3LV5A

Crystal structure of the mutant i199e of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAEIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 82
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lv5A00
1QWGA 4OV4A 3W7OA 3CEPA 2IQTA 3F4WA 1IXNA 1O5XA 3GXPA 4JTUA 4DO5A 5K9DA 3E9AA 3MWAA 5G2WA 1OHLA 1SPQA 3OVPA 3BO9A 3W1QA 3B0VC 2E5DA 1K8XA 4JYFA 4XTIA 4DEFA 3LHTA 2FQIA 3LRMA 3E0IA 2VEKA 3L68A 3W7DA 2QDHA 4JR5A 3PS7A 1VRDA 4XKYA 3LGEA 1C29A 4JTGA 3W1AA 4E0CA 1DORA 1ME8A 5F4WA 4YCPA 3W7IA 5D2YA 5FF3A 4LRSA 2ZZ5A 1H63A 2NWRA 4NNAA 1I2RA 1AW5A 5LNRA 4LS2A 4LU0A 4I7VA 1KBIA 1SFLA 4O54A 4FX7A 1PVNA 3NEVA 3M5XA 4BI7A 4CQ9A 1KA9F 4IXXA 4NX5A 5CGQA 2A6LA 1V5XA 3DZ1A 3CHVA 4HPXA 1PS9A 2B7NA 1P0NA 2YPIA 1P5BA 1VHNA 1YTEA 2CZFA 4AH7A 3EXRA 2ZA1A 4CCEA 4PL2A 1JQXA 4O1CA 3W6YA 4HHPA 3V75A 3A24A 2YFOA 2R14A 3P82A 2BLEA 2WO5A 4LT9A 5BW6A 3C56A 4LS0A 1JQVA 1ZAJA 3BG9A 4O13A 3HG3A 1LP6A 4HKPA 1IIGA 1LZOA 3LHUA 3TKFA 3L67A 1N55A 3NQVA 4UTUA 3TJLA 4DBDA 2ZBTA 3UWVA 2QKFA 3ATZA 2FJKA 2FPVA 3G3DA 1YXDA 1XUUA 3W71A 1OFRA 2VEMA 3W7KA 2R8WA 1VJIA 4NNCA 1DL3A 1LBLA 4TMBA 1RR2A 3NQAA 2NUXA 3TMLA 1QDSA 1MZHA 4A2RA 2WNZA 1H1ZA 4KKXA 1MEIA 1K02A 3QPYA 3VE7A 4UFHA 3FIGA 2FB3A 2V8ZA 3GKAA 3P60A 2H90A 3PBYA 1M7PA 5BNKA 5D03A 3BW3A 4JIPA 1HFBA 1DJNA 4H3DA 3W72A 2J9XA 5HUOA 1J2WA 3VE9A 4O4VA 3DKJA 3LCFA 4MFDA 1I2PA 1TCDA 4Z0JA 2WOQA 2Y7FA 3MHFA 4N9BA 4GUJA 1LRTA 3STCA 2HS8A 4BI6A 1PCWA 2P1FA 1L2UA 3W2NA 2X1UA 1VPXA 3TXVA 5K3VA 3HG2A 4WOZA 1F6PA 5DCEA 1B57A 4WY0F 4L4MA 3RLUA 3F1QA 3P80A 3T44A 4BI5A 3EX2A 2VFHA 3W1MA 2C19A 5D04C 2C0AA 4UTWA 3P5YA 3C2OA 5FF7A 2HTMA 1D3GA 4IUOA 3QFEA 4O0ZA 3N9SA 4FIQA 3BK0A 4MYXA 4YXGA 1TPUA 3G1FA 3MBFA 1QOPA 1JCMP 2Z2UA 2WJZA 1ZAHA 1OABA 2DZXA 1OYBA 2Z6JA 2B7QA 2CZ5A 4UUIA 3DENA 3NL2A 3PSVA 4G1KA 1FXPA 1VYRA 2DJXA 1DHPA 3VFLA 4FNSA 4JTLA 3TU9A 3WK3A 3VKJA 1TPFA 3SR7A 3O6CA 4NJHA 2W6RA 1P1XA 4LUIA 2Y61A 4WOQA 5LZLA 1DQWA 4IMFA 4TMCA 4DXVA 2CLHA 1SZEA 3GAYA 4YL2A 3TCEA 3W1TA 4AF0B 3NAVA 4LS1A 4O12A 3SY5A 3JS3A 3C3NA 4WX2A 1Z48A 4R34A 3THQA 4ZQOA 3UWZA 3C0JA 3LXCA 1KFKA 3W87A 3A23A 1GVQA 5IM51 2CU0A 5AB3A 4RV8A 3B8DA 1X8FA 4O18A 1OX4B 3UYCA 2Q3OA 4FB7A 4Z1BA 1QR7A 1B4KA 3LXBA 1KFLA 4FO4A 1ZHAA 2H8ZA 3G8RA 1XBZA 3O15A 1TO3A 1Q3NA 4PEKA 1T96A 2Y62A 2C14A 3F4NA 1LYXA 2EHHA 3QM3A 3CIWA 1IXOA 1TB3A 5LGZA 5HJLA 1JUEA 1NEYA 1TPWA 2JKAA 4NQ1A 4P61A 5LSMA 3CTLA 3BW4A 2QAFA 1A5SA 4FNTA 1VCGA 5AC7A 3LRLA 4I9AA 3M0ZA 3NQ2A 3TC6A 2FFCA 1OYCA 2JBMA 3FOKA 1CX9A 3C6CA 3RLVA 3A9IA 6ALDA 3HQ1A 1FDYA 3U8GA 1ZCOA 2AQWA 1SU5A 3P8IA 4AWSA 1TMHA 5K9CA 2BXVA 3FA5A 2FDSA 1YYAA 3GDMA 3LHVA 4XBKA 5HMSA 4HNNA 3W1RA 1G67A 5AFDA 3P84A 4K37A 2V0TA 3QSTA 1SW7A 1YADA 2YR1A 4BWLA 2V5BA 3KRSA 4YCOA 3I7SA 1KM4A 3TAOA 3O1NA 1KM5A 3OVQA 1I45A 1U83A 2DORA 5HQEA 1TTJA 3TMQA 2Z0IA 4MPQA 4M7TA 4C1KA 3M1ZA 3W1UA 3LTPA 5FF4A 2G95A 3LBCA 4O15A 1TQXA 1VLWA 2V2CA 1BWKA 1VZWA 3N3MA 3W07A 3TFXA 2OCZA 4EIVA 5F2GA 3PBVA 5F2MA 4Y8FA 2JGYA 3W2JA 1CW2A 2C13A 1A53A 2RDTA 4UNLA 2QCLA 4JX6A 1EUAA 3B0PA 2V2DA 1IXQA 3G22A 5BRBA 3GX9A 1KTNA 4LVFA 2Q8LA 3NDOA 1L6YA 2EKCA 5DBUA 3BARA 1ALDA 1VLIA 2V9DA 4D2JA 1OFPA 3L5LA 1A50A 3NGJA 3PG8A 3WJZA 3P61A 1H7NA 2YX0A 3D0CA 2E68A 3GAKA 4HNUA 2RHGA 4JTKA 1VS1A 3QPZA 3QYQA 4N9EA 5DXXA 4CNNA 5EMUA 1TYGA 2CLKA 2DZUA 3G1XA 4I7UA 4UFMA 4N6EA 3PWAA 1MO0A 1SR9A 3G0UA 4NU7A 2O7SA 1TJRA 2NV1A 3FFSA 2ABAA 5F1UA 2NLIA 4A21A 4BK9A 3B0UX 1ZFJA 3KVJA 1FDJA 3G8EA 3KRZA 5K2ZA 2DP3A 3QQ1A 5EPDA 1XKYA 4IX0A 3C2EA 2Y6ZA 3S5NA 3HB9A 4JTEA 5D2TA 3DFNA 5HWNA 3IIPA 3GDLA 3KVKA 2KZHA 4ZMGA 1J5TA 3M44A 4N9CA 5KZMA 4IMEA 1RD5A 2WPBA 3L0KA 5CPMA 2E6YA 3UZ5A 3TSBA 2TRSA 2TPSA 3GIYA 3MYPA 1FXQA 4X22A 3P7YA 3U2OA 3BLEA 2CW6A 4X9SA 3ZWSA 2XN2A 3W2LA 3S5ZA 1FWSA 4MY8A 5DY3A 4AHPA 3MW7A 1B4EA 1UASA 4XKYB 1W8SA 4DO6A 4QNWA 3W84A 4PCFA 3BPWA 2ZRVA 3NQMA 3QW3A 5D02A 4MZYA 4O50A 1WOBA 3BGGA 3OA3A 3NQ8A 4O14A 2ZRYA 5AYXA 3S1WA 4QSHA 3Q58A 2CZEA 4QAIA 5D2XA 1GZGA 3GXNA 1HO1A 1GVOA 1EB3A 1O4UA 4UTTC 3PG9A 1YPFA 1KFJA 1C8VA 3W2MA 3G0SA 3CC1A 3RMJA 3DHDA 3W75A 1XXXA 1WV2A 3F03K 1R47A 4MOZA 5E0KA 2GPTA 1KFCA 1WDWA 4X3ZA 2Y88A 2D73A 3N19B 5AN7A 4S2BA 4B5NA 3EX6A 3W85A 5G2IA 4E38A 3PY2A 1S5WA 4LY8A 1G4SA 4GFSA 4MFEA 3T7VA 4LWWA 3KXQA 3DU0A 4JTHA 4R53A 3SIZA 2ZTKA 3N14A 1Q6RA 3HPXA 3NPUA 2A1YA 3DI0A 4M6PA 1JCXA 1YXYA 2A2IA 3NPWA 1TPB1 2EPHA 2X1RA 1ML1A 4UTWC 3SJ3A 3B06A 1W31A 1BKSA 3UWUA 5I3GA 1KV5A 5CPNA 4LW7A 3IV3A 3O63A 1SO5A 1XI3A 1LORA 4QQ3A 5FEPA 2QCDA 3LI0A 4QNEA 3EWBX 3ABOA 1PCKA 3GDRA 3LI1A 1RV8A 3SFKA 1VR6A 4UTLA 4WZHA 3EKLA 5ABTA 3E49A 4TU1A 3NQGA 3HPSA 3S5YA 3NG3A 2H8XA 4GXMA 4M6QA 1N7KA 5FEXA 5FI8A 4HSNA 4IWWA 1LOLA 3I68A 1QCWA 2QCCA 3W23A 2YSWA 2HSAA 3E02A 4UTMA 1Z44A 3LCLA 2EAWA 2CLEA 2ZZ3A 3SGUA 1TV8A 1V7YA 4K7VA 1W5NA 4YLWA 2ZRWA 1Y0EA 3G24A 1H50A 1I2NA 5G1YA 5H2ZA 4OT7A 2UV8G 4JNMA 3G1DA 1AW2A 2YZRA 5F4SA 2NXHA 2QUVA 2VFEA 1GPWA 1W5OA 5K4ZA 1JCYA 1F2JA 1FWTA 3LBMA 4J9JA 1G4PA 1B3OA 3MI2A 2VC6A 1H60A 4UTHA 2J27A 4N4PA 1GYLA 