3LV6A

Crystal structure of the mutant i218f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGFIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lv6A00
1OK4A 2NUXA 1OHLA 4OQVA 4Y90A 3UWWA 4PEKA 2A7RA 3EXRA 3MYPA 1G4PA 2P0OA 4E38A 3S1VA 1TQXA 1OFAA 4I7WA 1EA0A 1V7YA 3LV6A 1DQWA 2E68A 2H90A 3T55A 5D2XA 2P1FA 2QDHA 4IUOA 5FI8A 2W6RA 5DCDA 1OX6A 3DENA 4JIPA 2DZUA 2WQPA 3ATZA 4Q33A 3OA3A 1Z42A 4OV9A 1SO6A 2ZRUA 4OWGA 1G7VA 1Q3NA 1MEWA 4JY8A 5BOOA 1OG0A 4FNTA 3TFXA 2R14A 3H53A 2E5BA 2QDGA 5E0KA 3B8DA 3P5YA 1H7OA 4UR7A 3GAYA 3PY2A 1N7KA 3O63A 5TBOA 1NVMA 3PUOA 4JX4A 3U2OA 2ISVA 3NQ2A 3I7RA 4CNPA 3F4WA 4WY0B 3GR7A 2Y7FA 3NXFA 2X16A 4ICNA 5AHNA 2Q3RA 1X1ZA 4LC8A 4DBDA 3EX2A 1JCJA 3TJLA 1ZAJA 2QCLA 4GJ1A 3LXAA 1FCQA 1BKSA 1H7NA 1QOQA 3JR2A 2GQAA 1SO3A 4N9BA 4UTWC 5K2ZA 4UFMA 4MIMA 4JYEA 2J88A 2NX1A 4GNJA 2R8WA 4JTHA 5BW6A 3N73A 4LOCA 2YYUA 3O1NA 2V30A 3NPUA 8TIMA 2WNQA 4O50A 1T99A 2QUVA 1YDNA 3GDKA 4WOQA 2ISSA 4LVDA 3R5EA 4R53A 3MP5A 2F7FA 3AO0A 4IMGA 5D09A 3PR2A 5EBUA 3SGUA 2ZZ5A 1YPFA 3PS7A 2WPBA 1FQ0A 1EPXA 5IM51 3S5NA 3QPYA 3W7LA 1KA9F 3UXAA 4D2JA 4NJGA 3DFOA 2H8ZA 5MHBA 2A4AA 1PIIA 3GX9A 1F05A 3W7QA 1G7UA 2EPHA 4UNKA 3UWUA 1R2TA 1SZFA 1FDZA 4HNTA 4WY0F 3FOKA 3MO7A 4K38A 1FCBA 1SO4A 1N8FA 1LRQA 3KVJA 3L21A 1ICSA 2YDAA 3LCLA 3IRDA 4FHAA 1R2SA 4JTJA 1MSSA 4YWIA 3N3MA 4Y9AA 1OFDA 4N9EA 4UTHA 4R33A 4UTKA 1KM0A 3FLUA 4BFAA 3S5YA 2DORA 3MP4A 4FB7A 3IVTA 2YW4A 3I65A 5HWJA 1J2WA 4LNYA 2VFEA 2Z6IA 5G2HA 4NT0A 3GXNA 3DFQA 3TJXA 1KFKA 3INPA 4O4WA 4Z08A 4LTSA 5J5RA 1S3HA 2C6QA 3QEZA 4JX6A 3CHVA 3TDFA 3QQ1A 5HR6A 3TE9A 3WJZA 3GKFA 4ZQNA 3G18A 1FCUA 3TKFA 2O7SA 2A1YA 4HT3A 3C2FA 1JCMP 2CU0A 3Q2DA 3WJYA 5AC8A 2BXVA 3P7YA 4RZ5A 3GZ3A 4NNAA 4JX5A 2WSQA 5D05A 3TK7A 3PBYA 4QISA 2RH9A 4JEQA 4TO8A 4NJIA 4HIBA 3MP3A 4Z0JA 1W56A 3G8EA 4XQ6A 4BK9A 2EF9A 4QIUA 1YTDA 1G69A 2NX3A 4WD0A 3S5ZA 1R46A 3LHVA 3FFSA 2VEMA 4S1FA 1JCYA 2XN0A 2JKEA 4ZQPA 3N19B 3PC0A 4M6QA 3VCRA 1RD5A 1ZAHA 3EWWA 3DHDA 3BPWA 1Z41A 4WJEA 3STCA 2VFDA 3W7JA 3V75A 1LZOA 2AQWA 2GPTA 3GXPA 3HIJA 1Q6RA 5DXXA 1O95A 3DHFA 1T0OA 3MHUA 5I3KA 4UTMA 4O8RA 1QPOA 2Y85A 3VNDA 3W74A 1XBZA 1MZHA 3R13A 5IBXA 2E6FA 4O0ZA 3LCXA 3HG5A 3W2KA 5FF0A 4PL1A 2OCZA 3TAOA 3TSDA 4BI6A 1OFPA 4H3DA 2FB3A 1ICQA 1L2UA 5ABTA 1Z48A 1D3HA 1DKWA 1XDLA 2C18A 4OGZA 4FXSA 2EHHA 2V2DA 1JRBA 5TQLA 4UXDA 4LRTA 2VEPA 4N4QA 2VELA 3LTSA 2P10A 1ALDA 1TRIA 1JCXA 3NL2A 3CU2A 1B4EA 4K8EA 1XI3A 3G1XA 3DU0A 1B9BA 2FQIA 2R91A 4A29A 4P2VA 5HWNA 4OT7A 2O7QA 1AW1A 1K8XA 2QJHA 4JR5A 1ML1A 1G6CA 4JTKA 1YADA 3AJXA 1EEPA 1AL7A 4UMAA 4DO4A 1O5XA 4X9SA 3VE7A 2FPYA 3F1QA 2Y7EA 3MHGA 1M7PA 3W6YA 3HGOA 3LERA 1Q45A 2YYTA 2WNNA 3KVMA 4JTFA 3VFLA 4UFJA 3RNDA 3KHJA 3THQA 2YCEA 2W79A 3EX1A 5DLCA 4BWLA 1HO1A 3SI9A 1IF2A 3NQCA 3PAJA 4DEFA 2RFGA 1TJPA 3BG9A 2CLKA 1D3GA 2NWSA 5DCEA 3UZJA 1SW3A 3N9RA 3KAOA 1W8SA 2Q8LA 3MMTA 3STFA 4MY9A 3K30A 3STGA 1PVNA 3OVQA 4QJ1A 2JGYA 2Y89A 3G0UA 1B4KA 2QCNA 3NQ7A 3MJYA 3W7GA 2I1OA 1S5WA 2G96A 3O07A 2QUTA 3GB6A 1TTJA 2V82A 1OFEA 5C6MA 4CNOA 5C5YA 3FJ6A 1GQNA 4I7VA 4DF2A 4RCXA 2ZRYA 4PFMA 2A6LA 1WOBA 1GEQA 1FY6A 3L2IA 1LYXA 4LS2A 5HWMA 1G4EA 4KWWA 4O0KA 1ZJIA 1EUAA 2NUYA 2FDSA 2ZTKA 3KVLA 4WXYA 3TXVA 1JQXA 3PBWA 2WSRA 3H55A 1QMLA 1LLZA 5CGQA 4LT9A 4TX9A 2ABBA 2X1TA 5KZMA 1WX0A 1LBFA 3LOTA 3TQ0A 3TAKA 2V8ZA 3M43A 2ALDA 3W7HA 3C2EA 5BMWA 2QCDA 2YSWA 2X2GA 3RF9A 1GWJA 4Z1CA 4N6EA 4XZ9A 4JTSA 3NDOA 3N34A 5EMUA 1F5ZA 2OT1A 4WX2A 3W86A 4MJMA 3NNTA 1QOPA 2FFCA 3BLEA 4GBUA 2G5WA 3MHFA 3W70A 4JTUA 3UYCA 1H60A 2VOMA 3EWZA 2C16A 2BTMA 1CW2A 4NNCA 4UFLA 1BEUA 3SY5A 3VE9A 2QCEA 3W7IA 2QCFA 5AC7A 3LRMA 4UTJA 3BW4A 1D9EA 2RHGA 1TB3A 1A5CA 2C15A 4A2SA 1DOSA 4MOZA 2WO5A 3PWAA 4K6AA 2H8XA 3NZRA 3CEUA 2ZRZA 1OFQA 2QUUA 2V5BA 3NOEA 1P0NA 3KX6A 4MVAA 2WJZA 2GUUA 3DH7A 5F2LA 1LOSA 4N9CA 1DL3A 3TV8A 3W7DA 3HPSA 1FWWA 3GDLA 3TMQA 4IMDA 1VLWA 3UQNA 4IGHA 3F03K 5IBXC 2DZXA 3W7NA 1LROA 4AF0B 5G1TA 4DO6A 3HGRA 2JGQA 3U6WA 1LOLA 3OG3A 1OVDA 2CLIA 4UMCA 4U28A 2CLLA 3WK2A 4ZMGA 3TC6A 4KKXA 3LHUA 4M7TA 5LKYA 3L5LA 5AFDA 4HNUA 1KFCA 4YCPA 3W85A 4LUIA 4RK8A 2Y61A 4HPJA 3M5XA 1QDSA 4ADTA 4K37A 4GUFA 4NZFA 1W3NA 4UFIA 1FX6A 3IIPA 5KZEA 3C4UA 3GVGA 3RFAA 5F4WA 3WK1A 1TCDA 5D03A 2I9EA 1XKYA 4CNNA 3IIOA 3EX6A 4QM1A 3QM3A 1UJPA 5AN7A 3PSWA 2PURA 4L4LA 1W1ZA 3GAKA 1R2RA 3TSMA 1JCNA 3TA6A 4YLWA 4BWLC 2DP3A 1IIGA 3C3NA 3G3DA 3FJLA 3T40A 1O94A 1VCVA 3HO8A 5HINA 4LC6A 4X22A 5AHFA 1NAL1 4JYFA 3CC1A 4GRSA 4YXGA 1OYCA 3G22A 4EIVA 1OFRA 3E96A 1OX4A 4WZHA 2J6XA 1L6SA 5LGXA 2KZHA 4RLIA 2ZZ4A 1XBVA 2ZA1A 2E1DA 5D04C 3FEMA 