA 3FLUA 4UCGA 1ICSA 2KZHA 2NWRA 2WKJA 4WUIA 3L2IA 3C3NA 5HR6A 4YXGA 3TC7A 4AWSA 1DKWA 5EPDA 3C8FA 4Z0JA 1VR6A 3EX6A 1JUKA 3BGJA 5FEWA 1K8ZA 2ATSA 1I45A 3O16A 4U28A 2HS6A 1GEQA 4JTSA 5DCDA 5HULA 3TK7A 3UWVA 4RXGA 1THFD 1WXJA 3NYZA 1KBJA 1RQHA 3MHGA 4O4WA 4GC4A
chains in the Genus database with same CATH superfamily
6REQB 3WFZA 3OB8A 1JUEA 3BMWA 3V35A 5HNTA 1MVYA 3W27A 4AVFA 1X39A 2R24A 5K4ZA 1CLVA 4S3AA 1KBIA 3HQPA 1VH7A 4PA8A 1SJAA 3UCCA 3W38A 4V27A 3F4VA 3W2KA 8TIMA 1YPXA 4BF9A 1GKPA 1W5PA 1R86A 4HVXA 1PWMA 2PGWA 3IJ8A 2PDFA 4KBXA 3M5XA 2C71A 1GQKA 1MFUA 2VJXA 1RY8A 1VPYA 3G2GA 1GHRA 4EF9A 4RK8A 3A4WA 2P1FA 3M4HA 4MJMA 3VFLA 1O12A 4C90A 2CZ5A 2NXHA 1UMLA 4CCCA 1P6BA 2P8CA 3QQ1A 3TIMA 4AWEA 4UMBA 4R5EA 3LQGA 1TX0A 4XZWA 3CL7A 1JULA 4PTDA 3EPOA 1PTAA 2QVHA 1LL7A 3H4WA 4AYSA 2J8FA 3WQEA 4IF2A 1TR9A 2E6DA 4QITA 1DTNA 1YDVA 1GOXA 1QOXA 2A2IA 4OZOA 2X30A 2VFDA 3MO4A 4G1KA 3SO7A 3STGA 3OA3A 1I60A 3TJ4A 4QP0A 3VKCA 3A47A 1G94A 2GUUA 4L1XA 4B5XA 3RXZA 4LYQA 4UWMA 1E70M 3TTEA 2EKCA 2JEQA 5FSEC 2E6AA 5LNSA 1T7LA 3GXDA 3WEMA 5FJIA 3VGHA 2E1DA 4TX8A 4PB3A 2GK1B 1LCOA 3DHUA 1JZ3A 3LB0A 2QMKA 3PAJA 2R14A 3JRKA 3W1LA 3VNKA 3UP8A 3EMZA 3FSUA 1T96A 4HA1A 2CHOA 3QEZA 4PMZA 3E0VA 3QH2A 3THQA 3SZ8A 1PTDA 4ZE5A 1NWTA 3MP5A 3LM7A 3W29A 4O0QA 1GJWA 1B3OA 4RE4A 3WQFA 4D8LA 2JKPA 3O63A 1IZJA 4QLJA 1QRQA 4NILA 1SR0A 1S2TA 3C86A 5FACA 3EPNA 4B3ZA 4F4RA 3OGRA 4AZ5A 5A8PA 3KS5A 2IXUA 2ZX8A 4JN7A 4RPPA 3THAA 3IUIA 3THUA 4LOCA 3TJLA 3AYTA 3ITVA 5A6MA 5G4EA 4B3LA 2XJ7A 4H6QA 4Q8QA 4BI6A 2O7QA 4QNWA 2J75A 1F74A 3KX6A 3NURA 4K7YA 1W1VA 3QY6A 1CW2A 1HQTA 3NQEA 4UTFA 2YZ5A 4NZ1A 3VDGA 3VIFA 3C0JA 1HT6A 4GYPC 3GW0A 4PULA 1W56A 4UFKA 3C2YA 3BGAA 4GGHA 1TWSA 2VI0A 3LG3A 3AXKA 1D8CA 3TTSA 4A2RA 4IIHA 4I5UA 3C8NA 5AC6A 2ATMA 4RZ4A 3PFMA 2QCGA 3LD5A 1UP3A 1X97A 5EMMA 2IMRA 3GFZA 1MW2A 1SYTA 3BLDA 3WYZA 4GFIA 1HKJA 3RLUA 2Z1WA 3QYQA 4O1BA 5BXPA 2HNHA 3PB0A 3PZMA 4CN6A 1GVFA 2AQOA 2QZRA 2YZRA 3WDJA 1UUMA 5FF0A 4JKMA 3N6HA 4XIAA 1O5QA 1ZAIA 4P8WA 2PRLA 2VVSA 2TPSA 4ZL1A 3OA5A 3N6JA 2QUUA 4AZGA 3CS2A 2XYLA 2DQWA 3IGXA 7REQB 5LNRA 4NYYA 3D5HA 1X38A 4DX3A 1TJ2A 2MANA 3UBPC 1NP2A 3EGJA 2FQIA 1WNOA 4BEQA 2ACRA 1QPQA 2YCIX 1Z8AA 3IIOA 4Z1AA 1DJNA 1AL8A 2VGBA 1RBAA 3PPHA 4FNTA 2BWGA 1LJYA 5CLWA 5JH2A 4ZQPA 3TAOA 4QDPA 3S1XA 1TSIA 4QSFA 3GRIA 2ZQ0A 3TONA 4ZB5A 1MXDA 3S5ZA 4LEQA 2XVNA 4HN8A 4HOXA 4H04A 2CBUA 3VOGA 3DYMA 5KZ6A 1PXGA 4MY9A 3MMUA 1EJUC 5E0FA 2RFGA 1QNOA 1ELSA 4A29A 1HUVA 1R9XA 5HNNA 4XSLA 1V03A 3NUKA 1TA3B 3VAVA 3CM4A 5IOBA 1O6IA 2VNCA 8RUCA 2QYGA 4FMVA 1UWTA 4HA0A 3SJ3A 1AD1A 1HIZA 5BW6A 3K2GA 3N1AA 3ZVHA 2ZX7A 2W27A 1Y65A 2AGTA 5EMKA 4JTCA 4IGNA 1XRVA 2E28A 4US5D 1H3GA 2XSBA 4GJIA 5TNVA 3VOHA 4J3UA 3UPBA 1D3GA 3CWHA 4GI8A 2VGGA 3WLSA 1UKSA 1S5MA 1QNVA 4AIBA 1LG1A 4WLCA 3AISA 1XG3A 2RDTA 1WDRA 4ASTA 3UVAA 2ZVIA 1CI1A 2VEGA 4A35A 4EXQA 3QC3A 3I3BA 5AHLA 4BQ5A 3UNDA 1XH1A 1L8NA 2V2HA 1M01A 1Q66A 3TDFA 3A9IA 1IXNA 4C6FA 2PC4A 1VCGA 3IEBA 5FCZA 1EXBA 2QT3A 4MWAC 4HBKA 1RY0A 1CGYA 1XXXA 4RKAA 3KDOA 3S1GA 3L5AA 1JNDA 3SGUA 3A4AA 4DY1A 2X0SA 4B5SA 4BQ2A 5AYZA 1H1YA 4E4PA 4R3UA 2WLYA 5CCZA 4RNHA 2OX4A 3AS0A 2DEPA 4PH6A 2BLEA 2BY1A 1CXLA 3AMDA 1TG7A 4QGCA 1G69A 2ZXDA 1XDMA 2OKTA 2ZA1A 1V3LA 1ZZMA 1SGJA 2DT3A 3HURA 3CEPA 1SSDA 4ENLA 1UD5A 1A5OC 3GVWA 3KBVA 4J9JA 3GTNA 1GKRA 2OEJA 1QNQA 