3LV5A

Crystal structure of the mutant i199e of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAEIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 82
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lv5A00
4IMCA 4UFKA 3GIYA 4UFIA 3W7CA 1GTHA 4UMCA 1BKSA 4LS1A 3FYOA 1AMKA 1QPOA 3E12A 3PAJA 1QDSA 3RLVA 5K9DA 1LRNA 3W1UA 4JYFA 1R2RA 1B3OA 3IIZA 3WJYA 5J5RA 1H51A 3TW6A 3NL3A 3W7RA 1B9BA 2QCEA 1NFBA 4XTDA 4MUZA 1CI1A 4Z1CA 2G97A 3N3MA 3CWNA 4GBUA 1ZCOA 5FESA 1EIXA 1FCBA 1X1OA 1VZWA 3IVTA 2RHGA 3LHYA 5F1UA 3NL5A 2Y63A 3TW7A 3U6WA 5EY5A 3W1RA 3PC0A 2V8ZA 1JR1A 3NQMA 1DQXA 4X9SA 1I2NA 1QO5A 2YZRA 4DQWA 5G5IA 2CW6A 2ISWA 2H90A 4TR9A 1XBYA 3LXBA 2NLIA 2YPIA 1VYSX 4UNKA 2NXGA 1A5BA 1FBAA 4QISA 3GXTA 3RU6A 2NXIA 3W7QA 2F84A 1TTIA 5KINA 3W2UA 5DCEA 1YXCA 3G24A 2WNZA 4UMBA 2OMAA 5EPDA 3M5XA 1YYAA 4XKYA 4NZJA 4R53A 3EWXA 1FXQA 4EIVA 1U5JA 4FNRA 3HPSA 4UMAA 1I8JA 4EVZA 1KW1A 2WPBA 4IMEA 3TQVA 1DKWA 2E6FA 5D33A 3O1NA 3IGUA 4WXYA 4XBSA 3OBKA 4QITA 3NQAA 3HGJA 4UR7A 1YADA 2PRHA 2QUVA 4JGDA 3C2OA 4CQ8A 3PUOA 2FJKA 1UCWA 2C15A 2GOUA 2YX0A 1JUBA 3A23A 1KFCA 4MFDA 1G4TA 2QEZA 3MYPA 4Y9AA 4JDBA 4JTGA 3P7YA 2NUXA 4N4QA 3THQA 2DJXA 2Y62A 3W7PA 5I3FA 3CEUA 4JTUA 1FQ0A 1JRCA 3C6CA 3A24A 4X3ZA 3MHGA 4EWND 1TPEA 1HO4A 4O10A 1WXJA 1GEQA 1JQXA 4MOZA 3FYPA 3W2LA 2ZZ4A 3VKJA 1W5PA 3W1AA 2BZNA 2GQAA 1H7PA 1LRTA 1VCGA 3B8DA 4I7UA 4HHPA 2RKXA 1LLWA 4K6AA 5H91A 1NSJA 3IGSA 1R30A 4ZQNA 2NX3A 3WJZA 3W3OA 1OK4A 1PVNA 4OV4A 1SZNA 3UZJA 3W1XA 4QAIA 3TA6A 2YFOA 5EL1A 4Z1AA 1OHLA 1W3NA 2VENA 3EX6A 3F1QA 4M7SA 3UY8A 4MY1A 3QJAA 1L6SA 3NQ2A 2J88A 3NVTA 1YDNA 4JS3A 4IWWA 3IVSA 4DBEA 2NX1A 2XN2A 3LM7A 3MJYA 3MP3A 3P62A 1D3HA 4JYDA 3LTYA 1L9WA 3R5EA 1PCWA 4CLMA 1EEPA 1KBIA 3FKRA 3NNTA 5DELA 2A85A 4Z0SA 3TJXA 5CKSA 3USBA 2ISSA 3M5YA 3TH6A 3G1HA 3WFAA 3PG9A 3LLDA 1I2OA 3P61A 3HGRA 1QCWA 2OT0A 5CSSA 1V5XA 1XC4A 1ICQA 4UTJA 1X1ZA 2UV8G 5FF7A 5C54A 1VH7A 2P1FA 4WUIA 2QCFA 3STGA 3LRMA 5T26A 3I7SA 4WX2A 5E0KA 3SZ8A 3R2GA 4R33A 3BG9A 2G5WA 3TXVA 3UNDA 3W1NA 3PG8A 3YPIA 3LGEA 4H6KA 1DORA 4JIQA 2XN0A 4RV8A 3P60A 3GAKA 4NJJA 4ADSA 1FCQA 3R89A 3INPA 5AHMA 4JTJA 2C6QA 2QUUA 3LCIA 2QCMA 5K4ZA 3LHZA 1QWGA 3DFTA 4LVAA 1E51A 3SECA 1DV7A 2ABBA 1FWNA 2W0UA 1KFJA 1ME8A 3W7MA 4AH7A 1TJPA 1EX5A 4J9JA 5D2VA 3NQVA 4IXHA 2Y70A 1LOSA 3IRDA 2Z2UA 3W7DA 3TV8A 1XCFA 4K37A 3GNNA 3W74A 4U4MA 5AFDA 5LKYA 5IBXC 4JR5A 3EKLA 4P61A 1S3HA 5D37A 1IXPA 4UTHA 4UTTC 3SIZA 5LHFA 3G0SA 1FUYA 4H3DA 2VFHA 4JTEA 1Q6OA 4EF9A 4MY8A 1F5ZA 3PM6A 4GC4A 4Z1DA 3MW7A 1OX4B 1XDMA 1XL9A 4OQVA 1NF7A 3FFSA 3L5MA 4WOQA 4XZ9A 1S5WA 1AW2A 3LERA 2V5BA 2H6RA 2A0NA 4GNJA 3LLFA 3ATZA 2W79A 2OX1A 1VQTA 3TX9A 1W37A 3NQCA 3ZR4A 1OYAA 2Q8ZA 1WBJA 2YYTA 5EBUA 1TYGA 2PE4A 3N19B 3E49A 4UTIA 4O16A 4PH6A 4GRSA 3CB8A 5CZ0A 4K8EA 1OFEA 3I68A 3QQ0A 5G4WA 2EF9A 1KLYA 1VHNA 4RXFA 1HO1A 1H7NA 3O15A 1KFLA 3TNOA 2OCZA 5A5WA 2G96A 5LZLA 4NNBA 3UXDA 2B7QA 2DZTA 3L0NA 2ABAA 2OT1A 3HF3A 3IV3A 3STEA 5HULA 4FXSA 5HQEA 2ZA2A 4UFLA 3BLFA 3P67A 3W2NA 2FDSA 1OFQA 4AHQA 2BSLA 1XUZA 5D30A 2BLEA 3WJWA 4DPQA 3KXQA 3UPWA 3S9YA 2NV1A 1JQVA 2VOMA 2JGYA 4JN6A 3KRZA 1YLVA 1SO6A 3F4NA 1QOPA 5BW6A 3CLMA 3G1AA 1JULA 1LBFA 1TPFA 1FDYA 4Y90A 4Z1BA 5LGZA 1WOAA 3SJ3A 2AGKA 1F2JA 4HSNA 3SGZA 4HNVA 5D2TA 1M5WA 1XBXA 1W5NA 3LHUA 3C2FA 2R8WA 4LW7A 2ZZ6A 3L9CA 3W84A 4IJBA 3DKJA 5A8GA 5FEZA 2VKZG 4DXVA 1W3TA 1SFLA 2QCCA 3UWUA 3QMTA 4LU0A 5BMXA 1SFJA 3O6CA 1W5OA 4Q32A 1FDJA 1Z44A 3GZ3A 3MHUA 3QSRA 2ISVA 2E6YA 3P84A 1TPUA 4BWLA 3IIXA 2ZRXA 1RD5A 4X22A 1DBTA 5U7SA 3OA3A 2X2GA 3ABQA 5TIMA 1HFBA 4JX4A 3WK0A 1RVGA 3O06A 4OGZA 1ME9A 3JRKA 2FB2A 1F05A 1QR7A 1I2QA 1GT8A 3W1QA 3M16A 1XDLA 1SUXA 4KWVA 3LHWA 2GPTA 3PUEA 1UUMA 3T7VA 3ANYA 1LYXA 4GXMA 1I2PA 1KLZA 3WK3A 2I1OA 3OVRA 2QJHA 4TIMA 4PEKA 3SGUA 3R8RA 4MVAA 3LI0A 1SPQA 3DFOA 4TMCA 1A5SA 3W88A 4OV9A 5CPOA 1O5KA 2NWRA 3C3NA 3A22A 3BPWA 4AB4A 2ZRVA 5E1QA 4CCEA 3ZWSA 3GVGA 1XBVA 3B0UX 4LRTA 2ALDA 3QC3A 5D32A 3HBLA 1IF2A 3TU9A 3RNDA 2A2IA 2OJPA 4LVFA 3C2VA 1QPRA 4ALDA 2J27A 4IOTA 4QM1A 1JCNA 3E0IA 5D03A 5L6UA 3NM3A 5C2XA 1OX6A 3DI0A 3LTSA 3MHFA 5K7JA 3GLCA 1VR6A 3M5ZA 4N9DA 2QAFA 3KVMA 3GDTA 2FIQA 1MXSA 1I45A 3W7GA 1MEWA 2V30A 5DBTA 3QMRA 3W7OA 2QCDB 5K9CA 1WX0A 2ZZ7A 3OVQA 3HOJA 5U4NA 1FWSA 3NL6A 4NJHA 4U28A 1Z41A 5G2HA 2G95A 1TQJA 1EWDA 4TX9A 5D02A 4LUJA 3FKKA 1O5XA 4AMAA 1O60A 4O1AA 1W0MA 2JKEA 2ZQ0A 5AYZA 1TJRA 5HR6A 3NR0A 4NVTA 2RDWA 2EHHA 1EUAA 3S5NA 3W71A 4NJKA 2J9XA 2X30A 1SO3A 3HG4A 5AHEA 3DFNA 4LOCA 5E93A 4GFSA 2JK2A 5HWNA 4QSHA 3BGJA 1DL3A 2GJNA 3O6DA 3W7LA 3RMJA 3LHVA 5G2WA 3S5ZA 3L68A 1GYLA 2Z6JA 3W6YA 4LT9A 4MJZA 1O94A 2GJLA 3EEGA 1TQXA 2GVLA 2NXHA 1TPH1 3S6DA 2X1UA 1JVNA 4QJ1A 2A4AA 4LVGA 5FEWA 3N34A 1VYPX 1GOXA 2NV2A 3PBUA 3EB2A 4NQ1A 4Y8FA 5D09A 4M5PA 4MLRA 2TPSA 3G1DA 2C0AA 1LROA 4KKXA 4GUIA 3N2XA 4C1LA 4WQ6A 2CZ5A 1W31A 3CPRA 1TV8A 2J24A 3UZ5A 2FPYA 2E68A 2CLIA 2Y6ZA 3PF3A 3TKFA 4M7TA 1Q45A 5FF4A 2XN1A 5HNRA 1OG0A 2NZLA 3W73A 4ZZ9A 3ZWTA 4A21A 2QAPA 5G2IA 1H7OA 2VEPA 3MBFA 