3LCFA 4KFNA 1UCWA 3QW4B 2CZDA 1ME7A 4O12A 4IMCA 1G67A 4A22A 4A3UA 1QO5A 5LNWA 4LUJA 2YW3A 1ME8A 4RV8A 4AAJA 4ADUA 1XM3A 4FX7A 5DY3A 1KM2A 3C0JA 1DHPA 1IGSA 5EA9A 3PVFA 4K39A 3QSRA 5CZTA 3CIXA 1THFD 3M1ZA 4BI5A 2E77A 4XKYA 2YFNA 1Z44A 1JUBA 2ZZ7A 2CZFA 4UFKA 5AOUA 1EP1A 2QJGA 3PUEA 5CSRA 1I45A 1GZGA 3G1VA 1X8FA 2YR1A 2ZRVA 2BX7A 2RDTA 1H63A 2EGZA 4S2BA 3NQ8A 4NVTA 3PBVA 3KOFA 1H61A 2Y88A 3I7QA 2DU2A 2E5DA 3EWXA 4QNWA 5A8GA 1QWGA 1W3TA 3W87A 4ADSA 5U4NA 4O52A 2Y63A 3E02A 3HOJA 4IPJA 2QCGA 1TV5A 1I2QA 1BWKA 1H1ZA 3P60A 1T8XA 4O1DA 1TTQA 3A24A 3LXBA 1RVGA 4Z0SA 4AWTA 1U5JA 1KLZA 3O15A 1DVJA 4O18A 4FNRA 3TMLA 3I6RA 2DZTA 1TO3A 4JTLA 1SR9A 3QYQA 4AHQA 2QR6A 3HPZA 4O28A 1M5WA 4ORMA 3B06A 1AW5A 1AW2A 2CZ5A 3R12A 4Y96A 5D30A 1U83A 4O15A 1M7OA 3PM6A 1FXPA 3M6YA 1FBAA 2J9YA 5FEPA 3W1UA 3NA8A 3A5FA 4XBSA 5FF4A 4M19A 2OT0A 5D33A 1PL9A 3TNOA 3OIXA 5L9FA 2VEIA 3LTPA 3QC3A 5DCBA 3G3MA 4E0CA 2ZRXA 3LI1A 1PCWA 1WXJA 1C8VA 5KSWA 1GYNA 3T78A 1SO5A 2Y70A 4UTTA 1TV7A 1ZFJA 5FEZA 1XUZA 3C56A 3I7SA 1H62A 1Q6OA 3MI6A 1GOXA 1SU5A 3R89A 2QCCA 3L65A 2GQ9A 1VC4A 1R30A 3RLVA 3CM4A 3W71A 1F6PA 5HUOA 1TTPA 2NXIA 5CKSA 3W88A 5F2GA 4AWUA 3M16A 1TPFA 4R7JA 4CCCA 1WAUA 1NFBA 1SZNA 3EKZA 3NGJA 3LGEA 3P62A 1LCOA 4PA8A 3W1AA 4IXHA 1W5PA 1TJRA 1GPWA 2B7NA 2TRSA 4O10A 3UZ5A 4MUZA 2GQ8A 1EB3A 4JDYA 3SSJA 3FA5A 4I7UA 5H91A 2DZWA 3NZ1A 5AYZA 1WA3A 3DFSA 3NQEA 3BVJA 5DBUA 3Q58A 2YX0A 4O57A 1YXYA 1KM1A 1I4NA 1F7BA 1IXQA 2B0MA 5K9DA 2GVGA 4LWWA 1YLVA 1RPXA 4RKAA 3G1SA 1FDJA 1M6JA 1RQEA 2Y7DA 4NX5A 3GDMA 4PODA 2V2CA 1BTMA 1J5TA 1PHQA 3CTLA 3Q37A 2A7PA 3USBA 1F2JA 1TRDA 3KRSA 1HUVA 3HGJA 1OYBA 3LM7A 2E6AA 3NM1A 4X3ZA 2HSAA 3MYOA 4MY1A 1G4TA 1IXOA 2H6RA 4M7SA 4JY9A 4Q32A 1SFJA 1IIHA 4C1LA 3U8GA 5BMXA 5AB3A 3O06A 5F4SA 1KLYA 4UTIA 4NJHA 2ABAA 4W9TA 3UWVA 4Z1AA 3NL3A 4PCFA 4GXMA 3LCIA 1OFBA 3LBMA 1ME9A 3W3OA 4FX6M 2NZLA 4M5PA 4UTLA 4MFDA 2J9ZA 4RZ6A 1A5AA 2NWRA 1TYGA 3CLMA 4WOZA 5BRBA 3H54A 2OMAA 3TSBA 2NXGA 4EVZA 2H3BA 3BO9A 5D2YA 4P61A 1VYRA 3LHTA 3DI1A 4FXRA 1MO0A 4S2CA 1X1OA 3NEVA 1FXQA 2BWGA 3B0VC 3V1PA 3UWZA 4JS3A 1YXCA 3W1PA 3UWYA 4HKPA 2A85A 5D38A 2ZBTA 4A21A 3O6YX 3W7PA 2CZEA 5CPMA 1SUXA 1YTEA 3KRZA 1W5MA 3QZEA 1JR1A 1TPVA 4HNVA 4O1AA 2J24A 4JN6A 3NQAA 3MWAA 5HMSA 3SECA 4JXCA 4WY0A 5I3FA 3EKLA 3T4CA 2YPIA 2Y6ZA 5E93A 3NYZA 3BARA 3W72A 1TSIA 1K7EA 3NPVA 3B04A 2A7NA 4JTTA 3KFTA 3ZS4A 3SR7A 3E49A 4O19A 1VQTA 3M5ZA 3NQFA 1KW1A 3M44A 2NUWA 1LP6A 3VKJA 2NV2A 4HSNA 1OABA 3W1LA 5KMYA 2J9XA 1K7XA 2Y7GA 3LCHA 5FEWA 1ZCOA 3OHIA 3ZFHA 3FKKA 2C19A 4HN4A 2VEKA 5EY5A 3HG2A 2GVJA 2QKFA 3NG3A 4DF0A 5LGZA 4B5NA 1KFLA 4JDBA 3S8HA 2ZCGA 3HJZA 2YGYA 1W5QA 1NF7A 3HMJG 4O11A 3IGUA 4UCGA 3P82A 4FO4A 1KBIA 5AHEA 3NO5A 1C29A 3LHZA 4IQLA 3L5MA 4XWUA 2E5CA 4N6FA 4MPQA 1LBLA 2IQTA 2VKZG 3UNDA 4RJEA 4UTTC 3W2NA 4DBEA 3P80A 4AVFA 2QAPA 5CPOA 1J4EA 3L67A 4QSHA 1QPQA 2HS8A 3DGRA 4PL2A 3ATYA 4H6KA 1L6YA 4AWSA 2G97A 5EL1A 3B03A 1O60A 3KRUA 1MEHA 4K36A 2Z2UA 2F84A 4K8HA 2A6NA 3DAQA 2JK2A 3JRKA 2YFOA 1B3OA 2BZNA 4MYXA 5D2VA 4EWND 1DBTA 5G2WA 1HFBA 4RZ4A 2FTPA 1IXNA 3FKRA 4TMBA 4H4IA 3SIZA 3M5YA 1S5VA 5G4EA 1TREA 1W3IA 3M9YA 3GNNA 4PTNA 3A22A 4ZQRA 4CLMA 3BV4A 1W31A 3IGSA 1XBXA 1RQBA 3C52A 1HL2A 3NL5A 2VFHA 1TPUA 1OF8A 4LY8A 1O4UA 2VENA 1GG1A 3PG8A 1W5NA 5CZ0A 1VS1A 2Y62A 3P8JA 3OBKA 4E2DA 4Y8FA 4NXSA 3ZR4A 1OF6A 5I3GA 3W73A 3GLCA 1UBSA 4LVBA 1S5TA 3EWUA 3QMSA 3Q94A 4GUGA 5KZDA 3W07A 5FF3A 4NZJA 4HNNA 1NSJA 4NUWA 3ABOA 1NF0A 2RDWA 4TMCA 3FYOA 3DXIA 1EUNA 3S5OA 4QAIA 3C6CA 3TW7A 3W2LA 5LHFA 1I8JA 1EWEA 5EKYA 5CZJA 4XTDA 3GKAA 2NX9A 1N55A 4MJZA 3TCEA 4IX2A 4J9JA 2WNZA 5HUPA 1KV8A 3QW3A 4AHPA 1AMKA 3IEBA 1XFBA 4KWVA 2X1RA 1A5SA 3GDRA 1I2NA 4MYAA 3GIYA 3UXDA 5G2IA 3MI2A 1WBJA 3A23A 3CB8A 3HF3A 4FEZA 2A21A 2WSYA 2VC6A 2CLOA 2QEZA 4LV4A 3ZWTA 3PB0A 3LCWA 3LLFA 4CCDA 4ZQCA 1DJQA 3G0XA 3S1UA 3IIVA 1ICPA 3NPWA 4DQWA 4JTEA 1SW7A 3LV5A 3G1AA 1B57A 1C9DA 3W7OA 1A50A 2C13A 3NPXA 3UPBA 5K9XA 1AK5A 3LCGA 3W7EA 5D2WA 2CLHA 1YDVA 5C2XA 1F73A 1JVNA 1RR2A 2A5HA 4Z1DA 3HBLA 4E2BA 2X30A 1YPIA 3SJ3A 2RKXA 1GTEA 4UFHA 3E0IA 3DFTA 4QITA 1TPC1 2UV8G 1L9WA 5F2MA 3TFCA 3FS2A 2X1SA 3GYEA 3BG5A 1H7PA 3DFPA 4ZVJA 1KM4A 3DFNA 1TPDA 1XL9A 1FWSA 3WJXA 1ZNNA 4GFSA 1VRDA 5AHMA 3LBCA 4MFEA 1K8YA 4ZQMA 2PC4A 1XCFA 1XDMA 3BK0A 4O1BA 5KTLA 4BR1A 2NXHA 2D73A 1W37A 4O1CA 3ANYA 3MI3A 1TPWA 4DPQA 4IOTA 3WK0A 3WFAA 2LLEA 3IVSA 1FUYA 4MZYA 3W23A 1SW0A 3O6DA 2ZRWA 3NQMA 4QNEA 2PCQA 5LNUA 4JYDA 1K3UA 5DN1A 4UUIA 4IX0A 3THAA 2ZYFA 4RXGA 2TPSA 1H1YA 5AHIA 3EX4A 1GJPA 4YL2A 4JICA 4AEOA 2BLEA 3ELFA 2FLIA 1W0MA 