2P10A 1W5PA 4LNYA 2E6AA 1FY6A 1AL8A 3OG3A 2X1TA 4IX2A 3M6YA 1O94A 2ALDA 3TH6A 3OEXA 3E96A 1K03A 8TIMA 5DXYA 2OMAA 5G1TA 1UCWA 2A0NA 3QH2A 3UPBA 2NX1A 3AO0A 3TXZA 4XQ6A 2ZYFA 4XZ9A 3L5AA 3TNOA 3TV8A 5LHEA 3W7HA 4Y96A 3C4UA 3W88A 3THAA 2Y63A 5KSWA 1QO5A 5A8GA 5LGXA 3G18A 2A5HA 3CLMA 4PFMA 4Z0SA 2E5CA 1A5BA 3QMSA 5H91A 4NJGA 3MUXA 1DV7A 5DELA 5LNWA 1EEPA 1QPRA 1OFOA 1DJQA 5HUPA 1JUBA 3S5OA 1U5JA 4IGHA 3FJ6A 3BLIA 2DU2A 2Y7GA 5LHFA 3WJWA 3M5YA 4HN4A 4K38A 2VFIA 3GNDA 3SI9A 1E51A 1AMKA 1QMLA 4BWLC 3W3OA 4O1BA 2QUTA 5DCDA 1F74A 1NAL1 4QIUA 1I2OA 5MHBA 3LHZA 3M5ZA 1JVNA 2BZNA 1WBHA 4IMDA 2ISWA 2X16A 3KOFA 3NO5A 1A5CA 3NQFA 3IGSA 2YCEA 4UTTA 2OT0A 4OGZA 3M16A 1RQBA 3R2GA 1OFBA 4UFLA 1KTBA 5D05A 4K6AA 5G4EA 4FIRA 5KITA 1TTQA 3IIOA 4ORMA 3MHGA 1B9BA 4Z1AA 1TPVA 3L21A 4GUFA 4DF2A 2OJPA 3SGZA 5FF0A 1FCVA 2C6QA 3DFOA 4LVDA 3B4UA 1KM3A 3Q2DA 1KFEA 1S5VA 4FEZA 1SZGA 1JJKA 4O11A 4POCA 5I3IA 4AEOA 3O05A 3NOEA 4LVBA 3TFCA 1TV7A 4NNBA 4AHQA 3LV5A 4PH6A 1WXJA 4GUGA 2VFDA 4JTIA 1TIMA 4EF9A 3HOJA 3UWYA 1KTCA 1OYAA 3HGJA 3PBUA 4AXKA 2PC4A 3FYOA 1H5YA 4AHOA 2P0OA 1EPXA 4ADTA 1SO6A 2DJLA 1LOSA 1OVDA 2Y7EA 1AL7A 3RF9A 1KV8A 1TPH1 2WSYA 4WD0A 4MZ8A 4XBSA 5EA9A 4IMCA 4WXYA 5I3FA 3GR8A 4IJBA 4NJIA 3W7JA 4I7WA 5D33A 4GRSA 5CKSA 1Z41A 3TIMA 2QR6A 1F73A 4NX0A 2FLIA 4XWUA 3VI2A 2C15A 1K7FA 4NVTA 3RU6A 1BEUA 3OBKA 4JYEA 3A22A 2HS6A 1LTDA 2OT1A 1YDNA 4MJMA 4M7SA 3K30A 2I9EA 3LLFA 2QUUA 3KVLA 2PRLA 2FB2A 1CI1A 3LDVA 4LTSA 5D30A 1A5AA 2YGYA 3TSMA 3W74A 3TQVA 3LTSA 1QFEA 4A3UA 5CPOA 4MIMA 4EOUA 4GE8A 4WXZA 3IGUA 4UMBA 1W37A 1J4EA 3O8AA 1LBMA 1MEWA 2JGQA 4KFPA 3EX1A 1IXPA 3BG5A 5U7SA 3T55A 5HWMA 4P2VA 3B03A 3MP5A 5TQLA 4O1DA 1L6SA 3R13A 3TROA 3W7LA 3OIXA 1OF8A 1GOXA 2VEIA 2TYSA 1ONRA 5AC6A 3B04A 4DBEA 1PE1A 3W7PA 3CB8A 4MJZA 1IIHA 3MHUA 1MSSA 4R33A 4UTKA 5DCBA 1Z42A 1NSJA 5D09A 4JTFA 3S9YA 4NJKA 2BX7A 1K8YA 4UFJA 3ABSA 1TV5A 4N4QA 5HR6A 1XCFA 3R89A 1TREA 3QRHA 1OFDA 2GVJA 2QJHA 3W2KA 2YFNA 3G1YA 3TK7A 4ORIA 2W79A 3IIXA 4JYDA 1FWWA 4GUHA 2X1SA 2VENA 2WKJA 5LNSA 3RNDA 3UY7A 3C61A 2B0MA 2QCMA 1PIIA 3WJYA 3NYZA 1HG3A 2DZPA 1L6WA 4O19A 5D2VA 1KM0A 1ZY9A 2A7NA 2VKZG 2VFGA 3DFSA 4UCGA 2R91A 4MUZA 1G6CA 3DBPA 3IGXA 3NA8A 5TIMA 1W54A 4QM1A 4M19A 3L5MA 4GJ1A 1EP3A 5FESA 1TTIA 4IOTA 4N02A 4NXKA 5EBUA 7TIMA 1TPEA 4O10A 1KM1A 3ATYA 2C16A 3QMRA 1EWEA 4NJJA 3QSRA 3CU2A 3W7QA 5TBOA 1DQXA 2PURA 2RKXA 3TW7A 2PCQA 1KLYA 3WJSA 3WK2A 1PV8A 1MXSA 3EB2A 3N2XA 2V5LA 1KLZA 3MYOA 4PL1A 2CLFA 1M7OA 1XC4A 3IVTA 4JS3A 3S6DA 3L66A 3NQ7A 3P5ZA 4FX6M 3ANYA 3LCXA 3GDKA 2CLIA 4OE7A 3NZ1A 3OVRA 3TUUA 3N73A 4FXSA 3FEMA 2NXIA 2QCDB 3QEZA 4JY9A 5KZDA 1GWJA 1HO4A 3KVMA 2GVLA 1F5ZA 4WUIA 3S1VA 1SO4A 2GQAA 4X2RA 3IVUA 1VYSX 1W3TA 3NQCA 4LOCA 1OX4A 5KZEA 5AHFA 1F6KA 3HG4A 5HWJA 3PSWA 4Z08A 1X6UA 3T40A 2CWNA 2ZTJA 3G1VA 1X1OA 4ONVA 2TSYA 3TX9A 1KM2A 4KFOA 4UIOA 2GOUA 3LXAA 4DELA 4CLMA 4RZ6A 1FBAA 3TAKA 1G7UA 4OHQA 3MP3A 3A21A 1WYIA 5K9XA 1RQEA 2PRHA 2XFWA 3Q94A 3VCRA 1H1YA 4OQVA 3CM4A 3LM7A 3TSDA 3EWXA 4IPIA 3A5FA 1R30A 3NM1A 4UFIA 2GUUA 2QJIA 1HTIA 2QCNA 4MKNA 4AWTA 1WAUA 3QJAA 1QPQA 2Q8ZA 1JRBA 1AG1O 3HG5A 3O16A 1C9DA 2ISVA 3UXDA 2NWSA 1Q6QA 1W3IA 5G2HA 3HGOA 2Q3RA 1SO3A 4RX0A 1JCLA 4Q32A 1IF2A 4HT3A 1IGSA 4N6FA 4AB4A 1XM3A 1G69A 3L2IA 4N2YA 3CWOX 1SFJA 1PL9A 4OV9A 3CEUA 4DPPA 2J6XA 1F7BA 3FKKA 2FPYA 4FNQA 3L9CA 4MYAA 3JRKA 4DO4A 4QJ1A 2QCGA 3O06A 4EVZA 3LOTA 3M41A 4CCCA 3DFPA 3MJYA 1EX5A 2ATMA 3GK0A 3BLFA 5U4NA 4S1FA 4JX5A 3DH7A 3IEBA 2WNNA 1GEQA 4YWIA 3STEA 4O1AA 3IRDA 1DKWA 2E09A 4IXHA 1NFBA 3H54A 1OFEA 3LV6A 1AW1A 2YXGA 2BWGA 5T26A 4UTJA 2FIQA 1O60A 4PTNA 3UZJA 3GDTA 1HL2A 1OFAA 4NUWA 4NT0A 1H7WA 3G3MA 3W22A 2I14A 1H62A 4Z1DA 4AMAA 1FQ0A 2DZWA 1ZALA 2FPTA 3BGJA 3IVSA 3EWZA 5C2XA 1YPIA 2Z6IA 1LRNA 3ABRA 3T78A 1N8FA 3TQKA 5A5WA 1FCUA 3W70A 1K3UA 3W2UA 4TR9A 2ABBA 3UY8A 5G4WA 1BTMA 2WSRA 2Y7DA 4MLJA 1LCOA 2FTPA 1KFBA 1GVRA 3YPIA 3I6RA 4CNOA 3LCIA 4AWUA 3WK1A 3NL3A 3HBLA 1Q45A 1XBYA 2W0UA 4HNTA 1OK4A 3KX6A 2CLOA 1M6JA 2BTMA 4H4IA 3QW4B 3BV4A 4LVAA 4Y6GA 2C3ZA 2X2GA 3H53A 3C2FA 3I7RA 4JIQA 4AAJA 4XUGA 4JDYA 1ZENA 4MZ1A 3A5VA 2G97A 2G96A 2PRMA 5IBXA 1VC4A 4RK8A 2A85A 4O28A 2ZA3A 3HIJA 4UR7A 4ALDA 4KFNA 5FF2A 1X1ZA 2ZRUA 4O52A 1H51A 4RLIA 3W7GA 3L0NA 3S42A 3EX3A 5CZJA 3KFTA 3ZWTA 3STFA 4FNPA 2DZSA 3SZ8A 3PUEA 4RCXA 1R2RA 3SSJA 1H61A 1WBJA 5C54A 3W1NA 1SZNA 1O5KA 5CSSA 3HPZA 1XFBA 5AHIA 1OF6A 1ADOA 3STGA 5J5RA 3EXSA 1UUMA 5AOUA 3L0GA 1VCFA 1GVFA 1XBXA 4QISA 3GNNA 4UR8A 1DOSA 4TX9A 2GJLA 2JK2A 1FCBA 1OG0A 2NX3A 3PUOA 1SW3A 1VH7A 3I7QA 2LLEA 4C1LA 4GNJA 4JTSA 3PAJA 3NPXA 4HNVA 1GJPA 2E6FA 3NZRA 4Y90A 2EGZA 4IMGA 5E1QA 1YLVA 1SSDA 4JD4A 2ZZ6A 1GVSA 2Y70A 2E77A 2A4AA 4FXRA 1UBSA 3W7CA 3INPA 5C6MA 3CT7A 3W83A 3MMTA 3PC0A 2XN1A 4CQAA 4PA8A 3HJZA 4H6KA 3W1LA 2E1DA 3PR2A 3NVTA 1GTHA 1VGAA 5L9FA 5EYWA 1LM1A 2QJGA 3WJXA 1NF0A 2Y89A 5CZ0A 3M9YA 3QMTA 4IQLA 4ZVJA 3TW6A 3P62A 3HMJG 1FX6A 1T0OA 3DFQA 3JR2A 1EP1A 1FWNA 3O07A 4A29A 2VELA 4DQWA 1ZAIA 1MEHA 1RPXA 5D37A 1QPOA 2I1OA 4K7YA 