3LV6A

Crystal structure of the mutant i218f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGFIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lv6A00
2ABBA 2QCGA 4XTDA 2ZFAA 1FDZA 2NX1A 3W84A 2Z6JA 3FOKA 2C13A 1W56A 4JIQA 2RFGA 3H53A 3EXTA 5K9DA 5CGQA 4IMEA 3LI1A 4NJJA 1ME9A 4JGDA 5FF0A 3LOTA 3O6CA 1K03A 4H3DA 3HGSA 4JY8A 3GYEA 2RH9A 4M5PA 3GNDA 3QM3A 5DBUA 1K8XA 5HWMA 3MO7A 1LRTA 4CNNA 1FDJA 3OIXA 4JX6A 3PUEA 4NX0A 2HSAA 1GZGA 1W3TA 4WXYA 5AOUA 3ZWSA 2ISVA 3TR2A 3F4WA 2QCMA 3EX6A 3FEMA 3DI1A 1A50A 2OZ0A 1X1ZA 1H1ZA 3QRHA 3R5EA 1BEUA 1YTDA 1Y0EA 3TQ0A 4TMCA 1FWRA 3ATYA 4UMBA 2Z2UA 4K7VA 1GTHA 3A22A 4UIOA 3TV8A 5LNVA 2B7NA 2G5WA 3UPWA 2ZRWA 5EA9A 3BLEA 1W3NA 3DFOA 1F5ZA 3HGOA 4HKPA 4JYFA 3CPRA 2CLFA 4JDYA 1VYPX 3GDLA 2GVLA 4EF9A 4OWGA 2CZEA 3CLMA 1J4EA 3O05A 3BGGA 3W2JA 2NUWA 2F84A 3C61A 2E5DA 1VYSX 2RDTA 2GJLA 3P84A 1ZNNA 4HNTA 3QJAA 3K30A 3ZFHA 3NXFA 3C6CA 4HN4A 2NX9A 4QIUA 1HL2A 3BARA 3EX3A 3KVKA 1QOQA 1T96A 5AHLA 1YDNA 2YFOA 2VXNA 1B4EA 2ZZ3A 4CQAA 3BGJA 2QJIA 4TR9A 5CPMA 2R94A 1ZHAA 1I4NA 4AH7A 5C5YA 1YDOA 3L2IA 3NQAA 5EKYA 5G4EA 3C56A 3IIOA 3C2OA 2GJNA 4A21A 4K8HA 3S5NA 3U6WA 1XUZA 3ZR4A 2FPVA 1FXQA 1FBAA 4OE7A 1JVNA 4PEKA 3V75A 1OX5A 3G8EA 2Q8ZA 2FDSA 4LY8A 5AHMA 3S1VA 3A21A 3W3OA 3I65A 3HGRA 2A4AA 3RLVA 4D2JA 4MLJA 4PCFA 1LORA 5G4WA 3CT7A 3KFTA 1MEIA 1JCJA 3Q37A 3TXZA 1W8SA 3RF9A 4MZ1A 4O1AA 1RPXA 5MHBA 4MIMA 4OT7A 1JCYA 1QWGA 2RHGA 2QR6A 1H7OA 3S42A 4O0ZA 2VKZG 4UFJA 4LRSA 4J9JA 3MBDA 1FY6A 4RK8A 1TRDA 4UTTC 3W7PA 1OJXA 4FNPA 3EX2A 3UD6A 3LHTA 3LLFA 1C29A 4UR7A 2E68A 4ZMGA 3VE7A 2GVGA 1I2OA 4O10A 4O17A 5AYYA 2DZSA 2ZZ1A 4MZYA 1KFCA 3I7SA 4JX5A 4M7TA 3GDKA 1Q6LA 4FXSA 3G1SA 5K7JA 4NUWA 4UUIA 2YXGA 3P80A 4ZQRA 1JCXA 3HMJG 2X1SA 5EBUA 3G18A 1S5WA 3NG3A 2Y63A 2ZZ5A 3G24A 4KWWA 1YTEA 2ZZ2A 3LHYA 1SW3A 4MY1A 1FQ0A 5BOOA 3TUUA 5DCDA 1WQ5A 4FXRA 1LTDA 3BW3A 2D73A 3PB0A 1OFAA 4JTFA 4DELA 3P8JA 4IMGA 3SJ3A 1XUUA 1K8YA 5D30A 1TJPA 3W1MA 4TMBA 3NYZA 4I7VA 1J5TA 1GG1A 4N4QA 4NX5A 4YCOA 1KFBA 4WJEA 1SPQA 3LRKA 4DF1A 3W6YA 5ABTA 5F2GA 4QAIA 4E0CA 3NM3A 1W5NA 2X1RA 3S1UA 3EEGA 3Q94A 3OA3A 1RVGA 2CLKA 1H51A 1LOSA 1ALDA 1W0MA 3MHFA 4IXXA 3G1AA 3LTSA 4EVZA 1JCNA 5EY5A 4N6FA 3NO5A 4Y96A 2J24A 1OFOA 1M5WA 1G7UA 3O15A 4E2DA 3R8RA 1PV8A 3IVTA 3MHUA 4JTUA 3LCGA 1XDLA 3NQ2A 3G1YA 2V5BA 3A5VA 5I3HA 1TMHA 1W1ZA 4R53A 1TPH1 1WV2A 3BW2A 4FNRA 3O07A 1KLYA 5LHFA 4UTHA 2J27A 4Q32A 3W1AA 3LDVA 4OHQA 4YXGA 3UY7A 1X7FA 1GJPA 3GXPA 4DPQA 3WJZA 4N02A 1L9WA 4MJZA 3BPWA 4CCEA 4FX8A 1GWJA 2EF9A 3GK0A 2BWGA 2QAPA 1SUXA 3M9YA 4Z1BA 2VEMA 3L65A 3PS7A 2A0NA 4UNLA 2ISWA 1LLZA 3W2LA 5LNWA 5A5WA 1LROA 1TCDA 3ANYA 1KM4A 4XZ9A 4AMAA 5F2IA 3W2UA 3M0ZA 5LHEA 5D04C 4FHAA 3PM6A 3LXCA 2VFDA 1QNVA 3NNTA 4RR4A 3T44A 4UTWC 1KFKA 4O53A 1OK4A 3T78A 2V82A 1H1YA 2QEZA 2BSLA 4NNCA 3CIWA 3GLCA 2TYSA 2C0AA 3VE9A 4QNEA 1TYGA 4LUIA 1V5XA 3W7OA 4YWIA 3CWOX 3A23A 4C1KA 5D2TA 3W70A 1YXCA 2ZCGA 3LHWA 2OT1A 3LBCA 3HG4A 3UPBA 2FB2A 1AL7A 3S5ZA 4JTEA 1ZFJA 4FNQA 2GQ9A 3KHJA 3STCA 2E6YA 5H2ZA 4QISA 4GUGA 1P0KA 1K8ZA 2B0MA 3EB2A 2CZFA 4IX2A 2YW4A 3IVSA 1BWKA 3MJYA 1H63A 3TMQA 2ZRUA 4PC8A 5FI8A 4JTSA 3R89A 4LVGA 5U4NA 4A2RA 1O95A 3E0IA 3CEPA 3EKZA 4AHPA 5I3JA 4GUFA 5E1QA 5C6MA 4UFKA 3L5AA 1GOXA 3KRSA 3LXAA 5AHEA 4CNPA 4O57A 2O7QA 4UC5A 1K3UA 5DXXA 1LM1A 2NX3A 3M1ZA 4IX0A 3QW3A 1S5VA 3KRUA 1XBXA 4P61A 1KFEA 3TSBA 1VQTA 5F4WA 2CZDA 1VLIA 4BI6A 2E77A 4RZ4A 1F74A 3GKFA 2VEIA 4JY9A 4S1FA 1QO2A 3EWZA 1W37A 5LSMA 3TQKA 4OGZA 3EX1A 3DU0A 1Z44A 5CZ0A 1XI3A 1OX6A 4YL2A 4HNVA 1KLZA 1P0NA 5I3FA 1W3IA 1M6JA 4JD4A 3W23A 1W5PA 3C52A 4POCA 1QCWA 2E5CA 4TIMA 1L2UA 2YCEA 4K38A 5I3KA 1CX9A 4RX0A 1WBHA 5F1UA 3NM1A 2A2IA 4OQVA 3W73A 5FF2A 4UTTA 2VFIA 3HQ1A 4RXFA 3QPYA 5U7SA 3SI9A 5FEXA 5G2WA 4ML9A 1XBZA 3PG9A 4Z0JA 1O4UA 4AEOA 3KXQA 1OF6A 4DQWA 1OK6A 4NJGA 1WOAA 2BX7A 3LLDA 1SSGA 2DORA 4RLIA 4TO8A 2I9EA 4ADSA 4WD0A 3IGSA 4U4MA 4I7WA 2F7FA 2NXIA 4YMZA 1QPOA 5HUOA 4NXKA 5HUPA 2A6LA 1F6PA 3SSJA 1OYBA 3JS3A 1H5YA 3VKJA 2WPBA 5C2XA 1JUBA 1VJIA 1TV7A 4ZL1A 1W5QA 5CZSA 2R91A 4IMFA 4KFOA 3ABRA 1XM3A 1B3OA 1YLVA 4O18A 3O06A 2A21A 3ZS4A 4FNUA 1G67A 3MI3A 4LC6A 2E1DA 4HPJA 2TPSA 3NQFA 3R2GA 1TPFA 1H7NA 3CM4A 1LZOA 2X1TA 5AC6A 3M43A 4X2RA 3DKLA 3LCXA 1N8FA 4JXCA 4JX4A 1OG0A 2CLLA 1XXXA 1LBFA 1SO4A 2HTMA 2QJHA 4L4MA 3W76A 3NQDA 2V2DA 1KFLA 2WKJA 3FLUA 4JDBA 2FFCA 2QUTA 1LOQA 2WV8A 1LDCA 2DU2A 1GPWA 2J9YA 2Y7FA 4O14A 2V9DA 4MZ8A 1EA0A 3C2RA 4JTTA 3DZ1A 3U8GA 1T0OA 2Z6IA 2PRMA 4LRTA 1O5XA 4WY0A 3LM7A 4K39A 1MXSA 3GAYA 4CCDA 4O8RA 1QAPA 2ATSA 4WOQA 5LGXA 4B5NA 1VGAA 1ME7A 3EXSA 3SR7A 1THFD 3M5XA 4O4WA 1GT8A 1D3GA 3QSRA 1PCWA 2ZQ0A 2CW6A 1DJQA 1FWTA 1Q45A 1MEHA 3NR0A 1JQXA 3Q2DA 6ALDA 1R47A 2C18A 4PA8A 4Y6GA 1GEQA 4A2SA 1FCVA 2Y62A 3KVJA 5BW6A 5HWNA 3N3MA 5D02A 1NF0A 3JR2A 1RV8A 3W07A 2NXHA 1TV5A 2ALDA 3QSTA 3QMTA 4C1LA 1X6UA 4LV4A 1Q6OA 1DQWA 2WSQA 3G1FA 2J88A 4DO5A 5AYZA 4FIRA 3MW7A 3SIZA 1SZNA 3H55A 3N2XA 4CQ8A 6TIMA 1GQNA 4L4LA 3ATZA 1FCUA 2H6RA 3W75A 3S8HA 3FFSA 3QH2A 