3PUDA 4PC8A 5LNSA 3EX3A 5HR7A 2ZZ1A 4O4VA 3NQVA 4NU7A 4G1KA 4RXFA 1HTIA 3LHYA 1RZMA 3EEGA 3P84A 2A2IA 3SZ8A 1E51A 4N4PA 2XFWA 4YMZA 3LHWA 2Z1BA 3DZ1A 3NAVA 3EWYA 1L6WA 2QJIA 1A5BA 4XBKA 1OJXA 1GT8A 3S6DA 2J27A 4LVGA 2DJLA 3C2OA 1VGAA 4HSOA 3BW3A 3O16A 3ABSA 1ONRA 2NLIA 2YXGA 4GUIA 4FNPA 3KVKA 4O13A 2ISWA 2C14A 3FYPA 4YCOA 4LRSA 5KITA 2QCMA 4N2YA 5A5WA 3CT7A 1GVFA 1DV7A 1A53A 4K7VA 3DBPA 2RDUA 5G1YA 4R34A 5C54A 5FF2A 3DKJA 1LTDA 4C1KA 2FB2A 3CQ0A 3L0KA 3PF3A 4MZ1A 5AYYA 4IXXA 3SFKA 5HULA 4NJKA 3GDTA 1WBHA 2PE4A 4FX8A 5D37A 3W1QA 1QCWA 1X7FA 4AH7A 4Y6GA 1TPH1 2ZDRA 2V2HA 4X2RA 3HQ1A 4OU1A 4LS1A 2ZZ3A 3TX9A 4POCA 1TV8A 5H2ZA 5EYWA 1DORA 1VYSX 3G0SA 4N02A 3UY7A 2ATSA 2ZFAA 3W83A 1K02A 1KTBA 3S9YA 4IJBA 4GUHA 1QPNA 5K9CA 3MBDA 1P5BA 4O53A 3W2UA 5KINA 3EWBX 4TIMA 7TIMA 1WQ5A 2E6YA 3LI0A 2GJLA 1RQHA 3L9CA 3C2VA 5CG7A 1VHNA 3L5AA 5I3JA 5HQEA 3TXZA 3IVUA 3TIMA 2V0TA 3LXCA 4WUIA 1GYLA 5I3IA 5DXYA 2TYSA 5U7SA 3LB0A 3G1HA 3LRKA 1LBMA 3G1YA 3QH2A 1GVQA 3MW7A 2ZA2A 4BF9A 4CQAA 2NV1A 4LVAA 3W1XA 3W7CA 1SPQA 4O16A 6TIMA 3W9ZA 1OK6A 1ZENA 1YYAA 5K3VA 4AF0A 1LLWA 1QR7A 1W5OA 3IIZA 1TMHA 2WV8A 1CI1A 5D32A 4M6PA 1VLIA 3W7KA 1UUOA 1ADOA 4LV9A 5FEXA 5G4WA 3E12A 1VYPX 1P0KA 4Q4KA 3W1NA 2B7OA 2JBMA 3W84A 2DJXA 3TH6A 1HO4A 1KTNA 4EOUA 4EF8A 2HTMA 3L0GA 1VR6A 2CLFA 1RV8A 5E1QA 5CZSA 1K8ZA 1OYAA 3M5VA 3O6CA 3TR2A 2VFIA 3ABQA 5K4XA 1OFOA 1GVSA 1KM3A 2V5LA 3YPIA 3NL6A 1UUMA 3LLDA 4DELA 3G1FA 4NX0A 5K7JA 4JNMA 2XN2A 2HS6A 5LZLA 3P61A 1YTKA 1GTHA 3B0UX 4JTIA 2B7PA 5CPNA 2QCDB 1QFEA 1JRCA 3UD6A 1AG1O 3W2MA 5G5IA 3P67A 2DZVA 4ALDA 1KFEA 2Z6JA 5C55A 2OJPA 3PG9A 1PHWA 2TSYA 5K4ZA 1PE1A 5DELA 3EXSA 3T44A 4JTGA 5D2TA 2QF7A 2BSLA 2GVLA 3QRHA 3L0NA 5J5DA 5GVJA 1KV5A 1LM1A 1WDWA 4UR8A 4LU0A 3RU6A 3C8FA 1KBJA 4LS0A 3BLIA 2Q8ZA 4XTIA 4DF1A 1GVOA 2Q3OA 4LW7A 4QQ3A 4LVFA 3NQ6A 1K03A 5HNRA 1EX5A 2G95A 3A21A 1IXPA 2GJNA 1XBYA 3NQDA 2Z0IA 1PCKA 3N14A 3BLFA 4ZL1A 1UASA 3P81A 2V81A 3R2GA 3O05A 3TC7A 2EAWA 3LRLA 2CW6A 4TU1A 5F1UA 4OHQA 1P1XA 1Q6LA 4DXVA 2YZRA 1Q6QA 6ALDA 4RX0A 1JQVA 2GOUA 3STEA 1I2OA 4IPIA 1ZALA 1TPB1 3TQVA 2PRMA 3TW6A 5DY2A 3S1WA 4UIOA 5BNKA 2R94A 1O5KA 2H3DA 4TR9A 3MBFA 1TQJA 3EXTA 4IWWA 1MXSA 1EIXA 2VFFA 3QQ0A 1JCLA 1GVRA 2W0UA 1X6UA 4O54A 3QMRA 4RR4A 4PH6A 3T7VA 1KFBA 5LNRA 3HPXA 4NJJA 4UC5A 5CPLA 4HPXA 5SWUA 4OV4A 3W1RA 1H7WA 4OE7A 1TPEA 1NEYA 1MEIA 3S1XA 2DZPA 1FWRA 4JIQA 1JUKA 3RMJA 4ONVA 4AHOA 5EPDA 3BW2A 3HB9A 3E9AA 3QJAA 3ZWSA 5HJLA 3NR0A 4UMBA 4FNUA 3WJWA 1AL8A 3KXQA 1JJKA 1YXDA 5TIMA 4MZ8A 2ZQ0A 2TMDA 1KFJA 3L68A 3N2XA 1SFLA 3NVTA 3PB2A 4IMEA 4ZZ9A 4NXKA 1Y0EA 2ATMA 3N2MA 3QFEA 2FIQA 1VCFA 3D0CA 1UB3A 3IIXA 2QAFA 3W7RA 1EWDA 4AMAA 2AGKA 2B7QA 1HG3A 3SGZA 4I9AA 3W22A 3NM3A 1FDYA 3LTYA 1V5XA 3BGJA 3UPWA 2DZSA 5FF7A 3BG3A 4CQ8A 5LSMA 4JD4A 3PBUA 1DJNA 3G24A 3CWNA 3C61A 1OX4B 1ZHAA 5D02A 3HG4A 4MLJA 3RLUA 4GUJA 3WJSA 1LRNA 1JULA 1QNVA 3LDVA 3UY8A 1PV8A 3B4UA 1T96A 2FPTA 2CFFA 1ZY9A 4FIQA 1VHCA 5LNVA 4ZQOA 1LOQA 3DI0A 4A2RA 2ZZ6A 5F2IA 4FF7A 3G8RA 4BI7A 3P8IA 5I3HA 1TIMA 4L4MA 2B4GA 3TUUA 3I68A 3SW6A 3N9SA 2PRLA 1K7FA 4XKYB 3HGSA 3TU9A 2E6DA 2C3ZA 1XUUA 2VFGA 3L66A 3OEXA 1TTIA 2PRHA 1BWLA 4MY8A 1YDOA 1I2RA 3A9IA 1W54A 3PULA 2JKAA 3GK0A 2CLEA 2ZA3A 5DBTA 3C2RA 3QMTA 4MKNA 1WYIA 5F4XA 4FIRA 1LORA 3CEPA 3M41A 1FCVA 3TROA 4EF9A 3WK3A 1FWTA 5CSSA 2HMCA 3CWOX 3OVRA 3TQKA 2JKPA 3ABRA 4M6VA 5F1VA 4ML9A 2XN1A 5T26A 2OX1A 4CCEA 1KTCA 3W75A 3IV3A 2CLMA 4UTWA 1OX5A 1VH7A 3GXTA 3DKLA 3NQGA 4GWEA 2OZ0A 3W1MA 3LX9A 1WOAA 3P74A 2V9DA 3M7WA 3BGGA 3OVPA 2WOQA 4AB4A 1GG0A 2FPVA 1H50A 1SQ7A 3QSTA 3HG3A 1H51A 3GR8A 3G1DA 4K7YA 1VZWA 5AYXA 4O14A 2AAMA 1I2PA 5LHEA 3P5ZA 4FNQA 2C0AA 4DO5A 1G4SA 4WQ6A 3UWQA 3S0CA 4CQ9A 3IGXA 1LDCA 4AXKA 4KFPA 3CIWA 4UTUA 1QAPA 4NQ1A 4U4MA 3W1TA 4Z1BA 4JGDA 1H7XA 2QCHA 3JS3A 3EB2A 3R8RA 1F6KA 2EKCA 1VPXA 3B05A 1H7RA 1SSGA 4GE8A 4N9DA 5AHLA 3QF0A 3VI2A 1XXXA 2X1UA 5FESA 1VCGA 4UNLA 1JUEA 2CWNA 1CX9A 1WV2A 1FWNA 3GNDA 2FJKA 4GC4A 2C1HA 1SZEA 4O17A 2WKJA 4HHPA 3CPRA 1F74A 4WXZA 3A5VA 1XC4A 4FNSA 3PSVA 3M0ZA 3RK8A 2ZTJA 2E09A 1R47A 1F76A 2A0NA 2ZZ2A 1SZGA 1ZAIA 4IMFA 1SSDA 3F4NA 1QPRA 5AC6A 4DPPA 4OBTA 5L6UA 3W76A 3M47A 1EP2A 1KM5A 3O8AA 4NNBA 1LRTA 3S42A 1H5YA 1KM6A 4KFOA 3W7MA 3MUXA 2I14A 2VXNA 3QPZA 4XUGA 1DQXA 1VJIA 3FIGA 3W2JA 3B0PA 4ORIA 1QO2A 1PS9A 4MLRA 1P4CA 1EP3A
chains in the Genus database with same CATH superfamily