3HIJA 3BO9A 1VHCA 1OFRA 2Q3OA 4CQ9A 2ZZ5A 3PB2A 3B04A 3O6YX 5C55A 3DFQA 3GDKA 3EKZA 4LS0A 4TMBA 1F74A 3E02A 3FJ6A 3NDOA 5AB3A 4FNQA 1YTDA 4RCXA 1IIGA 1SO5A 2TRSA 3W7JA 3W2JA 4KFPA 1BTMA 4ADTA 1WOBA 4ZQRA 4FNSA 5LNWA 1G7VA 1PV8A 2CZFA 1KM0A 3ZFHA 3M9YA 1QFEA 2GVJA 4O54A 3B03A 1LDCA 2A6NA 2VC6A 1K3UA 4IPJA 3CT7A 2ZZ2A 3PSWA 1LM1A 3NGJA 2Z0IA 3W22A 3SW6A 4ZQPA 5AC6A 1EWEA 4WZHA 3GXNA 2FB3A 4DF2A 4WY0A 1EUNA 1Q6LA 3A5VA 4DO4A 4HPJA 3NOEA 4JX5A 2XFWA 1TPB1 4JTKA 2RH9A 2H3DA 3EWWA 5K3VA 3S1XA 4UTWC 5AHFA 1RV8A 4E0CA 4Y96A 4RXGA 2Y7DA 3UWWA 4P2VA 1KFBA 3KFTA 4UXDA 1K02A 4W9TA 1ZHAA 3W7HA 4PTNA 3W1TA 1PL9A 5FF0A 3E96A 4YCOA 4LRSA 3LB0A 1A5AA 4KFNA 4OWGA 1F6PA 2ZRYA 3N14A 4N9BA 3W7KA 2ZYFA 1P0KA 4UC5A 5DXYA 1LP6A 5GVJA 4CCCA 2NWSA 3MO7A 4YCPA 3THAA 1Z48A 4O50A 1PS9A 1CX9A 1GVSA 4YXGA 1YPIA 2I14A 3TQ0A 1LCOA 3NZRA 3OEXA 2VFDA 4AXKA 3EWZA 1L6WA 4JEQA 3TAKA 3L2IA 1TTPA 1M6JA 5G1YA 2E5CA 5CZSA 2EAWA 2DU2A 2FTPA 4MLJA 4WY0F 3MI3A 1G67A 4O4VA 3H53A 4EF8A 3S42A 4OE7A 4CCDA 1R46A 1ZAIA 2VEKA 4O1BA 4LC8A 2TYSA 3HQ1A 2QR6A 4M6PA 5DY2A 5AOUA 2ZRUA 4UIOA 4AHPA 1TO3A 1T8XA 3LXCA 4IX2A 5AHLA 3N9RA 2ZA1A 3NA8A 2CWNA 2W6RA 3NM1A 3W72A 2E09A 4LTSA 2QCLA 3GKFA 4E2BA 1X7FA 2QUTA 2ATMA 2KZHA 4RZ5A 3WK2A 3TAOA 1GWJA 3KX6A 1AW1A 3RK8A 1EPXA 2QJGA 2V2HA 1PIIA 3W87A 2FFCA 4FEZA 3ELFA 1G4EA 1MEHA 1P0NA 5KZEA 2IQTA 5FF2A 4O15A 4IPIA 3WK1A 2O7QA 1LBMA 1KV8A 1B4EA 1FCUA 1RQHA 3NEVA 2QDHA 1JJKA 1N55A 4ZL1A 2ZBTA 1TPDA 3HG2A 4A2RA 4PL2A 1EA0A 2CLHA 4MFEA 2C3ZA 4AF0A 2BWGA 4ADUA 5DN1A 1H61A 2YR1A 4FX8A 3ABSA 5C5YA 4DBDA 4WY0B 1DVJA 2EPHA 1W5MA 4DPPA 5HR7A 4O1DA 4IGHA 3B05A 4R34A 1UUOA 2ZZ3A 1F7BA 3NQEA 3NQ6A 4O4WA 3M1ZA 3L65A 4MYXA 1JCMP 1XUUA 2PURA 3NQFA 5KSWA 2QJIA 1RZMA 3TSDA 1JCXA 3QYQA 1VJIA 4JDYA 2WNQA 2V0TA 2YYUA 2BX7A 3M7WA 4NX0A 4JXCA 3JS3A 2DORA 4UNLA 3HO8A 5D2WA 2NUWA 2H3BA 4IMGA 4NZFA 3M47A 4NJIA 1FWTA 2YDAA 3GKAA 5D38A 2YFNA 1TMHA 5TBOA 1PHWA 3G3MA 3NAVA 4CNNA 3QF0A 4EOUA 1D9EA 1R2TA 3B06A 3I7QA 4JY8A 3BW2A 4JTTA 3W1LA 1UJPA 2CLFA 3BARA 4O53A 1KA9F 1SZFA 4RZ6A 2A7NA 5CPNA 3L5AA 4LY8A 1RPXA 4JTHA 3CU2A 1B57A 3K30A 3B4UA 2CLLA 4O52A 2Q8LA 3LV5A 3PB0A 1W3IA 2Y88A 3BGGA 1T96A 3HB9A 3QRHA 1OX5A 3NPUA 3KVKA 1JUEA 1LBLA 4GUFA 3LI1A 2PRMA 4S1FA 4TU1A 2WSYA 4Q33A 1MSSA 4XKYB 3SY5A 5EMUA 1FX6A 4QNWA 4ORIA 3T4CA 1BEUA 2YCEA 1RQBA 3QPZA 1K7XA 5IM51 5DLCA 1SR9A 1AL8A 4UFHA 3BK0A 3CQ0A 3LCHA 2A6LA 4JY9A 3DH7A 4X2RA 1IXNA 1THFD 3G18A 1RQEA 1P5BA 3VNDA 1KFKA 3GB6A 2C1HA 3FLUA 5KTLA 2DZWA 4MJMA 4DEFA 3DXIA 5HUOA 3H55A 1KV5A 1DOSA 1ZALA 3FJLA 1OFPA 4KWWA 4NT0A 4ML9A 5D04C 4WJEA 1JRBA 4N4PA 2D73A 3CWOX 4FF7A 1H1ZA 4O14A 1FY6A 2E1DA 4QQ3A 1TCDA 4OT7A 1S5VA 1TIMA 3GAYA 4O57A 1N7KA 1OFDA 5MHBA 3NO5A 3S8HA 4DO6A 2P0OA 1O95A 3PS7A 1L6YA 1WYIA 4BK9A 3TDFA 4UFJA 1GG1A 4HIBA 1HUVA 4POCA 1J4EA 4FB7A 3GX9A 4FX7A 2ZZ1A 2V82A 1ICPA 1W1ZA 3QW4B 1S5TA 3KVJA 1EP1A 6ALDA 3DZ1A 1SZGA 4UCGA 4UTWA 4XBKA 4Z08A 3QQ1A 2Y7EA 2YW3A 3G3DA 3TXZA 2DZSA 5DY3A 1KM1A 2QDGA 3N73A 4HPXA 5DCDA 1CW2A 4ZMGA 2DP3A 3DHDA 1PCKA 4BI6A 2B4GA 3DFPA 3G0UA 2NUYA 1MEIA 5SWUA 3TSMA 1XBZA 3NPWA 3EXSA 3HGOA 2JGQA 4UTUA 3EX1A 3LRKA 3O63A 3Q58A 1K8ZA 3PUDA 1F6KA 1K8YA 3M5VA 5LSMA 4S2CA 2VEMA 2R94A 3LDVA 4R7JA 4A2SA 4MIMA 4RX0A 3NPXA 1ZAJA 3UWYA 4L4LA 3ZS4A 4UUIA 3FS2A 3CEPA 3CIXA 2GVGA 4N6FA 1QAPA 5BOOA 4OBTA 3DFSA 3OIXA 2B0MA 2BTMA 1SW0A 3M41A 5D2YA 2HS8A 4IMDA 1NEYA 1SSDA 3T78A 5BNKA 4ZQOA 3KRUA 1TRIA 4N6EA 1AG1O 1KBJA 3TFXA 4YLWA 2CU0A 3GR8A 2DZVA 3TK7A 3QZEA 1Q6RA 1KTNA 4S2BA 1PHQA 1P1XA 1JCLA 2Y7FA 3LCLA 2VFGA 2WSQA 4QNEA 5AC7A 2HMCA 3KRSA 3UY7A 3MI6A 4MY9A 4UR8A 3C61A 3PULA 4K36A 2GQ9A 4BR1A 2RDUA 3IIVA 1VCFA 2Z6IA 7TIMA 4AAJA 4HSOA 3B0PA 3HGSA 3DAQA 2CZDA 3A9IA 1ZJIA 4OHQA 3W75A 4LS2A 3W23A 1QMLA 3DU0A 3DKLA 3TQKA 3SFKA 5I3JA 2R14A 2CLKA 4PC8A 3M6YA 5C6MA 1WA3A 5HJLA 2V5LA 3C52A 1NF0A 2E6DA 1YXYA 1DJNA 4LWWA 1QOQA 3BW4A 4WD0A 3LV6A 1C29A 4NXKA 2WO5A 1ZAHA 2VFIA 6TIMA 1KTBA 1GJPA 3NG3A 4ZQMA 1OF6A 2WKJA 3UQNA 1WAUA 3W07A 3LOTA 1PE1A 2ZTJA 3MP4A 3LRLA 1GVQA 3LCXA 1YXDA 3VI2A 3MI2A 1LZOA 2VELA 3PBWA 3TCEA 3STCA 1ZENA 4DF1A 5AYYA 3O8AA 4I9AA 1R2SA 2C18A 5FEXA 5D05A 1G4PA 1JUKA 2A1YA 1VCVA 3V75A 1ME7A 3N2MA 4PL1A 3ABRA 4NU7A 4K7YA 5LGXA 4PFMA 3M43A 4XWUA 2FPVA 3UYCA 2TMDA 2A5HA 3AJXA 3BG3A 3LXAA 5CZJA 3B0VC 3G1SA 3DENA 1H5YA 5G1TA 1LOQA 2VFFA 4JIPA 2V2CA 4CNOA 4I7WA 1VS1A 1FXPA 2PCQA 2CLEA 2A7RA 2RFGA 1OVDA 3F4WA 4N9EA 4DF0A 2FQIA 3LBMA 4JTFA 1XM3A 2Y85A 3S1UA 3W9ZA 3BLIA 3PR2A 3CC1A 5HUPA 5FI8A 1MZHA 2JBMA 4JX6A 3U8GA 4FNPA 1U83A 5DXXA 3PSVA 4AEOA 5K2ZA 3SSJA 2X1TA 1OJXA 1W56A 1RR2A 4N2YA 2C16A 3NYZA 1KFEA 2OZ0A 3A5FA 3RFAA 2EKCA 1UBSA 5ABTA 1ZY9A 3CIWA 4RJEA 4CNPA 5F2GA 1GVFA 5HWMA 3KAOA 2Y7GA 4OU1A 4RKAA 3VE9A 3TR2A 3KOFA 4M6VA 3EWBX 3PVFA 2E5BA 4UTMA 2HTMA 2WOQA 5TQLA 3C4UA 4Q4KA 3QH2A 1KM6A 3G8RA 4KFOA 2C13A 1K7FA 4XUGA 3QEZA 4K39A 1XKYA 5CSRA 3KVLA 4AVFA 1GQNA 4HKPA 5HINA 3ABOA 1YTEA 5CGQA 4RZ4A 4MZ1A 4BWLC 2P10A 4JD4A 4RLIA 4AHOA 3GDMA 2WSRA 1R47A 5F1VA 4E2DA 4IQLA 3TE9A 