4MVAA 3O6DA 4LC6A 4LVGA 2R94A 3W76A 3Q37A 2V30A 3KHJA 1DBTA 5K7JA 3LB0A 4LUJA 2NUWA 3EEGA 4HPJA 3TA6A 3WK0A 4AVFA 1T8XA 1JCNA 2NV2A 4ZQRA 3O6YX 3FYPA 3MO7A 4WY0A 1SSGA 4OWGA 5D38A 2AAMA 1ME7A 1QAPA 5CZTA 1RZMA 1W5QA 5BMXA 5BOOA 1JCJA 3DHFA 3S1XA 1QPNA 2E5BA 2VEPA 4UMAA 2V81A 4RXGA 4KWWA 1UJPA 3P81A 1G7VA 4O4WA 2DZVA 3EXTA 2DZTA 3G1HA 3V1PA 3W7MA 4ICNA 1P0KA 1BWLA 4O0KA 3S8HA 1O95A 1L9WA 5CSRA 4K36A 5GVJA 2WV8A 5BMWA 1WQ5A 1EA0A 1R2SA 3E12A 5E93A 1EP2A 1Q6OA 3DGRA 3C2VA 2RDUA 4LV4A 1KW1A 3W73A 2GVGA 4ZL1A 4RZ5A 3LLDA 1LLWA 1XBVA 2V2HA 2WQPA 1AK5A 3RK8A 4K8EA 2ZZ4A 5I3HA 4ZQCA 5AC8A 5EKYA 1YTKA 3NXFA 1FWRA 4ADUA 4Q4KA 3EWUA 4ZQPA 1ICSA 1THFD 3C2RA 1WX0A 1NF7A 3MI6A 5L6UA 3UQNA 3C52A 5LNUA 3T4CA 2HMCA 3NL6A 1S5TA 4DPQA 4LC8A 4O16A 3W7RA 1W56A 5G5IA 3S1UA 1F05A 1GTEA 5SWUA 3WFAA 1Q6LA 3EWYA 1TRIA 4M6VA 3FKRA 5HNRA 1NVMA 3TDFA 3G1SA 3FS2A 2CFFA 4A22A 4XTDA 5J5DA 3MP4A 3LCHA 4FHAA 4JY8A 2ZCGA 1K7XA 2VFFA 4JTTA 1TSIA 2NX9A 4PC8A 4MY9A 4HIBA 1YXCA 4ML9A 6TIMA 1EIXA 2QDGA 1W1ZA 2QF7A 1D3HA 2ZFAA 5HR7A 2B7PA 3PBWA 1GG1A 3NQDA 3P74A 3VNDA 5FEZA 2J88A 2OZ0A 3PM6A 1YDVA 4BR1A 3W1PA 2OX1A 4W9TA 3PUDA 4UNKA 4JX4A 3PB0A 5AHNA 2ZRZA 1W3NA 2YYTA 4UC5A 2B4GA 3LX9A 2JKPA 4MY1A 1OX6A 3GB6A 1XDMA 1DVJA 2JKEA 5HULA 1FCQA 5CPLA 5DBTA 4KWVA 5C5YA 2RFGA 2GJNA 4A2SA 2F7FA 3EKZA 3MI3A 1OX5A 3N9RA 5C55A 3DKLA 2QCFA 1QNVA 3ZFHA 2WNQA 3LERA 4O17A 1I2QA 1WA3A 2Y85A 4UXDA 2H6RA 1ME9A 4M5PA 4DF1A 2YW4A 3NL5A 5F2IA 3UPWA 3PULA 5F1VA 2AGKA 3M5VA 5I3KA 1PHWA 1F76A 1TQJA 1VQTA 3C8FA 3IIZA 1TPDA 3ZS4A 3W1XA 4JDBA 3ELFA 2ZZ2A 3CPRA 4Q33A 1VYPX 3DXIA 1H7XA 2ISSA 2VXNA 4NZJA 4DF0A 3U6WA 3HGSA 4MLRA 2CLLA 1OJXA 4Y9AA 1LDCA 1SW0A 3ZR4A 3ABQA 5DY2A 1GYNA 5DLCA 3QC3A 3LTYA 1TJPA 3GLCA 3CIXA 3LRKA 5LKYA 1K8ZA 2B7OA 3W86A 5EL1A 3HGRA 1RVGA 3HO8A 3NQ6A 3N34A 2EF9A 4ZQNA 3GZ3A 3R5EA 3FJLA 2PE4A 5KINA 5IBXC 1QO2A 3AJXA 1UUOA 2NXGA 3KRUA 1GQNA 3TQ0A 3UNDA 1OFQA 3MBDA 2E6DA 4WJEA 3LHWA 2WSQA 1XUZA 4ZQMA 4AF0A 2A6NA 1ZNNA 3G1AA 2QAPA 1OK6A 4OBTA 1FUYA 1VCVA 3DFTA 1ICPA 2C18A 1T99A 4FX8A 4GUIA 4LRTA 3FLUA 3W9ZA 5CG7A 2H3DA 4L4LA 3R8RA 4UFKA 4FNRA 3TJXA 2YW3A 2G5WA 2H3BA 1GT8A 2QEZA 3GVGA 4E2DA 1KM6A 2GQ9A 2RH9A 5K4XA 1SUXA 2GQ8A 4O53A 1SQ7A 2J9ZA 3NNTA 3B05A 5AHEA 1R2TA 1ZJIA 3P67A 3USBA 1YTDA 3EX4A 1YDOA 2TMDA 1HUVA 2ZZ7A 3G0XA 3GR7A 4N9DA 4CQ8A 3UD6A 4FNUA 2YDAA 4HSOA 4TIMA 4JEQA 1H7RA 3L65A 3PF3A 2A7PA 4Z1CA 3R12A 2ZRXA 4U4MA 5HINA 5F2LA 2YYUA 3H55A 4O57A 4EWND 1LOQA 1G4EA 3BW2A 3PB2A 4BF9A 3M47A 1JRCA 5EY5A 4RXFA 4GBUA 4GC4A 3TC7A 4JGDA 5AYZA 4UMCA 4S2CA 3M43A 4ADSA 3W7NA 3UWQA 5D2WA 2J9YA 4WQ6A 1JUKA 4BFAA 4RKAA 5AYYA 1LBFA 3RFAA 5AHMA 3KAOA 3S0CA 2C1HA 2V82A 1FDZA 1RQHA 3EWWA 2A7RA 1SZFA 4RZ4A 4JXCA 1TPC1 5KTLA 1LRQA 3NM3A 3N2MA 2BSLA 1PHQA 4OU1A 3P8JA 3TR2A 1X7FA 3IIVA 1JR1A 1TRDA 1QOQA 1W0MA 1UB3A 2RDWA 3QF0A 4ZZ9A 2QCEA 1D9EA 3DAQA 5DN1A 3HF3A 2ZZ1A 2X30A 4NZFA 1G4TA 2ZA2A 3SW6A 4UTIA 4NXSA 2O7QA 4YMZA 5FEWA 4R7JA 1KBJA 1R46A 2ZDRA 4K39A 4IPJA 2NUYA 3UXAA 4TO8A 4O8RA 3GYEA 2CZDA 1XL9A 1I4NA 1WOAA 1EWDA 2CLMA 3PVFA 4CNPA 3I65A 4RJEA 3NR0A 3QZEA 3LCGA 4CCDA 3CQ0A 3NQEA 1M5WA 5KMYA 3OHIA 2A21A 2ZQ0A 1LLZA 1H7PA 4FF7A 3W7EA 5AHLA 3UWWA 3LHYA 4EF8A 1I8JA 2F84A 2QCHA 2VOMA 2ATSA 4QITA 5F4XA 1EUNA 3QQ0A 1VHCA 1H7OA 1K7EA 4U28A 2NZLA 4JICA 3NPVA 4E2BA 4PODA 2XN0A 1S3HA 3DI1A 4JN6A 1W5MA 5CZSA 3GKFA 1TTPA 3CWNA 3LCWA 3GXTA 1P4CA 4WY0B 4JTJA 1ICQA 5LNVA 4GWEA 1XDLA 4RR4A 1GG0A 4K8HA 5D32A 4LV9A 2Z1BA 3TE9A 1JULA 3M7WA 5I3JA 1LROA 3BG3A 3SECA 2J24A 3BVJA
chains in the Genus database with same CATH superfamily
4Q8WA 3CEPA 1PDZA 2IQTA 4QS5A 1GW9A 5KZ6A 5IXEA 5K9DA 1AD1A 3E9AA 3MMUA 3MWAA 3BO9A 1OADA 1K8XA 3IRSA 3E0IA 4ICMA 3W7DA 2QDHA 5A95A 2OLHA 3LGEA 4JTGA 4PTVA 3W1AA 1S2UA 1DORA 5F4WA 4PUKA 3W7IA 1A5KC 2XVNA 4LU0A 5TF0A 3ZZ1A 2R1MA 3D47A 1BXBA 3GO2A 1KA9F 5I24A 4DM1A 2A6LA 1P0NA 2WZIA 1S46A 2AOSA 4NAEA 4H9TA 3EXRA 3FDGA 2ZA1A 4W5ZA 1X6LA 4PUMA 4H9XA 3HMCA 4EX4A 2F2HA 1EQCA 2BLEA 1PPIA 2VC7A 1E6NA 1ZAJA 2NQLA 4ZOCA 5A6TC 1RUSA 4GGBA 1IIGA 2BGQA 3LHUA 3AHZA 1F4AA 2VR4A 1SYTA 1XFCA 1S5NA 3NQVA 3ARYA 3TJLA 4DBDA 5CGTA 4AEEA 5CPTA 1OGSA 2AMXA 3VIMA 2FJKA 2FPVA 4M24A 2ACSA 4OKDA 2E7FA 2Z1WA 1VKFA 2VEMA 3W7KA 1E5NA 1VJIA 1KBKA 2YCJA 4DUOA 2PWUA 3NQAA 3FAXA 2CKRA 1QDSA 4CEUC 3L2MA 1JFXA 4KKXA 1PBGA 3GKAA 4O1FA 1M7PA 4X9YA 3S2LA 3BW3A 4JIPA 2V68A 1DJNA 3W72A 5HUOA 1H41A 4S38A 1TCDA 1M9HA 1BGGA 3B9EA 1K6AA 3OLGA 4BI6A 3EPOA 1Q7MA 2DT1A 3M07A 4EXAA 3R25A 2D1ZA 1MW0A 1F6PA 3D3FA 5EMLA 3PZGA 4V28A 3F1QA 3HU7A 1E40A 3EX2A 2DT0A 1NFGA 5A1AA 5FF7A 1B1YA 4O0ZA 1OD8A 4B3ZA 2WZHA 2FZ8A 3MBFA 1LUCA 1GGOA 1JCMP 4Q8TA 3O3RA 2A3AA 1OYBA 6A3HA 2CZ5A 3WL0A 3PSVA 4MB1A 2DPEA 2O9OA 3VFLA 5D9PA 5GJMA 2GOKA 3APGA 1TPFA 3O6CA 4NJHA 2XZ9A 2VQUA 3R4IA 5IDIA 3GAYA 1VP5A 2XVGA 3TCEA 3W1TA 4AF0B 3KOYA 2NSOA 3NAVA 4LS1A 4ZTYA 3URNA 3VKKA 2HXTA 3C3NA 3MPGA 4ERGA 8A3HA 2XYLA 3UWZA 3N25A 1KFKA 1GQLA 3NIYA 1DJZA 3L4WA 3WBYA 1E1CB 2Q3OA 4Z1BA 1QR7A 4IZGA 1IYXA 2G3MA 3WF0A 2Y2WA 3O15A 