1CWYA 1OK4A 4PEKA 3EXRA 1ZPTA 3UJFA 4B5TA 1EA0A 3H2EA 4PGLA 3LV6A 1EYEA 5CJMA 3VOHA 5D2XA 4CNSA 2P1FA 5FI8A 3G6LA 3W25A 3EOUA 2DZUA 3ATZA 2ZWYA 1VEOA 2FZ9A 4DYEA 4OV9A 3BURA 5C7HA 3QV9A 2E4TA 3WLHA 3TN4A 4NHVA 1Q3NA 4KWOA 4JY8A 4L65A 1H1NA 3LM3A 2VHLA 4FNTA 3TFXA 2PTYA 3I4KA 1US0A 3URNA 1A5NC 1W1B1 4I6KA 3GHRA 4UNIA 1H7OA 2ZKMX 3VD7A 1JFHA 3PY2A 1N7KA 5BRPA 4L1GA 3MUZ1 3RLGA 3U2OA 2CIPA 3I7RA 3NQ2A 4CNPA 2OO6A 4DXXA 3GR7A 3NXFA 4XZBA 3AS3A 3V36A 1ZAJA 1A5LC 2J7FA 3LXAA 4WF7A 1BKSA 1EJTC 1GNXA 1OIMA 2GQAA 5H1WA 1PKLA 2NQLA 4S3DA 1SO3A 4AD4A 4GYPA 4C6NA 1WAWA 1AMYA 4MIMA 2CEQA 2NX1A 4XIMA 5BW6A 1XIDA 3V0SA 1XP3A 4LOCA 1UQZA 3O1NA 2WNQA 1P1MA 1T99A 1ZQ5A 3GDKA 4OKDA 3R5EA 3MP5A 3R0DA 1FWHC 5D09A 1DTUA 3MC5A 1YPFA 1P6CA 4IGMA 6TAAA 5IM51 3QPYA 3W7LA 3UXAA 4AY8A 3WMSA 3KTXA 4NJGA 3PP7A 3CS2A 3GX9A 3NDZA 3FA4A 1SGJA 2EPHA 4UNKA 3IAQA 3MUY1 5D9MA 4WKAA 4S39A 4GJIA 1SZFA 1E0VA 5ABEA 4L56A 3P0XA 1FCBA 1SO4A 5I02A 1KC7A 4H8UA 3IJQA 3C5QA 1CBGA 1P0EA 4PEEA 4R33A 3S5YA 4DRSA 1WB0A 2PWUA 4FB7A 3T05A 2YW4A 4QCEA 2VFEA 1I9CB 2PDKA 4CVUA 3POHA 3INPA 4O4WA 4Z08A 4W84A 2Y24A 2C6QA 1SFTA 3DYOA 4JX6A 4S3AA 2XZ7A 3TE9A 3HTWA 4P8WA 4ZQNA 3CHEA 2O7SA 4IIEA 4HT3A 3C2FA 3WJYA 1Q6CA 2BXVA 4DLMA 4XZHA 2WSQA 5C9RA 5D05A 3TK7A 1KXTA 1QHOA 4QISA 4CQDA 1SR0A 2GYIA 3VYLA 5CC5A 4TO8A 4HB7A 1Z9AA 7REQB 3TOPA 1W56A 3VC6A 2X40A 2EF9A 4QIUA 3U5UA 2BGQA 4R9OA 4WD0A 3LHVA 3FFSA 2YB1A 2FHCA 2OSXA 3KW3A 4ZQPA 4M6QA 1IZCA 1XDJA 4PMNA 3LA4A 1X39A 3EWWA 4W7VA 3BPWA 1ZS2A 5JBFA 2VFDA 3NQBA 4E4FA 3WQFA 3E3HA 2C0HA 3WKZA 1Q6RA 5DXXA 1FFRA 1B0IA 2FTYA 2CCRA 1XBZA 2F8QA 2E6FA 1D7KA 1UP0A 2BHUA 3WEZA 3U4AA 3LCXA 1TKKA 3HG5A 2VD9A 4WJXA 4LUTA 2OCZA 3TSDA 4Q6XA 4UQAA 1L2UA 1Z48A 1V0MA 2EBNA 4GGHA 5TQLA 1GQIA 2VWSA 1PXGA 4N4QA 2VELA 3LTSA 1MRQA 1TRIA 1JCXA 1QJWA 3DU0A 2FQIA 5HWNA 2DDXA 4P2VA 4M81A 2W61A 4JR5A 4C5YA 1FKWA 2GJXA 3HFYA 4X9SA 4XKMA 3VE7A 3SQMA 3RU8X 3SCTA 1UR8A 4EXBA 3W6YA 4CD5A 3LERA 1Q45A 1E4IA 2WNNA 3UCQA 1K70A 2OSYA 3RNDA 1DJWA 4BWLA 3SI9A 1IF2A 2D0HA 4NAEA 3LENA 2QUNA 2RFGA 3BG9A 1C3FA 2CLKA 3KAOA 4Q4QA 2Q8LA 1EX1A 2VEFA 4MY9A 3STGA 1PVNA 8RUCA 2E3ZA 3OVQA 2VWTA 2JGYA 2VGFA 3WUEA 4YHGA 2Y89A 3G0UA 4GYFA 1WZKA 3NQ7A 4F0SA 3W7GA 5DRCA 1XYMA 5EGRA 3VGBA 3W81A 3RR4A 1J6PA 3O07A 1TTJA 2V5JA 2V82A 3UG5A 5M2FX 4CNOA 1RD6A 4ES4A 2VGBA 4DZHA 3UW6A 7A3HA 4I7VA 4RCXA 4PFMA 1WOBA 1GEQA 1P7TA 5HWMA 4GABA 4KWWA 4ZGYA 2UWFA 4E3TA 2HPMA 3ISIX 2FDSA 2WWDA 3TYUA 4Y7EA 3QLLA 2WSRA 1S2TA 3WLKX 1LLZA 2VC9A 2WM0A 2YB4A 1V3MA 3LLXA 5HATA 1BQGA 5KZMA 1LBFA 4MWAA 3TAKA 5D9NA 2XVLA 1WZMA 3NDOA 3N34A 4QJ5B 5C9XA 4WX2A 4PTXA 2VP8A 1OGGA 3ARRA 3BLEA 6PTDA 4W87A 4AZCA 4KW2A 3CL6A 3VNMA 3W70A 3EWZA 2Y0FA 4G56A 1F3WA 2VR2A 5I79A 3OGVA 4NNCA 2E8YA 3TN3A 4UFLA 3WELA 3N9KA 4LUYA 3KL3A 3VE9A 4BEQA 1ZP3A 3CO4A 3W7IA 1GW1A 1XRFA 1V0KA 1R8LA 5JQ9A 2WO5A 3PWAA 4K6AA 3NZRA 2ZRZA 1OFQA 3SUWA 2V5BA 2PZ0A 5CBIA 2DQWA 1P0NA 4FK9A 4L6DA 3GRIA 2Z25A 4JL1A 4AVNA 2WYSA 3EDJA 1BSLA 5A6BA 2O4MA 1FWWA 3ZXWA 3WBYA 3M0HA 4OBSA 2J8TA 4HJWA 1E4NA 3W7NA 3IAPA 2VX6A 4AYGA 4LUSA 2GZXA 1Q6EA 4MB4A 3A3WA 4HYRA 4UMCA 4N7QA 2J62A 2CLLA 3H21A 2JIEA 4PUUA 3TC6A 4Z2GA 4KKXA 1UUQA 3BGAA 5LKYA 3OODA 3WLNA 2VCAA 4HNUA 3RCNA 3DBNA 4Q8UA 2Y61A 4HPJA 4PUNA 2NQ5A 4NZFA 4AZ5A 2BY1A 2CYGA 2I9EA 3IIOA 3WBEA 1AQMA 4QM1A 1Q7QA 3QM3A 3R58A 4XVDA 4REQA 2NVAA 3B40A 4PUKA 1KD0A 1KBKA 1HL9A 3TSMA 1XYBA 2BXYA 1UR9A 1BYDA 1HKMA 3FJLA 4JAWA 3TJ4A 1O94A 3ZVIA 2J66A 4UQEA 4YXGA 2H9AB 3CZEA 4NRSA 1DJHA 3LY0A 2XSAA 1XQLA 3GW3A 2J6XA 1L6SA 1HJQA 3PZUA 1XBVA 2E1DA 4WIWA 3FEMA 1FWAC 3VDCA 4B5UA 4IIBA 3LCFA 3R11A 4W86A 4LPCA 5HA7A 4MUPA 4HVXA 4O12A 2J4GA 4F0LA 3GBDA 2VR4A 1HXJA 4IL2A 4LUJA 5BXPA 3GU9A 1KCKA 5CGTA 4ADUA 3NURA 2J47A 1DHPA 3A6OA 3WDHA 1VEPA 3VMNA 1UC4A 3QSRA 4F8XA 1CYGA 4GLEA 3KUMA 4C6PA 2YFNA 1JUBA 2W3ZA 2CZFA 4UFKA 2QJGA 5CSRA 1I45A 4PUEA 3N4FA 1DTNA 4MG4A 3VXGA 3RMEA 3AS2A 2XUCA 1DP0A 1X8FA 2CKSA 2WANA 2YR1A 2ZRVA 2BX7A 2RDTA 1H63A 1T5AA 4NVTA 2KX9A 3WF2A 3KOFA 4TV6A 2EPNA 2VCBA 2DU2A 4AU0A 3HOJA 4WSJA 3EKGA 1TV5A 1GOWA 3P60A 2OVLA 1UQYA 3SJNA 4KEVA 1U5JA 3OJGA 4YVVA 4FNRA 3TMLA 3I6RA 1TO3A 3PPGA 4GO9A 2R9RA 1SR9A 3GG0A 1QW8A 1VAHA 3M6DA 4NZ1A 4LAOA 3HPZA 4GI9A 1DJYA 1AW5A 3MSDA 1IGWA 3PM6A 2QDEA 4JL2A 3M6YA 1FBAA 2J9YA 3W1UA 4G1NA 5D33A 4I5RA 1IR1A 5A69A 1UD2A 5A8QA 2PDLA 4J35A 3QC3A 3AS1A 3WF4A 3LI1A 1RA0A 1WXJA 1DWHM 1EJ7L 3WLIA 1ZFJA 5FJIA 3C56A 3TWBA 3OGSA 1GOXA 3R89A 1S46A 2QCCA 4GKTA 1R3RA 3L65A 1EGMA 4XAGA 3RLVA 1RCQA 5E9XA 3CM4A 1D3CA 1F6PA 5HUOA 2ON3A 5CKSA 3T09A 3GG7A 1PKNA 1Z3NA 1YNPA 2XINA 1WAUA 4J7RA 2WKGA 3NGJA 1OB0A 3MDWA 3RX3A 4GG9A 4LEQA 4IXHA 1GPWA 2B7NA 3BDKA 2TRSA 2PDHA 4A3QA 1CPUA 2GQ8A 1EB3A 3AUOA 5H91A 1WA3A 3E0LA 3QHNA 3NQEA 5BROA 5DBUA 