5K9XA 3M0ZA 3HPXA 1BWKA 3P82A 4ZQCA 4AF0B 4NJGA 2VFEA 3MMTA 2J9YA 2TSYA 2QF7A 4PCFA 3MUXA 4IUOA 4FO4A 3P81A 1NVMA 1WQ5A 1GVRA 1H1YA 1GYNA 3CM4A 4DO5A 3EXTA 3NQ7A 1DHPA 4JNMA 1WDWA 4JYEA 4UTKA 1T0OA 4GE8A 5J5DA 3QW3A 2JKAA 1TREA 1YDVA 1EP2A 1XI3A 3OHIA 3VCRA 4O0KA 4GJ1A 2ZCGA 5AHIA 4IMFA 1OK6A 1A50A 4RR4A 1FCVA 4XQ6A 3GDLA 5F2LA 2ZTKA 3P74A 3UWQA 4M19A 2WV8A 1OF8A 3PY2A 2Y61A 1K03A 4NNAA 4ICNA 3MP5A 1YTKA 3S1WA 4ZVJA 3IIOA 1SU5A 3GYEA 4CQAA 5KZDA 5LHEA 1VC4A 4A3UA 3FIGA 5LNSA 3S5OA 5FEPA 4JTIA 3MYOA 4K8HA 3LHTA 1GVOA 1H7RA 5EKYA 4MKNA 3C56A 4DELA 5F4SA 3I6RA 4K7VA 4ORMA 5F2IA 1KM3A 4BFAA 5I3HA 3LCFA 1NAL1 3CTLA 2VXNA 3T55A 3BV4A 4O19A 1TV7A 2QCNA 2RDTA 3G0XA 4MYAA 4O0ZA 1EP3A 1VLWA 4LVDA 1OFOA 1M7PA 4IXXA 3UD6A 1OFAA 1TPC1 3Q2DA 5K4XA 1D3GA 1SO4A 3IVUA 3NQGA 3STFA 1DQWA 3O05A 5LNUA 3QSTA 3NPVA 3EXRA 1FDZA 3O16A 1TV5A 3W2MA 3EX3A 1AK5A 3HMJG 1G6CA 3TFCA 5H2ZA 3QMSA 3W83A 5DCBA 4C1KA 4GWEA 2FPTA 1ZNNA 2V81A 1ONRA 1Q6QA 3CHVA 1X8FA 3GXPA 4O13A 1TPVA 1XFBA 3L5LA 3W7NA 1K8XA 2E77A 1SZEA 2ZFAA 1XXXA 1JCJA 3MBDA 4O11A 3C2RA 2DZUA 1TRDA 4HNTA 3TUUA 3DI1A 1KTCA 3NL2A 1G7UA 4QIUA 2NX9A 3U2OA 4YMZA 1VPXA 1UASA 1WV2A 2B7OA 2HS6A 2JKPA 2R91A 1GPWA 5EYWA 4PODA 4O17A 5AN7A 4G1KA 3GK0A 4FHAA 3IIPA 4GUHA 4M6QA 4N02A 3I65A 4E38A 2ZRWA 4AWTA 5F4XA 3T40A 3G22A 2ZA3A 1G69A 3OVPA 4UTLA 1A5CA 4D2JA 3HG3A 2E5DA 1SW3A 2Q3RA 1H7WA 4NX5A 3NQ8A 3UXAA 1A53A 3PWAA 4LVBA 4O8RA 4O28A 3BW3A 1WBHA 3LX9A 3G1XA 2X1RA 3MWAA 3Q37A 3RLUA 5EA9A 1HG3A 4B5NA 3W7IA 1P4CA 4FNUA 3WJSA 5LNVA 5CPLA 5F4WA 2H8XA 3VFLA 3O07A 4O12A 5HMSA 3TJLA 4HNUA 3W70A 1LORA 2DZPA 3IGXA 2CLOA 1X6UA 2YW4A 1Z42A 1ALDA 4MZYA 1L2UA 4FIQA 3Q94A 3SR7A 2FLIA 2J6XA 1VRDA 3DGRA 2Y89A 2AAMA 1I2RA 2ATSA 2C19A 3OG3A 3W7EA 3G8EA 1JCYA 3UWVA 3T44A 2HSAA 3I7RA 1H50A 3HPZA 4IX0A 3SI9A 2WNNA 2LLEA 1H63A 3VE7A 4A22A 3GR7A 4HNNA 3R13A 1K7EA 3GDRA 5CG7A 2X16A 1TSIA 5KMYA 4NUWA 2I9EA 1IXOA 2BXVA 2O7SA 3RF9A 3NZ1A 3NQDA 2GQ8A 1FWWA 3GNDA 3LTPA 4LV9A 5I3IA 1TB3A 4WOZA 2YGYA 4YL2A 1AW5A 3KHJA 3W76A 3QPYA 4JICA 3W1PA 3FEMA 3L66A 2YXGA 1W5QA 3W2KA 1OYBA 2A7PA 4HN4A 5LNRA 1UB3A 1HL2A 4MZ8A 5D2XA 2ZRZA 4UTTA 5IBXA 4GUGA 3D0CA 5G4EA 4FNTA 3FOKA 3PBYA 1F76A 3R12A 1BWLA 5F2MA 3E9AA 3G1YA 2H8ZA 3NXFA 1W54A 3N9SA 1QNVA 1MO0A 3S5YA 1FWRA 4H4IA 3TIMA 3L0GA 3L0KA 5CZTA 1AL7A 1VGAA 2F7FA 3W85A 2PRLA 3ATYA 1LLZA 4K38A 2ZDRA 5AHNA 2X1SA 3L21A 3HJZA 5BRBA 4LV4A 4WXZA 1DJQA 4AWUA 3W1MA 3EX2A 5FF3A 2V9DA 4PA8A 3DHFA 3BVJA 1LTDA 1KM5A 4LC6A 3FA5A 3QM3A 1GG0A 4UFMA 3H54A 1TTJA 4LNYA 5AYXA 4I7VA 1SQ7A 3TC7A 3C8FA 2CFFA 3PBVA 2CZEA 1VYRA 1ICSA 4BI5A 3LCWA 3L67A 4L4MA 1GTEA 1VLIA 2EGZA 3WJXA 1GZGA 4BF9A 5DBUA 2PC4A 2CLMA 3TMLA 3LBCA 1N8FA 1QPQA 1M7OA 1O4UA 3UWZA 5KITA 1ZFJA 2YSWA 1LRQA 3TMQA 4O18A 4NNCA 4GUJA 1QO2A 3BLEA 4JTLA 4YWIA 4LUIA 3G1FA 3UPBA 2QCHA 1Q3NA 3P8IA 3P80A 1W8SA 2J9ZA 4HT3A 1OFBA 2WJZA 5KZMA 4MPQA 1EB3A 8TIMA 1C8VA 2B7PA 4RK8A 1QPNA 4XTIA 1H60A 3LCGA 1B4KA 1OX4A 3P5ZA 1J2WA 1ADOA 1TPWA 3EWYA 1OABA 1I4NA 1KM4A 2DJLA 3TSBA 2WQPA 1YPFA 2QCGA 4BI7A 4AWSA 4Z0JA 3V1PA 3IEBA 1T99A 1TTQA 4Y6GA 1OYCA 4NXSA 4FIRA 1J5TA 3QFEA 2V2DA 2B7NA 1H7XA 3C0JA 3W86A 5AC8A 2DZXA 1KM2A 1F73A 4JTSA 5I3KA 3JR2A 1IIHA 3P8JA 2A21A 2E6AA 4FX6M 1LOLA 1C9DA 3G1VA 3P5YA 3F03K 1G4SA 1V7YA 1HTIA 2QKFA 3AO0A 1Y0EA 3A21A 2Z1BA 3M44A 2AQWA 3BG5A 1ML1A 3TROA 3EWUA 4FXRA 4N9CA 5I3GA 4ONVA 4A29A 3C2EA 3DBPA 4TO8A 1IXQA 3S1VA 4O1CA 3S0CA 5BMWA 2C14A 5CPMA 1IGSA 1SSGA 3HG5A 2QCDA 1SW7A 1YDOA 3TC6A 2GUUA 5HWJA 3EX4A 1H62A 5L9FA 2VEIA
chains in the Genus database with same CATH superfamily
1TWZA 1GTHA 3NO3A 4JQAA 1LG1A 1E56A 1QPOA 3RLVA 2Q6ZA 4JYFA 1CPUA 1R2RA 1B3OA 4AIOA 5BXTA 1NFBA 4XTDA 1W2PA 4MUZA 3UF9A 1AZ2A 4B5TA 4DJDD 2C79A 3N12A 3DESA 3GG8A 1I1XA 3NL5A 2Y63A 3TW7A 2FMOA 3GH7A 5AYBA 5EY5A 2QYGA 3W1RA 2V8ZA 4DQWA 3F5JA 2CW6A 2H90A 2BP1A 4PB3A 1UA7A 4B4FA 1K77A 3LXBA 1VYSX 1A5BA 4HU8A 3ARSA 3GXTA 1WXZA 1L8NA 2PF8A 1TTIA 2TODA 3SUSA 1UR3M 1DWFM 2Y8VA 4UMBA 4XKYA 4IISA 2D23A 3EWXA 1ZLPA 1U5JA 4FNRA 4RZBA 3VIOA 3ABXA 3QY7A 4BQ4A 5D33A 4MNJA 3ZQ9A 3IGUA 3E0LA 2XIBA 1AJZA 4F2TA 3LM3A 2A3BA 1F3EA 3A4WA 3MO4A 4GKLA 1J2BA 4U2YA 4QP0A 3KP0A 2QUVA 3TTOA 1QNPA 3C2OA 2VX6A 2FJKA 3V0SA 2C15A 2YX0A 1JUBA 4DJED 3GM8A 3WUBA 1K9EA 2UY3A 4JTGA 5PTDA 3MY9A 4N4QA 2I57A 3DN5A 7REQB 2DJXA 8XIAA 1OEPA 2Y62A 2YCIX 1XYBA 2GWGA 3CEUA 1YE6A 3CV6A 1JRCA 3A24A 4IFKA 3GC2A 1I6NA 3F5LA 3ZLGA 3TVAA 4REQB 4LGXA 2BZNA 3VU2A 1VCGA 1B3VA 1OGGA 1TX2A 4GACA 3IGSA 3MSYA 4ZQNA 3UZXA 2FGBA 2HXTA 1R38A 1RA5A 4H9ZA 2ZX6A 4IH3A 4Z1AA 1OHLA 4M7SA 3PN8A 1XD0A 3QJAA 4KS0A 2A3AA 1UD5A 1YDNA 4JS3A 4IWWA 4DBEA 5C9RA 3U7VA 1DE5A 3MJYA 2J77A 1PCWA 3MA8A 1EEPA 1KBIA 1XIFA 4FPSA 5DELA 4H01A 3WQ8A 2A85A 5CGTA 4Z0SA 5CKSA 2ISSA 3M5YA 4EX4A 1E15A 3WFAA 3PG9A 3LLDA 1I2OA 2OT0A 5CSSA 3KWXA 3RUBL 4IG2A 1NIUA 2DH3A 4WUIA 3STGA 2A3EA 3LRMA 2DVXA 2OZ8A 2WQDA 3HQNA 4J40A 4WX2A 4XZHA 3MKCA 5E0KA 5TD4A 2JALA 1U1UA 4R33A 2G5WA 3N4EA 4H6KA 4Q7BA 3T07A 4NJJA 3R89A 3INPA 5CJNA 5DX7A 3LCIA 