2Z1BA 3W7DA 1X98A 3VGEA 2NQHA 4UQCA 5I5RA 3N15A 1XI3A 3C0QA 1OWQA 2BB0A 1CGXA 4WOZA 4HZ7A 1W5NA 3P8JA 3ZVHB 4NT0A 5C2CA 5HINA 1UCWA 3IACA 4Z42C 4WR3A 1LUCA 4EKJA 5I06A 5DMYA 2OEMA 3G1VA 4IUOA 2X1UA 4HB7A 4N9EA 1UZ1A 4MSSA 3WO8A 2HMCA 1GWJA 2IPGA 3TN4A 4AU0A 3WDQA 3G22A 3W7QA 1KW1A 4YPJA 1S2AA 3MI2A 4NZJA 1NF7A 4AH7A 2GGIA 3TCEA 3W82A 3EOOA 3IS4A 5A6LA 3R8HA 3MC5A 4HCLA 4O16A 5ABTA 1J6OA 2A0NA 4JTTA 1TV8A 4J27A 3SBFA 4IG2A 3EWDA 3SR7A 4GMEA 1K8XA 3BAJA 1H0GA 1EBHA 4WQ6A 1KQYA 1E9ZB 5A8OA 3UQNA 4X0NA 5M2FX 4NU7A 4LYPA 1OFQA 3B8IA 2E5BA 1W5OA 5CXPA 2YOCA 3DHPA 1WKEA 3LK6A 4N2YA 4IMGA 3VUPA 2YFOA 4S3GA 3L7RA 1VBGA 3GXMA 3OLDA 3T0AA 1K77A 5TD4A 1IHIA 3IJIA 3PUEA 1FXQA 4DZIA 5H6HA 3NQFA 4KIRA 2O9TA 3H53A 3CUGA 4C6PA 3DFTA 3GDRA 2R1PA 1WAUA 4LBUA 3S6TA 4PCNA 3GNNA 5KINA 4Y96A 2NT0A 1PCWA 4V2XA 1IZCA 3GU9A 2ANUA 2Y7EA 3S3GA 2C18A 1Q6QA 4P5UA 2VRJA 4JL1A 3IANA 3I4EA 5B80A 3S4TA 3HPZA 1M03A 4ATWA 1SFSA 4ZB2A 3CPGA 3P74A 4OGZA 3CZJA 2ZRVA 1JAKA 1X7FA 2WHLA 2QNEA 1IT0A 4IJRA 3EDFA 5LIWX 4Y9PA 1AQHA 4M3PA 4GYFA 4WDWA 6ALDA 1Q5MA 3HZ3A 1V6WA 4A3QA 4AD5A 1QHOA 3P6LA 3IJ6A 1F7BA 4IM4A 4Y8EA 4KEUA 3EMCA 1ZBCA 3EDEA 4GA8A 1ZU8A 3FDKA 5I23A 3W1RA 1E43A 4S38A 2PRHA 5HATA 4WKFA 3WLKX 1EHAA 5F4SA 4M6VA 3CMGA 3T4WA 3FDGA 3FIGA 4C6BA 2ZCGA 4K8HA 4QG6A 5C9RA 1TTQA 3ALFA 2AMXA 2IXVA 2W61A 1Q8JA 3GHRA 3VKBA 1R7OA 1RBOB 4XBSA 2CWNA 2Z26A 5CZTA 3NYDA 1WZAA 2CLLA 1W5QA 1ADOA 2WVTA 4HD5A 3L9CA 1Y5WA 1C8QA 2DSZA 4GJJA 4PMRA 3VGGA 3TYAA 4DWSC 4XBJA 5ABEA 3FOKA 1HVQA 4AIEA 3QV7A 3QMTA 3TR9A 2ALRA 3FA5A 3GIQA 2NUYA 1J0JA 3M9YA 3R5EA 2EAWA 3NQAA 4L4PA 5HA7A 3D3FA 2OR2A 3GS6A 1EJXC 4ZZ9A 3PFRA 4W5UA 2IQTA 4IHCA 2A1YA 1NWSA 3AIBA 5BU9A 5K9XA 3NO1A 3UVIA 1VYRA 4LBRA 2CLEA 3R7MA 3PG8A 1KBLA 1GYLA 4JPGA 4O11A 1MMFA 2G37A 4GY1A 2W5FA 4OWGA 1POJA 3CTLA 4AD1A 2H3BA 4I9AA 1WQ5A 1W9DM 1VGAA 1TRDA 3TYZA 2O92A 1BVZA 2YCLB 3L0GA 4ATDA 4DF1A 3NXFA 3CAQA 4LY8A 3R0KA 3VMOA 2PDBA 2OPJA 1TE6A 1KM5A 4WGXA 3WF4A 1MXSA 3LXCA 4LF1A 2XSXA 2TMDA 4K8EA 4DBWA 4MY8A 4IQJA 4RZ5A 4AWUA 3M41A 4K2SA 3TV8A 2ZBTA 3TNOA 1UUOA 2PD9A 1NJJA 1TPDA 3BCJA 3MV01 4IPPA 1WDQA 2IW0A 3CTTA 3H26A 4P8VA 4UNIA 1MW0A 4L61A 3SCNA 3H2FA 1EB3A 1F6YA 5E93A 2GJPA 4OUIA 3OU8A 3TQPA 4Y8FA 2X16A 1FWCC 4JFUA 3VOFA 4XAZA 9RUBA 2E68A 4LVDA 1QHPA 4KW2A 3MDWA 1VP5A 5T9BG 1QHZA 2OSYA 3R8GA 3BO9A 5H91A 1VENA 4KCTA 3SSZA 1EUNA 3H4GA 3AYVA 3UG4A 5M5DA 4L4LA 2FZDA 4IFKA 1CDGA 3WQ5A 1VJSA 3NO3A 4YTSA 5EBAA 2IKGA 9CGTA 2GJRA 2OCZA 3QTGA 3IIZA 4JTUA 4Z1YA 5IDIA 4IQEA 3WJYA 2Y5EA 4JFTA 5FL1A 1ISWA 3SCSA 4C1NA 2FHBA 5FF4A 3NL6A 4MYXA 4YVVA 1OZMA 1JPMA 4YNGA 2CLIA 3N9KA 4IIGA 1E0UA 3MSRA 5FAGA 3MYPA 4B9ZA 1R85A 1NIUA 3A6OA 3NOYA 3SADA 3CQKA 1O66A 1TMLA 1UWSA 5D2VA 3SAZA 2FB3A 4MM1A 1FKXA 4JHOA 4HTYA 3MCNA 3J7HA 1A50A 4PRWA 4JQ4A 3UR8A 3T8QA 4KFPA 3MWAA 3ID7A 4FO4A 4P7LA 1XIFA 3QW4B 1A5NC 5C6MA 5LGZA 3LCGA 5HWJA 3VZZA 3FJ4A 1QOQA 4J5NA 3CIVA 3TLQA 1LT8A 1OADA 3QZEA 4JY8A 2FMOA 3NFUA 3OYZA 3AALA 2IPJA 4L9XA 4HU8A 2BX7A 1JCTA 3S0CA 3JUGA 4MWAD 3STEA 3GG7A 2WCAA 3PPGA 3LPGA 5LXXA 4JS3A 1OFPA 1VHCA 4PB5A 4F48A 3HJZA 2FZBA 3W1XA 4JBRA 4K8GA 2JEPA 2F9RA 4LUTB 4IFKB 5E0KA 1BSIA 2F6UA 4NJIA 1W3HA 4MUZA 2YL8A 2BXYA 4CQ9A 1TVPA 3F2BA 5CGQA 2X2YA 4TX9A 1R87A 5IHSA 4HPGA 4LUYA 8XIMA 4PUKA 3C2OA 3SM0A 1XWYA 4LS2A 2ZZ5A 3I4KA 1JIBA 2ZUNA 4R7JA 3W81A 4WD0A 