1ZENA 3QQ1A 3W22A 5E93A 4NJIA 1OHLA 3LCFA 2E6DA 3HG3A 1IXOA 2QDGA 4A22A 4ONVA 1A5CA 4UTUA 3W1UA 1IGSA 2OX1A 3CEUA 3IV3A 1KTBA 1FDYA 3IGUA 2ZRYA 2A7RA 5I3IA 1TTQA 4NZJA 2QKFA 2ZYFA 3UYCA 3HIJA 1TIMA 4JTGA 2NXGA 4LWWA 2FLIA 3TW7A 4AWTA 3TQVA 4HPXA 1F76A 2OMAA 3CQ0A 3M47A 4WY0B 1SZGA 1UCWA 5KMYA 2A7PA 1EX5A 3UXDA 3HOJA 1A5BA 3D0CA 2B7OA 3CWNA 3DFTA 4G1KA 2H3DA 3M16A 4N9CA 4ICNA 4IPIA 2EKCA 5EYWA 3C2VA 3NQGA 5D33A 2NV1A 4OBTA 2B7PA 3MP5A 1OABA 4BK9A 3NQVA 1L6WA 3TH6A 3EWXA 5CSRA 1A53A 2NUYA 1BKSA 3I6RA 2VFEA 4Z1CA 3RFAA 2H8XA 4O1CA 5AN7A 1JUKA 1R30A 3EXRA 4XBKA 4P2VA 4NNBA 4BI5A 1KTNA 1WXJA 1TRIA 1GVSA 4UTJA 3B05A 1PS9A 1O94A 1G4PA 3NQMA 3A24A 5D05A 3PUDA 1LP6A 4PH6A 5FF7A 3WK0A 1I2RA 2V2CA 3UZ5A 4H6KA 2PURA 1QOPA 3M5VA 4AAJA 1ML1A 4R7JA 2PRLA 4OV4A 2YPIA 3ABQA 3QEZA 2FIQA 4N9DA 4BWLC 2Q3OA 3LXBA 4IGHA 1TPEA 3ABOA 4IQLA 4IXHA 2YDAA 4R34A 1SO5A 3MHGA 2Y7GA 4JTJA 3TFCA 1TQXA 1RQHA 4NNAA 1UB3A 3HPXA 1IIGA 3P5YA 1E51A 3FKKA 3W1TA 3LERA 5K9CA 3IEBA 2QJGA 4K8EA 4MFDA 2ATMA 1XC4A 5GVJA 1G69A 4MJMA 3S5OA 1DL3A 5C55A 2HS6A 2VEKA 4O16A 3LI0A 1TPDA 4NVTA 2DJLA 3UNDA 1VR6A 3DHFA 3LV6A 1DBTA 5HR6A 1PE1A 3G1VA 1JJKA 3P61A 2YSWA 4PL2A 1FCQA 3W7RA 3LTPA 3G8RA 2AQWA 1OYCA 3O16A 3I68A 2V5LA 4RXGA 2J9ZA 2ZTKA 2ZZ6A 2A85A 4K37A 3NAVA 1KBJA 5HULA 3TKFA 3YPIA 3RU6A 3W7DA 2UV8G 2X2GA 3TJXA 1H7RA 1XKYA 3OVRA 1JRBA 3QW4B 3W1PA 1C8VA 3B0UX 1XBVA 3JRKA 2P10A 4QITA 1SQ7A 4LVBA 2QUUA 1I2QA 1UUMA 4FEZA 4IMDA 4X22A 2QCEA 3UZJA 3L67A 1FXPA 4XTIA 1G4SA 1P5BA 1SFLA 2DZWA 4JR5A 2H3BA 3I7QA 3OBKA 1PCKA 4ORIA 3SY5A 1W5MA 3P8IA 1FUYA 1F7BA 1XL9A 3UWYA 1VRDA 4O28A 3TAKA 5L6UA 4M6PA 3S6DA 3DKJA 2YZRA 3F03K 5DXYA 2ZTJA 3PR2A 3MP4A 4H4IA 3STGA 1ICSA 1JULA 4LVDA 4KFPA 2WNZA 3E96A 2V81A 1TO3A 5HWJA 3TSDA 4NJKA 1Z48A 1WYIA 4JN6A 3CU2A 2XN2A 3W1LA 3MMTA 2ISSA 3W7CA 4BR1A 1R2SA 3P74A 1TV8A 4DEFA 4O12A 1G4TA 3QMRA 3W7HA 4Q4KA 4AVFA 1EWDA 4ZQNA 1HO4A 3KOFA 1H7WA 5BMXA 3GDRA 3GAKA 4E2BA 3HPZA 2BXVA 4Y8FA 2BLEA 1HO1A 5FESA 1QO5A 3P62A 4RZ6A 1QDSA 1MSSA 3NPVA 3P7YA 4K6AA 4UFHA 1ICPA 1TTJA 3SGUA 1VH7A 2GUUA 4FIQA 4N2YA 3ZWTA 3GDMA 1P1XA 5H91A 5CSSA 4YLWA 3PUOA 4QSHA 2Z0IA 4M6QA 2VC6A 1LBLA 3LGEA 5IM51 5A8GA 3GNNA 4GUHA 3TNOA 2Y85A 2DJXA 4DF0A 3LHUA 1M7PA 3B0PA 3ELFA 5K9XA 1GTEA 1X1OA 1F05A 3GIYA 4WY0F 4ZQMA 4FF7A 3UQNA 1JCMP 4ZZ9A 1PVNA 2QCLA 1MZHA 1OFEA 4LVFA 4NQ1A 4UTIA 1EEPA 2DP3A 3HGJA 2A7NA 5KTLA 1EB3A 4AWSA 1OFQA 3M5ZA 2CFFA 3M7WA 4Z1DA 3R12A 2YW3A 3A5FA 2ZA3A 1LBMA 1H50A 1OFBA 4X3ZA 2JGYA 1OFPA 1UBSA 1EPXA 3PG8A 3WK1A 5LZLA 1KW1A 3G3MA 2VFFA 4WOZA 4Q33A 4AF0A 4TX9A 3BK0A 5BNKA 3QYQA 1VPXA 3CIXA 5CPLA 1KFJA 3LCHA 1ZAJA 5CZJA 1Z42A 3MI2A 5DELA 1TPC1 2ZA2A 3HG2A 4O19A 3CC1A 3E02A 3N14A 4LS2A 1FWWA 3DHDA 4M7SA 4QQ3A 1QPRA 3PWAA 1VHNA 1IF2A 3SECA 3LBMA 3THAA 5AC7A 1PL9A 3L68A 1JUEA 3IGXA 4LU0A 3PSVA 4O1BA 1H61A 1UASA 3SW6A 4IMCA 1ZY9A 4O0KA 1EWEA 5KZMA 4R33A 5DCEA 2ZDRA 5KZEA 4DF2A 4O1DA 3NDOA 1TB3A 4O11A 1D3HA 4LC8A 3VCRA 1CW2A 2VENA 1CI1A 5LNRA 4O52A 5G1YA 2RDUA 1MEWA 3L0GA 4I7UA 3BLFA 3LX9A 5F2MA 4XQ6A 3W74A 2VFGA 3EX4A 1XFBA 4AWUA 4MVAA 2NWSA 3KAOA 1ONRA 4CNOA 1KBIA 5C54A 2FPYA 3IVUA 4AHQA 5G5IA 1JCLA 4UCGA 1O5KA 4CCCA 2X30A 1BWLA 1TPB1 2W0UA 1KV5A 1EP1A 5FF4A 2RKXA 4JNMA 2QUVA 2Y88A 3HO8A 3E9AA 3B4UA 4LV9A 1SR9A 1WBJA 3BG5A 3LB0A 3C4UA 4UFMA 5CZTA 2PE4A 5AB3A 3STEA 3E49A 3G0XA 5J5DA 5K4ZA 3DFNA 3GKAA 8TIMA 3LCWA 2WNQA 4WXZA 5DY2A 4JTKA 4ZQPA 1JR1A 5DLCA 2ZZ4A 4N6EA 3N34A 1UUOA 5KINA 4Y9AA 1YDVA 2NUXA 5D32A 2HS8A 1GVFA 3W83A 3TX9A 3P60A 4NU7A 4GUJA 1KM3A 3DGRA 5IBXC 2BTMA 1WA3A 1G4EA 3W86A 5G2IA 3O1NA 4JYEA 3SGZA 5F4XA 3B06A 2JK2A 3UY8A 2DZPA 4MUZA 4N9BA 3W72A 3TCEA 3C2FA 4EF8A 4AF0B 3WJYA 3T4CA 1G7VA 3USBA 5D2YA 3A9IA 1GVQA 1SFJA 5E0KA 5J5RA 3WK3A 4CLMA 3LHZA 2PRHA 1RQBA 2H8ZA 5AC8A 3TE9A 4MKNA 5DBTA 2X1UA 4MOZA 4RJEA 3TROA 4UNKA 3CTLA 2P1FA 4K7YA 3W9ZA 1Q3NA 1EIXA 3GR8A 7TIMA 4UMAA 1OFDA 5L9FA 2WSRA 3PBVA 2V8ZA 1ZALA 2YYTA 1OX4B 4HSOA 4Z0SA 3U2OA 4JEQA 4A29A 3G1HA 4DBDA 4NXSA 3TAOA 3UXAA 5HR7A 5TIMA 3W7IA 3NQEA 1JQVA 1I45A 2ZA1A 3CHVA 3TMLA 3BVJA 2ABAA 2ZBTA 5D2XA 1NAL1 1RR2A 3M5YA 3NEVA 1U5JA 3VNDA 3P5ZA 2FPTA 2CLOA 3LHVA 3V1PA 2QCFA 3M41A 3FJ6A 3EWYA 4FNTA 1EUNA 3NPXA 2DZVA 2YR1A 3T7VA 1AMKA 2VELA 1PIIA 2FQIA 5CPNA 2JGQA 5LGZA 3GDTA 3NZ1A 3NZRA 3W7LA 3HBLA 4HT3A 4QNWA 3W1QA 2CZ5A 2WSYA 5TQLA 3S1WA 3BW4A 3HB9A 3UWWA 1HFBA 4LW7A 1OF8A 1K7EA 2YYUA 1H60A 1VZWA 3W2KA 3P81A 2CU0A 1W31A 1AW1A 4YCPA 3QPZA 3DFQA 4NJHA 3SFKA 1LYXA 2QDHA 2Y70A 5AFDA 2PC4A 3IIPA 3EWWA 3DFPA 4ADTA 1VCFA 4HSNA 4GJ1A 1QPQA 3WK2A 3QC3A 3O6YX 1S3HA 1O60A 3QFEA 3NL3A 1SSDA 1H62A 2ZRVA 2CLMA 2HMCA 3NQ8A 1V7YA 5KSWA 4HIBA 4ZVJA 3M44A 3QQ0A 3W1RA 1YXYA 3TFXA 4LUJA 3PY2A 4FNSA 4XKYB 3EWBX 2XN0A 3PF3A 3C3NA 3O6DA 2G97A 1IXNA 4BWLA 1GVRA 5EMUA 3GR7A 1S5TA 4DPPA 5IBXA 2V30A 3O63A 2OCZA 2NLIA 1UJPA 2Q3RA 5LKYA 3W7GA 1LOLA 1EP3A 3QMSA 2QCCA 4N4PA 1Q6QA 4MYAA 3GXTA 2JKAA 3LCIA 4JS3A 3UWVA 3UWUA 3UWZA 2J9XA 2E6AA 3I7RA 3GZ3A 3L21A 3NL2A 1HG3A 3NPUA 2X16A 4XUGA 3W7KA 4IWWA 