1BVWA 1POKA 4W86A 4L6OA 1QWGA 5F7UA 4NYYA 5XIAA 1J0JA 3G6MA 5A6TC 2IKJA 3P2VA 3MWCA 3K46A 1KFJA 1ME8A 4HN8A 1Q6EA 2VHLA 1EJSC 1EX5A 4J9JA 5D2VA 4IXHA 2D0GA 1W9DM 1LT7A 1R3RA 3MANA 1XCFA 3GNNA 4JR5A 2BVDA 3URAA 3QOMA 3R6IA 4MJ2A 3VNIA 3CUFA 4NY2A 1QK2A 3G0SA 3AISA 2VZSA 3KZSA 4F0MA 2VCBA 5FJOA 1XL9A 1NF7A 3FFSA 4XX6A 3S47A 5C0QA 4WOQA 4XZ9A 2V5BA 3QGVA 4PUDA 1HKJA 4ZOAA 4QLJA 3CZ8A 2OX1A 3UNTA 5LA2A 4GY0A 4LJ3A 2Y5EA 5EBUA 1FP9A 3N19B 1E0TA 1V0LA 4UBPC 3APYA 4K8EA 3I68A 1SZRA 3LGDA 4DB7A 1UR8A 2EF9A 1VHNA 1KR1A 4NRSA 3AQUA 5A5WA 3K4DA 4NNBA 3UXDA 1GVIA 1E72M 1PKNA 2DZTA 3L0NA 3K8KA 2ABAA 4H7ZA 3STEA 5E5CA 3SY8A 2WK2A 1U22A 1OFQA 2BSLA 3B9AA 5M03A 1GGOA 5D30A 2OEKA 3KXQA 3UA4A 4CD8A 2AGTA 3S9YA 2V3FA 3T0BA 1QOPA 1S2TA 1XCXA 1J79A 4PMXA 4DAIA 1XRFA 1TPFA 1FDYA 2C1GA 4AX7A 1WOAA 1F8MA 1HJQA 1OD8A 2VO5A 1F6YA 4JFWA 3SUVA 1EXBA 1W5NA 5AVHA 2VDHA 2R8WA 3W84A 2CHNA 5C71A 3KP1A 5EBAA 4R9XA 2I9UA 1FKWA 3BUVA 4F0HA 1UH4A 3BCJA 1SFLA 1E71M 3GXFA 3VGHA 3UWUA 4H00A 3O6CA 1W5OA 1EJRC 1CT5A 4DJEA 4PBEA 1EEXA 1EXPA 1TPUA 4BWLA 1RD5A 1G5AA 5CCZA 3ABQA 3WK0A 3O06A 1CIUA 2C1IA 1UZ1A 4MAZA 5H8PA 4A8NA 3W1QA 1XDLA 3W6LA 4ASTA 5I06A 3LHWA 3T7VA 1I2PA 2PLJA 4BKNA 1TG7A 1ZZMA 2I1OA 1C91A 3W81A 4GY1A 3BAXA 5FAGA 1BF2A 3GUGA 3SGUA 1XLEA 4MVAA 1RSCA 4TMCA 4XSLA 5E0CA 3WQ5A 1XW8A 2NQZA 3CL6A 2VC5A 1H0GA 1A4MA 4EXBA 5GJPA 4C6KA 5EFDA 3B0UX 2VGIA 5JH2A 4PR4A 3HBLA 1NOUA 2A2IA 3EYPA 2IPWA 4WEVX 5I6SA 3GVQA 4ALDA 3CO8A 2V38A 4J3SA 2J27A 5D03A 2EJ1A 5K7JA 3GLCA 4ZO7A 3QHOA 3OLGA 5BRQA 2V30A 2WWDA 2OGYA 4AYSA 2UZ9A 1I0BA 2VWTA 5K9CA 1WX0A 2YB1A 1FWSA 1A3HA 2ZUWA 4UOJA 2HDJA 2ZIDA 1L8PA 3T0CA 3EOUA 1NWSA 2IKIA 1EWDA 3GXDA 4Q8NA 5D02A 3BAJA 1KCXA 5A6LA 2FVLA 4J7RA 3DX5A 2ZX8A 2EPKX 5AYZA 4US5A 2DUXA 4HMDA 4V1YA 2VDIA 4KCUA 3SN1A 1JF5A 5IHSA 3SURA 2PP0A 5AHEA 1OD0A 3DFNA 4W4QA 2WSKA 3WD1A 3T2QA 3ARRA 3BGJA 1HIZA 5CBJA 3JZEA 4AD5A 1Y8BA 3RMJA 3A3HA 3L68A 3OZPA 4F0RA 4MJZA 2PDPA 3BQ6A 4JEJA 4AUBA 3MMUA 1QASA 4IUGA 1TPH1 1ONEA 1A3XA 2ZICA 2A4AA 3U48A 5FEWA 1E6PA 3N34A 1GOXA 4NQ1A 3PHAA 3FSUA 2PCEA 2CESA 4C1LA 3SSZA 1TV8A 1T6MA 5DT7A 3TKFA 1IGWA 1OG0A 4MNLA 3DG3A 4MNKA 1SGJA 3EWCA 4A21A 1XWYA 5G2IA 2VEPA 3WLPA 2Q3OA 1CWYA 3DIPA 3O6YX 5ABEA 3GDKA 4J3TA 3RX4A 4TMBA 4PSRA 1YTDA 4RCXA 2WJEA 2J75A 2CBVA 1VJZA 4FNSA 5LNWA 1G7VA 1G0CA 3ZFHA 1M41A 3M9YA 9CGTA 1QFEA 1LDCA 2A6NA 2VC6A 1K3UA 1ISYA 1EDTA 2V68A 3AYRA 1UPMB 3BLOA 3NGJA 2R1LA 1DEDA 2B31A 1BSIA 3B9DA 1YBQB 1ISVA 4GABA 2MANA 1TCMA 4WZHA 3M0KA 4WY0A 3AWOA 3GG1A 1KKOA 4DO4A 4L5ZA 1WDPA 2RH9A 2H3DA 3VIMA 4XBJA 4DYJA 4XZNX 2Y7DA 3FDGA 4I5UA 1K6AA 4HA1A 1PWLA 1PZ2A 1G1YA 2OSYA 1PX3A 1QHZA 1CXHA 4AD3A 1PL9A 4LY4A 4XV0A 1F6PA 1WKYA 1Y5WA 2FZMA 3W7KA 4ZSTA 4E8CA 3O9NA 1R9ZA 5DXYA 1Q6GA 3MKVA 6XIAA 3GG7A 3THAA 1Z48A 3T2OA 1GVSA 1CX9A 3D46A 4YXGA 4NIRA 3OEXA 2VFDA 2E8YA 2PP3A 2EG8A 3L2IA 3H2NA 3SQLA 3KS6A 5A69A 4WY0F 1U33A 4O4VA 3CTTA 3H53A 3WDRA 4CCDA 1ZAIA 4AZ5A 4ZSUA 1TV4A 2ZDSA 1RBOB 3WQGA 2TYSA 4N7QA 5A6KA 2QR6A 1UJQA 1S39A 4M6PA 3EPNA 1Z8AA 4AHPA 5CXPA 2Z29A 1NARA 1T5AA 3E2VA 2ZA1A 4PTXA 3BSGA 2PZ0A 3AMKA 3IJ9A 4LTSA 3B9NA 4WDXA 1UD3A 2FJUB 2Y8KA 1X7FA 2ATMA 5H1WA 1V6UA 1AW1A 4ZE5A 5DRCA 2IPGA 4FEZA 1HT6A 3VC5A 1KQZA 1LBMA 3LUTA 4ATDA 3UERA 4EKJA 2GJXA 4TVCA 1LL4A 1N55A 4ZL1A 2D3LA 3HG2A 4DJDA 4PB5A 2BWGA 4HYWA 3VCCA 4DI8A 3L4WA 1H61A 1QI5A 5AVNA 4WY0B 1AQ0A 3BJTA 3UP8A 1DHKA 3B05A 1KNWA 3GBEA 3USZA 3NQEA 4O4WA 1GKRA 3M1ZA 3W37A 3WH8A 5CPSA 1M3UA 1W1TA 2G50A 3B0XA 4C5YA 4LQ1A 3QYQA 1X6LA 4JDYA 1CLVA 2QJNA 3N17A 4D6IA 1GQIA 3JS3A 3WLLA 2DORA 2EPLX 3OTRA 2NUWA 4GIRA 2H3BA 4IMGA 5BROA 3M47A 2PDUA 1KBLA 3B9EA 2FHBA 4IGNA 5TBOA 4C5ZA 1PHWA 4RPQA 1R2TA 2FGZA 1E9IA 3I7QA 4JY8A 4TVDA 3NSMA 3BW2A 4S39A 4WDWA 4B4HA 4R3UA 3BARA 1BG9A 1KA9F 1J01A 3N4AA 2A7NA 3L5AA 4JTHA 1CGYA 1JPMA 1RP9A 2V5JA 4H8VA 3K30A 5HANA 3LV5A 4DWDA 3QY8A 1OX5A 3NPUA 2NSXA 3DC8A 4E4FA 3LI1A 1C92A 4XKYB 1V0NA 3O6AA 3AICA 1XIIA 4CD4A 1UWIA 4ATWA 1E1CB 1X38A 4CVUA 2EG6A 1XX1A 2A6LA 2V3EA 2V67A 2ZOXA 4NASA 2O4MA 3GTNA 6PTDA 3LLXA 4U5IA 1IXNA 1HL9A 3G18A 2VC7A 3CO4A 3VNDA 1MDLA 3SRDA 3BZJA 1J6OA 3FLUA 4IQDA 5AC5A 3H12A 2ON3A 4AZCB 4CCZA 4MJMA 3WL1A 1J18A 2P76A 3AYSA 1ZALA 4HMNA 1MNZA 3KS5A 4AY1A 1RBLA 4ML9A 5D04C 3MT1A 4F0LA 1JRBA 1W1A1 2D73A 3ANUA 1H1ZA 2ZADA 1XCWA 1UQZA 1VB9A 3C3UA 3N4FA 3AIUA 2QPXA 4G7FA 4OT7A 3S2LA 2DQXA 2P0OA 2XTKA 2PDKA 2XISA 5TF0A 5CH9A 5HAOA 3RX2A 1JYWA 4BK9A 2CBIA 4ERGA 3TDFA 1O1HA 4POCA 4QCEA 4FX7A 3RR4A 4XZMX 4Y7EA 3CYJA 2V82A 3P6LA 1YNYA 2XSXA 1EC9A 1TFVA 3QQ1A 4GXWA 2Y7EA 3AYTA 3BMXA 3EMZA 2QDGA 3N73A 3UR7A 1PZ1A 4FLRA 1RP8A 5HQLA 1LL6A 4ZMGA 4HOXA 2D69A 2B4GA 2PDQA 4KMQA 3W25A 1B1YA 3G0UA 1WZLA 3IUDA 5SWUA 4GCAA 1XBZA 1K6WA 3RU8X 3MCOA 2WJFA 2JQXA 1B5TA 4UTUA 3EX1A 1PYFA 4LAMA 2WAGA 3PUDA 3AJ7A 1GPFA 3SBFA 1ISWA 5I5RA 4A2SA 2OQHA 3WLMA 1VRXA 4J2PA 1X39A 3UWYA 3CV2A 2HE8A 2ZXDA 4TX8A 2GOKA 3FS2A 1VF8A 3CEPA 4HK7A 3W38A 5BOOA 2XH7A 4OBTA 4F8XA 3DFSA 4D1JA 1WDSA 3VKCA 4DBUA 2HS8A 7ODCA 1JPDX 