2PODA 3OZYA 4F2BA 3K1GA 3GC2A 4PEKA 4IFKB 2Y62A 1UR2A 1TV4A 3CIWA 4U5KA 1CXFA 2VHLA 3CUZA 1XLDA 1QOXA 3SUTA 1E5JA 3BTNA 4NQ1A 3LPOA 1ZL1A 1A5SA 4IGSA 3M0JA 4DJDA 1P7TA 3NCOA 1W9VA 3LRLA 4FI4A 1OYCA 3AIVA 3FOKA 3URAA 3RLVA 3A9IA 2AL2B 1G94A 1E4MM 2AQWA 1POJA 4YJ5A 4HP5A 3GDMA 4A6GA 2Y8KA 5HMSA 4LEQA 4KCUA 1G67A 1F4HA 1YADA 4BWLA 2YR1A 5C2GA 4XO7A 3H23A 1MYRA 3TAOA 2GGHA 1JAEA 3QOKA 1K1DA 1I45A 2DV0A 2HCVA 1WXYA 3TMQA 1MQRA 4QFUA 4M7TA 3M1ZA 1DIDA 4HB7A 3LTPA 4JFVA 2VUYA 3LBCA 1OD0A 1N82A 2WSKA 6PTDA 4GINA 2V2CA 1Z6KA 1E1EA 1VZWA 3N3MA 2VQTA 4ZGYA 5F2GA 5F2MA 1M41A 5BROA 1D7FA 2QMJA 1EHNA 3REQA 1CW2A 2C13A 4AY1A 2RDTA 3O0KA 2QCLA 5HNNA 3QLDA 5BRBA 3G22A 1KTNA 1TR9A 3MA8A 1CXHA 4DM2A 3BARA 1XLIA 2V9DA 5EFFA 1OFPA 2FYMA 1A50A 3PG8A 4FA3A 3WJZA 3P61A 3DOPA 1W1TA 1AA1B 4HNUA 4PBGA 2NVCA 3W6MA 1JPDX 1TKKA 4CNNA 2DZUA 4UFMA 9XIMA 3PWAA 1SR9A 2UBPC 1L0PA 4UNIA 2BODX 3T0TA 2O7SA 1VFMA 2ABAA 2PDIA 3T1GA 3GNOA 1FDJA 4GIEA 2DP3A 1EHAA 3AS0A 3UJSA 4PTXA 3N17A 4D6CA 4F40A 3C2EA 1DWAM 5D2TA 3DFNA 3AALA 3MCMA 3IIPA 4UTFA 2JF7A 3BH4A 3KVKA 4UZUA 4WIWA 3CWHA 4ZMGA 1JL8A 2J8FA 1M7JA 4ZB2A 4JIEA 1RD5A 3L0KA 2OOFA 2GSEA 1RCQA 3WX7A 3N18A 3MYPA 3XISA 1FXQA 4TV5A 3WQ6A 3BLEA 2CW6A 2XN2A 3W2LA 4MSSA 1FWSA 4AHPA 3MW7A 3K4DA 2AL1A 4XKYB 1W8SA 3QR3A 4R3UA 3PJUA 1MQPA 2QGHA 3BGAA 4MNKA 1R5YA 5D02A 4IP7A 3V1HA 1WOBA 3DG3A 1Q7QA 1WXZA 2DT2A 4GVHA 5AYXA 2PPGA 4MNJA 3L4ZA 1XCXA 3RRAA 1GVOA 3GM8A 1UD4A 3GU9A 2OKOA 1C8VA 3W2MA 3G0SA 1ZBVA 4UWMA 1GKPA 3A4WA 2Z2AA 5EB8A 2GPTA 2D73A 4S2BA 1OEPA 4TOQA 4B5NA 3W85A 4QE5A 2V3DA 4LY8A 3CUIA 1DJYA 3DU0A 4GQBA 3QGVA 4IQEA 1G0CA 3N14A 3ID7A 4YHGA 2X0YA 3HPXA 4GX8A 3WEMA 3DI0A 3KHDA 5B80A 2GDUA 1YXYA 3DC0A 4B9ZA 1ML1A 2CC0A 5J04A 1ZQ5A 4ROPA 1MMFA 3P2VA 1E3ZA 2A3BA 1CBGA 1AJZA 1XI3A 2VZUA 2QCDA 4NI8A 1A80A 4GYJA 3GDRA 1O66A 4O8AA 2FHFA 1RV8A 1VR6A 4UTLA 1QI4A 4M6QA 3M0MA 4Q7NA 4HSNA 2G3NA 3BZJA 2VX7A 2HSAA 4PTWA 4UTMA 2QHAA 3FX4A 4MJ4A 2EAWA 3PPHA 1UP2A 1TV8A 3CV2A 4K7VA 3CIVA 3BSHA 1Y0EA 4ATWA 1I2NA 1VD6A 4HYVA 1TZ7A 2UV8G 4JNMA 2QUVA 4KCVA 4UB9A 2D24A 3LMYA 3IS4A 4XIMA 4UQBA 1C3FA 4YTUA 4JL1A 2P10A 2V3GA 4AU0A 1Y65A 2E6AA 3KBJA 2ALDA 3OEXA 1Q5MA 3A4JA 3TOPA 4B3KA 5HMFA 4L9ZA 2PWDA 2NQHA 1B90A 2BGNE 4GNKB 1W3KA 3HV8A 3TNOA 2EJAA 3W7HA 4H9ZA 4H8HA 3W88A 3THAA 2Y63A 5KSWA 2WC4A 4DJDC 5LGXA 2W27A 3WLIA 4GKTA 3N4EA 1A4MA 2E5CA 1A5BA 3HM7A 1E9YB 5H91A 3R11A 3MUXA 3U2CA 5CSUA 4C6LA 1DV7A 5DELA 1BAGA 1NH6A 2PI6A 4JFTA 2XUCA 4NSBA 4IGHA 2Y7GA 4XKMA 2VFIA 2QIWA 1AMKA 4BWLC 1EOKA 3W3OA 4JN7A 1XC6A 3G2GA 3CYJA 2YKKA 4Y9NA 1RHCA 3R0UA 2PBGA 3VFCA 1WBHA 3UXLA 3B9NA 4IMDA 3UGRA 4H19A 3WQFA 3SUSA 5A69A 3PZVA 4XO6A 3R2GA 3EEZA 5D05A 1J8VA 5G4EA 3MHGA 4Z1AA 1LG1A 5D8WA 2RGMA 1OZQA 1U1UA 4MWAD 4DF2A 3SGZA 4D1IA 2C6QA 3DFOA 4QJ4B 1E73M 1KM3A 3VXGA 4JIHA 3FA4A 3MANA 4FEZA 1SZGA 5BYWA 5ABHA 4CQCA 4HK6A 1XGZA 3QGKC 4OTKA 3SCVA 1HJUA 3RCMA 1HVQA 4EPEC 4A8LA 4HD5A 4GUGA 3ENLA 2ZICA 2G4JA 3NZQA 1TIMA 3IAQA 2P53A 3AU2A 4F9DA 3HOJA 3UWYA 3H12A 4QG6A 1CLXA 3RUBL 1HX0A 1SO6A 2XISA 2Y7EA 5FJIA 2INFA 5TAOA 4WD0A 4IMCA 1H0GA 4WXYA 4IJBA 1W9PA 2ZE0A 3R79A 3QBUA 2YL6A 3UG8A 2DSVA 2QR6A 2X8RA 1BYAA 4NX0A 1B9ZA 4XWUA 3W37A 4W93A 2OO6A 1BEUA 3MMDA 3MVIA 1VBUA 1YDNA 1ADDA 4PBEA 4AZ5A 4M82A 2I9EA 4G5DA 3WBWA 2PRLA 1CI1A 2QUNA 4UQ9A 5D30A 3VA8A 1A5AA 3WQPA 1EO7A 3V18A 2DSKA 1Q6FA 1M01A 4EOUA 4MIMA 1FWDC 2FGZA 4PUNA 2GSHA 1KRMA 2PZ0A 1LJYA 5HWMA 3EDEA 5BRQA 3TROA 1D8CA 1OF8A 1KBLA 2VEIA 6XIMA 1JDFA 1UOZA 1J2BA 1ONRA 3FSUA 4P8UA 3POCA 3IJ6A 4DLFA 1V6TA 4P5UA 5DCBA 1Z42A 1GPFA 4JTAA 1XH2A 1Z32X 4V15A 2HVNA 5GNZA 4UFJA 3O2LA 4ERIA 4QDMA 1LT8A 1TREA 3QRHA 1AFSA 1J11A 1K9DA 3KS5A 1EL3A 2YFNA 4RNHA 4H2CA 1V6VA 3AAMA 2OKTA 1V3IA 4CD7A 5ABFA 4HMNA 3PFRA 2CEQA 1V6UA 2GUBA 1L6GA 4U3AA 2Z25A 5HA7A 3NYZA 3N6JA 1HG3A 1KO0A 3BUVA 4QSFA 2J6VA 1L6WA 1CGUA 1KM0A 4I9TA 2A7NA 1XLJA 1VBHA 2QULA 1GVEA 2VFGA 4UCGA 4MUZA 1TWSA 2D3NA 3IGXA 3NA8A 2HNEA 4M19A 3CK5A 3VVGA 3NGFA 1CGWA 2VL4A 1TCMA 5BXRA 2VR2A 1TPEA 3H24A 1CWYA 3KZSA 4NJJA 3HV9A 3T8QA 3EOEA 3W7QA 1DQXA 3MUAA 5C7VA 4KIEA 2HE5A 3B9AA 1EZ2A 3WK2A 3HJEA 4XIAA 3LG3A 1GZ1A 4GH1A 3MYOA 4PL1A 2IMRA 3B8WA 1HP4A 3CHDA 3FAWA 4FX6M 4ECLA 3LNPA 3A64A 1MUMA 1XLLA 4G1NA 1E43A 4PMNA 1JI1A 5JBFA 3L2LA 5GJNA 3PTQA 4GCXA 1AJ2A 4JBRA 3KL0A 4L6HA 4PMQA 3SCPA 1NWSA 4MKSA 2YIHA 1ELSA 1WP6A 5I09A 1OX4A 2PEVA 3HG4A 2GGEA 3FK4A 5HWJA 3GVQA 1E4NA 1OT2A 4Z08A 3T40A 1ONWA 4LJ3A 4ILSA 1BYBA 1X1OA 3B8IA 3XIMA 3KBSA 4KFOA 4UIOA 1VEMA 4KRUA 3TAKA 3G1RA 3IWPA 4MB5A 2FKPA 3MP3A 2CBVA 1V0NA 3GW3A 5K9XA 3Q94A 5C9ZA 4AX7A 3LY0A 1A0EA 3PZMA 4KH2A 1H49A 3NM1A 1UWAA 2GUUA 2PDWA 3SCSA 4YU1A 1NDYA 2QCNA 5DEZA 1B3YA 1W2VA 3OU8A 2E0PA 1XIJA 1Q6QA 3HGOA 4RX0A 5BXPA 1JCLA 1FWBC 1IF2A 3PZUA 3IARA 5DFAA 4N6FA 1I0BA 4AB4A 3L2IA 4N2YA 4V2XA 4HPHA 2J6XA 1F7BA 2DVTA 3L9CA 4Q4SA 2W62A 2VEFA 1ISZA 1X6NA 1XYMA 3T2PA 4EVZA 2WCAA 5CC5A 3F5KA 1IZJA 3MJYA 4C65A 2V5CA 3GK0A 3DCPA 4PEEA 2Y5SA 1DIOA 3UYIA 3ZLHA 3VIGA 2CBJA 1WKFA 4S1FA 5U4NA 