3B8DA 3T40A 3NQ7A 1VCVA 2GPTA 4OV9A 4RCXA 3PBUA 1A5SA 2TMDA 4UTKA 1FWSA 1X8FA 1D9EA 4HNUA 3RMJA 3N73A 2QF7A 2AAMA 3HF3A 2R14A 3THQA 1IIHA 1FX6A 4WUIA 3W7MA 4BFAA 2WNNA 3W87A 5K4XA 2C19A 3W7JA 3NOEA 3MUXA 2WJZA 1WOBA 2NV2A 3FS2A 4LS1A 1IXQA 2EGZA 2IQTA 3N2MA 3PVFA 3G0UA 1DQXA 3B03A 3N19B 4JYDA 2W6RA 3W7EA 1NFBA 2G95A 2Y7EA 3MBFA 3NGJA 3DI0A 4XWUA 3TU9A 3WJWA 2CLIA 3FYOA 1TJRA 1ME8A 2VFHA 1ZAHA 3LRLA 1EP2A 3QF0A 2WO5A 4DO4A 3BO9A 4GE8A 2DZTA 1VYRA 1AK5A 3QZEA 5CPOA 1AG1O 1VCGA 4GWEA 4EOUA 1FWNA 4JTIA 4EIVA 4O4VA 3L5LA 3STFA 4DO6A 4HNNA 4WQ6A 1AL8A 1T99A 4RKAA 1K7XA 1OYAA 2VEPA 4FB7A 3NQCA 4IJBA 1TQJA 1TSIA 5F1VA 4LNYA 4TU1A 2B7QA 5HINA 2NZLA 1NVMA 4UXDA 1F73A 3NPWA 3TSMA 3DAQA 3GX9A 4JIPA 3TA6A 1DOSA 5KITA 2A6NA 1W5OA 3LRMA 5AHIA 3TXVA 2Q8LA 3AJXA 4W9TA 2YX0A 5LNUA 3R13A 1VHCA 3W7NA 3C8FA 1KM2A 1C9DA 2CLHA 3GVGA 2E09A 2WQPA 3L5MA 4JTLA 3C2EA 3KX6A 1ZJIA 4BI7A 4JICA 4O13A 3EKLA 3PAJA 3DENA 4AXKA 4ADUA 4EWND 2FJKA 1L6YA 2I1OA 1M7OA 2QAFA 1K7FA 4MYXA 3UWQA 4IUOA 3N9SA 4LVAA 3P67A 1QPNA 5SWUA 5HMSA 2EPHA 5HQEA 2G96A 2PCQA 5K3VA 3NA8A 4OU1A 4RV8A 3B0VC 2QCDB 2VOMA 1XDMA 3PULA 2GOUA 4GNJA 3S0CA 3W85A 1N7KA 2C16A 3Q58A 3PBWA 1LCOA 1OFRA 5FEZA 1R2TA 1F6KA 4HHPA 3FJLA 5I3GA 3DH7A 1B9BA 4UMCA 4WX2A 1QFEA 4O15A 4IPJA 4XBSA 3BLIA 4QJ1A 3RNDA 3LV5A 4MY8A 1IXPA 2R8WA 2AGKA 3LTYA 2JKEA 3C0JA 3WJSA 1SO6A 4QM1A 5BRBA 1SO3A 4FO4A 4M19A 1YADA 2P0OA 4GUIA 4UTLA 1SU5A 4MPQA 4RZ5A 3L0NA 3W1NA 4MLRA 3FKRA 4NT0A 3AO0A 3WFAA 1I2PA 3L66A 4Y90A 1HUVA 3L9CA 3CB8A 2TRSA 3OVPA 4X9SA 4S2CA 5D09A 5D38A 1L6SA 1H7PA 1KM1A 1VS1A 4U28A 1B57A 3DBPA 4GBUA 1TTPA 1XBYA 1KM0A 3NL5A 4PTNA 4DXVA 3FA5A 2TSYA 3KVMA 3G0SA 1RQEA 3G1XA 1U83A 1NSJA 1F2JA 3DXIA 3W7QA 5EL1A 5G2HA 5K2ZA 1AW5A 2EHHA 4GC4A 1I8JA 1DORA 4AB4A 3PSWA 3T55A 3MP3A 4LS0A 3FIGA 4DBEA 1QMLA 4O50A 2J6XA 1OVDA 2GVJA 1NF7A 2LLEA 2RDWA 4KFNA 5CKSA 2JBMA 2Y7DA 3W71A 3INPA 2KZHA 3FYPA 3F4NA 4PL1A 4XKYA 3KVLA 4O54A 4LOCA 1LRNA 1YXDA 2Z1BA 3OEXA 2QCHA 4IOTA 2FTPA 1EUAA 1KM5A 3VI2A 5DCBA 3W88A 3F1QA 3OVQA 4I9AA 1N55A 2QCNA 1W54A 1YPIA 2O7SA 5HNRA 1BTMA 5D37A 5TBOA 1SW7A 1P4CA 2ZRXA 5D2VA 4GFSA 3PB2A 5AHNA 3IIXA 3IIZA 3B04A 5D2WA 3E12A 5EPDA 1XCFA 1TPVA 5BMWA 1TREA 4CQ9A 1RD5A 1DHPA 1DJNA 1GYNA 3PBYA 4M6VA 2FB3A 4UFIA 4A3UA 1SW0A 1QR7A 2H90A 2QCDA 2EAWA 2I14A 1NEYA 1TPUA 4ZQCA 5AYXA 1FCBA 1SZEA 3N9RA 4MY9A 5KZDA 4JTHA 5FEPA 1WAUA 3IIVA 1A5AA 5DY3A 1YPFA 3HPSA 4UFLA 3HG5A 3MI6A 2C1HA 1JRCA 2Y61A 3TIMA 2C3ZA 4UTMA 3S1XA 2DZXA 3OG3A 1VLWA 1T8XA 4AHOA 3MYOA 5FF3A 1H7XA 1GG0A 2OJPA 3RK8A 4ORMA 3GXNA 2V0TA 2WOQA 5FEWA 1TPWA 1PHQA 3TC7A 2GQ8A 4Z08A 3TC6A 1GVOA 3W2MA 1R2RA 5CG7A 2BZNA 3S9YA 1DVJA 2ZRZA 3L0KA 1WDWA 3G22A 3TK7A 1KA9F 1B4KA 1MO0A 2XFWA 3G1DA 3EWUA 3BV4A 1LRQA 3TDFA 3HJZA 2C6QA 2Y6ZA 1LLWA 2Y89A 2E5BA 1ICQA 1HTIA 3GB6A 1AW2A 1PHWA 1Z41A 3MWAA 2A5HA 3BG3A 4KKXA 5T26A 3DFSA 4LT9A 4S2BA 4N9EA 4UTWA 3W2NA 1ZCOA 5LNSA 4PODA 3S5YA 1YTKA 2YFNA 2NWRA 1KTCA 3LCLA 1ADOA 2ZZ7A 4ALDA 3M6YA 2OT0A 3WJXA 1SZFA 3MYPA 2DZUA 5D03A 3VFLA 1RZMA 1KV8A 3BG9A 3OHIA 2C15A 3SZ8A 4KWVA 1G6CA 4K36A 4WZHA 4E38A 1KM6A 3KRZA 1ZAIA 1VC4A 5AHFA 1TTIA 4GRSA 1OX4A 4UR8A 2CLEA 5F4SA 1I2NA 1DV7A 3PC0A 3ABSA 2E6FA 1DKWA 3TJLA 4NZFA 3H54A 3NVTA 4BF9A 1WX0A 4GXMA 3RLUA 3NL6A 2JKPA 3IRDA 3O8AA 2C14A 1J2WA 3W1XA 5G1TA 3NQ6A 1R46A 2A1YA 3P82A 1GYLA 2GQAA 4MFEA 5DN1A 2XN1A 4ZQOA 2CWNA 5HJLA 4Z1AA 1K02A 4FX6M 1YYAA 4LTSA 2W79A 4PFMA 2B4GA 2YGYA 4FX7A 5F2LA 1Q6RA 3G3DA 2V2HA 3TW6A
chains in the Genus database with same CATH superfamily
2BB0A 4PMYA 1Q6EA 2W3ZA 2I7GA 4QROA 1G94A 4NYUA 2Z6JA 3GXIA 4IPLA 4NZ1A 5EGRA 4GFIA 4MNJA 2DSWA 7A3HA 3ZJ6A 1E73M 4JGDA 3KOZA 3O6CA 1AQ0A 1K03A 4JY8A 3MUY1 3BCDA 3HFYA 3GNDA 1K8XA 4NZ4A 1WDDA 3OIXA 4JX6A 3RCMA 3APGA 3RJYA 3SN0A 2HSAA 5C71A 5AOUA 2HK0A 2MUCA 3ES8A 3I3DA 5CJNA 1EDGA 3W82A 3F4WA 4DN1A 1AH0A 3DI1A 2OZ0A 1H1ZA 5LXXA 4DWSA 4B4FA 3PJUA 3BURA 4DAFA 4GQQA 3TV8A 2UY4A 5MF5A 1XRVA 4XD3A 1W3NA 4FXJA 2D3NA 4JTDA 2CLFA 1VYPX 4JHZA 3GDLA 4EF9A 3VOIA 2D2OA 3LUTA 4KQNA 3LGGA 2DUAA 3HPFA 3E2SA 3A12A 2E5DA 1VYSX 3PAOA 4BS0A 3P84A 5GNYA 1ZS2A 1J93A 4GZIA 3NXFA 3N2BA 3KBMA 4FLSA 3VDHA 6XIMA 5HQLA 3S2MA 3SY1A 4CKQA 3T07A 4US5A 3KVKA 1W9BM 1S3TC 5KETA 2QW5A 5CPMA 2R94A 3NQAA 2V5KA 1LQ2A 4L6HA 4US6A 3IIOA 3TTQA 4F4RA 1UD8A 2FPVA 1JVNA 4HK6A 4FPSA 4OKDA 3V75A 1YW1A 2C7FA 4M8UA 4ROPA 2FDSA 1BXNA 4GYFA 5J04A 1BTCA 4KCTA 3WEOA 1MEIA 1J0IA 4R9OA 4MZ1A 4O1AA 1RPXA 4Q8PA 2YLAA 1SJAA 2BY1A 4UFJA 4LRSA 2G8ZA 3QGAC 1SYTA 1TRDA 3CL6A 3W7PA 4FNPA 3EX2A 3UD6A 4V27A 3PHAA 4LF1A 1E4LA 1C29A 1YBQB 3ITYA 2E68A 4ZMGA 3VE7A 3DGBA 4O17A 2ZZ1A 4MZYA 1EH9A 3BSHA 3C3UA 4JX5A 1RK5A 4FOUA 3W29A 4H00A 1Q6LA 5FJOA 5K7JA 4KGJA 4QRNA 4ZQRA 5EBUA 3G18A 3WLRA 4BEUA 1SW3A 1FQ0A 3OYXA 1RSCA 3BW3A 4UQBA 1A3HA 3CO8A 5IOBA 4XIAA 5A6JA 3SJ3A 2FVMA 1XUUA 3JW7A 5D30A 3T2OA 4TMBA 3NYZA 4PMQA 2OLSA 1J5TA 1KFBA 4WJEA 3LRKA 4PN2A 1HVXA 4DF1A 5ECVA 3W6YA 3LZ3A 4G56A 4E0CA 2XGZA 1EA9C 1W5NA 2NW0A 3S1UA 3EEGA 1S2TA 3Q94A 3OA3A 