1NEYA 4FLSA 1V02E 2PDFA 1RBAA 4N6EA 3NIYA 1KBJA 4ICMA 3IPWA 3TFXA 1W1PA 3TK7A 4OOZA 2P3EA 1XIEA 2WSQA 3VGGA 1HXJA 3VMOA 5IFTA 1VFUA 1VP5A 3CL7A 3ITOA 4MY9A 3S2JA 1KGUA 3PULA 4GIAA 4GVGA 4ZTYA 1PWMA 1H11A 2H9AB 2ZE3A 3B0PA 3HGSA 2WXDM 1XIDA 3OG2A 3U2CA 1QI4A 1XGZA 1R5YA 3W75A 4L64A 1QMLA 1MUWA 3DKLA 1XLJA 1MWOA 4HCHA 3BSHA 2AAAA 1WA3A 2IUZA 3WNMA 2F38A 4TVUA 4ZTXA 4NZ3A 3UR8A 1QOQA 3TJIA 1LLOA 3BTNA 4HMCA 1KTBA 3VIGA 4ZQMA 1OF6A 1D3CA 1F3WA 5MKGB 1CENA 3UQNA 1WAUA 2ZTJA 4KF1A 1FWCC 2PWVA 3LRLA 1TMQA 1YDYA 4G56A 1XPYA 2VX4A 2DPEA 1YXDA 3MI2A 4H7VA 4DM1A 4HD5A 2BDQA 1CZ1A 2DEPA 3WF4A 3ARPA 1G4PA 1RY8A 4HA0A 5E9XA 2ASHA 5DF0A 4NAEB 1ME7A 4GI8A 2NVCA 4PL1A 3PZIA 4LEQA 2NT1A 2FPVA 3DFHA 1BYDA 2GGEA 3U4AA 5EMMA 2A5HA 3BG3A 4LCQA 5RUBA 3DENA 1ZP4A 1Q63A 4LALA 2VR5A 3WLHA 3M6DA 2YXXA 4ZFCA 4JIPA 3KW3A 1VS1A 3O7UA 1FXPA 3UZZA 4QE1A 2J62A 1JFXA 2PDNA 3WQFA 5KEZA 1XM3A 4Q8PA 4AZ6A 4IMAA 1HKWA 1JZ2A 3S1UA 3W9ZA 3PR2A 5HUPA 2BHZA 3QXBA 1CBGA 3HPAA 1V3MA 4LSBA 3VD4A 3N04A 1XRVA 2X1TA 1ITXA 1VPYA 4N2YA 1EBGA 3UZYA 3CIWA 2OEMA 4MWAD 3T0AA 4Q8TA 1GVFA 1PXGA 4N0RA 2FZNA 4OU1A 3CAVA 3NWRA 3EWBX 3ARYA 4QS5A 3BSMA 1HVXA 4UTMA 3EDKA 3VKDA 2WOQA 5TQLA 4PEEA 3QH2A 5BWAA 2INFA 2C13A 4BQ3A 3QEZA 5CSRA 4GJJA 6A3HA 1J11A 4HB7A 2Y8UA 3CL8A 4IP4A 1R47A 1HX0A 1OIMA 3V0UA 1O7AA 3RPMA 4B2DD 3QY6A 4W7WA 3UXKA 3MMTA 2J9YA 4LF1A 2YL5A 4D1IA 3IRSA 2HJPA 4XAFA 3K13A 1WQ5A 1GVRA 1H1YA 1XLIA 3JW7A 4JNMA 1WDWA 4DXKA 1BXBA 1EJWC 2Y5JA 1RALA 4GE8A 5H6HA 1UIPA 3A13A 3OHIA 2IKHA 4GJ1A 5AHIA 2BBFA 1OK6A 1A50A 3WF1A 1FCVA 4XQ6A 5AYIA 2ZTKA 3P74A 3AXIA 5GQBA 2OX4A 4FZIA 1LJYA 2F6XA 3PZTA 4NAFB 3PY2A 4YN5A 2Y61A 2G3NA 4KRZA 1YTKA 3LYEA 2O92A 4CQAA 4DWSD 3FIGA 5FEPA 4JHMA 4LH8A 4DELA 3DBNA 4W93A 1BD0A 5LXXA 5IDZA 3W82A 5F2IA 3W29A 4BFAA 1UP0A 1PDZA 4DN1A 2Z4GA 3S2CA 3ZSSA 1P7TA 1M7PA 2FYMA 4RNFA 3EMQA 3KL0A 1FOBA 3Q2DA 4Q4SA 4XKMA 3TYEA 1D3GA 3CHEA 3NQGA 5A8MA 3VKKA 1UZDA 1KWGA 4S3CA 1FDZA 1CXIA 3PANA 1G6CA 3TFCA 3E3HA 3UVIA 1HNYA 3W26A 4C7FA 1C7TA 3N2TA 1UD8A 5DCBA 4GWEA 2V81A 1ZNNA 1ONRA 1Q6QA 4W87A 3GXPA 1OZMA 3ZT5A 4YPJA 4Q6JA 1EKOA 4XD6A 1K8XA 1XXXA 4RNHA 1JCJA 1Y65A 3MBDA 3WBEA 4O11A 5TNVA 2XHYA 2BMBA 4HNTA 3DI1A 1XYCA 3KOYA 2GSEA 1DQUA 1WV2A 5CG0A 5JBEA 3A64A 1QRQA 1F61A 4ZXOA 4PODA 1VFOA 4O17A 2XFYA 1AH4A 3IIPA 1ZU8A 3IK2A 2ZRWA 1SFSA 4JOMA 3RHGA 3OVPA 4GK8A 4D2JA 4FA3A 1SW3A 4GX9A 1UKPA 4GZJA 3ME3A 4LVBA 4DI9A 2FDMA 4O28A 3BW3A 4R7WA 4IF2A 1MNSA 3VA8A 1ZTVA 4D6EA 4Q4OA 2FH6A 3EA3A 1UR0A 1B3XA 4FNUA 5CPLA 3O07A 4HOWA 1JD7A 2O9RA 2XIQA 3TN5A 3VIPA 3H7RA 2CLOA 4MZYA 3R79A 1H09A 1M04A 4K68A 3VAVA 2PBGA 2FLIA 2J6XA 3GFXA 3V3WA 4V15A 2ATSA 3T44A 2PEVA 2XDFA 1ZBWA 3VE7A 3GR7A 3R13A 5KMYA 1TSIA 1GHRA 3TA9A 4QLLA 4U2ZA 2I9EA 1IXOA 1UROA 1FWWA 5I3IA 3GIQA 2UY2A 4JQ2A 3R10A 3ZLFA 3MSDA 4K1WA 1AW5A 1VBUA 3W76A 4QQUA 2ZUMA 4JICA 5HJYA 1DPMA 3L66A 2A7PA 5GNZA 5HATA 3CUZA 4GUGA 4QLKA 3GUWA 3LGGA 2TAAA 1IWBA 3PTKA 4GYFA 4FNTA 2VD8A 3PBYA 3R12A 3E9AA 3G1YA 2H8ZA 3TTSA 3SRKA 3S5YA 3XIMA 1GKPA 5CZTA 1BRLB 4PUMA 4GLEA 5BRBA 3NEHA 2VR2A 2PWFA 1FFRA 3ZT6A 3IJ7A 4W85A 4PB4A 2QNEA 3BVJA 1TR1A 5EFFA 3FA5A 2REQA 1TTJA 5CEWA 2FZ8A 3TC7A 3V35A 1XH0A 3PBVA 2CZEA 3ARUA 3MUAA 3BAKA 4L4MA 3RITA 3WJXA 1GZGA 3AS1A 4QJ4B 4E4UA 2CLMA 1BF6A 1N8FA 3VNYA 3U5UA 2PDIA 1ZFJA 1DE6A 1LRQA 1R85A 3TMQA 1UKTA 1Q13A 3WD0A 1S46A 2HXUA 3AIEA 4JTLA 1KBBA 4JBRA 2PDMA 5IOBA 5JH1A 1DWGM 1CB7B 4V28A 1Q2SA 3P80A 1JI2A 1W8SA 1EFZA 5KZMA 2XZ9A 3BLKA 1EZWA 2B7PA 2POTA 1OY0A 3SM0A 4XTIA 1H60A 3LSCA 3WLNA 4IJCA 4UOQA 1TPWA 2VZVA 5I77A 2W91A 1I4NA 1XLKA 2HEJA 2J7DA 2DJLA 4QEHA 1HJVA 2WQPA 1XIBA 2QCGA 4BI7A 3V1PA 3E2QA 5E9AA 1TTQA 4L9XA 1ZP3A 2E25A 1GOMA 4CD6A 1J5TA 1PTAA 2IQ0A 2V2DA 4LUSB 4CKQA 1P1MA 4Q4PA 4ZE4A 1F73A 1SVDA 1IIHA 3P8JA 4I6VA 5CC7A 1ZL1A 1CXFA 1TZ7A 3CXOA 4JTDA 4RDZA 3EA1A 3P5YA 4YS1A 1G4SA 1TUXA 3M44A 1W9PA 3TROA 3OU8A 4ONVA 5GJMA 3LZ5A 1IXQA 4M0XA 3S1VA 3UESA 1B2YA 4L80A 3GSMA 3HG5A 2ZUUA 1YDOA 3WUEA 1XG3A 4G7EA 5EU9A 1MQPA 1H62A 5L9FA 4H8HA 4H04A 2XVGA 4DWSA 3TYZA 3FXGA 2QW5A 4LS1A 4AVOA 3FYOA 5K9DA 4J3UA 4PUNA 4M29A 3NL3A 3CUGA 3QR1A 3JU2A 5GPRA 3TW9A 2G97A 4GBUA 1ZCOA 1EIXA 4M80A 1VZWA 2RHGA 1E73M 3U6WA 4MUPA 1KCLA 1JR1A 3NQMA 3GXMA 1I2NA 1QO5A 4AZCA 1YHTA 1LUCA 2YPIA 3A47A 5FCZA 4UNKA 1FBAA 4M81A 1QHPA 3W7QA 2F84A 2BHUA 3A12A 3LNMA 5E0FA 4X0NA 1YXCA 4KEUA 2WNZA 1YYAA 3HFTA 4NZJA 5BXRA 4R53A 2JFEX 3LPOA 4YIWA 1EYWA 1NDWA 3CZEA 3HPSA 4HMEA 4V27A 1JDEA 1I8JA 1KW1A 3KBJA 4IMEA 1JAKA 1EQCA 1VFHA 1DKWA 2E6FA 2RJHA 1YKWA 3O1NA 4KEZA 4B9YA 1VKFA 3OBKA 1NQ6A 4QITA 4L6DA 4RPPA 3TYUA 3RJYA 1YADA 5DT5A 2X8RA 4KGLA 3PUOA 2DVTA 3UXIA 3R7MA 1Q6DA 2QZRA 3CMJA 1KFCA 3MYPA 4AWEA 3P7YA 3PZOA 2UY4A 5I3FA 4LBSA 4JTUA 4FS9A 1FQ0A 3RGTA 4AMCA 3C6CA 3MHGA 3GTXA 1HO4A 3W2LA 4YTUA 4DUOA 3PPGA 4D6CA 2WMHA 2YLLA 2GJRA 1H7PA 1LRTA 1YW1A 3F4DA 3T8QA 5H91A 3MUY1 1RJPA 4KWOA 3VC6A 1W1YA 8RUCA 3UBPC 3WJZA 2F8QA 4DHGA 7XIMA 5CPQA 4DJDC 2XIIA 1H0IA 1PVNA 4QFUA 4QAIA 2YFOA 5IFPA 4A8RA 4WKAA 1HQTA 1E6ZA 