2FHCA 3DH7A 4B16A 2XH4A 1B31A 4B92A 3STEA 4GLEA 5HQLA 3BAIA 4IXHA 3CL6A 5LA1A 1CB2A 3LV6A 5FL1A 1QU4A 1NU5A 1O60A 1OGGA 2F6KA 4PTNA 4AWEA 3UZJA 2XH7A 4J7RA 4NT0A 3SBFA 4B5XA 2I14A 2CZVA 2AQVA 4DJED 4CD5A 3KEHA 3IVSA 5C2XA 3GNPA 3UG3A 4FXJA 2EG7A 2DZBA 1N8FA 1FCUA 3W2UA 4BZYA 2D22A 3UY8A 1BTMA 1XCWA 2VZOA 4MLJA 2Q01A 4PMOA 4X2PA 3JW7A 4CU7A 2FTPA 4HOWA 3OPSA 1KFBA 2EQDA 3WG6A 4Y9MA 4DZAA 4CNOA 3LCIA 4Q6JA 1VBGA 2W0UA 1OK4A 5D9MA 1XS2A 3KX6A 3TTYA 3S46A 2CLOA 5AC4A 4PMZA 3GRIA 2GL5A 1E0TA 4TX8A 1KCZA 4P8VA 1V6XA 3I7RA 4GXPA 4DZIA 4AY8A 4RK8A 2ZA3A 5E70A 3HIJA 2GVEA 2YLLA 4KT2A 1X1ZA 2ZRUA 4O52A 4H9UA 3EX3A 1M53A 3ZWTA 4FNPA 4JFWA 4I3GA 4NF7A 4WKFA 1NIUA 1WDSA 5C54A 3W1NA 1SZNA 1O5KA 1SR0A 2R82A 4C91A 1GQKA 1XFBA 5AHIA 4DRSA 3STGA 3EXSA 1ISXA 4EXQA 3GNNA 2YXXA 3IV8A 3V16A 1VIWA 3IJ9A 1WDRA 1EZWA 3NSXA 1UWIA 3A12A 1MQQA 1BQGA 2F2KA 4DJEA 2X7WA 3GXIA 4W7VA 4HNVA 2ZWYA 1BKHA 3EWDA 1EJSC 4H00A 3QY7A 4F0SA 4JD4A 2FGLA 3WLPA 1U1JA 2E77A 2A4AA 3UFYA 4FXRA 3GG7A 3FW6A 1UROA 3ZM8A 2ONEA 3MMTA 3PC0A 2BVDA 2XN1A 5FJUA 4ZXOA 2BBFA 2OGJA 5EYWA 1Q4WA 3WJXA 4FP1A 2SFPA 1F3TA 2CETA 1PKLA 3E38A 2EPOA 3QMTA 4IQLA 3QVQA 1I9CB 2WAGA 1EP1A 1FWNA 2XVLA 4A3RA 5D37A 4P7NA 3O6DA 4JCMA 5T9BG 3S2MA 3OW1A 3W76A 3EZ4A 2WBKA 3KHJA 4I5UA 2NQZA 4HPJA 2ACQA 2C79A 5I06A 1T8XA 5JQ9A 3E5BA 2NV2A 2PDMA 2VCCA 3FYPA 3M0LA 2BVWA 2VDGA 2Z26A 2RAGA 3TN6A 1KKRA 5HQMA 1QAPA 5CZTA 1W5QA 5BMXA 4Q8PA 3DHFA 1QPNA 2VEPA 1TZ9A 3I3EA 4O4WA 2DZVA 4Z2LA 3EXTA 3V1PA 1P0KA 4O0KA 4CCZA 3QPEA 2IPGA 5E0FA 1UKOA 4TV6A 2OQYA 5BMWA 3S3GA 5DT7A 4E4FA 3F4DA 4GCAA 4KWOA 3XINA 5CAHA 1EP2A 1YRRA 3ZSTA 4RE2A 4HOXA 2AGTA 3DGRA 2RDUA 3CO4A 1VJSA 1J18A 4ZL1A 4HJFA 4RZ5A 1LLWA 2NVAA 3RK8A 3A4AA 4K8EA 4DAIA 3AHXA 1K9EA 4QRNA 1XYBA 1VBJA 4FLQA 5EKYA 1YTKA 3NXFA 2RJGA 1FWRA 4ADUA 4C6EA 2GLKA 3AC0A 1IZKA 1JDCA 4C6FA 1U33A 3WSUA 1RAKA 1CNVA 4J5NA 5G5IA 1ZRQA 3S1UA 4LFYA 1Z3NA 4H9YA 5EBAA 2O9RA 5SWUA 2BOGX 1T40A 4PMVA 4F9JA 2WK2A 3ONCA 5HNRA 3BL3A 3RX2A 3G1SA 3RU8X 4X0VA 4JY8A 1NELA 4JTTA 4HIBA 1R3TA 4ML9A 1EIXA 4AD4A 2ZFAA 5HR7A 2B7PA 3ZLFA 1GG1A 3VNDA 1UA3A 1NY1A 1RPKA 1AUSL 4ES4A 1ENUA 4GMEA 2NVDA 6XIAA 4ZSUA 3AWOA 2B4GA 3LX9A 2JKPA 2HISA 4MY1A 1OX6A 1L8PA 2JKEA 1DVJA 1AQHA 1FCQA 5CPLA 5C5YA 2RFGA 2GJNA 4YVXA 2ZWZA 1BF6A 4GG9A 2F7FA 4ZFMA 1OX5A 2IXVA 3MKVA 3CH0A 2HK0A 2QCFA 1QNVA 3CYVA 2XZ7A 2WNQA 3LERA 4O17A 2Y85A 3KP1A 2H6RA 2WLYA 3PP7A 4Z2GA 1OCBA 3IIZA 5A8QA 3I4EA 5GPRA 1TPDA 4JDBA 2ZZ2A 1V0LA 1GW1A 1VYPX 4GXWA 3SY1A 4KWUA 4DF0A 4R7WA 3ARRA 2E67A 1H5VA 2CLLA 4LUYA 2OYKA 1EF2A 2FTYA 1GYNA 3LQLA 3GLCA 4JIIX 1WNOA 3CASA 1NDVA 1RVGA 1R3YA 3NQ6A 4I5RA 3GZ3A 1C9WA 3PZNA 1QJWA 2PE4A 3AJXA 1UUOA 1UWUA 2OSWA 1GQNA 3MBDA 3ARSA 1NQKA 3OP2A 4AF0A 3B3DA 4UOJA 3KL3A 3QQWA 5CSYA 4ZA0A 1FUYA 4ACZB 2REQB 3IK4A 3SURA 3VNJA 2BP1A 3FLUA 3S83A 4Q8UA 3W38A 2H3DA 1DWJM 4IP5A 3BAKA 3TJXA 1ZU8A 1FH8A 1E1CA 2G5WA 1S2WA 2QEZA 3MY9A 2HRWA 2PLKA 3GVGA 4XZBA 4E2DA 1KM6A 3USZA 1JIBA 2NQ5A 1XIDA 4O53A 1IWBA 3GSMA 2HBXA 1SQ7A 4V1YA 5JXQA 2OGYA 2R1KA 3B05A 1EFZA 1VPYA 3USBA 1JFHA 2VEGA 2TMDA 4HPNA 3GR7A 1DP0A 4L9XA 5CPQA 3VOCA 4JEQA 4MADA 3OQ8A 2A7PA 4WKHA 4DWSD 4C7GA 3ZYZA 3MWCA 2YYUA 3I3BA 2Z1VA 5KEZA 4YVVA 2WHLA 2XINA 3OZPA 4HZ8A 2AL2A 4GFIA 3VD9A 3E3HA 1JG9A 1S5MA 5A2BA 4MG4A 3QHNA 3URBA 3WUFA 3VC5A 4F48A 4S2CA 3M43A 4ADSA 4S3BA 3CHEA 1JUKA 3HFYA 3KAOA 2A7RA 1F8MA 3ZJKA 2W4XA 3A3WA 4E8CA 3CHCA 1TPC1 1OCNA 2PFHA 2Z24A 3EYPA 1CGTA 4OU1A 4F3HA 3WDIA 3Q4DA 1TRDA 1UB3A 2RDWA 4HNLA 2QCEA 4CNUA 5DN1A 1BXCA 1G4TA 3AMKA 4HVXA 3MMWA 4NXSA 4YMZA 3AQUA 4IFRA 1VFFA 1NP2A 2BG5A 4LCRA 4K39A 2CERA 4MAVA 3UXAA 2GDQA 4EACA 1XG3A 5A8OA 3S47A 4ZOAA 3ONBA 3LCGA 3CQ0A 4X0NA 1M5WA 5KMYA 1PYMA 4Q8QA 1E6PA 1TZZA 4FF7A 3W7EA 3W4RA 2PTZA 4EF8A 1NOUA 4XSMA 2VOMA 1EJRC 3QC0A 3V5CA 4QITA 3SCQA 4ZENA 4FS9A 2O4QA 4GIYA 1RY8A 2WW5A 3FN9A 4MJ2A 4E2BA 1IT8A 1YEYA 4L64A 4PODA 5LXXA 1S3HA 5CZSA 4G7EB 3C0QA 1GOIA 3A4XA 1J0YA 1R3WA 5LNVA 3OODA 4RR4A 1H1NA 2Z1KA 1V6YA 2CNCA 3FY1A 4K8HA 1CB7B 3SRFA 4LV9A 4UR9A 2Z1BA 2J25A 3M7WA 4D6HA 1KRBC 7PTDA 3CQHA 2QW5A 3QSRA 2O9PA 4OV4A 1UWQA 3W7OA 1KGWA 3F4WA 2OEMA 1YE6A 2D0FA 4MWAE 4KF1A 3SFWA 4HCLA 1OHLA 3AFBA 1SPQA 3W1QA 2V63A 2E5DA 4XTIA 1PIFA 2FQIA 1X7IA 3PWIA 1S1RA 4K1WA 2VEKA 4JR5A 3G5EA 4TQTA 4XKYA 3ZR5A 3T6CA 1C29A 2A3CA 3WQ5A 5GNYA 3UZXA 5FF3A 2NWRA 4NNAA 5CAKA 4LS2A 1SFLA 4O54A 3S2CA 4FX7A 1PVNA 3NEVA 3M5XA 4BI7A 5I02A 3EAUA 3EA1A 2YBUA 1R85A 3E1F1 1VAHA 4EE9A 2YPIA 2GJRA 4QX4A 2FH6A 4CCEA 5M5DA 1FWAC 4HHPA 5BW6A 1E4LA 3WH9A 4GIRA 4NRSA 4LS0A 5BCAA 3BG9A 5FACA 2YDRA 1FKXA 1LP6A 1ECQA 1GK8A 1TG7A 2INEA 1N55A 3MO4A 3KLLA 2FVLA 1MUCA 1Q7ZA 2BASA 1R3RA 3ATZA 4EK7A 4GJJA 3KUMA 3G3DA 4LGXA 1ADSA 1YXDA 3CGTA 3N4FA 1W3JA 3LENA 3W71A 1E6XM 4R9OA 3H21A 3POHA 2R8WA 1VFUA 4GHRA 3W27A 5FOOA 4PZVA 3TMLA 9RUBA 1LG2A 4YTQA 1H1ZA 2HXUA 1HF6A 1XIEA 2VOTA 3GG0A 4PB5A 1K02A 3QPYA 3VE7A 1GOWA 2V8ZA 2HROA 2H90A 3PBYA 1SMDA 5BNKA 1UQZA 1HFBA 1O1HA 1RY0A 3DYOA 4LY4A 2GUYA 2VTFA 4ZBCA 2J9XA 3R6IA 1DWIM 