1H51A 3QLDA 1W0MA 7PTDA 3MHFA 4LH8A 2IPWA 1XCXA 1JCNA 3NO5A 2VDHA 3WIJA 2J24A 4C7FA 1OFOA 5CG0A 1VENA 3R8RA 3GC5A 2PDMA 3LCGA 1NP0A 3NQ2A 3G1YA 2V5BA 3A5VA 1W1ZA 4R53A 1WV2A 2WMFA 3VIJA 1MNSA 3N2TA 3LNMA 5JH2A 1WXZA 3ZT6A 2AKMA 1WZKA 3AZRA 3T2QA 1BPLB 4C6OA 4MDPA 4FNRA 4Q32A 1CENA 3W1AA 1KRAC 1DTUA 4OHQA 4NKCA 4J28A 3UY7A 2Z7GA 3BLKA 3WJZA 4N02A 2VJXA 4MJZA 3BPWA 3DN5A 3GK0A 1SUXA 3M9YA 3WD3A 1WZLA 3L65A 3AWOA 4U2ZA 3T42A 1K1DA 3WLMA 4UNLA 1MYRA 4FR1A 4V33A 1I75A 5A5WA 3H2FA 3ANYA 4XZ9A 1Q4NX 3W2UA 4AFYA 1V0KA 3M0ZA 4HOXA 2VFDA 4QS6A 3A13A 2HDJA 3T44A 4MDOA 3WLPA 3DCPA 2OLAA 4QE5A 4C6NA 2F9RA 2C0AA 2Z1SA 3GC4A 4QNEA 3CPUA 1W1PA 4LUIA 1V5XA 1J18A 2CWXA 1QI4A 5D9NA 2ACRA 3H4XA 3A23A 5D2TA 3W70A 1YXCA 2FHBA 2ZCGA 3LHWA 3GNRA 3LBCA 3N4AA 1AL7A 3S5ZA 4UQEA 3GUGA 4FNQA 2GQ9A 3WO8A 2UY5A 3A9BA 2VHLA 4RPPA 5D9MA 2E6YA 4GUGA 3THDA 2CZFA 4IX2A 3WQWA 4B3LA 3M07A 2ZRUA 2HXTA 4Y8EA 3IPWA 1O95A 1BQGA 5DRCA 3E0IA 4N42A 4RDWA 3UZYA 5M1TA 1UKTA 3BSMA 5E1QA 5C6MA 4UFKA 3KRSA 1EO5A 3GY1A 3LXAA 4NP7A 5AHEA 3VOJA 3WZ0E 4O57A 3WLJA 4LQ1A 4U10A 4UC5A 2OWXA 1K3UA 3VNLA 1BF2A 4YTUA 4BI6A 3NZPA 1PB0A 4RZ4A 4JQ2A 9CGTA 1S1RA 2VEIA 4D8AA 5LSMA 4OGZA 2PWGA 2F2KA 1IYXA 1QPKA 4FAMA 5A3HA 1PUDA 1JFHA 2CNCA 3PZVA 2BY3A 4MNMA 4HNVA 1MW2A 2Y1HA 2ZE3A 3GTFA 3E5BA 3ZR5A 3KL5A 2PAJA 3W23A 4PRTA 2R1NA 3ANVA 5FJTA 4M1BA 3SCTA 3TR9A 2E5CA 4TIMA 2CERA 3WQ6A 2ZX8A 2YCEA 4K38A 2QDEA 2DV0A 2HXUA 1QW8A 2QF8A 4CD6A 3EZ4A 4U2YA 2V3FA 4LANA 4MPKA 5FF2A 4H9ZA 2VFIA 1EDQA 2WB5A 3HQ1A 1US0A 3BCJA 5EFDA 4ZFMA 1O4UA 3MUAA 4MAZA 3LLDA 3NIYA 2DORA 1A0CA 4PMJA 1CLXA 3MMWA 1AJ0A 4QJ3B 4I7WA 4DJDD 4PTWA 4YMZA 4C60A 1QPOA 3AHYA 3H4WA 1MQPA 2A6LA 4Q4QA 3I6EA 1H5YA 1Y5VA 2WPBA 3N12A 5HNNA 1SMAA 4WR3A 4BY3A 5CAHA 1XM3A 2J7DA 1UC4A 4LFYA 1QK0A 3DHUA 1G67A 3CQHA 4H8HA 4DWSC 1JFXA 2P5NA 1B31A 3WELA 2CLLA 4UOZA 2HTMA 1M03A 4QLKA 3SCWA 1PAMA 4L4MA 3U48A 3UGVA 1C91A 2V2DA 4DNHA 1FRBA 2VX4A 3FLUA 4M29A 2WV8A 2P3EA 4CCZA 2DU2A 4K1GA 5C9WA 4MM1A 4O14A 2V9DA 3TJIA 1Z89A 3U8GA 1T0OA 1FP8A 3ABXA 4I8DA 1HGYA 1Q8JA 2PRMA 4JZ5A 1XLKA 4NI3A 3ZO9A 4CEUC 1O5XA 4B4HA 1XLGA 5XIAA 2V6AA 2ATSA 2G3NA 2BASA 4B5NA 2GVYA 3WN6A 1AUSL 3V5FA 3SUUA 4PBGA 1ESWA 1PCWA 1E4IA 1JQXA 3WUEA 5BOFA 6ALDA 3S2LA 4A2SA 1UZHA 2Y62A 5BW6A 3KVJA 1GUVA 3N3MA 1PDYA 2ALDA 4G8TA 2IQ0A 4C1LA 5EBAA 1Q6OA 4W84A 4G9PA 1M7XA 2OYLA 2HISA 2J88A 1PDZA 1ZL1A 4CQ8A 1SZNA 3H55A 3OGSA 6TIMA 1UKOA 4IM4A 3MJMA 3FHAA 5I07A 1OC6A 3QQ1A 5D8ZA 1OHLA 1LQAA 4Q4MA 4S3KA 2E6DA 4C6FA 4ONVA 4ZB0A 1A5CA 5CAKA 3GXDA 3QVQA 4GNKB 4DZIA 3MTWA 2QKFA 7REQB 1TIMA 4IIGA 1P6WA 1V51A 3PJWA 4AWTA 3QHMA 4HPXA 1F76A 3CQ0A 3VIOA 3VOHA 5DQPA 1PWMA 5KMYA 1GONA 2A7PA 1A5BA 1D8CA 1R9YA 4IIDA 2YB4A 5CPSA 4BQ4A 2EKCA 4URIA 5EYWA 4HA1A 1E6RA 5D33A 2NV1A 4NASA 2INEA 3GU1A 1OABA 2E8ZA 4BK9A 1B3XA 4EPDC 3HQNA 1L6WA 3GUWA 3EWXA 2D2JA 4NG3A 1TG7A 3MKVA 2PC8A 4KCWA 4DI9A 3I6RA 4Z1CA 3RFAA 4IT1A 4O1CA 5AN7A 4C5ZA 1JUKA 3CV2A 2PDWA 4DJFC 1TRIA 2JEQA 1Q7QA 3H26A 1K9TA 3NQMA 1GKQA 3UG8A 3KTSA 1MQRA 2I9UA 1TR1A 3UZ5A 4H6KA 1UMYA 2EBNA 2EEXA 3W01A 4JN7A 2PRLA 2YPIA 3ABQA 3EWDA 4Y2WA 4N9DA 3H70A 3I3BA 3PJXA 2DVUA 1HP5A 5GPRA 2Y7GA 1TQXA 1RQHA 1R3VA 3VINA 3FKKA 3W1TA 4F40A 4MMWA 1CECA 1EL3A 4K8EA 4EPBC 1DQUA 2ATMA 5LIKX 1WZMA 1G69A 5C8BB 4L61A 1IQ8A 1ZJHA 3S5OA 4GJIA 2HS6A 4CNSA 1TPDA 3LM3A 4XVEA 3L4VA 1ISWA 1PKNA 1NFGA 4HCHA 2ANUA 3G1VA 3P61A 3W6LA 4PL2A 2GSHA 3LTPA 3UCDA 2AQWA 2OELA 1J2BA 2Y8UA 2ZTKA 3VIKA 4K37A 3WQDA 1KRMA 1KBJA 1K9EA 3YPIA 3RU6A 4NL1A 4JKLA 1FP9A 4AW7A 5A6BA 1B9ZA 3IANA 1H7RA 3OVRA 2GFTA 1JRBA 4QITA 2KX9A 1EPVA 3WNPA 3QYSA 1UWAA 4Q8QA 3UZJA 4D6IA 3L67A 4L5ZA 3QR3A 2DZWA 4JR5A 2H3BA 1ADSA 3LN3A 3OBKA 3TYCA 1PCKA 4JNZA 1W5MA 3SCQA 3KBSA 3UWYA 1VIWA 5AY7A 2YZRA 3F03K 4FS9A 4NRRA 2D1ZA 2VR5A 3VIPA 4B5XA 3E96A 2V81A 1TO3A 3EYPA 3EMQA 1W9DM 1EF2A 2EKGA 2Y5SA 2ISSA 4U33A 1RALA 4TX8A 1PSCA 2P88A 4GHRA 4DEFA 4TTUA 3PANA 2CBIA 4Q4KA 4AVFA 1EWDA 3GBEA 3IJ7A 3KOFA 2VQTA 3TYAA 1XHGA 4B16A 1S2CA 2BXVA 1OCQA 3SUVA 1YE6A 3ZM8A 2B81A 3SDOA 2X0HA 3L4WA 2VVSA 1QDSA 1NARA 2PDNA 1VH7A 1M1BA 4N2YA 4KCUA 1X39A 4B2DA 2Z0IA 1MW1A 2QNEA 3TNOA 4DF0A 1A49A 5K9XA 1X1OA 1F05A 3U2EA 3VD5A 4ZZ9A 1PVNA 2QCLA 1OFEA 3WF1A 4NQ1A 5C9RA 2DP3A 4AWSA 1OFQA 3G5EA 2CFFA 4X60A 2YW3A 2P76A 4X3ZA 1UWTA 4XAYA 1UBSA 1EPXA 3KTXA 1NP2A 2J8TA 3CZ8A 3ITOA 5BNKA 3CIXA 5DELA 3N4FA 3B8IA 1Q7ZA 2PB1A 3DHDA 5T9CE 1QPRA 3UR5A 4HYWA 3F5JA 3SECA 5AC7A 2X7VA 5JBEA 3N3TA 3A64A 4YYCA 5KZMA 1DJZA 1TX2A 2PTDA 1WDSA 1EXBA 2HROA 5FKYA 1HKWA 1D3HA 3L7RA 1CW2A 5IFTA 3VXGA 2VENA 3ARPA 4ACYA 5DF0A 1HKKA 3R1ZA 3ZQ9A 3L0GA 4H9TA 2DH2A 5F2MA 2V3EA 3AZTA 2OKOA 1XFBA 3BC9A 3VOCA 2NQJA 2NWSA 1GNXA 4PCPA 4CNOA 5C54A 2X41A 6PTDA 3QXBA 2ZX7A 2E1WA 5HA7A 3GHRA 2CBUA 3B4UA 3NSNA 3C4UA 5CZTA 1BGAA 3E49A 3G0XA 3QKZA 4H2HA 3QY6A 5JU6A 5DY2A 4JTKA 1X8CA 4JQ4A 2ZZ4A 3I3EA 3BAXA 3FDKA 5D32A 1KWGA 3USZA 1GVFA 3W83A 5M03A 2EG6A 1AODA 3CYVA 4Q7BA 2BTMA 1R3YA 1G0CA 1WA3A 1G4EA 3W86A 1UOZA 5EB8A 3SGZA 3ZSTA 3EEZA 