3NQ2A 4CVWA 3NVTA 3GS6A 1D3HA 3CZJA 4JYDA 3I3EA 2X09A 1L9WA 3FAWA 4LAUA 2PFHA 2IS7A 1CECA 1RY0A 2G8ZA 2HVOA 1QCWA 3MUCA 4M6UA 4UTJA 1V6TA 1BRLA 2JIWA 2ONEA 2DUAA 2WCAA 4HCDA 2P1FA 1IZCA 5T26A 4JTRA 4EPEC 3SZ8A 3BG9A 3TXVA 1EA9C 3W1NA 4TUFA 1P0EA 1DORA 4HZ7A 4RV8A 3QV6A 4OKDA 3L4VA 3GAKA 5AHMA 4JTJA 2C6QA 3HQOA 1V93A 2P53A 2QUUA 4Q8QA 2QCMA 3TR9A 1P0DA 2PDXA 3MPGA 1JZ3A 4KERA 4I9TA 1B9ZA 1E4IA 4ACZB 1AJ2A 2Z1VA 3WDIA 5DMLA 3NZGA 2Y70A 4S3DA 2REQB 1ADSA 3LBOA 3W7DA 3TV8A 1J0IA 2R1NA 4PUKA 3CHCA 4K37A 3W74A 5AFDA 4P61A 4HNOA 1BYCA 2DZAA 5D4YA 3WLJA 4UTFA 5LHFA 2H9AA 5HK4A 4GY7A 1WZAA 4H3DA 2VFHA 4JTEA 4MY8A 4Z1DA 3N18A 5LIWX 4YJ5A 4H9MA 3LERA 3MUZ1 5HNNA 4C6CA 2XU2A 3WBXA 3QLDA 2VGFA 2YKKA 2W79A 1FVPA 1VQTA 3VDHA 2VX5A 1BFNA 3ZR4A 1OYAA 3EMCA 1MZRA 2PE4A 3E49A 4DYKA 4LUTA 2GJPA 3LENA 3M0JA 1QU4A 3SCRA 1QWKA 1E6RA 3QC0A 1OFEA 2ZVIA 1HO1A 4FAMA 3EOSA 1T7LA 2YB4A 4X60A 4ZB0A 2OCZA 2ESCA 2G96A 5LZLA 4K3ZA 3WEOA 1XLHA 2OT1A 3SJNA 1OQFA 3VILA 1DJZA 3F5KA 5HULA 4FXSA 2ZA2A 3P67A 3W2NA 3ONCA 3OZOA 5FKYA 3LSBA 4AHQA 1KGWA 2J74A 3TP4A 4PN2A 2W5FA 2WLZA 2W63A 2GDUA 3GW3A 2XIOA 4H9YA 2PP1A 4DPQA 2JIEA 3UPWA 3Q67A 1R7OA 3ARTA 1EC8A 3CK5A 3F4NA 2ZX7A 2OZTA 4X0VA 9XIAA 3ZJ7A 3CLMA 3G1AA 1TWWA 4F79A 1MW2A 4Z1BA 3SJ3A 4MDPA 4K1GA 3UZWA 3SGZA 1X96A 5CSYA 5GNXA 4HNVA 1K8CA 2BVWA 3QR0A 3R0DA 1EJ7L 5A8GA 5KZ6A 3WNNA 4P7OA 1TV3A 2PTDA 4DXVA 4IGMA 4W7UA 4YHEA 3S3GA 1M03A 3ITVA 1HP4A 3IJ6A 2GQ3A 3GZ3A 3I3BA 2E6YA 4C6BA 3WNLA 4UQEA 4Q22A 4JKLA 2ZRXA 2PLMA 5U7SA 2X2GA 1G9HA 1HFBA 3BCFA 4FI4A 1RVGA 1M7JA 1IZJA 1H4PA 3M0YA 4C6MA 1S2WA 4KT2A 1FHUA 3H2CA 3PUEA 2EXOA 3PTMA 1KLZA 2HK1A 3WK3A 4PMYA 4P5UA 4ACYA 1DIOA 3OVRA 3KDOA 1CLKA 4PEKA 3PZ9A 4PCTA 3A4AA 1A5SA 3DDMA 4OV9A 5CPOA 2PODA 3V16A 2NWRA 1MQQA 4AB4A 2ZRVA 5E1QA 3VGEA 2OODA 3ZWSA 3MMDA 3GVGA 4LRTA 2VJXA 4AC1X 3KCJA 3KTCA 3RNDA 3TU9A 4LFYA 1UP2A 2AMXA 3OHMB 1W9UA 4JKMA 1L6GA 1ZSXA 3MJMA 1WB0A 4GX8A 5L6UA 5M17A 3NM3A 3WD4A 4JZ5A 5BXSA 2C0HA 3KVMA 1GKQA 3GDTA 1MXSA 3W7GA 3HV8A 1MEWA 3QMRA 2I5IA 1JZ5A 2Y24A 4KETA 1WNOA 2XVNA 2ZZ7A 3ISIX 3OVQA 2HPIA 3ZZ1A 4DLMA 4F2UA 6REQA 3S2NA 3VX0A 4DJFA 1M9HA 1EJVC 4DBSA 4U28A 1ZS2A 1Z41A 4GXPA 3WDPP 3FKKA 3QOKA 5D9PA 1O60A 4S3FA 1W0MA 1MXDA 2Y4SA 2RGLA 2ZQ0A 1VBRA 1PTGA 3TWBA 1DWHM 1A47A 3GFZA 5HR6A 1JCTA 2D0FA 1EZ2A 4UR9A 1KRCC 3W71A 4NJKA 1KCZA 1CGVA 1GQJA 5FD0A 1J9YA 2J8GA 3SCWA 4DRSA 1V6YA 1DL3A 2ZC8A 4GFIA 3O6DA 3W7LA 5ABGA 3CBWA 5BXPA 3LPFA 4WJ8A 2Z1KA 9RUBA 2AMGA 3W6YA 4LT9A 5A8PA 2EG7A 1WKEA 2GJLA 3EEGA 2GVLA 2NXHA 3FGCA 3H26A 3S6DA 1JVNA 4QJ1A 5FJPA 4IGSA 4LVGA 2WKGA 4C6PA 2NV2A 3PBUA 3EB2A 4Y9OA 3MDWA 4MLRA 4MWAE 5FL0A 3UG3A 3N2XA 5FJRA 3CPRA 1UIOA 2E68A 2Y6ZA 4HSHA 1XYAA 1Q45A 5HNRA 3G1RA 4W89A 2NZLA 4ZBCA 4J1OA 1E5JA 3WQOA 1V3JA 4GO9A 4UQDA 4H83A 4H9XA 1UD6A 5I78A 1H7OA 4HHLA 3BO9A 1VHCA 3TYDA 2AQVA 2Z27A 5A94A 5C2GA 3V0TA 1HN1A 3HN3A 4UOZA 4Z2IA 3E02A 3FJ6A 4FNQA 3NXLA 3K1GA 2YCLA 4B91A 5AY7A 3W2JA 4TTUA 1XYFA 1WOBA 1AUSL 2CNCA 3AZRA 4HK5A 1PV8A 5LA0A 1J10A 2CZFA 3LQGA 1UWQA 2GVJA 1M53A 1DIKA 1KCKA 4IPJA 1Z6KA 3PSWA 2AOSA 2Z0IA 1VFFA 5I7GA 3W22A 2GDQA 1CYGA 3SQMA 1NOWA 4ZQPA 5AC6A 4JCMA 2HPMA 3NOEA 3BJFA 1TPB1 2XH2A 3EWWA 3S1XA 2XFRA 4LUYA 3FYYA 2AL2A 4E0CA 1HF6A 4P2VA 1E9ZB 2X2YA 2X0SA 1KFBA 1ZHAA 4DWSB 3POCA 5LIUX 2CC0A 1XP3A 3FN9A 3WELA 1A5AA 4KFNA 4OWGA 1OCNA 1E3XA 4N9BA 2ZYFA 4UC5A 1B30A 3UGVA 4CCCA 3DHPA 4UWMA 4O50A 4F0KA 3W02A 1UR9A 1PKYA 4JL1A 3JUGA 4PSPA 3H2OA 1KRMA 3EWZA 3TAKA 4RW3A 1TTPA 1PX4A 3AIVA 1M6JA 5G1YA 2E5CA 3H4GA 5CZSA 3WEZA 1TJ0A 1JDAA 1AMYA 1I75A 2DU2A 3EB4A 3O3RA 4OE7A 3QKZA 4O1BA 1UWRA 2WMIA 4A6GA 4LC8A 3OODA 3KBVA 5DY2A 1S38A 2ZRUA 5CJ5A 2HBVA 4UIOA 4RV3A 2Y5SA 2R1MA 1A5LC 3NA8A 2CWNA 2W6RA 1IQ8A 3NM1A 5A1AA 3W72A 2WYSA 3GKFA 2QUTA 4IHCA 2CKSA 3UW6A 1HL8A 5EGRA 4DLFA 1EPXA 3KOWA 3PZMA 4HPNA 2UWFA 3ELFA 1G4EA 1P0NA 5KZEA 2IQTA 1LWJA 2O7QA 1RQHA 2Z2BA 4PCSA 3NEVA 4PBFA 5MKGA 4C6FA 2ZBTA 4KESA 3K1DA 2CLHA 4MFEA 2C3ZA 2AKZA 1XICA 3L7RA 5EMLA 3R11A 2WC3A 4FR6A 2EPHA 2YL8A 5E09A 2G3FA 3S6TA 5HR7A 4A3HA 4QJ3B 4IGHA 1UUOA 3LMZA 2ZZ3A 3T9PA 2J66A 5ABFA 1UUQA 2BNJA 3WYZA 1AJ0A 4NF7A 1CXEA 3L65A 1JCMP 3N6HA 2DT1A 1LWHA 2PURA 2PMQA 4YTRA 2PGRA 3WBYA 3WFLA 3CUHA 3M7WA 1LQAA 4NX0A 1LQ0A 4UNLA 5D2WA 2Y2WA 4A4AA 2OXNA 2YFNA 3NAVA 1D9EA 3RR1A 8CGTA 1UH3A 3B06A 1BKHA 2J7GA 4NZCA 1T8QA 1EOMA 2DIKA 3ICJA 4RZ6A 4GYKA 3M7SA 1EF2A 3AHXA 4QS6A 4H9UA 4DM2A 1B57A 1IR1A 3B4UA 1KC7A 3SGGA 3RXZA 1CGXA 1WE5A 3KLLA 3I6TA 2XH4A 2NSOA 2P0IA 3ITGA 1JUEA 1LBLA 1BHGA 3F2CA 4Q33A 1F8IA 4HYVA 2HVNA 4ORIA 2A3HA 2XM2A 2J7HA 3DFYA 1K7XA 1SR9A 4UFHA 3BK0A 2P88A 2XSAA 1KQYA 4YWSA 1NDZA 3TC3A 1K1DA 3U7BA 4BY3A 1B0IA 4C91A 3SUUA 1HKVA 2ZWYA 4TTGA 4JY9A 3VOJA 2WM0A 3H2FA 3A9BA 2J25A 1P5BA 2WVVA 3GB6A 2C1HA 4TOQA 4ACZA 3TOYA 4L1WA 1HVQA 3ZLHA 2HCVA 4DEFA 1TWDA 3DXIA 3AUJA 3NQBA 3H55A 4J4KA 2WHKA 4AZBA 1RH9A 3E0FA 2BODX 5CAHA 1JZ4A 4EE9A 4FF7A 2ICSA 4O14A 3C2YA 1FY6A 3SY1A 4QQ3A 1VIZA 3HU7A 4U10A 4O57A 3NO5A 3S8HA 4DO6A 2YA2A 1O95A 1XC6A 