1LLOA 1LRTA 1B3ZA 4CQDA 1L2UA 1BVZA 2ZUWA 4GISA 4HN8A 3B9DA 3TXVA 4WOZA 1B57A 3VTRA 2PDNA 3TWAA 3ITLA 1I75A 3SDOA 5D04C 2C0AA 2HTMA 4GI4A 4YYCA 3LA4A 4KEUA 3QFEA 4A4AA 3N9SA 2OODA 4FIQA 4YXGA 2QF8A 1QOPA 3P0WA 1ZBWA 4H41A 1EDQA 1ZAHA 2Z6JA 1PKNA 1DHPA 3PZOA 1W91A 3F7JA 3TU9A 4TUFA 3SR7A 2PTDA 4LUIA 5EMJA 2Y61A 3C2YA 1DQWA 1PJ9A 4DYJA 3KDOA 1M04A 1W3HA 3FHQA 3RGTA 4G9PA 4R34A 4AD1A 1JNEA 3LXCA 5G4HC 1UKPA 3KBWA 4Q8MA 3WMBA 1GVQA 2PF8A 3MSRA 2ALRA 5AB3A 4RV8A 3H4GA 3UYCA 1OINA 1U30A 5I6SA 4ICCX 4FB7A 2HQAA 1UMLA 4IICA 1B4KA 3LXBA 4FO4A 4W84A 3UG5A 5FA5A 4WSJA 3LK6A 3EBVA 1SJAA 1Q3NA 3MSDA 3QXBA 2C14A 3UJFA 3F4NA 1I0DA 1XQLA 3EMCA 2PZNA 3R8GA 1E0XA 3NO1A 4KBXA 3E2QA 1UIOA 1TB3A 5LGZA 1JDEA 1JUEA 1TPWA 4DXXA 1R0MA 3ZIZA 4CNSA 5JIWA 3ZT6A 1B54A 3TN4A 4G8TA 3SO7A 4N0RA 3QHMA 3RN6A 5AC7A 4KMQA 1QNRA 4I9AA 3M0ZA 1XRSA 3TC6A 1UJQA 3ZMRA 2JBMA 3C6CA 1R3QA 4H9MA 1ZCOA 1YHTA 3P8IA 1TMHA 3CTTA 1O6IA 3KWSA 4KPLA 4HNNA 3AI0A 1GOOA 1JPKA 3K4WA 3H2CA 5AFDA 3P84A 2VRKA 5CPSA 2V0TA 1SW7A 2WCSA 3UCCA 4CN1A 4YCOA 1R6WA 4L5ZA 4AD2A 1KM5A 3OVQA 4HNCA 2OPJA 1AJ0A 3WENA 2QLYA 4P7RA 2DORA 2HVOA 4C1KA 3EMZA 3U48A 3MTWA 2OZ3A 3WELA 1E72M 1RCXB 4C6IA 1BWKA 3W07A 4Z1YA 2OCZA 4EIVA 3PBVA 2XHYA 2EJ1A 1A53A 4NZ3A 4UNLA 1J6PA 4JX6A 5I78A 3B0PA 5A2CA 1IXQA 3GX9A 4LVFA 2Q8LA 5CBBA 1GZJA 5I5RA 1UPPA 2X1IA 3RLHA 3F4CA 2FH8A 2YX0A 3D0CA 1Q6CA 3HN3A 1I1WA 2RHGA 4CQBA 1LWJA 4JTKA 4EWJA 1VS1A 3U2EA 3G6MA 2JIWA 3AUJA 4J4KA 2KAUC 2CLKA 3G1XA 4NP7A 1X38A 1XYZA 1MO0A 4C6CA 3T8LA 1R3VA 5F1UA 2CBIA 4A21A 1ZFJA 5CJNA 2PD9A 3KRZA 3TYEA 1BSLA 3RLGA 3QQ1A 5EPDA 1V08A 1X97A 4GQQA 1P6BA 2JQXA 1VFSA 4QEEA 3V5OA 4Z2HA 2KZHA 3SN0A 1J5TA 1J96A 4GYPC 4N9CA 1UQYA 5ECVA 4C7FA 4IMEA 3SJNA 2WPBA 4NI3A 5XINA 3L4UA 5MKGA 3UZ5A 1QASA 4LPCA 1FFQA 3VOFA 4X22A 3P7YA 1G01A 4X9SA 2OWWA 3ZWSA 1B2YA 4CVUA 2A3EA 2YOCA 2ZRVA 3WDQA 3QW3A 1GORA 1DTUA 4O50A 4W8BA 3RJYA 3K8MA 3OA3A 4O14A 1FHDA 3AOFA 1KR1A 2WANA 1K8CA 3NDYA 3PPCA 3Q58A 1YIXA 4QAIA 2AKMA 1XLEA 3CAWA 4BS0A 2UWFA 4U3CA 2EG6A 3IACA 1YPFA 4JZ5A 5I77A 3N15A 3DHDA 1WV2A 1GQJA 2Q8XA 1TVNA 1BYDA 2Y88A 3V3WA 1XGDA 4US5D 2YCIX 2H9AB 1C91A 2Z27A 3VOGA 3PY2A 1G4SA 3WFZA 5FAJA 4R53A 2ZTKA 4BEQA 2QVNA 4WJ8A 4OJYA 1H09A 1Q6RA 2OZTA 3TTSA 2A1YA 3S9IA 2A2IA 3ITYA 3VGEA 3SJ3A 3TQPA 3U9IA 3IK2A 2X0SA 1KV5A 3UGVA 3O63A 4MB4A 1SO5A 2PP3A 2WMFA 1ZJBA 4QQ3A 4CD6A 3DN5A 4QNEA 1RCOB 4AUBA 3ABOA 1PDYA 3IJLA 4Q8VA 5BZAA 3RITA 3LYEA 3SFKA 2BY2A 5ABTA 1BLIA 4GXMA 1PSCA 3SUVA 5FEXA 1TFVA 3R58A 4ERAA 1QCWA 2QCCA 2YSWA 2YL9A 1A4LA 1Z44A 1E71M 4LF1A 4PFHA 4E4UA 3SGUA 4KW2A 4MM1A 1H50A 1LQ0A 5G1YA 2Q09A 4W89A 3VGGA 3G1DA 4URIA 5K4ZA 3UXIA 1FWTA 3LBMA 1EH9A 2C71A 3VIIA 3CUFA 2J27A 4PRTA 1GYLA 1ZCCA 1G9HA 2DVXA 3K4AA 4LNYA 4MNMA 4US5A 4IX2A 3M6YA 4I90A 3TH6A 1V79A 1K03A 1OT1A 2XH0A 3N29A 3WQOA 2OMAA 2A0NA 3BLPX 3UPBA 3AHTA 1UZ1A 1OB0A 4HQVA 3L5AA 4XZ9A 3NQBA 4QJ5B 5LHEA 3C4UA 1MW1A 1QO5A 3ABZA 2J7BA 3QMSA 3CV7A 4J40A 5LNWA 2GWNA 2ZUVA 2IPFA 1OFOA 1QI3A 3DHPA 1IEVA 1U5JA 3BMWA 3W81A 1OCQA 5LHFA 2BY3A 4FR6A 3SI9A 1E51A 7ODCA 2E25A 4O1BA 4D6DA 4RE0A 3MDUA 1W2PA 2GK1B 4Y9OA 4PB4A 1UR1A 1KXQA 3NTYA 3VILA 4MWAB 3LHZA 3WL1A 2R24A 1E1FA 2PGWA 2ZX7A 5CGMA 2ISWA 3UERA 1HQTA 2CHRA 2R6OA 3NQFA 2YDSA 1KBBA 3VYLA 4A8NA 4UTTA 2OT0A 1T6MA 3RPMA 3VU2A 3PNZA 1MNSA 3ITGA 2OXNA 1JXJA 4ZOBA 3KOZA 1XPYA 1CLVA 1OFBA 2R1PA 4J2PA 1KTBA 4D6IA 3QKEA 1DWFM 1TE6A 3IIOA 3V36A 2B31A 2F38A 4LEFA 1T8QA 3VZYA 3RYSA 4MGGA 1S5VA 2WVSA 4Y8EA 5D9OA 4POCA 3T42A 2Z7KA 4J3ZA 3NOEA 1AODA 3PFMA 2C8NA 3TFCA 2W5FA 3HQPA 4GGHA 4PULA 1FWIC 4AHQA 2DIKA 3BDKA 4B5SA 4EF9A 3MV11 1KTCA 1OYAA 1VPQA 1Q2RA 3R0KA 1H5YA 4QHRA 3CPGA 2WMKA 1XLCA 4EAYA 1LOSA 1AL7A 1FWFC 3M6DA 4A8IA 3RRXA 1T5AA 2WSYA 4MZ8A 1TVLA 4XBSA 5EA9A 2V6AA 5GNXA 3GR8A 4GI9A 1F3XA 3SRHA 5I3DA 1US2A 2F61A 2DT3A 1K7FA 1Q85A 5JU6A 3H7UA 1EJ7L 1QI0A 3ES8A 4J35A 3UU0A 3A22A 1F6YA 4M7SA 3WH5A 2QUUA 5A3HA 5HMEA 4LBSA 1Y5VA 1XLKA 5BWAA 1PTGA 5A6BD 4YYFA 5CPOA 4GE8A 2QPXA 1DWHM 1LBMA 2WKLA 5U7SA 4MF4A 3WFLA 3MP5A 2YB1A 3CZEA 3GC5A 3W7LA 3RR1A 3B8SA 4DBWA 1TE1A 4L4OA 3DX5A 4ZB0A 4DBEA 3W7PA 3WUEA 3SN1A 1IIHA 4OFCA 3TTEA 2ACUA 2ZADA 2IKGA 3H8AA 1B30A 4JTFA 4NJKA 1RBAA 1TV5A 5HR6A 1MI3A 4XAZA 2QJHA 2ANUA 3QKZA 4AIBA 2EO7A 3WF4A 4ORIA 1BGAA 2W79A 3IIXA 4JYDA 1FWWA 3DYPA 2VENA 5AVHA 5LNSA 1XISA 1NFPA 3NWRA 3C61A 1J5SA 2B0MA 3KDNA 4JOMA 2QCMA 4I6VA 2POZA 4PTDA 3OLEA 3GH5A 2DZPA 1CGXA 2PP1A 5D2VA 4EXBA 4YVPA 3UCQA 3AHVA 2P76A 2PDUA 3LEPA 2R91A 3BANA 3VMOA 3DBPA 5M3WA 2FZMA 2YBTA 1W54A 1W3LA 1TTIA 2OEJA 4E5TA 4K1GA 7TIMA 4O10A 2VZVA 1OQFA 4GKLA 1EPVA 2FTWA 5EGRA 3TW7A 2J74A 2I5GA 3LPGA 2J8TA 3KW3A 1KLYA 3WJSA 4XISA 1PV8A 3N2XA 1XINA 1L2QA 4QEHA 2YA2A 1M7OA 1XC4A 2J7HA 3CL8A 3S6DA 3SN4A 3L66A 4OUIA 4HHMA 3NQ7A 3P5ZA 3ANYA 4GABA 2E28A 1FWJC 2CLIA 4OE7A 3TUUA 3NOYA 4FXSA 4D8ZA 1NWRA 2NXIA 5IHRA 2XIIA 1HO4A 3KVMA 2GVLA 3OLIA 1JZ6A 3H26A 4WUIA 3S1VA 2GQAA 2EPNA 3IVUA 5KZEA 3QGAC 5EU9A 5AHFA 1R8LA 3PSWA 4PRRA 3GHTA 1TJ1A 3CHFA 2VX6A 2I5IA 2WPGA 