3Q58A 4O57A 1YXYA 4QSFA 1KM1A 2ZADA 4EAMA 5K9DA 3FNDA 3ZJKA 1FDJA 1E9YB 4CQBA 1J10A 3T0CA 4KQNA 4PODA 2WM1A 1J5TA 1PHQA 1F2JA 1TRDA 2EJ1A 1GVYA 2FTWA 4GD0A 4Q4SA 4EAYA 3LM7A 2E6AA 3WLLA 4X3ZA 2HSAA 3VU2A 1IXOA 3KL5A 1M1BA 1ECEA 4C1LA 3E6EA 5AB3A 3O06A 3GU1A 4NJHA 2PUZA 3LCIA 1ME9A 3GR4A 4H9TA 1W9XA 1BF2A 2J9ZA 1A5AA 1MDRA 2OMAA 3TSBA 2EJAA 2NXGA 4EVZA 4C6LA 5C2GA 1GUVA 4S2CA 1SM9A 3KZPA 3S2JA 1GOMA 2BWGA 3WO8A 4H9VA 3W1PA 4HKPA 5BRQA 2WVTA 2ZBTA 4ZBCA 4LYKA 5CPMA 1SUXA 4RDVA 4M0XA 3KRZA 5AY7A 5EB8A 3WDJA 2PCEA 2AL2A 3QVQA 3QKEA 2ZOXA 5HMSA 4IIFA 9XIMA 4WY0A 1BYCA 4Q7IA 3HFTA 1VBHA 4LGXA 2I17A 4GZEA 2OX4A 5E09A 4IG2B 1NQ6A 1TCMA 1VQTA 1Z8AA 3MJMA 2VRKA 1KW1A 1LP6A 4ZOEA 1OABA 3W1LA 1OWQA 2YA2A 2J9XA 3CUIA 2NVDA 2Y7GA 4JFWA 4QHRA 3ZFHA 1M7JA 3RILA 3FKKA 2VUNA 2VEKA 1UR2A 3GVWA 5EY5A 4DF0A 3C0QA 3NG3A 5LGZA 2ZCGA 1G5AA 3HJZA 2YGYA 1E73M 1NF7A 3HV8A 5I00A 2OEMA 4UCGA 5FD0A 4Q8MA 3P82A 1US3A 1L2QA 6REQA 1C29A 2Y2WA 3LHZA 5I03A 1QI0A 4XWUA 3ERPA 4N6FA 2E1WA 3RO6A 5CLTA 2D0FA 2DT1A 2VKZG 1YNYA 4RJEA 3UU0A 3P80A 5A6TC 3BOLA 4AVFA 4C6CA 1RK5A 3GTHA 1QPQA 2PDQA 4PL2A 4H8NA 1L6YA 4NSBA 3ZSSA 4OUEA 5EL1A 4K8HA 2Z2UA 2F84A 4JHZA 3DAQA 2YFOA 3ZJ7A 1B3OA 2XH7A 4MYXA 1DBTA 4ECLA 1E43A 4H04A 1TREA 4CKQA 4XZIA 1H3GA 3F5LA 1W31A 1HL2A 3WLTA 4E2VA 1H49A 1RLCL 4QX4A 4ERIA 3SN4A 4LY8A 3JW7A 4Q7BA 3AOFA 1VS1A 3SO7A 3V18A 4XB3A 1MUCA 3A3HA 3VNLA 1EA9C 3ZT5A 3MANA 4RNIA 3QMSA 3LD5A 3UJ2A 1UROA 2ZXAA 3TLLA 4EPEC 4HNNA 1XLBA 5IFTA 4J3UA 3WD3A 2QIIA 3REQA 2NVCA 4D1JA 3C6CA 3TW7A 4GX8A 1Q6GA 5LHFA 1EWEA 1VFMA 1U2YA 3QR1A 2D2HA 1JZ2A 4J9JA 3SN1A 5DEZA 1KV8A 4DWDA 2DZBA 3IEBA 1XFBA 3WQ4A 3AISA 3BLOA 2R1PA 1NP2A 3AIRA 3GIYA 2EG6A 5G2IA 3H4XA 2WSPA 3MI2A 2ZVIA 2A21A 4TUFA 4R7WA 2VC6A 2OLHA 3EAUA 3PUGA 2OOGA 3LCWA 3F2DA 3NPWA 2G8ZA 1UOZA 4IPNB 1N2VA 1SW7A 3AIBA 3MCOA 3IGHX 1C9DA 1ITQA 4RDYA 5K9XA 4B9ZA 4B15A 4RPQA 3WNLA 4FLQA 1MUMA 4DJFA 1JVNA 3PZVA 4AYSA 1B3XA 4IZGA 3DFTA 3HURA 1I1WA 3FS2A 4DHGA 1QNQA 1F4HA 2ZE3A 1H7PA 4TXEA 4ZVJA 1ESWA 3FA3A 3TWAA 3WN6A 3AWNA 1TPDA 3KOYA 1XL9A 1ZNNA 3QZ6A 4TTGA 4WK9A 4MKSA 5BXSA 4LQ1A 4ZQMA 2HCVA 4BR1A 2DUZA 1XD0A 1QNSA 2D73A 1W37A 2YCIX 4E8GA 1XLIA 1WKFA 3MI3A 1TPWA 5KEZA 3WK0A 3GHTA 5IOBA 1QW9A 4MZYA 4ZTXA 1SW0A 2ZRWA 4NI3A 3IRSA 3VD9A 2I5IA 3CQIA 3MCMA 2AKMA 1EC9A 1K3UA 3GXMA 4NP7A 3TR9A 2TPSA 3DG3A 4YL2A 5E9AA 1AQ0A 4ZENA 2BLEA 1W0MA 3VPLA 4LBRA 2EO7A 2ZZ1A 4Y9PA 2RUSA 4O4VA 1LQAA 1S2WA 2VGIA 3LGDA 3NQVA 1HL8A 4U31A 4RXFA 1OEPA 5ABHA 1ZBVA 1RZMA 2IXVA 2A2IA 1E51A 2YXXA 2WW5A 4LBUA 2Z1BA 1L6WA 2QJIA 1RBAA 1OJXA 2FGZA 2ESCA 2J25A 4HK6A 4IISA 2Y8VA 3S6DA 4EXQA 1ZU8A 1PUDA 3BW3A 1ONRA 2NLIA 3UESA 4HYWA 1L8PA 4DJDC 1I6NA 1M3UA 3ENLA 5IHRA 5A5WA 2XISA 3AU6A 1DV7A 1A53A 4K7VA 5G1YA 2QVNA 2PDGA 5FF2A 1OD0A 5EFDA 1FWEC 4C1KA 5BWAA 2FB2A 1B3YA 3SFKA 3SGGA 4NJKA 4QEHA 2PE4A 3CAWA 3W1QA 4AH7A 3VCCA 4KBXA 1EDGA 4OU1A 2ZZ3A 2J7GA 1R6WA 4POCA 1TV8A 4JQ3A 4UOZA 3G0SA 1LG1A 3T2PA 2ATSA 2BVWA 4IJBA 1QPNA 3HA1A 5K9CA 3W2UA 2GK1A 3C2VA 4G9PA 3H2NA 4DBSA 3BL3A 1MXDA 5I3JA 3IK4A 2ZICA 3LS9A 2PLKA 2VVNA 3AHTA 3VIPA 3Q67A 4WUIA 1GOQA 3FDGA 3PJXA 2PC8A 1KCXA 2Y1HA 5E0FA 1GVQA 3WD4A 1UWUA 3QGAC 3SY1A 2V63A 1LWJA 1FWIC 3W1XA 1S5NA 4PSRA 5CC3A 6TIMA 1ZENA 1YYAA 1TZZA 3T4WA 4AF0A 5CJ5A 1QR7A 5J04A 1TMHA 4J3ZA 3B97A 3H7VA 4LV9A 1OCQA 2WVVA 1IT8A 1P0KA 3GTIA 1E0TA 2R82A 4HCLA 1HO4A 4EOUA 2CLFA 1RV8A 2WMIA 3ES7A 5CZSA 4WGHA 3F2BA 4P7OA 1V3HA 1KM3A 4C6FA 3YPIA 3NL6A 3PPHA 3LLDA 1W3JA 2IPGA 2HS6A 1N82A 5HPOA 3NIYA 3ARSA 2QCDB 4HU3A 1W1A1 5CC6A 2ZC1A 3W2MA 2E7FA 3P67A 2DZVA 2I9UA 2GGHA 4ZO7A 4W4QA 2FZDA 4LCRA 1PHWA 3ABXA 3THCA 3LNMA 3N2TA 5JMUA 1FWJC 2BVYA 3GBEA 3L0NA 4UR9A 3GU2A 4BZYA 1NWUA 5FSDC 1KV5A 1LM1A 1RP9A 4AEEA 2UZ9A 3L4WA 3VTRA 2DVXA 4ZXLA 3MZNA 2Q8ZA 4ICCX 1GVOA 4L4OA 4LW7A 3AMKA 5HNRA 2G95A 3JU2A 2GJNA 3R6IA 2Z0IA 4UOQA 5A8MA 5JH1A 3BLFA 4AY1A 4C6QA 4ZL1A 3P81A 2YJQA 3R2GA 2P3ZA 2NW0A 2EAWA 2O92A 2PP0A 1U22A 1P1XA 4DJDD 2YZRA 1Q6QA 1U1JA 3VM5A 2WNWA 3STEA 3MUAA 5A1AA 2YLLA 4DWSB 1WKEA 2PRMA 3TW6A 4AMCA 4CUCA 1PX8A 1XW8A 3MBFA 1TQJA 2G3IA 2CBIA 1MXSA 4DO7A 2OU4A 3KBMA 1X6UA 4O54A 3UZXA 4PH6A 3T7VA 4AD1A 4NJJA 5CPLA 4HPXA 2PU0A 1EBHA 5CCZA 2YZ5A 3HZ3A 1GZJA 1L0PA 3S1XA 4EK7A 5C8BB 3IARA 3PZIA 3RMJA 4ONVA 4AHOA 1HF6A 3E9AA 1J9YA 3V16A 5HJLA 3H22A 4C6DA 2JEQA 2GDVA 1EL3A 4FNUA 3WJWA 3OBAA 4JIRA 2VL4A 1IV8A 4JCLA 2ZUNA 3VZYA 1XIBA 3I6EA 4ZEPA 1EQPA 1KFJA 1SFLA 2XVPA 3PPCA 4QLLA 4NXKA 1JEZA 1JDDA 4L7ZA 2FIQA 3R8HA 1JIBA 3LUTA 1VCFA 4HU8A 1GOOA 1K1DA 1LUCB 3WLPA 2Q09A 1UBPC 3GH5A 2PDFA 2REQB 2UY2A 5LSMA 