1EL3A 1A0CA 1L6YA 1XF0A 1F07A 5EMKA 4DBWA 1FA2A 3EPMA 3ZM8A 3VYLA 1HUVA 3GX9A 1BXNA 4HTBA 1XLLA 2XM1A 1A80A 1VBGA 4WSHA 6ALDA 1W1VA 4UTWA 2D2GA 4XBKA 3TN4A 2QV4A 4RL3A 2D0HA 3TXZA 5DY3A 1RLDA 4OBSA 5FAJA 1UWSA 4EAMA 4PTVA 1QNSA 3AS3A 4BI6A 3VIHA 1ODZA 4GC3A 3TSMA 5BOFA 3UG5A 3EXSA 3HGOA 3GTHA 1GJUA 3ORWA 3O63A 2QGYA 1K8ZA 1A3WA 2CBUA 1XRSA 1K8YA 1NQKA 2Q09A 3J7HA 1U1JA 3WMSA 2Z7KA 4R7JA 3ES8A 2XVLA 4I90A 1XSKA 1NFPA 4RX0A 1J6PA 2PB1A 1ZAJA 1JPKA 4GGBA 3ZS4A 1I9CB 3CIXA 4N6FA 1TVLA 5CGMA 3M41A 5D2YA 3WZ0E 1GEHA 4IMDA 3EA2A 3KTXA 2QIWA 1TRIA 3AALA 1AG1O 2CU0A 2DZVA 3S46A 4WLCA 1Q6RA 4X61A 4B5XA 3S1GA 2WZTA 1PHQA 3UG4A 1P1XA 1JCLA 4RE3A 2DSZA 3LCLA 2VFGA 2QMJA 4Z1YA 4QNEA 2HMCA 4O1EA 3MI6A 1WDRA 4UR8A 4K36A 1VEMA 1V4YA 3DG7A 2RDUA 2C71A 5E70A 5HXMA 4GMEA 3A9IA 4GNKB 2WCGA 1E6QM 4AIUA 2WVVB 7REQA 2Z1XA 2J13A 1D7KA 2NLYA 2ACSA 3N13A 5LIYX 1Y7VA 2J4GA 2V5LA 1DJNA 3WDJA 3W27A 2V5CA 5A2AA 1ZAHA 1JGIA 3UR2A 1QI0A 2EPNA 3NG3A 3UXLA 2IMRA 2WKJA 2GJXB 5E6YA 3WH7A 3W07A 1TJ1A 7PTDA 3LOTA 2HK0A 3MP4A 3KM8A 1H2JA 2I5QA 4HP5A 4ZOCA 3OYZA 3ZT7A 4R7OA 1LZOA 2VELA 3VD5A 3T8LA 5HJXA 4DF1A 3O8AA 4LX4A 1DYSA 1R2SA 3SRFA 2A79A 4XZWA 1VCVA 4H9VA 3N2MA 4YTSA 3ABRA 2PWGA 1V79A 4K8GA 3GYCA 3UYCA 3B0VC 1XLDA 3C8NA 5B80A 5G1TA 1KR0A 1LOQA 4LBUA 2PCQA 4H2CA 1E5NA 3KBMA 3C0LA 1XSJA 4GZ7A 3IS4A 4N9EA 1OC6A 2Y1HA 3BQ5A 2FQIA 4JTFA 2YJQA 4I5XA 1MYRA 4UCFA 4NZ1A 1K4HA 1ITCA 1XLCA 5FI8A 4KCVA 1JZ8A 4GISA 3H22A 1MZHA 2JBMA 3U8GA 4FNPA 1U83A 5DXXA 3H6OA 3V18A 1SFTA 3SSJA 1OJXA 3PJWA 2E0PA 4MAVA 2C16A 2QGHA 4GKTA 3B9OA 3SCSA 3WG6A 2JF7A 4CNPA 3VINA 2P5NA 1XGDA 3VE9A 5BU9A 4Q4RA 5G1MA 3IK4A 3KOFA 3TR2A 3VOHA 1IEQA 3GR4A 3RCNA 2E5BA 1PYMA 1MMFA 4GH1A 4HA3A 4J3WA 2CETA 3G8RA 4P8WA 1Z7AA 1GOWA 4XUGA 4K39A 1EHNA 5J8LA 1ZUAX 4AVFA 1GQNA 3P14A 1YTEA 3EBVA 1W9BM 5C70A 1E9YB 4MZ1A 1RJRA 4JD4A 3WQPA 4HJFA 3CASA 5F1VA 2PDJA 4KWUA 4IQLA 4Z2KA 1H5VA 3MVIA 2QXWA 3WUFA 4B5WA 4I9MA 3HPXA 4B16A 1BWKA 4G6CA 4WIWA 4AF0B 3UVAA 4NJGA 2VFEA 4BCEA 4CNSA 4V2XA 3EDFA 2QF7A 3MUXA 3ARZA 4IUOA 1GZJA 3OPSA 3EXTA 2ZE0A 4UTKA 1T0OA 3KOZA 1BG4A 3RN6A 3QW3A 4DZAA 2JKAA 1TREA 4UNIA 1EP2A 2R24A 4ZB2A 3ARQA 4Q7NA 3F4CA 3I4KA 2W3ZA 3GDLA 1OBAA 1ISXA 3UWQA 4M19A 5JBDA 2WV8A 4B9ZA 1OF8A 5BZAA 3ZYZA 2BOFX 4NNAA 4D72A 3MP5A 3OLIA 3GYEA 5KZDA 3RPTA 1ZJHA 4FP1A 5C2CA 1JZ6A 5LNSA 4JTIA 2QIIA 3KL3A 4G8TA 5JMUA 3E5PA 5EKYA 4MKNA 3C56A 3IUIA 1GNXA 3CWHA 4Y9MA 4F4RA 4AIEA 4H1ZA 3K8MA 4ILSA 3RX3A 3S4TA 1FKXA 2QPSA 2V5DA 3R8HA 3APGA 2Q02A 3LCFA 3SDOA 3CTLA 3T55A 2QCNA 2EJAA 5B7YA 3BOLA 3FY1A 1DJYA 4IXXA 3ONBA 3QLLA 1OFAA 3AIWA 5IRPA 2FHFA 3QTPA 1E9LA 3IVUA 3XISA 1DQWA 6REQB 5LNUA 3NPVA 2WPGA 3TZNA 1AK5A 3U57A 5H2ZA 3QMSA 3W83A 3F7JA 3NGFA 1J93A 1SJBA 1A5OC 5CC3A 5D8WA 1GQLA 4JN7A 4ZB5A 4CD5A 2JEPA 3D3AA 2OVLA 4PZVA 1ONWA 2ZFAA 1VFLA 4OFCA 3C2RA 2XIJA 5M3WA 4LPCA 1KTCA 3NL2A 4YMZA 1VPXA 1UASA 4E6MA 3AZSA 2B7OA 3GC4A 1QI3A 3STPA 1TZ9A 4IL2A 1XQLA 2FTWA 2OQYA 4NYUA 4KCWA 3CGTA 2X0YA 4GUHA 4KIRA 4M6QA 4N02A 3I65A 4AWTA 5AKQA 3T40A 1V02A 2IKGA 3G22A 1G69A 1E0XA 4NX5A 1A53A 4C6EA 3PK7A 4HZ8A 1RPKA 2DIJA 4B5NA 3W7IA 3WJSA 5LYRA 4ZODA 4DNMA 5F4WA 2XUCA 4GD0A 3CQKA 3OBAA 1ESWA 1R3VA 3D6NA 1LORA 2DZPA 3FX4A 1L2UA 5ECVA 3Q94A 4FSAA 3DYPA 4DZIA 3LPGA 3DGRA 3LY0A 3RPDA 2C19A 1GW9A 3W7EA 3G8EA 1V3LA 4LYPA 3UWVA 3UR5A 3HPZA 1MRAA 2WNNA 3H21A 3CH0A 2IPFA 4YYFA 5C9WA 1G01A 4Q8UA 1JNEA 2CHRA 5D9MA 2BXVA 4C60A 3RF9A 1F4AA 3NZ1A 1B3ZA 5HMDA 3NQDA 3GNDA 4XISA 4G5DA 1HZYA 1TB3A 3IV8A 4WOZA 2PDHA 4M8UA 2YLAA 2QV5A 2XFFA 2YXGA 3W2KA 5LNRA 1WZMA 2WNWA 3PTQA 1EGMA 2D2JA 1YMYA 2PDGA 2CHOA 5REQA 1R3SA 3EWDA 5IBXA 3GDBA 3PZNA 3VM7A 4MWAC 3FOKA 4HZ6A 5F2MA 1S3TC 5T9CE 1OCQA 1W54A 1JL8A 1AQFA 1QNVA 1MO0A 2OOGA 3L4UA 4H4IA 3AAMA 1AL7A 1VGAA 2F7FA 3GE7A 3VOGA 4GJIA 3L21A 3HJZA 2V63A 1QW8A 4LV4A 3UJEA 3FGCB 3DHFA 4IIGA 3WD3A 4LC6A 2X1IA 1L0PA 5AYXA 3N3TA 1SM9A 2CFFA 1B3YA 4H19A 1ICSA 6CGTA 3L67A 3U9IA 2HISA 1OT2A 2VZOA 1MW3A 1GTEA 3FAXA 4GZEA 3T42A 3WF2A 4MNMA 2EGZA 2WKLA 4KBXA 2VL4A 4R27A 1GVEA 3TMLA 2NQ9A 4Q3MA 1RHCA 1O4UA 3UWZA 5KITA 5BYWA 1JAEA 1FWEC 3SCQA 4GUJA 3KEHA 4S38A 1UR4A 1QBBA 2ZXAA 2E28A 4IZGA 1NY1A 2J9ZA 2WJZA 1GVYA 1EB3A 1GHSA 4C6LA 1ZJAA 1OX4A 4JIRA 1YPFA 2WVUA 4AWSA 3IEBA 4Y6GA 1OYCA 1XHGA 2WW5A 3MB9A 4Q4QA 4XG1A 1H7XA 3C0JA 2D2HA 3W86A 1LL7A 1KM2A 5AECA 1O12A 4JAWA 1X1NA 5JUVA 3EDEA 1EF3A 1NOFA 1S2VA 2RJGA 2A21A 4CQBA 1LOLA 3IJLA 1O1ZA 3QV9A 3TLQA 1V7YA 2QKFA 3AO0A 2Z1BA 1C8YA 3BG5A 3IAQA 4ZFMA 1QBAA 1ML1A 3EWUA 4FXRA 5A6JA 4EPBC 3WLIA 1GCYA 1E0UA 3S0CA 4HQVA 5BMWA 4U33A 3FNDA 1XFCA 1IGSA 1CCWB 2A3CA 1R8LA 1SW7A 5A2CA 2GUUA 5HWJA 2PDYA 2VEIA 4DJFD 3GVWA 4IMCA 2YCJA 4CN6A 2INZA 1EQPA 3E12A 1QDSA 3UYIA 1WKDA 3W1UA 3BAYA 4R9OA 2CYGA 3WJYA 3IIZA 1H51A 4B5VA 3TW6A 3WCZA 3W7RA 2QCEA 2Z28A 3RO6A 1TIWA 3OGVA 2OB3A 2DSVA 1CI1A 3CWNA 1GQKA 3DHUA 4OVXA 5JQ9A 1OG6A 4GIYA 3IVTA 5ECUA 3KOXA 3LHYA 5F1UA 4CD7A 4X63A 2PWHA 3PC0A 3EKGA 1AD1A 4RNIA 1OIFA 4W8AA 1DQXA 3R1ZA 2YZRA 2C91A 5G5IA 2ISWA 4JCLA 4WRHA 