1JF6A 1B3ZA 2DZPA 2ON3A 3A4WA 4HK5A 3E5PA 4J3VA 1A5MC 3TCEA 1ITUA 3GVRA 4AF0B 4RE0A 4PCSA 1K4HA 3CZEA 3H2NA 3VZZA 5B7ZA 1N8WA 2VRQA 3LHZA 2GZXA 4L1GA 2WWDA 1DWAM 3KOWA 4H9UA 1FWEC 3CL7A 1V08A 2X1UA 3R4IA 1XYZA 1TIWA 4UNKA 2P1FA 4E8GA 3W9ZA 2FTWA 3B3DA 2OQHA 3R0KA 4MB1A 3GR8A 3MMDA 4PUUA 7TIMA 1RH9A 3RAOA 4YTSA 3EOSA 1OFDA 5LXEA 2UZ9A 2CXGA 1OX4B 2EPLX 4AZIA 3U2OA 4JEQA 4A29A 3G1HA 4NXSA 1TKKA 1VFLA 3TAOA 5HR7A 4ZO7A 2VOTA 1I45A 4GQBA 4X9YA 3CHVA 2ABAA 5D2XA 2E40A 5I03A 1V3LA 4F0MA 3QV6A 3V1PA 4PR4A 1EUNA 3NPXA 5C0QA 2DZVA 2YR1A 4R3UA 3AS2A 3PP7A 2B31A 2HK1A 1O5RA 1PIIA 1EJSC 2JGQA 3VA8A 4QNWA 3W1QA 2VD8A 3HB9A 3UXIA 3UWWA 1I1WA 3VKAA 4J5NA 2YYUA 1H60A 1WO2A 2C79A 3ZZ1A 3GTIA 1J0KA 4L4PA 1V6VA 4D71A 1J0JA 1H3GA 4NJHA 1OGGA 3E38A 4EXAA 1EC7A 4RL3A 2Y70A 4DWSB 3IIPA 1I6NA 3DFPA 4ADTA 1VCFA 3NQBA 1QPQA 2CBVA 1ZJAA 3QC3A 4DWDA 4YHEA 3NL3A 2AKZA 4HIBA 4ZVJA 2BHUA 4I9JA 3V5OA 3TFXA 2DEPA 3PY2A 5GNXA 2XN0A 3C3NA 1TV2A 2G97A 5A2AA 1IXNA 3JUGA 1NFPA 4PTXA 1GVRA 4BWLA 1VFFA 1CB7B 3DYMA 3VC5A 4JHMA 2AMXA 1S5TA 3N1AA 3QOKA 2Q3RA 5E09A 5LKYA 3GYCA 1F3TA 1RLCL 3QMSA 2QCCA 1JPDX 3RN6A 4I3GA 2YJQA 1DJIA 3R0UA 1QNRA 3ZT7A 4JN8A 3GR4A 2WJFA 4WF7A 3UWVA 3UWZA 2J9XA 3GZ3A 2YXOA 3HJEA 2ZX9A 3NPUA 3W7KA 2QIIA 4IWWA 3NQ7A 3PPCA 1VCVA 4RW3A 4RCXA 3EB3A 3PBUA 3SCOA 1FWSA 1QWKA 3QY8A 5DO8A 1Y5XA 3VKKA 4ZOAA 4HMDA 3RMJA 1U1HA 3N2CA 1JDDA 2YCKX 4WUIA 4BFAA 1P48A 5K4XA 2E25A 3NDZA 3VYLA 3NOEA 5CPQA 3UWEA 2WJZA 1WOBA 2PP0A 1VP5A 3WENA 1TELA 1Q2RA 3AMCA 3PVFA 4C6QA 3N19B 3B03A 4L9XA 1Q5MA 1GKRA 2W6RA 3APYA 3DHPA 2I5GA 3NGJA 3DI0A 4XWUA 4N0RA 2YA1A 4E4PA 1RUSA 2VFHA 5A6SA 4YU1A 3LRLA 3T9PA 1EP2A 3QF0A 4EANA 2WO5A 4DO4A 8A3HA 1WB0A 2DZTA 2EPNA 2CYGA 1VBGA 3W4RA 1AG1O 3OGRA 1VCGA 2W66A 4EOUA 4JTIA 1H49A 1MUCA 4A3QA 2F2HA 4S3GA 1J01A 4G1NA 1VB9A 3WQ8A 4LUSA 4WQ6A 2G3FA 1T99A 1ZP4A 1HZYA 1VBRA 3NQCA 4IJBA 1TQJA 2PCEA 4LNYA 3V18A 1NVMA 1W9XA 2ZDSA 3K4DA 4ERAA 3DOPA 3KE0A 2YX0A 5LNUA 5HMFA 4MKSA 4ZXLA 2E09A 1X1NA 4JTLA 1H1NA 1SJDA 2Z00A 4BI7A 5JBFA 1OADA 1DIOA 4ADUA 1GZJA 1L6YA 2DQWA 3KP0A 2J7HA 1W3LA 5H1WA 4F3HA 1EX1A 4DYEA 1QPNA 2G96A 2NQHA 2QUNA 1NWUA 3NA8A 5K3VA 3WD1A 3TYBA 3B0VC 1PIGA 2ALRA 2VOMA 4D6CA 1XDMA 1TMQA 1V6TA 3M0JA 1PYFA 2GDVA 5I3DA 3MCOA 3XINA 3FSUA 3Q58A 1LCOA 1C8QA 5FEZA 1Y65A 3FJLA 5I3GA 1BSLA 3DH7A 4UMCA 2Y8VA 4XBSA 2HQAA 3BLIA 5TD4A 4QJ1A 5I78A 3UG5A 4J3TA 1EBHA 2AGTA 2HPIA 2R8WA 4CD7A 3LTYA 1K77A 3HQPA 1SO6A 4FO4A 4UOQA 5GJPA 1M53A 4Z2LA 1YADA 2P0OA 1SU5A 4MPQA 3KEHA 3L0NA 2HVOA 3AO0A 1I2PA 2A3EA 2HBXA 2TRSA 3V0UA 5D38A 1VS1A 3WLQA 3DBPA 4PTNA 2TSYA 2IQDA 3OB8A 5K2ZA 1J8VA 2EHHA 1FHUA 1I8JA 4AB4A 3PSWA 4LS0A 3FIGA 3H12A 1RA0A 5I24A 2VEFA 1UR0A 1XR2A 5HJYA 1OSEA 3TTYA 2LLEA 3KCLA 3W71A 5CGMA 1KXTA 2IPGA 3UXLA 1C7TA 2Y24A 2YDQA 3NO1A 3KVLA 1LT7A 3WBWA 4LOCA 3HA1A 4IOTA 1H09A 1EUAA 1KM5A 3W88A 1YE4A 2QCNA 2O7SA 3EPNA 1UYQA 1OCBA 2HNEA 1V3JA 2WMJA 3V35A 9RUBA 1OT2A 2ZRXA 5AHNA 3IIXA 4AYGA 3ALFA 3RITA 4B5SA 4UQCA 4AD4A 5EPDA 3LBOA 1TREA 2VX5A 4ZEPA 1DJNA 3AIWA 3T0BA 4MUPA 5EMMA 1QR7A 4XBJA 1E3ZA 3LSCA 3N9RA 4IG2B 5HPOA 3NZQA 3V16A 3IIVA 4LEQA 1A5AA 4K68A 1YPFA 3HPSA 4UFLA 3UJFA 3E74A 2NQZA 3E6EA 4LUTB 1JRCA 3V1HA 5DX7A 1R38A 4Y9PA 4W8BA 3S9IA 1X6LA 3S1XA 3VDCA 3AZSA 1EYEA 5FF3A 4IF2A 3N18A 4ORMA 5T9BG 3GXNA 4ILSA 1W6TA 1TPWA 1BWVA 4HPNA 3N25A 1PHQA 5C9ZA 4IFKA 2GQ8A 4Z08A 2D24A 4DYKA 3OU8A 3W2MA 4D1JA 3EOUA 3ID7A 3S9YA 4HPHA 3FK4A 3VGEA 3G22A 3TK7A 3TW9A 2XFWA 3G1DA 2O0TA 3EWUA 3SJNA 1LRQA 3OOQA 3TDFA 2C6QA 1LLWA 3EDKA 1XGEA 3SY8A 3S2CA 2E5BA 4XZMX 3WBEA 1XSIA 2QPXA 3EA2A 2A5HA 1DXIA 4PUKA 4AZCA 1KGUA 2W4XA 3W2NA 2ZICA 4PODA 1W1TA 1A5OC 3I10A 1YTKA 4PZVA 3N6JA 2NWRA 2XM2A 1ADOA 3LCLA 2ZZ7A 5AKQA 1DIDA 3CUXA 3ZVHA 1RZMA 1KV8A 4F0HA 4ECLA 1G6CA 4WZHA 2YB1A 4E38A 4B9YA 1KM6A 1R8LA 4UQ9A 1IR1A 1VC4A 1TTIA 2UY2A 4B3ZA 2XWDA 3IJIA 2G4FA 2CLEA 5F4SA 2QPUA 3C86A 1I2NA 3VM5A 5GNZA 2Z2AA 1NDVA 2V5CA 3FVDA 4NZFA 3NVTA 4QDWA 4D6FA 4BF9A 4GXMA 3PPHA 3NL6A 2JKPA 3S46A 3SAZA 2C14A 2G3JA 5G1TA 3K1DA 4EE9A 3QTGA 4LX4A 3UT0A 2A3AA 3WKZA 2GJXA 1P6BA 4FOKA 3V0TA 1K02A 4FX6M 4LTSA 1UKPA 3MSDA 4PFMA 4PUWA 2YGYA 4FX7A 1Q6RA 2V2HA 3D3AA 2PFHA 3U4AA 2DSVA 4XTDA 2ZFAA 4RDZA 1KCXA 4KBXA 3W84A 4E3TA 3L4UA 3FOKA 2C13A 2VC7A 1W56A 2PBGA 4W4QA 1V4YA 2PS2A 3EXTA 5K9DA 5TAOA 4IMEA 3LI1A 3BAKA 4UWMA 4W7UA 3N6HA 4M5PA 3QM3A 3F5LA 5DBUA 4GPNA 7ODCA 4CNNA 1XRFA 1JYVA 3RILA 3N13A 1W3TA 4WXYA 5XIMA 4HCDA 3U5UA 1W17A 4DBUA 1A50A 1HJWA 1X1ZA 1F6YA 1YTDA 3TQ0A 1FWRA 3ATYA 2ZX6A 4CU7A 2YZ5A 1DXFA 3OG2A 3ZLHA 3A22A 2CEQA 4UIOA 3JZEA 2VVNA 5LNVA 1AD1A 2B7NA 1JZ8A 3UPWA 2ZRWA 4XUYA 5EA9A 2QT3A 1NDWA 1F5ZA 3HGOA 1CXHA 3CPRA 4XG1A 4OWGA 3UZXA 4C1NB 1J4EA 1ENUA 3O05A 3BGGA 3WH7A 1X6NA 2VGFA 1RP8A 2Y8KA 1QHZA 2NVDA 2BS9A 3QJAA 4LF2A 3N4EA 1NDZA 1HL2A 1TJ2A 2AL2B 5BXRA 3BARA 5CPTA 5GJNA 1POJA 3EX3A 2WZHA 3CLWA 4BA0A 1T96A 5AHLA 1B4EA 2ZXQA 3SGGA 3Q67A 5DMMA 1VIZA 2VGBA 3ARUA 3H7UA 4GO8A 7TAAA 1GYMA 1ZHAA 3LPFA 4QSFA 3XISA 3B8UA 2G0WA 5C5YA 3PZQA 1PX4A 