1X1NA 4W7UA 1DJNA 3SBFA 1VD6A 1PWMA 3IUHA 3G24A 3CJPA 1ZHAA 3ZOAA 4YHEA 4PRRA 4HJFA 3WJSA 3FJ4A 4H6QA 2XGIA 4GH3A 1LRNA 1UIOA 3MQTA 3NDYA 3UY8A 4B4HA 3B4UA 4GCAA 3UR8A 2FPTA 5I3DA 4AZIA 1HVXA 4B3KA 4J3VA 1LOQA 3QTGA 2ZZ6A 1JZ6A 3AFBA 5CH9A 5C9ZA 1TZ7A 4IP5A 4BI7A 1M41A 3QN3A 1TIMA 1TR1A 1AZ2A 4C6BA 3SW6A 5A6SA 5JXQA 3HGSA 4HN8A 2C3ZA 1XUUA 3L66A 1ZB5A 5I24A 3UXKA 1BGAA 2NQJA 2POTA 4W8AA 3Q45A 3OZOA 3WY1A 1I2RA 4KEUA 4ZE4A 1XF0A 3C2RA 4FR6A 4MKNA 1ZJHA 1WYIA 5F4XA 1LORA 3AUJA 3ZM8A 3ZMRA 8CGTA 1BTCA 4P7LA 1E72M 1X98A 2JKPA 3ABRA 4M6VA 2OX1A 4ZXOA 3K46A 3SN0A 4MKVA 3KBVA 3UVIA 2WHKA 5TNVA 3R8GA 1Z7AA 3DKLA 3NQGA 3MWCA 4US5D 2BP1A 3DDMA 1H0IA 5A8NA 4K3ZA 1WOAA 3GNXA 5DMNA 4UWMA 3QSTA 3HG3A 4HGXA 4K7YA 3GHUA 3WL0A 4G7EA 3DECA 4AUBA 3PZOA 3P5ZA 1GZ1A 3CL7A 4DO5A 1TA3B 4WQ6A 3T0DA 2VC5A 5E6ZA 3IGXA 4J3SA 4KFPA 2W66A 2PBGA 4UTUA 3KTCA 1EO7A 1CXIA 4Z1BA 2IMRA 1UWQA 4TQTA 4JGDA 4HSHA 2QCHA 3GXDA 3JS3A 3EGJA 2EKCA 3B05A 1SSGA 4A8IA 1ZBWA 1QI5A 3RRXA 1HQTA 4UNLA 3NYDA 1CGXA 4C6JA 1OSEA 2C1HA 3AALA 4HHPA 1S1RA 3OLDA 1F74A 3BJSA 2HV5A 4BKNA 3RG6A 3W02A 1HJXA 4I9JA 3OLEA 3S6TA 1HGWA 3SADA 3A4XA 4L61A 2OPJA 3GY1A 4IM4A 4IMFA 5IDIA 5JU6A 2Z24A 4DPPA 4Z2LA 1KM5A 1X38A 1I0BA 4IJCA 4LYPA 3UT0A 1H5YA 4M51A 1LQ2A 2VYOA 4XUGA 3B8VA 1VJIA 3CPGA 1V02A 3QKZA 3UFYA 1HP4A 4ORIA 1PS9A 4MLRA 1ONEA 3WJXA 2YDRA 3EWCA 3E5BA 4GIAA 1OHLA 4QR6A 4OQVA 4Y90A 3UWWA 2A7RA 2F61A 4B5SA 2IW0A 3MYPA 1S38A 1SJCA 1G4PA 2P0OA 3S1VA 1TQXA 4D9PA 1OFAA 3N1AA 4I7WA 4URIA 2E68A 1VFUA 2D69A 2ACSA 1A80A 4IUOA 1NFPA 4M1RA 4NKCA 3KL0A 2DSKA 5MKGB 1TWWA 3WEOA 1OX6A 5AZ1A 3NEHA 2WQPA 4HA0A 3EOSA 2PD5A 2ACRA 2ZRUA 3NSNA 4U3AA 3HN3A 3BZGA 4G6CA 1LT7A 3WQVA 1OG0A 4TTUA 4F66A 1EJVC 1UH2A 3T07A 2E5BA 3AYVA 4Q8OA 3P5YA 2I57A 4ZFMA 2OYLA 2ANUA 2D1ZA 3O63A 5TBOA 2ZX8A 3BQ6A 3GW0A 2G41A 4FXJA 1NVMA 5HANA 4JX4A 5REQB 2ISVA 3H2FA 5HQMA 3T1GA 2Y7FA 4E6MA 3KLKA 4DBDA 4LC8A 1JCJA 4L64A 3TJLA 4MPKA 2C1IA 4GJ1A 1FCQA 1TX0A 3QY6A 1QOQA 4AZ6A 4W88A 3U7VA 2DVUA 1KGUA 1R38A 5I09A 2OQYA 2DUAA 1OCBA 3BAJA 2VDHA 5I6SA 4WOQA 1JF5A 1QHZA 3TP4A 3WH7A 3AO0A 1WO2A 2XFRA 3PR2A 5EBUA 2ZZ5A 3I3EA 3UZYA 3CBWA 1FQ0A 4ATDA 4TX6A 1OM0A 5DX7A 2DW6A 5C71A 1OC7A 1EPVA 3BLDA 1F05A 1TVNA 3FSUA 4QLKA 3EYPA 1VFOA 3CGTA 4L6OA 3U9IA 1BVNP 4HNTA 4WY0F 3FOKA 1OGBA 3MO7A 4DXKA 3KVJA 3IRDA 3BOFA 3R4IA 2CBVA 3UBPC 4G5DA 3CMFA 4Y9AA 1OFDA 4N9EA 1XD1A 1IWBA 4UTKA 1EGZA 2FH6A 3U3HA 3DOPA 2DORA 4RE3A 7ODCA 3MP4A 1REQB 3I65A 3ZR6A 2Z6IA 2TAAA 2QULA 1AQHA 3XIMA 3VFCA 1KFKA 4H01A 4JTDA 2QS8A 3L23A 3CHVA 1CNVA 1Q6DA 3WJZA 2PGRA 1DJGA 3RJXA 3L7RA 3T9PA 1FCUA 3CQJA 2A1YA 2QJMA 1W1YA 3Q2DA 2CU0A 3P7YA 1YNQA 5T91A 4RZ5A 3IPWA 1AUSL 2CITA 2HVOA 3GIQA 1MMFA 3K13A 2GQ3A 4HIBA 4Z0JA 1MNZA 4XQ6A 2BV9A 3MSRA 2NX3A 1ZBCA 4S1FA 1JCYA 2JKEA 3VNIA 3VCRA 5ENLA 3JVAA 1YMYA 1FP9A 3BZJA 4H9YA 1E4MM 3STCA 4WJEA 3GXPA 3HIJA 2GPTA 4A3RA 4HTYA 4MJ2A 4OVXA 1O95A 3DHFA 1Q5MA 5I3KA 1ZJBA 2Y85A 3OLGA 5IBXA 2HVNA 1UKPA 4EX4A 5KZ6A 4R3UA 5FF0A 1MZRA 3IJ6A 1S39A 2D3NA 1WUFA 1XIHA 2FB3A 1DKWA 1D3HA 1GJWA 2QUMA 4LRTA 2VEPA 4QBXA 2Z4GA 3UR5A 1ALDA 1KCZA 1V8EA 4D1IA 3CU2A 1B4EA 1XI3A 3G1XA 1XLCA 2O7QA 1AW1A 2QJHA 2WXDM 1G6CA 3GHSA 2ADAA 2JIWA 4EP8C 2PDXA 3AJXA 2CPUA 1UD6A 1AL7A 4UMAA 1O5XA 2Y7EA 3DC0A 2QW5A 4GYPC 4RW3A 2VURA 2YYTA 2BB0A 4PBFA 2VX7A 4GYKA 4YPJA 3B0XA 3THQA 3EX1A 2W79A 5FKYA 1B90A 4GQQA 1V0NA 3UZJA 3N9RA 3AXHA 1W8SA 3STFA 1XLMA 3K30A 4W5ZA 4QJ1A 1W2VA 3VIHA 1S5WA 4IICA 4R7OA 4AZBA 3CAVA 4QE4A 2ODOA 2QUTA 3GB6A 1OFEA 5GJNA 4QDMA 5H8UA 3LBOA 3FJ6A 4Y9NA 4PB4A 2Q8XA 5A6KA 3SAZA 1B30A 4UQCA 3L2IA 1G4EA 1ZJIA 5H8MA 4AZ7A 1CLKA 3I3DA 3KVLA 4WXYA 3H55A 1QMLA 4LT9A 2X1TA 2V8ZA 3UCDA 5A6AA 2A3AA 3C2EA 2CHOA 3D3FA 1Q6FA 1GWJA 2JFEX 2I7GA 4JTSA 2OT1A 3BQ5A 3URBA 4IFRA 7TAAA 1QOPA 3GYCA 2VDGA 1OG6A 5TAOA 4Q7NA 2G5WA 4WLCA 2OZ3A 1GVEA 3ECQA 4PR4A 2BTMA 2G3MA 5IFPA 1RCXB 3SY5A 3NWRA 3TTEA 3LRMA 3RDKA 1U30A 4UTJA 2OZ8A 1D9EA 2RHGA 2C15A 4W5UA 1YBQA 4MOZA 1J6OA 1O6IA 3AC0A 2DUXA 1X8CA 3KX6A 3URQA 2WJZA 3DH7A 5F2LA 4N9CA 1DJIA 3DFYA 4QDWA 3HPSA 3TYDA 3UQNA 4IFKA 1U33A 3AI0A 2J13A 3F03K 2BY3A 4IF2A 2DZXA 1W9BM 1LROA 1RUSA 2PGEA 5G1TA 1GKQA 3LK6A 5LIXX 1TELA 3HGRA 4AIOA 2JGQA 1HP5A 3KWSA 3ITVA 3CO8A 1OVDA 5HNUA 2CLIA 3WK2A 2QDDA 4MWAE 3S3GA 1UWAA 4AISA 1KR1A 1KFCA 4HPNA 1EXPA 3W85A 2VMFA 3FEQA 2R24A 3ITTA 4K37A 4GINA 1UHVA 1Z6KA 1FX6A 3TCSA 3GVGA 1C9WA 3NZPA 3WH8A 1FH9A 5ABFB 3V0UA 4D6HA 3U48A 4L4LA 4WEVX 5A3HA 3CHDA 2PDYA 1JCNA 3QQWA 2D20A 1XIFA 4BWLC 1IIGA 3AQUA 2ZX6A 3G3DA 1WUEA 1UR1A 1XIIA 4JYFA 4PYSA 4XD5A 4GRSA 3G22A 4Y9OA 