2J24A 5FF2A 1EJTC 2HNEA 1S2VA 3P0WA 4B2DA 3AMLA 4DO6A 5FIPA 5I00A 1VC4A 1XYBA 4Y2WA 3IJQA 3E0IA 4DI9A 3RPDA 4B2DD 4JGDA 2DSWA 2QJJA 2DT1A 4FNSA 4BI7A 5DXXA 2IQ0A 2VYOA 4F2TA 4DF0A 4UFIA 3FJ6A 2QCFA 2OZ0A 2Y85A 4PTMA 3T8LA 2GVJA 5I7GA 4LAZA 4H00A 3AHVA 1A3WA 2YBTA 4LYRA 1OK4A 1ICQA 1G5AA 4YIWA 4MWAB 3MSGA 5DF0A 3PVFA 4MB5A 1PCKA 4QG8A 5CSYA 3WENA 1F05A 1OD8A 4UQ9A 4UR8A 1M6JA 3PTMA 3ATZA 1V3JA 4HSOA 1Q6DA 5D8WA 4R9OA 1Q4NX 3VNJA 3UZ5A 2CBIA 2FPYA 2QJGA 1WP6A 2HRWA 2PU1A 3QZ6A 1QAPA 4TR9A 3ARSA 1VEMA 3ZWTA 1IWBA 2PDNA 3WELA 3E0WA 4JICA 1HJXA 1SR9A 1PS9A 2DGAA 3EEGA 1X96A 4GE8A 4IICA 1BGGA 2J9YA 1W9VA 1VBHA 2P50A 1PYFA 2NXIA 4WXZA 2YL9A 4ADSA 4ERAA 1EDQA 3HFTA 2OXNA 1TB3A 2ZICA 1VB9A 3MB9A 1SFTA 1AJZA 1EWDA 1NWRA 4N6FA 1UQYA 1UPPA 4GC3A 1NELA 3HOJA 3SCVA 3VIGA 4M5PA 3PZOA 3B8TA 3QOKA 5CG7A 1UP2A 5K3VA 3W24A 4MFDA 2GDQA 4H6KA 3O06A 4XK2A 1RP8A 3OBEA 3AYRA 2XIBA 4NSBA 5HMDA 4UOZA 2YXOA 4MIMA 1YE4A 4HPJA 4O1AA 2BSLA 3E38A 1E0VA 2WZEA 3DUGA 1O5KA 2FGLA 3PUGA 2NUXA 1B2YA 1PJ9A 4OKDA 3TA6A 4JIQA 5BMWA 4AEOA 4L80A 3IGHX 3PWAA 5GNXA 7ODCA 3HU7A 3O9NA 3RCYA 3A22A 4N42A 4C7FA 3D3AA 5DXYA 1EWEA 1WOBA 4Q6XA 1SZRA 1SU5A 2GQAA 1P7TA 2J13A 2XTKA 3ABQA 2YXGA 4MKSA 4GK8A 2WHJA 3HO8A 5BRQA 1LT7A 4GZ7A 5B7ZA 1IE7C 4AC7C 4AY8A 3BTNA 3WNMA 1R3TA 4UTKA 4U10A 3H70A 2O7SA 5E9XA 2DZUA 1TPWA 1TTPA 4ZBCA 1KFKA 3QZAA 4ZA0A 3OW1A 3RM8A 4NJGA 2GVLA 4Z08A 4JTJA 1OCBA 3BSGA 1MDLA 3M0KA 5I3DA 1GPFA 2O55A 3W7IA 2NX9A 1J0IA 4KEVA 4DWSD 5JQ9A 3S1VA 5D9PA 5K2ZA 3A3XA 3B0UX 3SUVA 1UBPC 1MFVA 1OT2A 3EA2A 5CG0A 2ZX9A 1SMAA 2DIEA 1PKYA 3WK1A 1H7WA 3RX2A 3WN6A 4F2BA 5JBFA 4X63A 1VIZA 2GUYA 3W1NA 3FYOA 1TJ0A 1UR1A 4M19A 3IJ7A 1QOPA 1ZCCA 1NEYA 4F9DA 3LTYA 1LRTA 2NLIA 3GUWA 5K9CA 3BW4A 1WZLA 3ZT6A 3BGGA 4NHVA 1LBLA 2VC6A 3I7RA 4PUWA 4OBSA 4IPJA 3G6LA 2CITA 2HISA 2NQZA 1KGWA 3WH6A 4AISA 2NV1A 1F07A 3HMCA 1KLYA 2J9ZA 3TEVA 1E5NA 3QHOA 3VA8A 3T1GA 1XQKA 4H7VA 5EFFA 3SY8A 1EF2A 3TMLA 4QTGA 4LYKA 2NVDA 2IPFA 1KGUA 1LBFA 4O0ZA 1QJWA 2PDYA 3VGDA 3GWQA 3KHDA 5EU9A 2HVNA 1WXZA 4QISA 2Z24A 2PDLA 4YHGA 3YPIA 2WNQA 4XVDA 5TIMA 5CKSA 1NQKA 2QUTA 2WHKA 4RJEA 5D9NA 1AJ0A 1EYEA 1G0CA 3VCCA 3GFYA 1C8VA 2XINA 4G9PA 4AF0B 3OZOA 4CNOA 3EA3A 2BDQA 4KKXA 4E5TA 3MI6A 4QDWA 4B5UA 1A5UA 3D47A 2QCMA 3N2XA 2PPGA 1B54A 4S2CA 2UY3A 5CBBA 4JDYA 1YXDA 1H49A 2DQXA 2OWCA 3B97A 2A3BA 4Y9MA 1P0EA 2PRMA 3XIMA 3SRHA 4REQA 3B03A 4IUGA 4HYWA 3QKZA 4H7ZA 1GVEA 2X1RA 3CK5A 5DMMA 1C29A 4KGLA 4B90A 4YWIA 2E1WA 2IPWA 2CWXA 1TIMA 2D2JA 4EOUA 2XHYA 2HTMA 1UR4A 1FH9A 3D0CA 3LXAA 1TUFA 4GXMA 1N8IA 2PTXA 3S6OA 4EACA 3G6MA 3BAKA 2F6XA 4D9PA 1HGYA 1ZGDA 1X1NA 1RJRA 3WK3A 3AHZA 2ASHA 1GVOA 1XSJA 3VCRA 4HP5A 4YVXA 4OOUA 1P6CA 4CNTA 2GQ8A 3GTXA 3M5VA 4GCXA 3B9DA 3UZJA 4XD4A 4DQWA 3DCPA 4I6KA 1QPNA 3QHMA 2J7GA 4IJCA 1K9FA 4AWTA 4HMNA 3TNBA 2VWSA 1EJ7L 1FRBA 4Y9OA 4C5YA 3SB0A 1CXIA 1E6RA 1K4HA 3V7PA 1LLOA 3IIXA 2NQJA 4HA3A 3GHUA 4JN6A 3VILA 3GDBA 4XZIA 1E73M 3W2JA 4HHMA 3BOLA 1JYNA 1EA0A 3GU1A 1GW9A 4O52A 3DN5A 4GIYA 1E71M 1GQIA 3KTSA 4JQ2A 4P8UA 1QASA 1Z9AA 4GNKB 2C1IA 1XG4A 1REQA 5LHFA 3LI0A 3PBUA 2GGGA 3WQPA 2WLZA 5D8ZA 1ZBWA 3NQGA 1NWUA 2V2CA 3R94A 3GY1A 4J3XA 4R7WA 4W7UA 5DBUA 1KA9F 2V63A 2QIIA 3N19B 3GVQA 4FX8A 5JIWA 4RNIA 3RITA 6PTDA 2P88A 4EANA 1EA9C 4NJHA 4DVOA 3MUY1 4KWVA 1H60A 4KWOA 1PX4A 1AA1B 4REQB 3W70A 2Q71A 1YPIA 1VQTA 