5EKYA 3VD4A 4JQAA 4NZCA 2EJ1A 5H8PA 1UA7A 3C2OA 3DBNA 5FJIA 3ZR4A 4IQEA 1FXQA 4OE7A 4PEKA 2YIHA 1VFTA 1OX5A 3TN4A 3IK2A 3KUMA 2ZADA 5AHMA 1EBGA 4GQGA 3I65A 1L8NA 2A4AA 2PODA 4PCFA 1GOQA 3RG6A 1E56A 3TXZA 1GJWA 4PB4A 5MHBA 1JCYA 2QR6A 4KH2A 4J9JA 1FY6A 4HOZA 2BOGX 1OJXA 1O1ZA 1F3EA 3VKCA 3GFZA 4L1WA 2Z27A 3F7JA 2GVGA 3I7SA 4XSLA 1XW8A 4NAEA 2FMNA 3GDKA 4GACA 4H04A 1QBAA 1U1UA 3EBVA 1AZ2A 3G1SA 1EQPA 3L12A 3RX4A 2NVAA 3LZ5A 4LB3A 3PZNA 2X1SA 1XCWA 3NG3A 2ZZ5A 3G24A 4I6VA 4MY1A 1HJXA 2PP3A 3FNDA 1LTDA 1IWPA 4IISA 3MY9A 1D3CA 2GGIA 4DELA 3OQ8A 1K8YA 4MB3A 4QCEA 3AIQA 1GG1A 3AICA 1E6ZA 4YCOA 3W6MA 4NYYA 3MSRA 1W1IE 1JF5A 2J75A 2RJGA 4GQ0A 1V3HA 1XLHA 2X1RA 4H7VA 3G1RA 3DG6A 1GOIA 4G7EB 4Q6JA 1UZ4A 3WUFA 2CLKA 5IDZA 3LTSA 4FALA 2VNCA 3WQGA 3ARQA 2VD9A 1SFTA 4E2DA 2OSXA 3IVTA 2PDKA 4JNYA 1XDLA 2Z24A 1A0DA 1DWGM 1TMHA 5FL1A 5C7VA 4C6DA 3QZ6A 1Q6DA 2XFYA 3BW2A 1LL6A 1BRLA 4UTHA 2J27A 3IUDA 3LDVA 1IEWA 4YXGA 2WMIA 4DPQA 1L9WA 3URQA 1GWJA 3GHSA 2EF9A 1RJPA 3H2CA 4KWOA 2VEMA 4US5D 1PJ9A 3PS7A 4B90A 2XINA 3MVTA 4AVNA 4WSKA 1LLZA 2W9MA 5LNWA 1IZCA 2OPJA 1E71M 3TN6A 1TCDA 1UP3A 1QXLA 1O6IA 1ECQA 5F2IA 4WDUA 3PM6A 3LXCA 3NNTA 3C5QA 4PMRA 3HURA 3FCPA 1OK4A 5G1MA 5KEZA 1H1YA 2VQUA 4EAYA 3SO7A 5CQ1A 3CIWA 4AQLA 4IZGA 3QGKC 2TYSA 1TYGA 3W7OA 2JF6A 1H4PA 1IT0A 1JZ3A 4DBWA 3CWOX 5FL0A 2VEGA 4IGSA 3B8WA 1E0VA 4CU6A 3V4BA 2D69A 3UPBA 2WCGA 3T8QA 3ARRA 2PDPA 3VOGA 5H2ZA 4EP8C 3T4WA 4XAFA 1BWKA 4ZCWA 1H63A 5DEZA 3GQYA 4PC8A 2NSXA 4P7LA 5A8QA 3T0CA 3FVMA 4Y9NA 4A2RA 3CEPA 3EKZA 4AHPA 3L4ZA 1A3XA 4IQDA 3L5AA 3AQUA 4H2CA 2IPJA 2VZVA 4RNJA 1E0XA 1GQJA 3CH0A 8XIMA 3WEZA 1LM1A 3M1ZA 4IX0A 4JKMA 1IE7C 4XZWA 3TSBA 2XDFA 3WMLA 1GVIA 5F4WA 3G6LA 3KL0A 1XLIA 2OFJA 4M81A 3UVIA 4S1FA 4Z17A 2PDYA 1W37A 4NAFB 2VURA 3EX1A 1IEVA 4DI8A 5CZ0A 1MI3A 3B9AA 1US3A 3TYDA 4AWEA 4P7NA 3OLGA 3PZOA 4PMXA 4DBSA 2VR4A 1M6JA 2FZ9A 1QBBA 2INFA 1BYBA 4ZGYA 4D6JA 5I3KA 1HP4A 3HFTA 1WBHA 3O9NA 2A2IA 4ZO8A 3QOMA 4QG6A 4NSBA 1DPMA 4UTTA 3BLLA 4RXFA 3SI9A 1MFVA 2I5QA 3PG9A 1VFUA 4AEOA 3KXQA 1VRXA 4UTFA 3RM9A 3WQVA 1PEZA 4HJFA 4U4MA 4C6BA 5REQB 3B9EA 5HUOA 4NXKA 5DRIA 3M46A 3WQCA 4EK7A 1R3WA 3JS3A 1R87A 1EC8A 4Q7NA 4XVDA 1UD6A 1FA2A 3EOLA 1JUBA 5AVNA 1OINA 3ARXA 4ZL1A 1W5QA 2BVTA 4KFOA 5FJUA 3O06A 1MXGA 5E9AA 3ZS4A 3H23A 2X1IA 4LC6A 3BAYA 3NJ3A 4LEFA 1E9ZB 1YPXA 1MW3A 2X1TA 2YL6A 2QV5A 5LA0A 3RCNA 5A6MA 1OG0A 1XXXA 1SO4A 2PWFA 2QJHA 3W76A 1JDEA 3SCRA 5AZ1A 3SADA 4JDBA 2FFCA 3UA4A 1LOQA 2J13A 1GPWA 5E0FA 2Y7FA 4JTTA 1UHVA 3DZ1A 3ZVHB 3M0VA 1KXQA 4DZAA 5ABFA 4WY0A 1EJ7L 3LM7A 1EKOA 3VNJA 4K39A 1MXSA 4IUGA 3GAYA 4CCDA 1K9DA 1SR0A 4O8RA 1QAPA 4WOQA 3ITXA 3TZFA 3EXSA 1OD8A 3BJTA 1GT8A 1S39A 4BQ3A 1Z8AA 3QSRA 2ZQ0A 4DNMA 4P8XA 1DJQA 1FWTA 1K6AA 3Q2DA 1R47A 4PA8A 2QPSA 3CQJA 1FCVA 1DIKA 3SSZA 5HWNA 3NSMA 4DB7A 3W07A 2NXHA 1TV5A 3QMTA 5A6TC 1X6UA 4I8YA 3V7PA 3F4VA 1ZBCA 1Z3NA 2BODX 3K8KA 4TVUA 4DO5A 3LA4A 3GXFA 1GQNA 1B2YA 3ATZA 4U31A 3W75A 5FAGA 3FFSA 1ZENA 2J4GA 1PXGA 3IACA 3IAPA 4H19A 2ADAA 3RDKA 3LCFA 1NWTA 5D8WA 3VU2A 3HG3A 2QDGA 4A22A 4QEHA 1E6QM 1Z7AA 3W1UA 4UOJA 4PUNA 1B3WA 5M5DA 1P0BA 5A6BD 1XLCA 1DE5A 2ZRYA 2A7RA 4NZJA 5I0DA 1OCNA 3WBXA 4OBRA 4YJ5A 4BKNA 4ZE4A 3TQVA 3M47A 2FZBA 1UCWA 5CC3A 2B7OA 2QMJA 1JI1A 1FWCC 3DFTA 1AVAA 4HPGA 9XIMA 1ZPTA 2J7EA 3M64A 1GJUA 1FTXA 2ZOXA 3ARYA 3S2JA 3C2VA 3NQGA 2ZWZA 4HU4A 4M80A 4C6JA 4OBTA 2B7PA 3D6NA 2BXZA 3NQVA 4PBEA 1DXEA 4AEFA 1UW9A 2D0FA 2WVVA 1ECEA 2KAUC 4XX6A 2VR2A 5LIUX 1BKSA 3B97A 1E5NA 2R1MA 4CGTA 1NJJA 4LAUA 5CC7A 5EU9A 2RJHA 1R30A 4JPGA 3UG4A 3EXRA 3KLKA 1KTNA 4QBXA 2XH7A 3E3HA 1HQTA 4B2DD 3AMDA 1TE1A 1LP6A 4PH6A 1XYLA 3WK0A 1QOPA 5FJJA 3GTXA 4AAJA 7XIMA 4A8LA 1XH0A 3PZGA 1ZCCA 4P7QA 4BWLC 3UJ2A 3WH6A 2XZ7A 3HZ3A 4IQLA 3UJEA 4GIEA 3TFCA 4HMCA 3OBAA 1S2UA 4NNAA 3DC0A 1JXJA 2V3DA 4X0NA 3QBUA 4P5UA 3HPAA 5K9CA 2AAAA 3KHDA 2QJGA 1TWWA 4ZSTA 3PNZA 1XC4A 4KETA 5GVJA 3OO2A 5DANA 4WHBA 1ADDA 2VEKA 3UJSA 4NVTA 2DJLA 3GG7A 1CIUA 4WEVX 1VR6A 4HMEA 4H7CA 4PMZA 4ZB2A 1PE1A 2PLMA 1JJKA 2YSWA 1FCQA 2V63A 2V5LA 4RXGA 2J9ZA 2A85A 4DO7A 3NAVA 3TKFA 4WDTA 3W7DA 3VKBA 5BU9A 4YVPA 3QW4B 1XYCA 3B0UX 2NV9A 2P10A 1SQ7A 1ISXA 2E7FA 4MKVA 2BY0A 2QCEA 2CC0A 4ZBCA 4UNIA 2O9OA 3AJ7A 1SFLA 1XWYA 4ORIA 3MZ2A 3EPMA 1GEHA 1HNYA 1F7BA 1XL9A 1VRDA 2ZKMX 4O28A 1EHAA 3VMOA 1LG2A 3G2GA 4R5EA 1E6XM 4BEQA 4HU8A 2FDMA 3WG6A 2ZTJA 3PR2A 3STGA 1OIMA 3L23A 4HK7A 4LVDA 4CUCA 4A8RA 1OM0A 3O0KA 4NJKA 4AX7A 4HZMA 3CU2A 2XN2A 3W1LA 4GY0A 3TJ4A 1XLJA 1KWKA 2IMRA 5HOSA 1TV8A 1QI3A 1G4TA 2WJEA 1UH3A 1TCMA 4E2BA 1CGXA 3HPZA 4Y9OA 1V3IA 1ONXA 3JZUA 4MG4A 5FESA 3QR0A 3BLDA 2A3CA 1XD1A 3P7YA 4K6AA 3SGUA 4FIQA 4AZGA 2VP8A 2GGJA 1P1XA 5CSSA 3EKGA 3FGCB 3MC5A 4PSPA 2NQLA 4M6QA 1JAKA 4J2MA 2JQXA 2PDXA 3EAUA 4AZBA 4JFSA 2VZOA 1W1YA 1GZ1A 2PGWA 4ZQMA 4FF7A 3IK4A 3PN8A 2W62A 4UTIA 3S5SA 2ZUSA 2WVVB 1EB3A 3OHMB 1UH2A 3CK5A 4B15A 1B30A 3VGDA 1FFRA 5A6KA 3CV1A 1QI0A 3FXYA 4ASTA 1E72M 3PG8A 3WK1A 1KW1A 3G3MA 3TTSA 3Q45A 4AZ6A 1J6OA 3UCQA 3S47A 3BK0A 4LBSA 4ZOEA 