1ZSXA 3OOQA 3MV11 4M1BA 5LGXA 2KZHA 4BJHA 4PMDA 5D04C 2ZA1A 3BJTA 2ZXBA 2ZVRA 4JCMA 4IIGA 4QRNA 1VPQA 4A22A 4UZUA 3C0SA 1QO5A 5LNWA 2DEPA 1OCJA 1Q2SA 3UGVA 2L5HA 3MVIA 3K8MA 3PVFA 1PEZA 1O1ZA 2QNEA 4XIAA 3ARVA 3CIXA 3OZMA 1Q8AA 1R7AA 4XVEA 1OC5A 4B9YA 4HPHA 3PUEA 4MWAC 4U2YA 3AYSA 1E1CA 2DIJA 1ISWA 3XINA 3L2MA 3PFRA 1NDZA 2EGZA 3NQ8A 3R0UA 3PBVA 3IANA 5G4HC 4H8HA 1AJZA 4ACZA 4MB3A 3I7QA 4QNWA 2E5DA 3W87A 2WJEA 1VKFA 1C91A 3E02A 4IPJA 4O8AA 1FHDA 1BWKA 3B9DA 1T8XA 4O1DA 3TJIA 4KRTA 3M64A 1DPMA 3AROA 3N4AA 4O18A 3CZLA 1UA3A 3AZTA 2P3EA 3FW6A 3CV2A 3ZVHA 1XV8A 1A5UA 1S2AA 3D5HA 3AIVA 4O28A 4ORMA 3R10A 4Y96A 2Y4SA 2RJGA 1IEVA 1E1EA 5EMKA 4IHCA 1M7OA 2X42A 1OINA 4C1NB 2GFTA 3N2OA 5BU6A 3VOIA 3GXFA 2RGMA 5L9FA 2VEIA 2HBXA 4BS0A 4E0CA 3VABA 2EG7A 1BQCA 1GYNA 2QT3A 4R5EA 1TV7A 4OFCA 1CT5A 4F0HA 4GNVA 3RCYA 1SU5A 1W9UA 1R30A 1TV3A 3VCNA 3R25A 4IPPA 3PTDA 4D6EA 5AYBA 3W88A 5FJJA 2G37A 4Y8EA 2CHRA 5ABGA 4NY2A 1VFSA 2ZUWA 2HNEA 4R7JA 1WNOA 1NFBA 1SZNA 4JOMA 4HCDA 1BSIA 3CH0A 3P0WA 3W1AA 1W5PA 4O10A 3PWGA 2O9PA 1ZP4A 3TTYA 4JDYA 3H2CA 2VTFA 2XGZA 4I7UA 1T6MA 4Q22A 2F6UA 4LH8A 2QQ6A 4B3LA 3K8LA 2BY2A 3BVJA 3KCLA 4B3ZA 2YX0A 1I4NA 5DT7A 4GIEA 2PEVA 4A8RA 3NGFA 1RPXA 4TVDA 2Y7DA 4NX5A 2GOKA 2V5CA 1E71M 3EA3A 3QZAA 2V2CA 2X0YA 3UXLA 3CTLA 3O0FA 3Q37A 2W62A 3L4ZA 4KWSA 5IDZA 1HUVA 3HGJA 1W9VA 3BC9A 3MYOA 4MY1A 1H09A 4B16A 1G4TA 2H6RA 1HT6A 4M7SA 2XIQA 3CUHA 3U8GA 5BMXA 3WUFA 4AZHA 5F4SA 3W4RA 1IR2A 1SJBA 4UTIA 1V6XA 3W6LA 5LXXA 1A49A 3W3OA 3T0AA 1SMAA 1MQRA 4UTLA 4WOZA 1IEWA 2NWRA 5BRBA 2H3BA 3BO9A 5D2YA 4AQLA 3LHTA 4MWAD 1M01A 1X1OA 3NEVA 4KRZA 3B0VC 3V1PA 1JPDX 2V3DA 4M8UA 3ME3A 3N18A 4GY0A 4H2CA 3U7BA 2NSOA 2C7FA 3NZQA 3O6YX 1UP2A 1R5YA 2FYMA 3FXYA 3MVTA 4A35A 3VOCA 1W3KA 4WSKA 1W5MA 5CSYA 3ZT7A 1JR1A 3MWAA 2PLMA 3WUBA 3SECA 3PJUA 2QJJA 1VBUA 4JIHA 2YPIA 2Y6ZA 5E93A 3PANA 3V5FA 3RITA 1TSIA 2OLAA 3NXLA 3A9BA 1K7EA 3OZPA 5HBFA 3M7SA 3E2VA 1H41A 1VB9A 1HGYA 2GUYA 3SR7A 1Z69A 4O19A 3M5ZA 3WLSA 3VKJA 4HSNA 4PZVA 3LQGA 3S5SA 3LCHA 3W38A 5A6BD 2AAAA 4WJ8A 4HN4A 4PCTA 1BKHA 3HG2A 1HZYA 4PUJA 4ATWA 3E0FA 5FJRA 4DY1A 1W5QA 2C91A 4O11A 3IGUA 1KBIA 1LLOA 3FAWA 4FS9A 3ZLFA 4GO8A 4Q4MA 3EPOA 3LG3A 5I23A 2OGYA 3SCNA 3GC4A 3UNDA 4DBEA 3M0YA 2QAPA 3HU7A 3GG8A 3L67A 4X60A 3DGRA 2QLYA 4H6KA 4AWSA 1NIUA 4R27A 4IPLA 3WDIA 2XFYA 1XYAA 3B03A 1O60A 3WSUA 2AOSA 3KRUA 4K36A 4OOZA 4F9JA 3JRKA 2J8GA 3EZ4A 3ARZA 3FJNA 2JF7A 4WDWA 2FTPA 1IXNA 4S3FA 1S5VA 4AVOA 1W3IA 4DBUA 3M9YA 2PBOA 3DIPA 3UERA 3BV4A 4PFHA 1RQBA 3AMLA 4ZSTA 2OQHA 1SJAA 3RM8A 2VFHA 3GIPA 1O4UA 2FZMA 4GJJA 1GG1A 3V3WA 3SCUA 3AS0A 3B8SA 2GJRA 3VUSA 1S5TA 3Q94A 4JQAA 1A4LA 1XLJA 1KKOA 4P5UA 4XAYA 4GUGA 1E9IA 4M29A 5FF3A 1NJJA 4C7GA 2A3HA 1PO9A 3WQOA 3O9NA 1FHUA 3CMJA 1ZJAA 1XCWA 1NF0A 1V08A 4TMCA 5AECA 1NTHA 1EUNA 1EZ2A 3UZWA 3UCCA 4QAIA 4HMEA 1I8JA 2PWEA 4CN6A 4XTDA 3GKAA 4PUMA 4W89A 1ISZA 3TCEA 4AHPA 4RDZA 3UR7A 2CESA 1QVBA 3G2GA 1ZL1A 1XLGA 1KXHA 1ZZMA 5E6YA 1R0MA 3GDRA 1I2NA 4ML4A 4DWSA 3ZZ1A 2Z7KA 4H41A 3QGKC 4PRWA 3CB8A 1VP5A 3HF3A 5H8PA 3HM7A 4X63A 4F0RA 3A4WA 2CLOA 4LV4A 3HPFA 1WDRA 1DJQA 3EWDA 3S1UA 3IIVA 4DYJA 4XSMA 4J5NA 3LV5A 3UXIA 1B57A 4PMZA 2WHMA 1A50A 4D6IA 4PMXA 3PBGA 1E9ZB 1AK5A 3LCGA 5D2WA 4OOUA 3RX4A 3EPMA 1YDVA 3OYZA 1M03A 2YA1A 1F3TA 3WIJA 1F73A 1YRRA 4RE4A 5A95A 4Z1DA 2A5HA 2EXOA 3HBLA 4UFHA 3E0IA 3T2OA 4HHLA 4XUYA 4JTCA 1GKPA 5JUVA 2GSHA 3VDAA 4M82A 3CYJA 1T40A 3BG5A 3DFPA 2O56A 3DFNA 2WLZA 1V93A 1VRDA 5AHMA 1CB7B 2PC4A 1XCFA 3H12A 3BK0A 4HCHA 5KTLA 3FVDA 3SQLA 2REQA 3KOWA 1Y5WA 2YIHA 1VBJA 1RHCA 3H8AA 4QNEA 2WHLA 3MMDA 4IX0A 3THAA 2ZYFA 4RXGA 2J79A 5AHIA 3EX4A 4JKMA 4JICA 1QI2A 4AEOA 2WB5A 2BMBA 1JAKA 1G01A 1WDQA 3TONA 3PUDA 5LNSA 5CPSA 4PCPA 4NU7A 4R85A 1HTIA 1J0HA 2PWDA 4U33A 1PDZA 3LHWA 3EWYA 4IGSA 1A5BA 1Q8JA 1GT8A 2Z1WA 2DJLA 3KS6A 3NSXA 4HSOA 4ZTYA 3ABSA 2PWHA 4FNPA 3S2MA 4O13A 4LUTB 4GY7A 3FYPA 4YTSA 4EPDC 2QCMA 1WE5A 4N2YA 1DEDA 3CT7A 1GVFA 4LB3A 4H9XA 2RDUA 3PF3A 5HULA 3GDTA 3H26A 5D37A 4Y6GA 2ZDRA 3AAMA 5BXTA 2QMJA 5H2ZA 2V6AA 5EYWA 2ONEA 4ASTA 5DANA 3W83A 5JBEA 3S9YA 4GUHA 4M6UA 4QP0A 3MBDA 3CT2A 1B3WA 7TIMA 2JE8A 5HAOA 1Q63A 4YTRA 3LI0A 1OCNA 3L9CA 3RO8A 3SUSA 1VFTA 4MGGA 2YOCA 3TXZA 1HKKA 3IVUA 1YHTA 4P7NA 4NAEB 2V0TA 3C8NA 5HOSA 3LXCA 3WX7A 4QG6A 3G1HA 3G1YA 1XS2A 4QXIA 4DLFA 2AGTA 2AQOA 4FZIA 3QOMA 4BA0A 1Z32X 2ZXDA 1GONA 4DM1A 2PD9A 3K4WA 1SPQA 4O16A 3W9ZA 1QWKA 2GGJA 3DG6A 3D46A 1LLWA 1W5OA 3IIZA 3RHGA 3BOXA 5D32A 4M6PA 3W7KA 3E2RA 4LBSA 5FEXA 1JYVA 2CLPA 4H6EA 1VYPX 3W84A 1EJUC 3TH6A 1KTNA 4CQCA 3IJIA 4EF8A 1P7TB 1XKJA 