4YN5A 3TX9A 3T05A 4DELA 3LXAA 4INFA 4C6JA 1FBAA 3RJXA 4YTSA 4RV3A 3QOMA 4F79A 1FRBA 2HPIA 2PRHA 3ANVA 3VCRA 1H1YA 1C8QA 2J7GA 7XIMA 1VJZA 2DQXA 3TSDA 3IAPA 3A5FA 3U7VA 2QJIA 2NT1A 8XIAA 5BXTA 4XAYA 4NZ1A 3CBWA 4IQDA 1QPQA 1JRBA 3O16A 1V02E 2ISVA 5G2HA 1W3IA 2OO0A 1SO3A 4YWSA 1QUMA 4HT3A 4UQCA 1C90A 4XZWA 1IEIA 1JD9A 3EKGA 4OV9A 3CEUA 2XFYA 5C2CA 2O0TA 3I10A 3CUGA 2FPYA 3L7RA 3FHAA 3JRKA 4DO4A 4QJ1A 2YXOA 3LOTA 3OIHA 5FAGA 3B97A 2VCAA 3RO8A 3PWGA 2HJPA 3D5HA 1IT0A 1A0DA 3GXMA 4JX5A 1FHLA 1GEQA 2DW7A 2J13A 7ENLA 3WNPA 5C9UA 2E09A 3B4YA 3NUKA 2BWGA 2FIQA 1F9CA 4JL2A 5G1MA 1PAMA 3GDTA 3WQ4A 1D7KA 1VENA 1OFAA 4NUWA 4HZ7A 1H62A 3IGHX 1F3EA 3P14A 4Z1DA 1MDLA 1A3XA 4LQ1A 2XSAA 2FPTA 1ZALA 3SSZA 1CZ1A 3VK5A 1WKDA 1YPIA 1TMQA 2Z6IA 4BHYA 1LRNA 4ACZA 2REQA 4MHBA 3RX4A 5A5WA 1A3HA 2VDIA 4M6UA 4KIRA 4AYSA 4GVIA 3MUZ1 3VNIA 1OZMA 2O55A 3S9ZA 4AWUA 3NL3A 1PZ3A 1Q45A 1H2JA 1TWZA 1M6JA 4H4IA 5DMNA 3QW4B 4LVAA 1HL9A 3H53A 3C2FA 1XF0A 4JIQA 1QK2A 3DHUA 1ZENA 3A5VA 2G97A 3KS6A 1DIEA 2PRMA 3UEQA 3T09A 1B3XA 4O28A 2MUCA 4UR7A 1IV8A 1JGIA 5FF2A 4RLIA 3S42A 2WQDA 4D72A 3JZUA 2QV5A 3KFTA 1VFOA 5E6ZA 3UP8A 4XD5A 1H61A 3LUTA 3TW9A 5I0DA 1OF6A 1P6CA 2ZKMX 3CQIA 5J5RA 1MRAA 2TAAA 1VCFA 4WDUA 1Z69A 4QISA 3OG2A 4KRZA 4DWDA 1BQCA 4JKKA 1E55A 2PP0A 3II1A 2JK2A 1FCBA 4Q7IA 4GACA 4WK9A 2NX3A 3I7QA 2LLEA 5E9XA 1Y7VA 4GNJA 3ITOA 4JTSA 3PAJA 1GJPA 3EDFA 3F2BA 4IMGA 3BCDA 1YLVA 3M0IA 3GHRA 5BOEA 4H8NA 1A5NC 1XYFA 2ZZ6A 1HZYA 4BEUA 2DUAA 4HNOA 3BJSA 4UBPC 1BRLB 1VFTA 5DMYA 1FA2A 4LB3A 4RDVA 2E1DA 1C92A 1DPMA 3PR2A 1UYQA 1TX0A 1LQ2A 3NVTA 5L9FA 1X1NA 2QJGA 1NF0A 1M68A 2OSYA 2VVSA 4A05A 1V0MA 3P62A 3U5YA 1T0OA 3DFQA 4PSPA 2E9LA 3S2JA 3NDZA 3D46A 5BU9A 2OX4A 4M81A 4A29A 5CLTA 3VGBA 1XD1A 4HMCA 4K7YA 3M7SA 2V30A 1HGYA 4AZCB 3GUGA 1H11A 3GHSA 1D8WA 4AVFA 3WK0A 4LYKA 4G7EA 5E0CA 4ZQRA 5CC7A 3GU2A 1US0A 2PUZA 4XZMX 1W1YA 4DN1A 4J3VA 4OWGA 2J8GA 1JYWA 1RA0A 2GVYA 3K8LA 3CH9A 1XIMA 4KCWA 1PKMA 4HU3A 1JI2A 1UJPA 3BSMA 3VIJA 3ZR6A 3TYBA 1L9WA 4AISA 3A3HA 3UJ2A 1NJJA 1WZMA 3P3BA 3T2OA 4HHHA 4Q3MA 1Q6OA 3PK7A 3C2VA 4LV4A 4WHBA 4ZB5A 1UPMB 2GVGA 2GWGA 5LIWX 4AG0A 1U1HA 4IISA 5HNUA 2Y8UA 3OOQA 1E6RA 2X40A 1IQ8A 1DYSA 1Y5WA 4Q4KA 4ZQPA 1ICSA 1XP3A 1WX0A 3E6EA 4DUWA 3UQNA 3C52A 5LNUA 2HMCA 3NL6A 4LC8A 4CU8A 3VNKA 4AXNA 4B4FA 2ASHA 5HOSA 4Q8OA 5EMMA 1F05A 2BY0A 1W9XA 4D6GA 1GTEA 1Q6LA 2IXUA 3FNDA 3EWYA 3GR4A 3TDFA 3CUJA 4B5WA 2CFFA 4J2MA 3FV9A 1QNSA 4XTDA 3TJIA 4FHAA 3IJ8A 4IJCA 4PC8A 1YXCA 4C6BA 2G3IA 4GZEA 5H1WA 4XUYA 1A3WA 5FEZA 3TONA 2OZ0A 1YDVA 2F6XA 3W1PA 2OX1A 2BS9A 3KTXA 4Q4QA 4UOZA 1W3NA 1QHPA 4RE4A 4C1NB 1XDMA 3GB6A 2J78A 2BOFX 4AQLA 5C8BB 4KWVA 3BICA 3N9RA 1R38A 3DKLA 2VVNA 4LSBA 3MU7A 1KD0A 3LGDA 5RUBA 4NYUA 1I2QA 3MUY1 4PMDA 3PBGA 5CZKA 3F2DA 4DF1A 4DJFD 2YW4A 3NL5A 2WWCA 2Z29A 4J3UA 3MKKA 3M5VA 3T2QA 3U2ZA 2W92A 5A8PA 2C1GA 4D6JA 4BY3A 1AQFA 4JHZA 4M1BA 8CGTA 4Q33A 2WVTA 1H7XA 2ISSA 2VXNA 4LB4A 3HZ3A 2ZIDA 1YBQB 4H1ZA 3U6WA 3HGSA 4MLRA 3WYZA 3H2EA 1SW0A 3ABQA 4PMJA 3M46A 3QC3A 3LTYA 3HURA 3CIXA 3W86A 4PUJA 4C90A 3HO8A 3OLDA 1QNOA 4DYKA 4XZLX 4GQ0A 3SM0A 1PB0A 3FJLA 4E2VA 5KINA 3MQTA 3RDKA 3R1ZA 1WUFA 2PDJA 4HU4A 3TCSA 3LHWA 2WSQA 4ZQMA 3WF3A 1ZNNA 3G1AA 2QAPA 3NZGA 4MB3A 1OK6A 1AQMA 5JBEA 4OBTA 3DECA 2PDFA 6CGTA 1UD5A 1K9TA 1T99A 3OGRA 3QTGA 5LYRA 5FSEC 3I6EA 4UFKA 4U2ZA 1A47A 4DWSB 1VBRA 3MUCA 1EJUC 1QPKA 3PPFA 5A6MA 1NQ6A 2GQ9A 2RH9A 3FCPA 2UY5A 2J47A 4K68A 2R9RA 3AMLA 1TJ0A 2PDXA 3HQOA 5AHEA 3RILA 4ZOEA 1YTDA 4AZ7A 3N3TA 4H9VA 1ZLPA 4HMEA 1QT1A 4N9DA 4CQ8A 4TIMA 1H7RA 3L65A 1PYFA 1QBBA 3R12A 3SQLA 3WD2A 5HINA 5F2LA 4KCTA 4S3CA 3EPNA 4CGTA 4LYQA 2UY3A 3IPWA 4EWND 2YB4A 4L6OA 2YL5A 4BF9A 3WIJA 1RH9A 2G50A 2POTA 4QLKA 5EY5A 4L80A 1RBOB 5AYZA 3UZWA 3LZ5A 4GD0A 1DJWA 4MUPA 1CDGA 3UWQA 5D2WA 3V5FA 1PX4A 5JUVA 3U4FA 1XKJA 1LBFA 5AHMA 3S0CA 2C1HA 2V82A 1FDZA 5JIPA 1KNWA 3EWWA 5REQB 4P7QA 3WLNA 4B5UA 1LRQA 3N2MA 2D2OA 4NZ5A 3RMEA 1PHQA 3P8JA 4WF7A 4FOUA 1X7FA 1KGUA 5CCZA 1QOQA 4AD5A 1TV2A 3DAQA 1IE7C 1WDQA 2ZA2A 3KBMA 5FEWA 4M1RA 1KBJA 5HJYA 2Y4SA 4IQJA 1MXDA 4GZ7A 2ZDRA 1CCWB 4GX9A 1BHGA 4O8RA 1UHVA 1CLKA 3GYEA 4TX6A 1CIUA 2CLMA 2PLMA 3PVFA 2XFRA 2WVVB 3I65A 3QZEA 4HPGA 3NQEA 3B40A 2V67A 3K1DA 1H7PA 3DYMA 2PAJA 1OY0A 5AHLA 3UWWA 1NDZA 2WM1A 1NOFA 2Z1SA 2F84A 1UWRA 2QCHA 3GH4A 1RVKA 4GO8A 2EG8A 3C0SA 1UWTA 4WSHA 1H7OA 4D71A 4U28A 4OOUA 2DGAA 2NZLA 1HN1A 3WUBA 2BFGA 3KOWA 3NPVA 4B2DD 3CO8A 3RM4A 1TJ2A 1X98A 3PJWA 4JN6A 1W5MA 1QI5A 1GCYA 4O1EA 3LCWA 1P4CA 4JTJA 1ICQA 3E2VA 3GUWA 3OA5A 4GWEA 1GG0A 3VAVA 5DX7A 1NDWA 5IFTA 2Z1XA 3WNLA 1AVAA 3WY1A 1LROA 1QNQA 3SAZA 3QHOA 1LT7A 4ATLA 1QWGA 2JIEA 4MNLA 4M51A 2VNCA 4C6MA 3GVWA 3GXPA 4JTUA 5FJJA 3CV6A 2Z4GA 3PTKA 4U2YA 3OQEA 3OVPA 3GG1A 3B0VC 4JYFA 3AXKA 3LHTA 3LRMA 4YTRA 3L68A 3ZVHB 4E0CA 1HXJA 4BKNA 5E6YA 4YCPA 5D2YA 2Y1HA 3WLKX 2ZZ5A 1I2RA 1AW5A 5LNRA 4JIRA 1SMAA 1KBIA 4I7VA 4CQ9A 4IXXA 4NX5A 4C6DA 2PD5A 1V5XA 3ISIX 1O5QA 4J3TA 2B7NA 1MUWA 2G41A 1P5BA 1VHNA 2CZFA 3UVAA 3BJFA 1A5MC 1HKMA 3W6YA 