1TVNA 1XH0A 4O18A 4BA0A 3AHTA 3VIOA 1XD1A 2X40A 3GK0A 5HNRA 3CNYA 4B16A 3T9PA 1JPDX 1R2RA 3LBMA 3S2NA 1XBZA 1UC5A 4KF1A 5D2WA 4GBUA 4PTXA 3GDLA 5KITA 3QR1A 4UIOA 5TBOA 3GR4A 1Q2RA 1EP2A 3BE7A 3TZNA 3UERA 3OOQA 5A6BA 5D37A 4HNVA 4D6DA 2X1TA 5C9WA 1I2PA 3R4IA 2JF7A 3FS2A 4WY0F 4DM1A 4W93A 4PE8A 1B1YA 3ANUA 4LEFA 2OO0A 4PR4A 3GQYA 3AXXA 1AQ0A 4RZ6A 4X2RA 2PCQA 3P3BA 4F0RA 1JZ8A 3TH6A 2A3EA 1HGWA 4IH3A 3TN5A 5F1UA 2BXZA 1K7EA 2XG9A 1MRAA 3CLMA 3RLVA 4A8NA 4GQ0A 5IBXC 4LTSA 3G1YA 1DQWA 4NP7A 2Q3OA 4KCVA 2ACQA 1X1ZA 1REQB 3MKCA 3PJXA 1E5JA 4B5WA 5LNVA 3BQ6A 1B0IA 2YSWA 4U4MA 1S39A 2WHMA 4HYVA 1J93A 1XGEA 3HM7A 4Q4PA 3W7OA 2C1HA 4PBGA 2XVGA 3LGGA 2KZHA 2NWRA 5HOSA 1X8CA 3L2IA 3C3NA 5HR6A 3KS6A 4D6GA 5BYWA 4G8TA 2J79A 4Z0JA 4C6EA 2HPMA 3EX6A 1I45A 4V15A 1FA2A 1EC8A 4AZ7A 1GEQA 5DCDA 4WJ8A 3S2CA 1WXJA 1XH2A 1DJXA 3TYCA 3WKZA 2BHYA 1AZ2A 5I0DA 4I9MA 2W6RA 1UR8A 5I3IA 3EB3A 1CECA 4H2HA 1FKWA 4GQRA 1HF6A 1YHTA 2QQ6A 2VEKA 1OK6A 3HBLA 2QLYA 3T44A 4TXEA 5GPRA 4AYGA 4W5ZA 3C2EA 1NVMA 4NAFA 4HZMA 4IOTA 1BYBA 3ZIZA 3H2EA 3CV2A 3MSYA 5HNUA 1LWIA 5GJNA 3V0UA 3QVQA 1SZEA 1JDAA 2VEFA 1WE5A 7TAAA 3IJDA 3TYDA 4IMFA 1OINA 1ZSXA 3A24A 2OELA 2XN1A 3UYIA 3FHAA 1ZP4A 1ME7A 3H4XA 3IVSA 1W1ZA 3L2LA 3UZWA 2JE8A 1B3XA 3NGFA 2X09A 5H8MA 5HWNA 1WX0A 1PAMA 1D8WA 4BZYA 2VDGA 4KERA 2JIEA 3ELFA 4US6A 1XCFA 3KAOA 5EMYA 3WNKA 3STCA 4L6DA 3EWYA 3BMXA 6TIMA 3C0SA 1K7FA 1K02A 3AUJA 4JTRA 5CPTA 1EJWC 1Z89A 2V2DA 4Z2LA 3BL3A 1POKA 5CGTA 1LP6A 4HOZA 2Z1KA 2PWDA 2XFYA 1TWIA 3RIKA 3QPYA 4XD5A 1C91A 3USZA 4JYDA 2VOTA 3NCOA 3D6NA 3VIHA 3XISA 1LOLA 1KV8A 1FWRA 3AJXA 4MUPA 3M7WA 1TPEA 3WLOA 4YCOA 3R0UA 1IGWA 2C15A 3ZJ8A 3MO7A 2OGJA 3VC6A 3FHQA 1GVRA 2PF0A 3KVJA 3DH7A 3CO8A 4O12A 4GH1A 3WLJA 2OODA 4MB1A 4O53A 4Y9NA 4Q8UA 1KM6A 1ONXA 1A5CA 4W7WA 5C9XA 1QBAA 1D3CA 2QULA 1W6TA 1LLZA 5C9ZA 2WBGA 4M1BA 1KRBC 2YPIA 1HFBA 2D3NA 4N9CA 3AIUA 2Z0IA 2F7FA 2J8TA 3W87A 1PDYA 5FJJA 4D6IA 3ZR6A 1EH9A 1ZAJA 3KL0A 4NAFB 3TYBA 1OVDA 1G7UA 3HV9A 1E4MM 4UTWA 2PE4A 4L9ZA 3CL8A 1W3KA 3ZT5A 3E2SA 3N2CA 1OFBA 2WM0A 4AVNA 2ZUTA 4NZFA 3CQ0A 3C4UA 1Z32X 1L2UA 4HPHA 1Q65A 4B5NA 1G6CA 2WO5A 4E4UA 1HJUA 1W1B1 2OT0A 3FYYA 3VNIA 2O9PA 2DUZA 2J25A 1CEOA 1VFMA 2WJZA 5HUPA 3T55A 3AJ7A 4UFLA 1OYCA 3ZZ1A 3EDJA 4ZO9A 2GSJA 4KEZA 1KGXA 5EMLA 1S2WA 1JG9A 1QNPA 5CEWA 2C19A 1XGZA 2WM1A 3TP4A 4C1LA 3O07A 2WZMA 2EXOA 1VLIA 4CU7A 3KM8A 2J7CA 4D6CA 1U33A 3W7NA 1TV3A 3VINA 4BS0A 2VDIA 4D71A 2OT1A 3ONBA 4HZ6A 4FHAA 3TSBA 4I7UA 1W54A 4LFYA 1P0BA 1XLFA 3R11A 2FVKA 1ML1A 2QPXA 1E6XM 1DHKA 4DUVA 3CUFA 3G8EA 1SFJA 5BCAA 2HZGA 2HK1A 3N13A 3AMKA 3VMPA 3EX4A 5C55A 5CSUA 2H90A 4Q8MA 2HPIA 5F2MA 3NO5A 1H09A 1BXBA 1OCNA 2QCDA 1E4LA 3GC2A 3GE7A 2XH0A 4FALA 1PZ2A 3F5KA 3W0KA 5CZKA 3QFWA 3S83A 4RNJA 3MUIA 1TE1A 4AG0A 4LB4A 5GJPA 3U3HA 5CLTA 3T0TA 3KBWA 4KT2A 4U33A 1YMYA 4GYJA 3QF0A 1W1A1 4FXFA 2PMQA 4Z2JA 4ONVA 2DVXA 1HN1A 1F5ZA 1GVQA 3GBEA 3F4CA 1BF2A 2ZDSA 3NZGA 1F73A 4J3ZA 3F4WA 3RMEA 3CB8A 4GUIA 1J0KA 1MI3A 4UTUA 5FAJA 4F66A 3U7BA 3DI0A 3A4XA 4ICNA 4U3CA 2J47A 3CAWA 1VJZA 3B8SA 2WBKA 3FXGA 3HPAA 5GVJA 2GQ9A 3T81A 2ODOA 1CIUA 4L6HA 2ZC8A 4UQEA 4NUWA 1N55A 2Y2WA 4IX0A 3W88A 1J96A 4GACA 3AMCA 4DIAA 2I5GA 4DLMA 3S2LA 1AH0A 4PN2A 4RE0A 2JGYA 4XKYA 4MF4A 1DXEA 1RPXA 2VOMA 2DH2A 2P0IA 1LL4A 3WQVA 3EWCA 2PAJA 5DRIA 4HPXA 7ENLA 1XYAA 4DI8A 3E6EA 1OX4B 1O1HA 