3GG8A 3QYQA 5CPLA 2FFIA 1Z42A 1XYBA 4A8NA 1CCWB 1VJZA 2DSUA 4LS2A 1FWWA 4E3VA 1VHNA 3W37A 1IF2A 1ODZA 3THAA 3QKEA 5M3WA 3OLDA 4HB7A 4B9ZA 1MNZA 1VBHA 3SW6A 4IMCA 1ZY9A 3VUPA 1TA3B 3VGBA 2Y2WA 3R94A 3NDOA 3DIPA 2OQYA 3AIRA 4O52A 1BHGA 1CXLA 4QJ5B 3LX9A 1O66A 4PRRA 3JVAA 1KKOA 1NM9A 1FHLA 4AWUA 2YL8A 1XICA 3E0WA 4DYJA 3KAOA 5JH1A 1E3XA 1KBIA 5ABHA 1MW0A 2FPYA 4GH1A 3IVUA 4EACA 4AHQA 5G5IA 3K8MA 3PFRA 4UCGA 5BWFA 4CCCA 2JEPA 1BWLA 4JTCA 1EC9A 1JPKA 4S3JA 2QUVA 1JDFA 2C71A 3MSYA 2Q02A 2PE4A 4Q7IA 5AB3A 5AC4A 3S2NA 2YA0A 2YBTA 3CO4A 3P93A 3RR1A 5K4ZA 3DFNA 4QLJA 8TIMA 3VCCA 1WDPA 3OZPA 3AIVA 4ZQPA 2BVDA 4S38A 3RPTA 1JR1A 4N6EA 2VM8A 3EMCA 1JIBA 3N34A 4Y9AA 3UR2A 1YDVA 2HS8A 4I9TA 3XIMA 1FH8A 3OYZA 4C6LA 2GWGA 1KCKA 4NU7A 4GUJA 3OJGA 1KM3A 2C91A 1W3KA 3EA3A 1YIXA 3MQTA 4JYEA 1E70M 5F4XA 1ONWA 2DY3A 3SQMA 3W72A 2XYLA 4I5UA 2WHMA 3WJYA 7ENLA 1RBLA 2INZA 4E8CA 1RD6A 1L2QA 1TJ0A 2WVSA 3DESA 1GVQA 1XQKA 5IXEA 3WK3A 1BAGA 5E9XA 3A4JA 1RQBA 4MKNA 3PTMA 3TROA 4RJEA 4NAFA 3B4YA 4K7YA 1PTDA 1NIUA 1Q3NA 3IV8A 4L6OA 1EIXA 2WM1A 1UMLA 1I0BA 3AFBA 2DPEA 4Q6XA 1TZ7A 3REQB 5L9FA 2WSRA 3BLPX 2V8ZA 2YYTA 4HSOA 2HV5A 4PB3A 5FJRA 4C6IA 2OU4A 3W26A 3EDFA 3BICA 4BQ5A 3TMLA 3BVJA 1XIEA 1RR2A 2FGLA 5A8NA 1U5JA 3ZLGA 1I0DA 1BKHA 2WAGA 1KQYA 3LHVA 3M41A 3EWYA 4FNTA 3MKKA 3W38A 3T7VA 1AMKA 2VELA 1E0WA 4B5UA 5CPNA 4YHGA 5LGZA 2GGHA 3NZRA 4EXQA 2CZ5A 2IKGA 2WSYA 3AALA 1LUCB 3AMLA 1HFBA 4ZE5A 1PIFA 3R6IA 1V02A 4H9XA 1EZWA 3LEPA 3W2KA 2FGZA 3VGFA 3G77A 4XIMA 3SFKA 4M6UA 3VD3A 5C2GA 1O7AA 4JL1A 1WKDA 4GJ1A 1WDRA 3WK2A 4HTBA 2VWTA 3O6YX 1S3HA 3FA3A 1R3RA 3QFEA 1XKJA 1SSDA 1H62A 2ZRVA 2CLMA 1T6MA 2HMCA 1V7YA 5KSWA 3M44A 1YXYA 1CYGA 1DIEA 2PDFA 1AMYA 2IKIA 1ZGDA 3PF3A 4IICA 3KLLA 4AZ5A 2YL5A 1UR4A 4DPPA 5IBXA 4LCRA 2PD5A 3O63A 2OCZA 1AQHA 2PGEA 3RUBL 3TCSA 1DWFM 3CZLA 4N4PA 1Q6QA 2GL5A 4GI6A 4XZLX 3LCIA 2JKAA 2E6AA 3I7RA 3L21A 5E0CA 3AXMA 2X16A 1GGOA 2D22A 2GPTA 4IPPA 3RLHA 2UY3A 1S2VA 4R27A 1KRBC 1VBUA 2WMIB 3W24A 3ES7A 1S46A 4HNUA 1A3WA 4S3FA 4U5KA 2OODA 4MWAA 3HF3A 3M0KA 2R14A 4RDYA 3B9NA 1IIHA 3LS9A 3O0FA 2ACQA 3W7MA 3W87A 1EGVA 3UYIA 4WDWA 3FS2A 4AEEA 3CIVA 1T8QA 3PBGA 3MMUA 4LS1A 1IXQA 4GYKA 1XYMA 3WCZA 3RCYA 1DJGA 3ISIX 3W7EA 1NFBA 1B0IA 3UFYA 1M9HA 2GUYA 4HA0A 9XIAA 3B40A 1KBKA 1N2VA 4PCTA 1ZAHA 3OBEA 3BO9A 4V1XA 1IR2A 5HJXA 4DM2A 3WNMA 4GWEA 3GO2A 4EIVA 1BRLB 4O4VA 1BXBA 4DO6A 3STFA 1FWJC 4UQAA 4HNLA 4RKAA 1XIIA 1K7XA 1OYAA 5FAJA 3H2AA 4KGLA 3MSGA 1E6NA 2W27A 1E4MM 3P0XA 1E4NA 1F73A 3NPWA 3TSMA 3GX9A 4YVXA 1DOSA 5KITA 4N7QA 3SEPA 4W9TA 2OG9A 3U57A 1NH6A 3RJXA 1QW9A 3A4XA 3C8FA 3GW3A 8XIAA 1KM2A 5D9OA 3B8VA 1C9DA 3P0WA 2WQPA 3PUGA 4TXEA 3PBMA 4R88A 3KX6A 3MS8A 4O13A 2FJUB 3DENA 4AXKA 2FJKA 2PTYA 3IUHA 4LYKA 5AVHA 4PMVA 2E9LA 3CAQA 2QAFA 4GMEA 7CGTA 1E1FA 3N9SA 3R8HA 1HXJA 1HKIA 1XIFA 2NQ9A 4DIAA 5HMSA 1EF3A 1NWSA 3H22A 2HVNA 1P7TA 4KEZA 4F48A 4AUBA 1GVYA 2WMHA 4XZNX 5D9PA 4RV8A 4H6EA 3TC3A 3FN9A 2QYGA 1PTGA 3CJPA 1S1PA 3W85A 1ISZA 3D47A 3UVAA 3QY7A 4ES4A 3AS3A 1F6KA 5I5RA 4WX2A 4IIFA 1MWOA 1US2A 5XINA 3ZOAA 3AIEA 3RNDA 3LV5A 4MY8A 3POCA 2JKEA 3BV7A 2HZGA 3C0JA 4PMDA 1TWSA 3BMXA 4DXKA 2QXWA 4UTLA 4RZ5A 1X98A 3ARVA 4NIRA 2E8YA 1XLDA 1U30A 4YS1A 3CASA 4FSAA 4F9JA 4Y90A 4GYJA 1HUVA 4ML4A 4S2CA 5LIXX 4WKFA 2DVTA 1PZ0A 4YN5A 3M0LA 1BF6A 3HTWA 1XYFA 1KM0A 4JTRA 1M68A 3FA5A 2OZ8A 1U83A 3ANUA 4GXWA 5EL1A 1AW5A 5CJ5A 3P2VA 2F61A 2ZUWA 1DORA 1EJRC 4H8UA 3CMGA 2JFEX 3T55A 4DBEA 2P0IA 1GQLA 3GVVA 1C8XA 3ZYZA 4KFNA 1VFMA 2Y7DA 4LUYA 3INPA 1EQCA 3F4NA 1D7KA 4XKYA 4H8VA 4O54A 2Z1BA 1H2JA 3UPMA 3LNPA 2E67A 3TNBA 1RBAA 2ACSA 2FTPA 3VI2A 5DCBA 4I9AA 1YPIA 5HNRA 5D37A 1SMDA 3RIKA 2PBOA 2E9MA 4MWAD 4GA8A 4AD0A 3LMZA 1Q6GA 3FXGA 1XGDA 2QJJA 4QG8A 3DFYA 5D2WA 1TJ1A 3C2YA 3ARTA 1TPVA 4R9XA 4UCFA 1UR9A 2DT0A 1RD5A 1DHPA 1ITCA 4YWSA 2FB3A 2PLKA 2YDRA 4AY1A 2VO5A 2QCDA 2BP1A 1TPUA 1YHTA 1V03A 5AYXA 1SZEA 4MY9A 1KBBA 4C91A 2IS7A 5DY3A 2VCBA 4B5VA 1J0HA 1UPPA 4UTMA 3MCMA 3EGJA 3W27A 3OG3A 1N8IA 3K4WA 1GKPA 4KEMA 1H7XA 4F0LA 5ENLA 2BY2A 2XGBA 1GG0A 2OJPA 2X0YA 1I9CB 2CESA 3TC6A 5A94A 1GVOA 3LENA 2BZNA 1CGVA 2E28A 4FXFA 4OOUA 1KR0A 4PCNA 3ITTA 1SVDA 3BV4A 4L4OA 4HVXA 1K70A 2D23A 3GB6A 1XIBA 3CHEA 1UIOA 1Z69A 3FAWA 4H41A 3LU2A 3MWAA 2OWWA 4LCSA 2OWCA 4KKXA 1DEDA 5T91A 1LWHA 3KZPA 1ZCOA 2IPFA 1GW1A 3VZYA 1MDLA 1KTCA 2FZ8A 3M6YA 3PFMA 3WJXA 3DUGA 2NSOA 4JCLA 4Q8UA 3SZ8A 1WXYA 5C70A 1XD0A 3VIFA 3H2EA 1HF6A 1BXCA 1ITXA 1MXDA 4X2PA 5AHFA 1XLFA 4GRSA 4KF1A 3E0LA 2REQB 6TAAA 4UR8A 1B3VA 2IUZA 2IKJA 4TV5A 1OGSA 1LQ0A 2OKTA 1DV7A 3PC0A 4TQTA 3ABSA 2P8CA 2BGNE 2EO7A 4C5YA 3H54A 4CN6A 3IJ6A 1EZ2A 4A8IA 1S2AA 4D1IA 1XX1A 3KS5A 1VFOA 4F0RA 1U1JA 2XM1A 3O8AA 1KXHA 1J2WA 3GNXA 6REQB 1IT7A 1NY1A 3LPPA 3UP8A 2GQAA 2GJPA 1V6WA 3FJ4A 2XN1A 2OGJA 5HJLA 4Z1AA 4CD8A 1YYAA 2W79A 4W7VA 2OTDA 1YQ2A 3G3DA 3TW6A 1KO0A 3VKDA 2ABBA 2A3HA 4L9YA 2NX1A 1VEOA 4JIQA 2RFGA 1RJRA 3N6QA 3P6LA 2PDHA 1ME9A 5FF0A 3VIMA 1V79A 3CBWA 3HGSA 1UD5A 2RH9A 4V28A 1LRTA 1UKQA 1FDJA 2BNJA 