1OC5A 3A24A 3G77A 2R14A 3P82A 3NSMA 2WO5A 4GH3A 4LT9A 3APYA 3BLLA 5CC6A 1DXFA 3C56A 5M03A 2WVUA 1JQVA 3TLQA 3EA3A 3HG3A 2BHZA 3UZZA 3U3HA 1LZOA 2Y0FA 3GWQA 2H9AA 4ZTXA 1ZUAX 4UTUA 1IEXA 1FH9A 1B0IA 3ALGA 1GKQA 3NZPA 1EGMA 4PMXA 3N04A 1OFRA 3BSGA 1PIGA 3LBOA 7REQB 4KGJA 3MZ2A 1RR2A 1R9XA 2XWDA 3VKDA 1JCTA 4A2RA 2W61A 3LSBA 3AIQA 1S2VA 1E6SM 3N6QA 1TVPA 4LANA 4UFHA 4LAMA 3FIGA 2FB3A 4XBJA 5D03A 1XRVA 4I9MA 5E9AA 4H3DA 3L4TA 3I4KA 2HK1A 3VE9A 3DKJA 4S3AA 1WZLA 1I2PA 2Y7FA 3MHFA 4N9BA 4GUJA 4J3XA 3STCA 1LQAA 3WMCA 2P1FA 3W2NA 3H6OA 1VPXA 4LAKA 4QCFA 3ZJ7A 1UP3A 5DCEA 4JEJA 3RLUA 3VNLA 3KL5A 3T44A 1BF2A 2VWTA 4BI5A 3W1MA 3CZLA 3P5YA 3C2OA 4IUOA 3H2AA 4MYXA 3K2GA 3G1FA 2QGYA 3OHMB 2CYGA 2Z2UA 2WJZA 2G3JA 4UUIA 3DENA 3NL2A 1FXPA 1WKEA 2DJXA 1W17A 3FGCB 1JPMA 3VKJA 1DTNA 2W6RA 2PS2A 5LZLA 4TMCA 4Q4OA 4LX4A 4DXVA 2PDCA 4YL2A 6TAAA 3TYDA 2QDEA 3PTMA 4AVNA 1AMYA 3CS2A 2PF0A 3JS3A 3ANUA 4DXKA 2HVMA 3W87A 4NY2A 2F9RA 1RJPA 3A23A 5IM51 3RR4A 4PTMA 4LYRA 3AXXA 3GIPA 1OX4B 3NFUA 2WLZA 3VDHA 2BDQA 1AH3A 4D9PA 1KFLA 1ZHAA 2H8ZA 1V51A 4IPLA 2BVYA 2RUSA 1TO3A 1T96A 2GK1A 1LYXA 3QM3A 1FFRA 3O6AA 1EJWC 4MWAA 2OU4A 2X09A 3CXOA 1IXOA 2CWXA 1M1BA 3N1AA 3VKCA 2JKAA 4P61A 3UPMA 3CTLA 2D2GA 2QAFA 4CU6A 5FJRA 4Y2WA 4C60A 2E40A 1VCGA 1E15A 8XIMA 1V4YA 4IM4A 1POKA 4HZMA 5FKYA 3AS1A 1EBHA 6ALDA 3HQ1A 3LMZA 1FDYA 3U8GA 4REQA 4YPJA 1SU5A 1QBAA 4AWSA 4W5UA 3R0DA 2P5NA 3LHVA 4XBKA 1ITCA 4IGMA 1B3VA 3QSTA 2HPMA 1UA7A 2ODOA 3I7SA 2NW0A 1AQ0A 3O1NA 3A3XA 3A13A 1UZDA 3T0DA 3CUHA 1U83A 1WPCA 3BLDA 4WLCA 5HQEA 1UC5A 4JTDA 3W1UA 4W7WA 5FF4A 3TVAA 3VKAA 4O15A 1TQXA 5D8ZA 1VLWA 4J3SA 4NIRA 2E4TA 4IG2B 4R5EA 1T41A 2Y8VA 4CN6A 2DIJA 5AKQA 4B15A 4Y8FA 1QI2A 3W2JA 2EKGA 3WCZA 3W24A 3AIUA 5LIUX 3VCCA 2V2DA 2NQ9A 4DZ5A 3MVTA 4W86A 3CZGA 3NDOA 1L6YA 1MWOA 1JXKA 3C5QA 4IIBA 4D2JA 3BWWA 3NGJA 4FLRA 1H7NA 3ARUA 2ZXDA 4DY1A 2E68A 4DIAA 1S3TC 4YTTA 3QPZA 3UVIA 3QYQA 3WH7A 4AIEA 3W25A 1CXEA 3QY8A 1JZ8A 3B0YA 1RK5A 3HTWA 4I7UA 1T7LA 2VC5A 4A3YA 1J0HA 3ABXA 4Z42C 3G0UA 1TJRA 2NV1A 3FFSA 3FJNA 4P8XA 3RPDA 3ME3A 2NLIA 4BK9A 3B0UX 3KVJA 1XICA 4M0XA 5K2ZA 4PMYA 1YNYA 1ISWA 4C6PA 4TXEA 4OZOA 1XKYA 4IX0A 1KCKA 4FPSA 3CAQA 3S5NA 3HB9A 1DJIA 4JTEA 5HWNA 3CUXA 1LL7A 2DFAA 4IIEA 2IKIA 1BD0A 3BLKA 3WF1A 2D69A 5B7YA 4QTGA 5CPMA 2OFJA 3TSBA 2TRSA 3GIYA 5AZ1A 2BHYA 1EBGA 1ZB5A 3U2OA 1GJUA 1KXHA 2DUZA 2JEQA 4LXFA 2OR2A 3S5ZA 4LAZA 5DY3A 4HA4A 1B4EA 4DO6A 4QNWA 4UQAA 3GTHA 3NQMA 1KKOA 1W9BM 3IANA 4LUSB 3NQ8A 4HA3A 3KTCA 4PMRA 1UC4A 3S1WA 1IZCA 3W53A 3PZIA 1W1A1 3GFZA 3KP0A 3GXNA 1HO1A 4PB3A 1EB3A 1O4UA 3CC1A 3RMJA 1R47A 3TA9A 4MOZA 5E0KA 1KFCA 1WAWA 1WDWA 4X3ZA 3N19B 5AN7A 3C0LA 1IT7A 1FKWA 5G2IA 1HIZA 3TYUA 3DG7A 2UY2A 1S5WA 4GFSA 4LWWA 3KXQA 3JVAA 4R9XA 4JTHA 3IUDA 3SIZA 3M4HA 1SFTA 3ZVIA 4AC7C 2W3ZA 4M6PA 1JZ5A 1JCXA 3UW6A 3GTNA 3B06A 4PYSA 1PZ2A 1BKSA 5FIPA 2JF6A 5CPNA 4LW7A 2XTKA 3IV3A 1RLCL 5A6SA 3VIOA 3C8NA 1RK6A 2GFTA 1LORA 5FEPA 3EWBX 2IS7A 1GQIA 3R10A 4XK2A 2E9BA 1UR4A 1W1VA 2VGGA 4LAUA 2YCLB 3EKLA 2PMQA 3NQGA 3HPSA 3NG3A 2H8XA 2QXWA 5FI8A 1FH7A 4ZODA 4JQ2A 2MANA 3I68A 3W23A 3E02A 3AMCA 2CLEA 1GOQA 1V6WA 1XRFA 4AMCA 2ZRWA 3G24A 3WD3A 5H2ZA 3N13A 3NEHA 2PTYA 4OT7A 4Q7BA 5F4SA 1EC9A 1GPWA 1UBPC 1JCYA 1F2JA 5T91A 1BVNP 4J9JA 4W7UA 3HPAA 5AY7A 2X0HA 1H60A 4F4RA 1RBLA 1VEPA 1XH0A 4N4PA 2BMBA 3PUGA 3GTFA 4HA0A 4FOJA 1FY6A 1UR8A 1UH2A 3E0WA 2X1TA 4JTQA 4MWAC 1ODUA 8TIMA 2BGSA 5G1TA 1K77A 3V0UA 3QH2A 3RCYA 2NX1A 3TXZA 5HNTA 2ZYFA 1ZBCA 2VX5A 4Y96A 3W01A 1PO9A 5C9RA 3AIRA 1DIKA 4L6DA 2VD9A 5A8GA 4IP4A 3CLMA 4PFMA 3DGBA 4Z0SA 2JFEX 4L61A 1EIBA 2DY3A 3FVMA 4XX6A 5AECA 3GG8A 1EEPA 1E6QM 1DJQA 2KX9A 3ZOAA 5HUPA 4S23A 3WLJA 4LH8A 2VP8A 2DU2A 3WJWA 1A5UA 4IIGA 3P6LA 4K38A 1QMLA 1J10A 2PDBA 3RIKA 2WYSA 2IQ0A 3BXWA 4EANA 5M2FX 4FALA 3T08A 4IIDA 3ECQA 1JZ3A 2P3ZA 2V3EA 5AC5A 1KRAC 1NAL1 1I2OA 3AZTA 1SJDA 1Y5XA 2YJQA 1JVNA 3V0SA 2BZNA 1RJQA 4HA1A 2X16A 4GQGA 3FJ4A 3KOFA 3P0XA 2PTXA 1A5CA 3N2OA 3IGSA 1R3SA 2YCEA 4L1GA 4OGZA 3M16A 5D9NA 3VGFA 4IHCA 2ISFA 4UFLA 2XIQA 4K6AA 4FIRA 5KITA 1TTQA 4ORMA 1B9BA 2J7FA 1J93A 3L21A 4GUFA 1XLFA 2OJPA 4A35A 5FF0A 1FCVA 1WO2A 2PSNA 5CBJA 1DJXA 4GQRA 1E0WA 4LVDA 4RDYA 3Q2DA 1E0UA 4NAFB 1JJKA 2VGIA 2ZX6A 1JAKA 5I3IA 1XHGA 4UQDA 3O05A 4GYKA 4LVBA 4DJDD 3PHAA 1R86A 1HJSA 3LV5A 3O7UA 3H2MA 4NZ4A 2P8CA 1EEXA 4PH6A 3FEQA 1WXJA 3WLSA 4JTIA 4XG1A 1EXPA 1REQB 1BSIA 4FSAA 4AFYA 5CQ1A 4L1WA 4AXKA 1Z89A 2PC4A 3FYOA 2A3LA 4AHOA 2P0OA 1EPXA 4YIWA 2DJLA 3QN3A 4F0HA 1JPIA 3VDAA 1UR3M 3MZNA 3RF9A 4GPNA 1KV8A 1TPH1 5I3FA 2ZXAA 3W7JA 4I7WA 5CKSA 1Z41A 2BNJA 2X05A 1JF5A 3PAOA 2FLIA 3VI2A 4KERA 4F2UA 1TUFA 4ZCWA 1ZP4A 1ISYA 3FSTA 5A6AA 4I5XA 5C9WA 1D3CA 3SEPA 2OT1A 1IEQA 3M0VA 4X63A 2Z2BA 3LLFA 3UF9A 1F07A 4JFUA 3KVLA 2WHJA 2FB2A 4LTSA 1Z8AA 5HDRA 2HV5A 1YW1A 3W74A 3STPA 3TQVA 5IHSA 1HKIA 1ITXA 5ABEA 1QFEA 4A3UA 1XIFA 3CNYA 3VDBA 1BRLA 4HJWA 3IGUA 1W37A 3DFYA 1Q65A 4KFPA 1GKRA 2JGQA 2J4GA 3EX1A 1IXPA 3T55A 1HT6A 4P2VA 3B03A 4JCLA 5A6LA 1L6SA 3OIXA 2XVKA 2TYSA