4YVPA 1F6KA 3CV6A 2QCDB 3RLGA 1TZ7A 4GQBA 2ONEA 1AW2A 5I09A 1DTUA 3GLCA 3CU2A 3WSUA 5MHBA 3A12A 5G2WA 4AXNA 1Z42A 3PSVA 2PP0A 4WHBA 3HPSA 5KTLA 1YXYA 2VX6A 1L6WA 4JNMA 1E0TA 2W0UA 3VNLA 4HNOA 1TPB1 5A1AA 5IDZA 4WRHA 4DNHA 2VELA 3EB4A 2CKSA 3VCNA 4L9YA 1DJIA 3DFYA 3KWSA 1M04A 2DU2A 3DI1A 3E9AA 4WDUA 3LX9A 5FJUA 3URQA 3OIHA 1RXOB 5J5DA 2QAPA 1Q85A 1TPVA 4H9YA 4CVWA 4PEKA 1A5SA 4AD4A 2VP8A 4N4QA 3AIQA 1FP9A 3IJLA 1JF5A 2J6XA 3CUJA 3DFQA 2WQPA 2CXEA 5BWFA 4D6EA 3AXHA 1L6SA 1NY1A 4DXXA 1JDDA 3GUGA 1LOQA 1DJWA 5A6TC 3PC0A 1GYMA 4QIUA 4E8DA 1ZB5A 5E1QA 3SRDA 3W74A 3A5VA 1R8LA 1UP0A 3LRMA 2B7OA 4XKYB 1OFDA 2WMHA 5C7HA 1XQLA 2OWXA 2VX5A 3UYCA 2AKZA 1U5HA 3H2MA 1ZRQA 4Z2GA 1T6MA 3LHVA 3PK7A 3EZ4A 3TJIA 3OVGA 4P7QA 2EQDA 3UPWA 2DSVA 2BS9A 3U2CA 1W1YA 1LTDA 1KRCC 5A6SA 3U57A 2PGEA 2PWVA 1M7OA 4HSHA 3WF0A 3AIEA 4GVHA 4TUFA 4GVGA 1FHVA 1V6VA 4PMQA 3RX3A 4IL0A 1QNRA 5F2LA 3KHJA 3CLWA 1MZHA 5FJRA 1J18A 3WNOA 5G2IA 2FLIA 2YA2A 3B04A 1W2VA 4IL2A 3BLOA 1EDTA 4FLRA 4MPKA 3H6OA 2Y7GA 2G41A 1EP3A 3NJ3A 5HK4A 3VIJA 4PMVA 4B9YA 1HTIA 3N18A 2NWSA 2QF7A 4M56A 4GY0A 2DIKA 3CB3A 3B8WA 1AQMA 3FA4A 2HBXA 2W92A 4GUJA 1TTIA 3LSCA 5F7UA 4KCUA 2AGKA 5DT7A 5E0CA 1GQJA 2HJPA 3W75A 4EWJA 1UPMB 5LIUX 1E9LA 1H41A 5TF0A 3SGZA 3GTIA 3H7UA 3T40A 3BOFA 1DJZA 2XU2A 3CHEA 3KEHA 4H3DA 1OT1A 4GOAA 1JD9A 4HSNA 4W4QA 5G2HA 3VKKA 3NR0A 3H24A 1C9DA 3QC0A 1TMHA 5AC7A 4INFA 2BVTA 1DXIA 1AMYA 2XGBA 2YLAA 3VE7A 5IRPA 2WSRA 1E3XA 1H61A 3A3WA 5GNYA 2BY0A 2QW5A 3V5CA 1BD0A 3JU2A 3WCZA 1O1ZA 1YBQB 2EBNA 4DLFA 4UTHA 1RD5A 1TREA 3NPVA 3TTQA 3EKZA 3LV5A 4B4HA 1YTEA 2PZ0A 4YTRA 4XBKA 4JZ5A 4ZB0A 4P2VA 2REQB 1UOKA 4DHGA 1X7IA 3MJMA 1JFXA 3O6YX 7A3HA 4IIDA 1JGMA 5A2CA 4CD8A 2I16A 2VRKA 1RA5A 3UCDA 1VFUA 2BHZA 4TV5A 3NPWA 3TQ0A 4IMCA 1S2UA 3WLNA 1LWHA 5DELA 4DBEA 4Z2KA 3GR8A 2R8WA 2A5HA 2WK2A 3PAOA 1UB3A 3URNA 3GDKA 2Y62A 4PRRA 2VFHA 4H19A 3SN1A 2UY4A 1O95A 1OYBA 1V51A 3VD4A 1EPVA 3NSXA 1J79A 5FF3A 4PCPA 4CEUC 4F79A 8XIAA 4PUJA 2KX9A 2GVYA 5AYYA 3T2QA 1Z44A 2PGFA 1DPMA 4JTKA 3F1QA 3G1HA 3M43A 3WBYA 2J78A 3OJGA 3JZUA 4YWSA 1MW1A 2BY2A 1SO5A 1TPUA 1EYWA 3RCMA 3S1UA 1AMKA 3TWAA 2CERA 4U5IA 1A0DA 3OBAA 3NQDA 4NG3A 4MJZA 4ZXOA 3WZ0E 4LVFA 1TMQA 1VEOA 3SQLA 1JXKA 3O7UA 1XFBA 5HR7A 4DJFA 2V67A 1QW9A 4LU0A 2OLAA 3GG0A 3VZYA 4G56A 1HW6A 2YA1A 2ZVRA 4LC8A 2ZTJA 3F2CA 3H23A 1RLDA 1EDGA 1GONA 1S5NA 1ODUA 1DWFM 3VDBA 5E09A 1SW7A 3FW6A 3RUBL 4RW3A 1A5MC 1YX1A 5DX7A 2AL2B 1AL7A 1F8MA 4ERIA 1DVJA 4IX2A 1U30A 4M29A 3LNMA 3W6MA 2V68A 4G7FA 3VD5A 5CZ0A 5CPLA 2EEXA 5LSMA 4AQLA 3Q65A 3IPWA 1BVNP 1PB0A 4A3UA 4H8HA 4GX8A 4LX4A 5CJ5A 4DUXA 3WIJA 1QPKA 4Q8WA 2VX4A 1FHDA 5HPCA 2EPNA 3KRUA 2OYKA 4FNQA 3RJXA 1H4PA 1BLIA 3NDOA 1V0NA 2ZE0A 3VD3A 3PZNA 2ZZ3A 5D30A 1HX0A 4YYCA 1DORA 3SFWA 3C61A 4ICCX 3T2OA 1JRCA 1C8XA 1GOWA 2Z2UA 1OABA 3AS1A 3BH4A 2GDUA 4IPLA 4YN5A 1OCJA 3EA1A 2XFRA 2KAUC 4H4IA 4XZMX 3IVTA 3FVMA 3DEQA 3W26A 2WMGA 5ECVA 2V5DA 2E77A 4EX4A 2WJEA 4J4KA 5IHRA 2GWGA 3W2LA 5FA5A 3BCDA 1ALDA 1W3JA 3W7MA 2OQYA 4NZ3A 1H7PA 4XAGA 4BR1A 3W7PA 2OLHA 4JCLA 3AC0A 1OZQA 4RDVA 1I9CB 3EX1A 2PDGA 1J0YA 4QCFA 1YE6A 4I5XA 4MLRA 1EX1A 2FPVA 3KL3A 4KETA 2BOGX 3VDAA 1TPC1 2ZDRA 3WJZA 4AFYA 3NQBA 4GABA 4C7GA 1AD4A 1HNYA 1W1TA 4NXKA 4JQAA 1QK0A 1B57A 2QCCA 2DUAA 3W6YA 1G67A 1VBUA 3BV7A 3PG9A 1GG0A 4RPQA 1EJSC 2RHGA 2FH6A 4QAIA 3W7JA 3WD2A 