4NX0A 1GZGA 1EOKA 3UCCA 3ZWSA 4Q8MA 3SBFA 3TR2A 1XLLA 2QCMA 2BBFA 3FEMA 3R5EA 2OXNA 5EMYA 1CDGA 4TMCA 4UMBA 3AHZA 1SJCA 2CITA 4K7VA 2CZVA 1GTHA 4PUEA 1H0GA 4B92A 2G5WA 1XIDA 4EKJA 4HA3A 2FH6A 3BLEA 1BG9A 1PTAA 3DFOA 3GDBA 3QPEA 4HQVA 4HKPA 1AH3A 3ITGA 4JDYA 5GQBA 2GVLA 1XH2A 2CZEA 3CLMA 3MV01 5PTDA 2J7CA 2F84A 3C61A 4MSSA 4HNTA 1G9HA 3K30A 1D7FA 3C6CA 4HN4A 2NX9A 3BXWA 2QULA 4QIUA 3VABA 3IAQA 1JL8A 3CQIA 4PULA 2CHRA 1BLIA 4IFOA 3CWHA 2WQDA 2VXNA 2ZZ3A 3OLEA 2WSPA 3BGJA 1A80A 2QJIA 1RK6A 4TR9A 1A4LA 5FACA 2CHNA 1YNPA 2Z1WA 4AH7A 1R3SA 1YKWA 1YDOA 4TV6A 1ONEA 3L2IA 4QXIA 5G4EA 3EA1A 4S3BA 1RY0A 1HJUA 2GJNA 3SB0A 4A21A 4K8HA 2EQDA 4FR6A 3S5NA 3U6WA 2EPOA 1FBAA 3A3HA 3ZVIA 3NGFA 3G8EA 2Q8ZA 4LY8A 3A21A 3W3OA 1FHDA 3S6TA 3RLVA 4ATLA 4D2JA 4MLJA 1UWUA 1LORA 1XINA 2WMKA 5G4WA 3CT7A 6XIAA 3KFTA 4MGGA 3W25A 2XVLA 1I60A 3LSBA 2VGGA 2ZC8A 1JCJA 3Q37A 3RF9A 4KEUA 1V3KA 1RAKA 4MIMA 2NLYA 4ICMA 4OT7A 1QWGA 2RHGA 3MO4A 3S42A 4UTTC 4E4FA 2BFGA 1SM9A 3K13A 3LD5A 2WCSA 3H7RA 3CUIA 2FTYA 4A3YA 1V3MA 4Q4SA 1KFCA 2Z2BA 4JHOA 2YXGA 4KT2A 2BGQA 1JCXA 3WLSA 4J1OA 1PKYA 3WDJA 2Y63A 4KWWA 5BZAA 4ACZB 3AIUA 4HN8A 2XIOA 4IP4A 3KTCA 1TMLA 5DCDA 4Q4PA 4FXRA 3PJTA 2D73A 1OFAA 1SJBA 3U0HA 1R9ZA 1XSJA 3EOEA 1NU5A 5I2UA 4D6HA 3K46A 1SPQA 4HU0A 4GCAA 5F2GA 4RV3A 1J0ZA 4UB9A 1LT8A 3BL3A 4KS0A 4IXXA 4EVZA 1QNOA 5EY5A 3TN5A 1R7AA 3R7MA 4Y96A 1DJWA 2VZSA 4Q8WA 5I06A 5TF0A 3LLXA 1G7UA 3O15A 4HNOA 1PV8A 3SQSA 1Q66A 4JTUA 4CD5A 5JIWA 4Q22A 5HMEA 5I7GA 3W00A 1Q4WA 1YDYA 1EO7A 2PI6A 2GOKA 5I3HA 1TPH1 3CL8A 1WCGA 2XH4A 3CNYA 1F3WA 1U22A 2ONEA 4W5ZA 5LHFA 1VBJA 2GK1A 4ZTYA 3IJ8A 2ODOA 1X7FA 1HKVA 3GXPA 1GQKA 3CPGA 3ABZA 4FX8A 4B91A 3DX5A 2BWGA 4XZBA 2QAPA 1EJVC 2J78A 1FFQA 1ZBWA 5CBJA 1J79A 3BAJA 2ICSA 1REQB 3URBA 1LROA 2XIQA 1JZ2A 1KM4A 4AY8A 5JMUA 1VKFA 3GFXA 4FHAA 4E6MA 1J12A 1UA3A 4RR4A 5BXTA 4UTWC 1KFKA 1POKA 3T78A 2QEZA 1DP0A 4QP0A 3NCOA 4FP1A 3ITCA 2XIJA 3WH8A 5ABEA 4J3UA 3VE9A 3WUBA 4W8LA 4M24A 6A3HA 2E3ZA 1DJHA 3IUIA 1QJWA 4C1KA 1LWJA 4E5TA 1CPUA 1J11A 3HG4A 3LMYA 1QVBA 4P7RA 1RCOB 2FB2A 4J4KA 1ZFJA 2CKRA 1XRSA 4QISA 5I79A 1GOOA 1P0KA 1Z32X 1K8ZA 3EB2A 3OQEA 5I00A 2YW4A 3M0IA 1GW9A 3MJYA 2ZXDA 3TMQA 4ACZA 5CC6A 5FI8A 1P0EA 4JTSA 5DT5A 4LVGA 4QHRA 3WLIA 3HN3A 4Q8VA 3BCFA 1BQCA 2F6KA 3VOFA 1TFVA 3FDGA 3WLLA 5I3JA 4GABA 4GUFA 3WL1A 3PZMA 1KC7A 1GOXA 3OZMA 4BHYA 4CNPA 3KOXA 2GWNA 5DXXA 2IXVA 1S5VA 1R6WA 4OFCA 1KFEA 3AS1A 3FX4A 5E5CA 4FMVA 1EJXC 3GNPA 1A5KC 1F61A 3T81A 3QTPA 1FWAC 3GKFA 4JY9A 1QO2A 1UD4A 4CVWA 2AMGA 3WF0A 1IWBA 1VJSA 1Z44A 2R1KA 3RR4A 1XI3A 1UOKA 5BWAA 3SRDA 2I16A 1P0NA 4FLRA 1CXEA 1X7IA 4IFKB 1W3IA 4A3HA 2D0HA 3ERPA 4P8WA 3C52A 1ZBKA 4MNLA 1QCWA 3EPOA 1C9WA 3FJNA 2A79A 1FWGC 4LBRA 3C8NA 3C0QA 1TV4A 4RX0A 5F1UA 3NM1A 4QS5A 3VNIA 2PWUA 4QGCA 3UNTA 3OVGA 3W73A 1ZBVA 4WKAA 5U7SA 5FEXA 1XFCA 4ML9A 1XBZA 4P8UA 3SCSA 2DUZA 4NJGA 1X96A 2BX7A 2D2GA 1SSGA 4RLIA 4XV0A 4TO8A 1W9PA 3K2GA 2I9EA 4WD0A 3IGSA 1JGIA 2F7FA 3AU6A 2ZVIA 2VUNA 3ICJA 4F79A 2J66A 1OYBA 1F9CA 3S3GA 3VKJA 2OGYA 3II1A 1NDYA 5CLTA 3OPSA 2FHCA 1VJIA 1TV7A 4Z2HA 1IEQA 5CZSA 3ABRA 3KCOA 1B3OA 1SGJA 2VCAA 3ZR6A 3M4HA 3MI3A 2E1DA 4HPJA 3SUSA 3NQFA 3R2GA 1TPFA 3IRSA 3CM4A 5HNUA 3CT2A 5AC6A 5KZ6A 3LCXA 4JXCA 4JX4A 5HAOA 3TYEA 1Q85A 1LBFA 1W3HA 4OBSA 2D3LA 5CLWA 3T05A 4I6KA 5E70A 3GIPA 3NQDA 6REQA 1FVPA 4HTYA 4F2BA 3H8AA 1KFLA 2WKJA 3Q4DA 4FF5A 3GE7A 4DM1A 1LDCA 3FEQA 2W92A 4YTRA 4KW2A 1V6XA 2YKKA 1EA0A 3C2RA 5C9UA 4HP5A 1QUMA 4JKKA 2Z6IA 2VX7A 1TWDA 3VK5A 4ERGA 1BGGA 4H01A 4G7EA 2V5DA 4V2XA 5LGXA 3VGHA 1VGAA 1ME7A 1UD2A 1THFD 2D20A 1V6YA 4HHLA 2EG8A 2O9PA 3BLOA 4AD5A 1PKLA 3T2PA 1XIHA 2CW6A 1OC7A 1Q45A 2GVEA 1MEHA 2XG9A 2C18A 5FJPA 1GEQA 1XH1A 2VC5A 1JPMA 3I4KA 2XJ7A 5D02A 1NF0A 1X97A 2P8BA 4GIRA 3JR2A 2MANA 1DHKA 5LA2A 1DQWA 2WSQA 1OBAA 4JIRA 4WKHA 3CAKA 4S3AA 3MW7A 3N2XA 2WC7A 4QDMA 1UG6A 4L4LA 5AZ0A 1L6FA 3BAWA 2Z28A 3QH2A 3VDAA 3W22A 1CBGA 4GY1A 1B1YA 4NJIA 3BE7A 2BXYA 4XAGA 3OP2A 4UTUA 1IGSA 2WWCA 4W88A 2A3LA 3CEUA 4MTVA 1OWQA 1KTBA 5H8UA 3IGUA 3KCJA 4LAZA 1Q65A 1TTQA 1W91A 2GYIA 2ZYFA 2JF7A 3UYCA 3HIJA 3M0HA 2G3MA 4JTGA 3QN3A 1E1CB 3ORWA 2OB3A 3TW7A 1KBLA 4D6DA 3WQFA 4WY0B 5TNVA 1HL8A 4NZ3A 2XIMA 3W0KA 3LGDA 4JAWA 3D0CA 3TZNA 1PZ1A 4M3PA 5E6ZA 4HZ7A 1TWZA 1UQYA 3M16A 1OQFA 4N9CA 4ICNA 4IPIA 1JNDA 3ZJ8A 3APTA 2VTFA 1RCXB 4MWAB 4GJJA 4IHCA 4PUMA 2HBVA 3TH6A 1NELA 3JU2A 5CSRA 4QR6A 3VX0A 2VFEA 1GVEA 3TVAA 2YBUA 4XBKA 2FZMA 4P2VA 4BI5A 4D6EA 4KESA 1XIMA 4UTJA 3B05A 4MNKA 1G4PA 3A24A 4AYSA 3U7BA 3BAIA 5JIPA 5D05A 3PUDA 1CXIA 4BZYA 5FF7A 1I2RA 3CAWA 2XVGA 3M5VA 4QCFA 1ML1A 4OV4A 2C0HA 3WQEA 4PSRA 2I17A 4IGHA 3ABOA 1GPFA 3PPFA 3DDMA 4R34A 4JTJA 2P50A 1JNEA 3HPXA 3WLTA 1IIGA 2P3ZA 3LERA 4GYPC 3MDUA 1J9YA 2PA6A 3MUIA 1NOUA 1XJBA 4AD3A 4MJMA 5G4HC 3AU2A 2QS8A 6ENLA 5C55A 4O16A 3LI0A 4HMNA 1UROA 2R9RA 5E6YA 3UNDA 4EX4A 3DHFA 1JDAA 2WZTA 2YCJA 3SUTA 5HR6A 4GC3A 4UZUA 4M56A 3W7RA 1CEOA 3G8RA 2J74A 2BV9A 2ZZ6A 4DY1A 3NDYA 2UWFA 2AL2A 1E55A 3W1PA 2QUUA 3VNZA 4X22A