1XBYA 2VZTA 1UP3A 2PLKA 4QISA 3XINA 5KINA 2P8BA 1I1WA 4TQTA 5DCEA 5EPDA 3M5XA 4GYJA 5I0DA 2NQ5A 1PAMA 1TE6A 3SFWA 4EIVA 4XZIA 3RMEA 1YQ2A 4UMAA 3TQVA 1VBHA 4C1NB 4CGTA 4HPHA 4WXYA 4O1FA 4CU6A 4PBGA 1V03A 3K2GA 3WLKX 4D6DA 3GG0A 4CQ8A 3VOFA 1UCWA 2O4QA 2GOUA 2J7BA 3A23A 1G4TA 4Y9AA 4JDBA 3PAOA 1XRTA 5DRIA 1JF6A 1S5MA 1EH9A 3THQA 3ITXA 3A6OA 5T9BG 4AFYA 1UW9A 3RDKA 3WQ4A 2GVYA 4O10A 1WXJA 3GFYA 1GEQA 1NP0A 4MOZA 3FYPA 1E40A 3VNLA 1W5PA 4HNCA 4R5EA 1OADA 2GQAA 4I7UA 3B8DA 2PC8A 4HHPA 4AC7C 4CUCA 2RKXA 3HURA 1LLWA 3HZ3A 4S3GA 4K6AA 4O0QA 1R30A 2NX3A 2NT0A 2PLCA 4GQQA 1MW0A 1W3LA 3W3OA 3E2SA 4OV4A 3MZNA 1Q8AA 4GQGA 5EL1A 3F1QA 4MY1A 1L6SA 1YRRA 1B54A 3VIKA 1KD0A 2WMKA 2VRKA 4BEUA 4RDWA 2NX1A 5JU6A 3MP3A 3P62A 3LTYA 2NVAA 3NNTA 4ZOBA 2EBNA 4FF5A 4CN4A 4L9ZA 1QI2A 3USBA 2QUNA 4PUJA 3FA3A 3CS2A 4DUVA 3P61A 3HGRA 1V5XA 1X1ZA 2UV8G 1WAWA 3RRXA 7A3HA 2QCFA 3NO1A 1GOOA 3I7SA 2PGWA 1HJUA 3R2GA 3UNDA 3LS9A 3PG8A 1OT1A 4JIQA 2XN0A 2ANUA 3QN3A 3THCA 4ADSA 1Q7MA 4WVXA 2V6AA 2OLSA 3ZR5A 3M0LA 5K4ZA 3ZVHA 4N42A 1WO2A 1E1EA 4PMRA 1Y5XA 2Z24A 2QUMA 2CEQA 4LVAA 4ZEPA 3SIMA 1E51A 3SECA 1DV7A 2ABBA 2W0UA 3O2LA 1CEOA 3CYVA 4AH7A 3OP2A 3BANA 2CXGA 3PBGA 1ZJBA 4OBRA 5B7ZA 1H49A 3NZQA 1X98A 4XD3A 2QDEA 4U4MA 4IIEA 4ROPA 1P0BA 5D37A 4CEUC 1IXPA 4UTHA 2WC4A 1FH9A 3L2LA 3B4YA 3FVDA 3ALGA 1Q6OA 2VEFA 3WH6A 1WUEA 1UOKA 1F5ZA 3PM6A 4GC4A 1N8WA 4HA4A 1M01A 3MW7A 1OX4B 4GYPC 4OQVA 2VUYA 1AW2A 4MG4A 5AZ0A 2A0NA 3URQA 1W17A 1VEPA 1WUFA 4GNJA 4L1GA 3LLFA 3RM4A 3GH4A 2RGMA 3TX9A 2OG9A 3AMLA 3NQCA 3OGRA 2PU1A 4W8BA 2YYTA 3CH9A 4NAFA 5AC4A 2VQUA 3RO8A 4PH6A 4GRSA 3CB8A 4L9YA 5CZ0A 3BJSA 3QQ0A 1BGGA 1KLYA 1H7NA 3OVGA 1PKLA 2QQ6A 3TNOA 4DYEA 2DSKA 1TV2A 1UC4A 3PZVA 1IT0A 1LG2A 4NL1A 4DVOA 4DAFA 1UD4A 1W3HA 2CERA 5HPCA 2R82A 5HQEA 4IFOA 3BLFA 3GC5A 2Q01A 1VPQA 1PBGA 1XUZA 1V0MA 2BLEA 3WJWA 5FJUA 2HNEA 4S3JA 1QUMA 1JQVA 2VOMA 5HQMA 3N2CA 2JE8A 3B40A 2JGYA 1YLVA 4PMZA 1XKJA 1JULA 2XGIA 2V3GA 4D9PA 3BAWA 3ZVIA 3OIHA 3M4HA 2DSWA 5LGZA 1CXKA 1BVZA 2WHLA 2AGKA 2DT0A 1AH0A 5D2TA 1M5WA 1XBXA 2WHMA 4AZ7A 4Q7IA 4IJBA 3DKJA 4GH3A 1ECQA 2AL1A 2VKZG 2FH8A 2QCCA 4Z17A 2NQJA 4C6IA 2J6VA 3QMTA 5BMXA 2G4FA 3H24A 1SFJA 4UQCA 3VGFA 1FDJA 4Q6XA 1Z44A 3QSRA 3VIJA 2ISVA 1PJ9A 3P84A 1JXJA 4WSKA 3IIXA 1JXKA 4B5UA 5BOEA 3OA3A 5TIMA 4OGZA 1ME9A 2VVSA 3JRKA 2XH0A 2FB2A 4JFVA 2BOGX 1F05A 1I2QA 4FXFA 3GU2A 1SUXA 1UZHA 4KWVA 2DVUA 3M46A 1UUMA 4S3AA 1LYXA 2GSHA 1JYVA 2ZC1A 3ANVA 1R0MA 1O5QA 2HVMA 2QJHA 5E6ZA 1KRBC 4LYQA 1SPQA 3SEPA 4ECLA 3W88A 3RG6A 1O5KA 4HGXA 3W6MA 5CAKA 1NM9A 4CCEA 3QFWA 1XBVA 3AU2A 3DUGA 5FACA 3OGSA 3OA5A 2I16A 2CIPA 1EYEA 4PRWA 4MJ4A 4G9PA 4D6GA 1EBHA 4IT1A 4IOTA 4IIHA 4QM1A 1JCNA 1PUDA 5C2XA 2GFTA 1OX6A 3DI0A 3LTSA 3MHFA 5T91A 2WLYA 2X41A 1VR6A 4PE8A 3WO8A 4HVXA 2QAFA 2FIQA 2D24A 3WENA 1HW6A 3JVAA 1NTHA 1JG9A 3W7OA 3VMNA 3CQIA 3PZUA 2DH2A 1X6NA 1R87A 5HA7A 3V7PA 1DXIA 2G95A 1TQJA 4QCFA 3V5OA 2ZX5A 1O5XA 4PMUA 3VNJA 2J8FA 1K4GA 3R8GA 2OWXA 3NR0A 4NVTA 2EHHA 1EUAA 1X8CA 1FWHC 3S5NA 4YU1A 1C7SA 4MB4A 1SO3A 4OUIA 4IIBA 2POZA 2JK2A 4LB3A 5HWNA 1PX8A 3SAZA 4YVPA 3EDJA 2WBGA 3LHVA 5G2WA 3S5ZA 4AXNA 3WF0A 3FA4A 1CGUA 2Z6JA 2I7GA 1CTNA 4EWJA 4E2OA 3KBSA 3R94A 1W1IE 5JIWA 1A5UA 2W61A 1XLGA 3N15A 4OTKA 2X1UA 3C0SA 1VYPX 3SN4A 4PMQA 4Y8FA 5D09A 2TPSA 1DTUA 2CXEA 4P8VA 4KKXA 5DMYA 1EGZA 2D1ZA 4WQ6A 2CZ5A 4OIFA 1W31A 1REQB 2EEXA 1XISA 2FPYA 3PF3A 1Q65A 1XIGA 4M7TA 3KDNA 5I24A 1GORA 4C90A 3W73A 4ZZ9A 1GK8A 2WZHA 3DYMA 3MBFA 3HIJA 1MFVA 3BC9A 4AY8A 2ZZ5A 1GUVA 3PB2A 5JVLA 5LIKX 5C55A 3TN6A 3DFQA 3E6EA 3TTEA 3EKZA 3UJSA 4DUXA 2VWSA 3V36A 1F74A 3NDOA 5AB3A 1IIGA 1A5MC 1W2VA 2E3ZA 2TRSA 3OYXA 3F4VA 4XZBA 3W7JA 3DERA 2OYKA 2ZKMX 1BTMA 4ADTA 4ZQRA 2VTFA 3NOYA 1KM0A 2KX9A 5CBIA 1VD6A 3WH5A 1C90A 1JIBA 4MMWA 1DJGA 3B8IA 2ZZ2A 2EPOA 5DEZA 1SJAA 3BLDA 3VPLA 1EWEA 3GXNA 2FB3A 1EUNA 3A5VA 3R0UA 4HPJA 4EXQA 2XFWA 2BGQA 1Q7QA 3SUWA 1TELA 4MGGA 2R1KA 4M24A 4NZ5A 4UTWC 5AHFA 3I6EA 4Y96A 1CB2A 3AHVA 3UWWA 3D5HA 5CLWA 2P50A 4V1XA 1Q8JA 5CSUA 1O5RA 3KFTA 4UXDA 4AD1A 5A6MA 2I56A 4W9TA 4XD4A 2NQLA 3W7HA 2FTYA 3W1TA 4S23A 4EPDC 3E96A 4LANA 3VGDA 2ZRYA 2WM1A 5EMYA 3PWIA 1SR0A 1P0KA 5GJNA 2IPJA 3RAOA 5JIPA 3MO7A 3FXYA 1SJDA 1D8WA 5IDIA 2DUZA 1YPIA 2I14A 3ENLA 3TQ0A 3KCLA 1SYTA 1LCOA 1UH2A 4AXKA 1KKRA 5HDRA 1ZPTA 4M1RA 2FTPA 3AMCA 4JQ3A 4MLJA 3AFBA 3TN3A 3S42A 1EDGA 2YCKX 4WGHA 4TV5A 3HQ1A 2O9OA 1U30A 5AOUA 3R0KA 3ITYA 1C8XA 1PSCA 3WEMA 3MMWA 4ERIA 1T8XA 3LXCA 1UMLA 3N9RA 4C65A 3SCOA 1TVNA 3T09A 5I3DA 4E2BA 4AQLA 3SB0A 4ES4A 4RZ5A 4AG0A 3TAOA 2P8CA 1L6FA 3RK8A 2V2HA 3W87A 1WPCA 4Y9NA 1DJHA 3MUIA 1MEHA 5FF2A 4O15A 1KV8A 1B4EA 2QDHA 3IJ8A 3IUHA 1JJKA 3IARA 4AEFA 2EPMX 3VZXA 1TPDA 4A2RA 4PL2A 2PDCA 4AF0A 4ADUA 5DN1A 5C5YA 3S9ZA 4DBDA 1W9VA 1UWTA 3FCPA 1W5MA 4DPPA 4O1DA 5FL1A 1NP2A 3GO2A 4R34A 1WDDA 1F7BA 3NQ6A 4LUTB 3T0TA 3VGBA 1Q66A 3N9KA 3A3WA 3KUMA 2W67A 4E8DA 4O8AA 2YYUA 4WDTA 2BX7A 4FLOA 1JPHA 1JPIA 1V6WA 4ERAA 4BA0A 3H2EA 4JXCA 4AEEA 4XB3A 3OOQA 2CBJA 4NZFA 4IQJA 4NJIA 5I07A