1E4NA 2AQWA 3TQKA 1MNSA 1WDWA 4MWAE 1YRRA 1DBTA 2XWEA 4R85A 3SCUA 4QCEA 2A85A 4JKKA 4OECA 1EO5A 4LV9A 4C91A 3KE0A 1NH6A 1NDWA 3PWGA 1TZZA 3PPFA 1JGIA 3SCRA 3RN6A 3RF9A 4IPIA 2BVYA 1A5BA 1BXCA 2Z29A 2J8GA 1GOKA 5I03A 1VRDA 1C93A 3S8HA 4D1JA 4QE1A 3FX4A 3GM8A 4XAPA 4M6QA 4KWUA 4GUFA 1M1BA 3AHYA 3WH8A 1ZLPA 2PLMA 3G1FA 1BRLA 1H7XA 1O60A 2NLYA 4D6HA 5I3KA 5HXMA 5AHEA 2XFWA 5FI8A 4I3GA 1ZNNA 4R7OA 3EXRA 1SO3A 5CH9A 5CC7A 3T42A 4BJHA 3F5JA 2QUVA 4B91A 1LLWA 2Y89A 3KL5A 4IP7A 1RVKA 2NQLA 1Q45A 2VEIA 4JAWA 2BTMA 2ZUMA 2NVAA 3KBMA 3OPSA 3CH9A 2PGRA 2X7VA 4MKNA 5AC4A 2GJXB 3EWZA 2ZOXA 2BMBA 5CZJA 2HE8A 4NYUA 3R2GA 4WIWA 2P3EA 3LOTA 1E40A 1LBMA 2CLKA 3BAYA 1E1EA 4GIRA 3FV9A 1V0KA 5LIXX 3K8LA 2QCEA 5BWAA 3L66A 2GFTA 3REQA 3H54A 3CV1A 1RAKA 1AW5A 1UD3A 5AB3A 3MUAA 5A94A 4D8ZA 1A5AA 2DIJA 3LBOA 1H62A 2D22A 2PZNA 3CEUA 1NQ6A 2WZHA 1RUSA 3DOPA 8A3HA 5FJPA 1R3SA 1QI3A 2YKKA 1R3YA 3G77A 1H5YA 2I7GA 4LAOA 3KRSA 3HQNA 1UA7A 4CD6A 1UD4A 1ZCOA 3MY9A 1BHGA 3AO0A 3TTYA 1TPFA 4AZCA 1G4PA 2VZTA 3DG7A 4EPKA 1XBXA 1AH4A 1MXGA 1ZQ5A 2UWFA 1TQJA 2X41A 2ZX6A 6TAAA 2VL4A 4QJ4B 2WC4A 2OVLA 5G4WA 3LQLA 1CT5A 4Z17A 3UJSA 1DOSA 4DJEA 1UKTA 3RAOA 4IIEA 3UXDA 4F3HA 1EC9A 3BAIA 5KZDA 4LWWA 1PX8A 4FNPA 3P5ZA 1S2CA 2ABAA 7TIMA 3LMZA 2J7HA 3PR2A 2F2HA 1BRLB 1HJVA 2C79A 1KR0A 4EPBC 2JF6A 3T09A 2FMNA 1DP0A 3N2MA 2QDDA 2E6YA 3A3HA 4ZSTA 1PVNA 1ISVA 3OZPA 3MT1A 2YBUA 1FHLA 2E4TA 1Y7VA 3DYPA 5CPOA 1OCQA 4ZQRA 5ABFA 2XIIA 3Q67A 1BXNA 4H9UA 4QS5A 3VIKA 3O15A 4ZQNA 3MTWA 5BOEA 2QJHA 3Q45A 3NG3A 5BRBA 1O94A 2J4GA 5J04A 3RU8X 3TCSA 4LVGA 1AW1A 1EQPA 3UXAA 1E55A 1OFOA 2OX1A 2CLFA 2Y8KA 2AMGA 5LA2A 2VR4A 3DIPA 3E5PA 1S1PA 3NIYA 3CHFA 4OHQA 4ATLA 1KLZA 4EVZA 1P0DA 3EBVA 5M1TA 4CQ8A 1Q6LA 2PLCA 3UXLA 1KBBA 2R1KA 2PA6A 4F8XA 5I79A 4AX6A 2HROA 4MJ2A 4DNMA 3IAPA 5C0QA 4FXRA 4HPNA 1ITQA 3O0KA 1IR1A 1D7FA 4H9VA 1V3MA 5TQLA 3W76A 4XZHA 1MEHA 5DQPA 4AMCA 1SW3A 2P3ZA 4MGGA 2ISVA 4PMJA 1J12A 4M81A 4JTHA 4BQ4A 2WNWA 3GH5A 3V5OA 2OZ3A 4H7CA 3IIVA 1HO1A 4R34A 5DY3A 5C9UA 2HBVA 3KVKA 3ANVA 1FDJA 1BKHA 4JKLA 4I6VA 3PANA 1QWKA 5E9AA 3B3DA 4QNEA 1N82A 1W37A 2OEKA 2DY3A 6ENLA 4G7EA 1UR0A 1RP9A 4UTTA 5LHEA 6A3HA 3V1HA 3AU6A 3MHFA 4Z2HA 1XL9A 5ABFB 2PDWA 4JIEA 1XM3A 3CWOX 3P5YA 3T2PA 1C7TA 3NWRA 1GW1A 3LV6A 2J7FA 2D1ZA 2VEPA 5XIMA 3S6DA 1H11A 3QTPA 2ISWA 3EXSA 1TCDA 3WQ6A 1D7KA 1RSCA 5E5CA 4GINA 1VD6A 1IV8A 3W1MA 4Z1BA 2ZUSA 1L2QA 4ZO8A 3ALGA 3SCOA 2HWGA 4GQQA 1KKOA 4XIMA 3PZTA 1XSKA 4DM2A 5MKGA 2O9OA 3PJWA 1OC7A 1WAWA 1X1OA 1TUXA 2NT1A 1B9ZA 3Q94A 4M6UA 2OSXA 1US0A 2J77A 3BLIA 3DFOA 2DVTA 1G9HA 3WBAA 1QDSA 3GR7A 1JQVA 3WBXA 5D32A 2Z2BA 1F3XA 4ZQMA 3LMYA 2NSOA 4X9SA 3IIPA 4FNUA 3G24A 4ICMA 5E6YA 4ILSA 1RQBA 5EY5A 4CNNA 2FHCA 3V36A 2ZA2A 1U2YA 4A21A 5HQEA 2Y88A 1YW1A 1QR7A 2WB5A 3PF3A 3CXOA 3O0FA 4ZCWA 4XZBA 3ITOA 4A6GA 2O0TA 1PUDA 1UJPA 3URBA 2WANA 4WKHA 2F6KA 3JS3A 1E6ZA 3JR2A 3LDVA 3LM3A 4N0RA 2Z6IA 1E56A 1DEDA 4TQTA 3HGSA 5H8UA 4MZYA 4FXJA 4E38A 3BJTA 3MKKA 2WZIA 4KWSA 3WD3A 1UH2A 2DUXA 3E2QA 3I7QA 1VCVA 1GT8A 4QEHA 1KFLA 3LU2A 4EK7A 1FWTA 4AW7A 4ZQCA 3TE9A 1J5SA 2IS7A 3BW2A 1QI5A 4O8AA 3WBWA 1SPQA 2Q02A 4RV8A 4OUEA 5A6JA 4W8AA 3WJXA 3HF3A 5I07A 4HNTA 4NJJA 4FPSA 3GH4A 2IKIA 3PNZA 1A5KC 3BZGA 1XLDA 3JZEA 1XKJA 4HGXA 4X2PA 1EHNA 4LH8A 2YR1A 5MKGB 3G1DA 4LXFA 3GVGA 4LBSA 1JPIA 1QMLA 3UJEA 2DZWA 3M0HA 5BRPA 2YIHA 3RPTA 3POHA 2UBPC 3LRLA 4WGHA 4GUHA 3WF2A 4R53A 1KM4A 4WF7A 3MUXA 2QIWA 4U3AA 3WMSA 1GPWA 3W84A 2AAMA 1XIIA 2VZSA 4UNLA 4HMDA 4WSKA 3QY8A 2NV2A 4IJBA 4TMCA 1CZ1A 3UZYA 1JQXA 1PKMA 4KRUA 1HL2A 1JZ4A 2ZXBA 3KBSA 3M0VA 4LS1A 1JYWA 2FHFA 1NFBA 2R1NA 1WPCA 3GAYA 3MHUA 2WC7A 2QGHA 1PEZA 4H6EA 3PB2A 3CZ8A 2ZA3A 3KOXA 3ZR5A 2Z28A 1GG1A 3IK2A 4QJ1A 5U4NA 1R2SA 1CLKA 5C8BB 1J5TA 1NF0A 1CNVA 1XYZA 3ABSA 4AAJA 2GUBA 2A3HA 2I56A 5AOUA 1IEXA 2A6NA 2QF8A 1TELA 1JRBA 1HKWA 4PL1A 3MPGA 4UCFA 1BQGA 3SSJA 2Z7GA 1EBGA 3LGEA 5AC5A 1EGVA 3GU2A 3V16A 2R6OA 3ERPA 1XDJA 4W89A 2H9AA 2NX1A 1DXFA 1S3TC 4WXYA 1L8PA 2WWCA 3H21A 4JTFA 3GSMA 4L1GA 3I3EA 2XWDA 2HE5A 1GOMA 2YW3A 3TWBA 2DH3A 4S1FA 1VFOA 4KPLA 4XX6A 1J01A 2HS8A 4PBEA 4N02A 2CPUA 3BLLA 4L5ZA 5T9CE 3U2ZA 3S47A 4D2JA 5A3HA 1MEWA 3RRXA 2NQ9A 4FLOA 1RCXB 3BZJA 2V5CA 3WNNA 5ABHA 3T4CA 4GPNA 1NDVA 1C9WA 1KFBA 2C3ZA 5AECA 1EQCA 1IXOA 5D2YA 1B3ZA 1BF6A 4PBFA 1P6WA 2B7NA 4D6FA 1W5MA 4W7VA 1W32A 4OTKA 4GH3A 2C0AA 3KZSA 2BGNE 3B8VA 4JEQA 5I24A 3EEZA 4XD6A 3VX1A 2A3AA 1VF8A 3AICA 1FTXA 1DIOA 2V8ZA 2ACSA 2TRSA 1B9BA 4GCAA 3TOPA 1UWUA 3SRKA 3VIMA 3I6RA 3R10A 3W1UA 3G8RA 2QV5A 4OBTA 3W22A 4OOZA 1NU5A 3KFTA 3ZYZA 3LENA 3CUXA 1H50A 2C7FA 3NSMA 2QV4A 5C70A 3LGDA 1CCWB 2WMIA 3PULA 4ECLA 1EZ2A 1JJKA 3THDA 2RDUA 3FLUA 2WKJA 4UQDA 4P7OA 4YXGA 2H9AB 1PTGA 1DKWA 3C8FA 5I6SA 4J35A 5FEWA 4A4AA 2YDRA 4DBSA 4JTSA 4M24A 4RXGA 1OIMA 3QGAC 1RQHA 1PPIA 3ARQA 1XCXA 3OQ8A 4PFMA 3ES8A 2G3JA 3VO0A 2P76A 4ML9A 2WMKA 3C2RA 3RO6A 5AKQA 3F7JA 4NXSA 2GDVA 4EPEC 2V5LA 5F4WA 4YHEA 1EKOA 3HGRA 1HL9A 1I2RA 3UY8A 4QQUA 1IT7A 3SGGA 3VKJA 5HQLA 1B90A 1GTHA 3O8AA 4HMCA 4M6PA 4A22A 4CD5A 3LHUA 4BK9A 4H8NA 2A6LA 1K3UA 1V7AA 2C13A 3CUHA 1A47A 1XRSA 3VDHA 2EGZA 3MVIA 3S42A 2A21A 4NIRA 4DXVA 1ONEA 1FWWA 2G4JA 3GFXA 1CGUA 4HHPA 1M65A 1YNYA 2OO6A 2UY2A 1V3IA 4S3BA 3SUSA 2CCRA 3Q37A 3BLEA 4ZFCA 3KRZA 5LNUA 2VZUA 2HK0A 3VD9A 3P82A 5BXTA 1WXYA 4LVAA 1M3UA 4NNCA 4R88A 1FWGC 5G5IA 3G1RA 2HCVA 1FDZA 4S2BA 3SQSA 3I3DA 4C5ZA 3KLKA 2OZTA 3QGKC 3HTWA 1LUCB 1UZ4A 1F4AA 1GEHA 4IGSA 1YYAA 1SZNA 2V9DA 3BOXA 2CU0A 4A3RA 3TW7A 3BAWA 1MQRA 3COTA 3W1TA 1S5WA 1IYXA 4Y9AA 5A8GA 4NF7A 1I2OA 3PUDA 2QJNA 1KO0A 4RDZA 1DJGA 3TROA 1X6UA 4DF2A 4V28A 2POTA 3FKKA 2W3ZA 3PTDA 1EFZA 1VJIA 1EL3A 1PL9A 3PZUA 4IG2B 1YXCA 2I5QA 4PSRA 1EX5A 2V5KA 5HJLA 1FVPA 1V77A 5CJNA 1ZJBA 2V30A 3QGVA 5A8NA 1EP1A 1RV8A 1FCVA 2W62A 3B4YA 3CYJA 3N2BA 2CFFA 1TCMA 4I8DA 3LS9A 1UYQA 4Q8PA 1OG6A 3NM1A 2XIMA 1P43A 3P84A 2C16A 3DECA 3APGA 2VWTA 3OLIA 4GZEA 3W7EA 3U6WA 4Q4OA 4PMDA 3AWOA 3P7YA 3W86A 1W9UA 3E2RA 3ARTA 4DO7A 3EX2A 1IF2A 3SIMA 3WL1A 2Y8VA 4ZEPA 2EJ1A 4PFHA 1KM2A 1K8YA 1A5LC 2F38A 4F0MA 2QMJA 3PY2A 2OYLA 2A3CA 1QO2A 1UOZA 4OV9A 2DZSA 5G4HC 2FJKA 1B5TA 2LLEA 1PSCA 3GX9A 5KEZA 4BWLA 3T0DA 1XIJA 1PZ3A 3EWWA 4PCFA 4DJDA 3W1QA 3MYOA 1BKSA 2F8QA 3WEOA 2BG5A 1K9DA 1T0OA 5JMUA 4XB3A 1SO4A 3KOZA 1BWVA 3S5SA 4DJDD 4J3WA 3IV3A 1T40A 3OQEA 3ITYA 1BGAA 1L6GA 5CAKA 3BICA 2PUZA 5F1VA 1U1HA 2G50A 2G5WA 5EFDA 2EJAA 3R89A 3UNTA 2ON3A 3MANA 1PKLA 3CC1A 1ME9A 3GBDA 3RDKA 3WQ4A 2C1GA 1FQ0A 1HL8A 4WVXA 4BY3A 4Q8VA 4C6DA 1XR2A 1VZWA 3IRDA 3IRSA 3UR2A 3V4BA 4Q8NA 4JR5A 3FSTA 1E6QM 2Y63A 3ZLFA 1UWRA 4IQLA 2J88A 2PFHA 4Z0SA 4DBDA 1JDFA 4O50A 1Q4WA 3WY1A 1SSGA 2JKAA 5AHIA 1NDZA 3QFEA 1LOSA 1XS2A 3W83A 3HQOA 5I3GA 1KCLA 4GZIA 5CPNA 3OLGA 1JCYA 3FA3A 4CCEA 2GSEA 4WJXA 4CQCA 1U5JA 2E3ZA 1LL6A 3LHWA 3CHCA 3HA1A 4NRRA 2XDFA 1KCKA 4BFAA 2PP1A 1LYXA 4FK9A 3WUFA 1FH7A 4FIRA 1DL3A 3A13A 4IFRA 2EG6A 3LHTA 1ZL1A 4GFSA 1I4NA 2VX7A 5IFTA 1CPUA 3QYSA 4W88A 5HAOA 2FTYA 1J10A 3URAA 1ESWA 5HWMA 1UZHA 1ZALA 5AYXA 1ADSA 2CLMA 1BAGA 5LNWA 1TTJA 3LTSA 1MNZA 4BF5A 1MUCA 3G3DA 3R25A 1SVDA 1OX6A 3ITGA 1QPOA 2DZAA 4MKVA 1W17A 4IMAA 5MF5A 2XVPA 4FEZA 4XWUA 5CBJA 2WCGA 1O7AA 4XD3A 4AMAA 3UZXA 1DYSA 3A21A 1KM1A 1PWLA 3CZEA 3UR7A 3SIZA 4D1IA 3QM3A 3R6IA 3NA8A 4AUBA 3SRFA 3VXGA 4D72A 3I7SA 4PEEA 2GLKA 2V5BA 1VCFA 4YLWA 2C0HA 3U7VA 2VXNA 4FX7A 3WBEA 2F2KA 3GH7A 1F3TA 3MSDA 1XHGA 2V81A 3WFAA 1RBLA 3NDZA 4KQNA 3W72A 4ZSUA 4HHLA 3NM3A 5LZLA 5M17A 3N3MA 3APTA 3EOSA 4MNLA 4RXFA 2D2HA 4A8IA 4N9BA 4HNCA 1MWOA 4BF7A 3DKJA 3NGJA 1CB2A 3DZ1A 3EMQA 2E9MA 2D2OA 4M1RA 3KLLA 3VOIA 3ZVIA 3AAMA 3U4AA 3RGTA 5PTDA 2RDXA 3TA9A 2WAGA 1QWGA 4LUIA 4Q33A 1KWKA 1W9BM 4C6KA 1XUZA 2OJPA 3HN3A 1OG0A 3VKAA 3UXKA 1MSSA 4JX4A 3K46A 5FJOA 5AC8A 3WUEA 2J74A 1A4LA 1KWGA 2TYSA 5CQ1A 5CAHA 3RM4A 4C7DA 3CBWA 3H12A 5AZ1A 1DWIM 4AIUA 4C1NB 5CGMA 4UC5A 2TAAA 2ZWYA 3NNTA 4GO8A 4S3EA 4LQ1A 1JXJA 4O10A 1NAL1 4UFJA 4DELA 1ZUAX 1N7KA 4H9XA 5D4YA 1W8SA 3WLMA 2WSYA 1CWYA 5HMEA 3SN0A 3OVRA 1MQQA 4IMDA 4NZ5A 4ERGA 2WMJA 5I2UA 1Q3NA 2DSKA 3V0TA 4TTGA 4H41A 1Q6OA 2JGQA 3UWZA 2ZRYA 1F2JA 3QV8A 3E1F1 2CBVA 4DB7A 4FI4A 4D8AA 3UG3A 4CN1A 3WK0A 4ZTXA 3M0JA 1Z41A 3T0CA 4K6AA 3PM6A 2RH9A 3GZ3A 1N8FA 2VC5A 1VFTA 3N2TA 3UT0A 2YLLA 3EYPA 2X1SA 1YADA 4QLLA 4GIAA 5FF7A 1XISA 5I3HA 1R2TA 4AZIA 3LLFA 1XBVA 1UKPA 3EAUA 2XVLA 2XGIA 4JTAA 4R27A 2Y70A 3UA3A 3L4ZA 2J7BA 3BVJA 1C8YA 1U5VA 4IZGA 3KCLA 3WDHA 4JNZA 2TSYA 4XUYA 5IM51 4UUIA 2NV9A 1ZJIA 2GPTA 3QR0A 5T26A 5FEZA 1G4EA 2P0OA 4E8GA 4LC6A 2Z1VA 3KP0A 2VKZG 2A79A 3HG5A 5KZEA 2J7DA 1JL8A 3AYSA 2GZXA 4QR6A 1QUMA 1OJXA 3EX3A 1B3VA 4CQAA 1OY0A 4LB3A 3VU2A 4KWWA 3S9ZA 2VHLA 1FY6A 2XZ7A 1HJQA 4Q7BA 2PWGA 1K6WA 2Y1HA 3VNZA 3DDMA 2WSKA 2G95A 5HPOA 5EYWA 5BXRA 3BPWA 5CC6A 1RD6A 1UIOA 3GC5A 5GJMA 4LPCA 3FYPA 1AZ1A 1KCZA 3GB6A 2GOUA 2FZNA 3SEPA 2FZMA 1AUSL 1EJRC 3BLPX 3W07A 5A95A 4TVDA 2FDMA 1EIXA 3R12A 1VS1A 2GQ3A 3FEMA 3R1ZA 4KIEA 3DC0A 1OGBA 3CMFA 4W84A 4JHZA 1GJUA 4PUNA 2QHAA 3KCJA 3RYSA 4UR7A 1K9TA 2UY5A 1UMYA 2WQDA 1FHUA 4M0XA 3FGCA 3CJPA 3ABZA 8CGTA 3G3MA 2Y24A 4PZVA 5C71A 1UD6A 2FJUB 1ZP3A 4R33A 3LHZA 1XYFA 3AZSA 2W4XA 4ADUA 3DHFA 1F4HA 1QW7A 4QG9A 3MI3A 1J4EA 1T8QA 3PZGA 3CGTA 1YNQA 1UZDA 5JBEA 1DWHM 3KCOA 3CAKA 3CO4A 1FDYA 3WQWA 2OFJA 1PBGA 1I6NA 4MYAA 1K1DA 1PHQA 1KTBA 3KW3A 2ISDA 2WKGA 4B3KA 1BFNA 3NPXA 3FAXA 1LDCA 4RUBA 3ONCA 3QR3A 2E8ZA 2D3LA 3OODA 1BTMA 4O1CA 3AXIA 2VUNA 1V0LA 3PZIA 5HMSA 2ZC1A 2ZZ2A 5AFDA 4NI3A 3PJTA 1XLEA 1TV2A 1QXLA 4W85A 3GNRA 4YJ5A 3WUBA 3K1DA 5HDRA 3AS3A 3NEVA 4J1OA 4UTLA 2BGSA 4WSJA 4YU1A 3K8KA 1WDDA 2VR2A 7REQA 1TV5A 1W1PA 3RHGA 3A64A 1V6TA 3K5XA 3DAQA 1Z7AA 3RR1A 5LA0A 1V7YA 4AIOA 5D9OA 4JYFA 1MW3A 1LQAA 4J2MA 3UWUA 3D46A 4JFSA 2AL1A 3QV6A 4FA3A 2DDXA 4UTIA 4U5KA 2VGIA 1Q6FA 1K6AA 2VZOA 2DSUA 2WVSA 2J7EA 1UJQA 1XKYA 1IR2A 3FGCB 4GZJA 1OBAA 1VRXA 3DKLA 2E9BA 3K4DA 3OTRA 1G4TA 4FLSA 3POCA 3H2NA 2C14A 1QPRA 2V82A 1O5XA 4ZOCA 3SFKA 3ZS4A 2G96A 3GKFA 3UW6A 1BWLA 1TQXA 7XIMA 3ARPA 3K13A 1P5BA 2RDWA 2OWWA 1TA3A 2ZRXA 3S2MA 1J6PA 4UTWC 4AD2A 5JU6A 3QY7A 2BY3A 1P7TB 3VM7A 5D09A 4MJ4A