3C2YA 4NF7A 2V67A 4DJFC 1K8ZA 1OYAA 3M5VA 3O6CA 2VFIA 3ABQA 9RUBA 1UMLA 1TE6A 2V5LA 1BRLA 1O68A 2PWVA 5I2UA 3G1FA 3AXKA 4JNMA 2XN2A 4MWAB 4AZGA 4PTMA 4MHBA 1F9CA 1QFEA 1JRCA 3UD6A 1WKDA 4ALDA 1KFEA 1DWGM 4NI8A 1RAKA 2OJPA 3VDGA 3OVGA 3EXSA 4O0QA 5I7GA 2VJXA 1J18A 3QRHA 5J5DA 3WF0A 5M5DA 3GFYA 1E6QM 2DW7A 4UR8A 3C8FA 3SCSA 1KBJA 4XSLA 2DQXA 4NZCA 3NQ6A 2W4XA 3MY9A 4CVWA 1NQKA 2R1NA 3UGRA 2FHFA 1IXPA 3QPEA 3NQDA 3N14A 1UASA 2V81A 3S1GA 3BSHA 4YYCA 5F1UA 3QV8A 3VGDA 4CD6A 4H9UA 1EQCA 3O6AA 3AZRA 1XYCA 4RX0A 5FSEC 2GOUA 1I2OA 3U4FA 1M53A 4YYFA 3TQVA 1CLXA 3GC2A 1UKOA 1O5KA 2H3DA 3N13A 3MB9A 4LUSB 4TR9A 4FI4A 4IWWA 3EXTA 5T9CE 4A05A 1IZKA 2VFFA 3QQ0A 1K77A 1UC5A 2QF8A 1B3VA 3QMRA 3SCRA 1A0EA 3V0TA 3USZA 3N4EA 5LNRA 3HPXA 3GTXA 5SWUA 1H7WA 5BZAA 1TPEA 3V5CA 2XM1A 3CZJA 1FWRA 1FA2A 1JUKA 2QPSA 5FAJA 3BAWA 3D3AA 3HB9A 3QJAA 3MTWA 1UA7A 4Z2HA 3QC0A 2CXGA 4UMBA 3KXQA 2E40A 1JJKA 2XH2A 1BVWA 2VOTA 2ZQ0A 1XLAA 2X7VA 3L68A 3N2CA 4REQB 3BXWA 4CEXC 3KP1A 2DSWA 3WLQA 4NAFA 3QFEA 4JTQA 1TX2A 2J78A 3QFWA 4DUXA 3W7RA 1Q13A 4AMAA 4IL0A 1JFXA 1HG3A 5J8LA 2UBPC 4I9AA 1RLDA 2IQDA 2HQAA 4UCFA 1V5XA 3FAXA 2DZSA 5FF7A 4CQ8A 2X2YA 3EOEA 1RVKA 2VO5A 3CWNA 3RLUA 3WYZA 4DUOA 3QHMA 2YL5A 3WLRA 4DJFD 1IEIA 9CGTA 1VENA 2AQVA 4FIQA 1IEQA 1FKXA 1VHCA 2XSXA 3T8QA 1TWIA 4IFOA 4FF7A 2OG9A 1H2JA 1Y5VA 1XLFA 2BS9A 4ENLA 4FA3A 1IT0A 3LSCA 1V7AA 3ID7A 3I68A 5AVNA 5M03A 2ZUSA 2D2GA 3UF9A 2PTDA 3M4HA 2PRLA 1K7FA 1MW2A 1CGTA 1XRSA 3OEXA 1OY0A 4MNKA 4GKLA 1PZ1A 3TZFA 3FV9A 1BWLA 3VKKA 1IZJA 3PZMA 5JIPA 1W54A 3PULA 2JKAA 2ZA3A 1CGYA 3QMTA 1UZ4A 3T42A 1GW9A 3M41A 1UIPA 3B9NA 1UWIA 4H2HA 3ZJ6A 4CCZA 3CWOX 3OVRA 1NELA 5F1VA 4ML9A 3AIUA 3LSBA 4ROPA 1KTCA 3IV3A 4UTWA 3KWXA 3GXTA 2BOEX 4GWEA 4DNHA 3GNOA 2J75A 3LN3A 3W1MA 1B31A 1XWYA 5FCZA 2JALA 2WMFA 2V9DA 2XVGA 4ACYA 3OVPA 1W3HA 2FPVA 1H50A 3GR8A 3PTKA 3G1DA 1TWZA 5AYXA 2R6OA 3VNZA 2R1MA 1KXVA 5LHEA 1XIJA 2C0AA 1G4SA 3UWQA 3MU7A 3T2QA 1VFHA 4OJYA 2CWXA 4CQ9A 1TV2A 1CGVA 2WPGA 3CIWA 4D6FA 4IMAA 1QAPA 4U4MA 3W1TA 4L1WA 3M0XA 3G77A 3R8RA 2XM2A 1F6KA 1VPXA 2YXOA 4ZB2A 2X41A 4FP1A 4GE8A 4N9DA 2WBKA 2X1UA 1A3WA 3AWOA 1JUEA 1BF6A 2CWNA 4EWJA 1WV2A 3SY8A 1FWNA 1O12A 4O17A 2VZUA 3L4UA 4WXZA 1EHNA 1OZMA 3A5VA 3PSVA 3RK8A 1F76A 2E0PA 3E2QA 1VF8A 1FWGC 4UQBA 1ZAIA 4XO7A 4OBTA 3W76A 1AH3A 4IP4A 4E5TA 3O8AA 1MFVA 3S42A 3W7MA 2PMQA 3FIGA 2INEA 4ZE5A 2GGEA 1QO2A 6ENLA 2VZOA 1EP3A 3W27A 2WCGA 5AYIA 3I3BA 2V3FA 4YTQA 4E38A 1DQWA 2H90A 3T55A 3VGGA 5I78A 1Q2RA 2QDHA 3W01A 1MI3A 1HX0A 3DENA 2XU2A 1Q66A 4V27A 4Q33A 1DJXA 2WZEA 2OZTA 4PRTA 1RJQA 4OWGA 4AX6A 3E38A 1UH4A 3BH4A 3K4AA 2BODX 2W27A 4N42A 2R14A 2RAGA 1JAEA 5E0KA 4YU1A 3UVAA 3B8DA 1EHAA 1UD5A 4PBEA 4G2DA 4JFSA 3RPMA 3EDDA 4P8UA 4UR7A 4ZO8A 2FKPA 3GAYA 3RM9A 5B7YA 4D72A 3PZTA 4F4RA 1AA1B 3CZ8A 4E4PA 4ZFCA 2XIOA 4DJEA 3F4WA 4WY0B 1EYWA 2PPGA 2ZUUA 4J3XA 4NRRA 5HPCA 3GM8A 3VIKA 5AHNA 2HK0A 2Q3RA 4D71A 3EX2A 2QCLA 3VINA 3CMGA 1V02E 4V33A 3JR2A 2E9BA 2MNRA 3CUGA 3MPGA 4CNUA 5K2ZA 4UFMA 1M7XA 1BGGA 2GJPA 3H2MA 4JYEA 1QW7A 4JTHA 3N73A 3MO4A 2CC0A 2YYUA 2V30A 3NPUA 8TIMA 5DMLA 4O50A 4MDPA 3DCPA 4GI8A 1XISA 4XAFA 2ISSA 4R53A 2HROA 3H4WA 4IMGA 2F7FA 1D7FA 4AW7A 3PS7A 1AODA 3E1F1 3BMXA 6REQB 2GGIA 2ICSA 1KA9F 4QTGA 1UKQA 3IUDA 4D2JA 4NYYA 2H8ZA 3MKVA 1TWSA 3OLIA 3UWUA 4F3HA 3SEPA 1R2TA 3AMDA 1FDZA 3TA9A 1PWLA 2FVKA 1N8FA 1ICSA 4QCFA 1R2SA 3MS8A 4JTJA 1MSSA 4YWIA 2ZX5A 4AEFA 1EC7A 4UTHA 1V3KA 4F48A 3PBMA 1KM0A 3FLUA 2B31A 4BFAA 3ZQ9A 3IVTA 3WMCA 3PJWA 4NT0A 1OIFA 3PZ9A 3GXNA 3BCJA 3DFQA 3TJXA 2F2HA 4MF4A 3GH7A 4QROA 1IE7C 5J5RA 4GXPA 3TVAA 4ZO9A 1PB0A 3TDFA 3QQ1A 3CASA 3K8KA 1ZUAX 3SQSA 5GNYA 3G18A 3TKFA 3RIKA 3BLPX 5AC8A 5FL1A 3SRKA 3GZ3A 3SM0A 4JX5A 3PBYA 2CETA 4FOUA 4JEQA 4NJIA 3BMWA 3MP3A 1NU5A 1RBLA 3REQB 3G8EA 4BK9A 4C91A 1XLKA 1K6WA 1R46A 2VD8A 1F3XA 2VEMA 4S3CA 2G3FA 4F0MA 3N19B 1RD5A 3DHDA 1Z41A 5LA0A 2PZNA 2ZUMA 3V75A 2AQWA 4TVUA 1RPKA 1GQKA 2PDIA 3N2BA 4C6KA 1T0OA 2OELA 3MHUA 3ITXA 2D3LA 3GG1A 4O8RA 3FSTA 3W74A 4L6HA 3VIGA 4MAZA 4GVIA 4O0ZA 2EPLX 4PL1A 4GVGA 3STPA 2XYLA 1TWDA 3N04A 1CGWA 2C18A 2EHHA 2V2DA 1JRBA 4UXDA 1TV4A 1I0DA 3CAKA 4LAZA 1V3LA 4JN7A 1XIGA 3NL2A 1JZ4A 4QAWA 2BY0A 1FVPA 1B9BA 1JDAA 4Z2KA 1K8XA 1ML1A 5FACA 4JTKA 1UYQA 3DX5A 4NILA 5C2CA 1GYMA 3N11A 3FHAA 1DXFA 1KBBA 2HDJA 1UPMB 1XYZA 4BQ3A 1JYWA 3MHGA 3RX2A 1XGZA 4JTFA 4YWSA 1TJ2A 3P6LA 2YCEA 3SCPA 3NQCA 1Y5XA 3PAJA 3CLWA 3GDBA 3VMPA 1UH3A 4I6VA 4DEFA 1WXZA 1TJPA 3WD1A 5DCEA 3J7HA 4C1NA 2OSWA 3IS4A 1B2YA 1XINA 4K68A 3S2LA 1PTGA 4MNMA 2W9MA 4JQ4A 1JYXA 1SYTA 3MKCA 1B4KA 1BXCA 1PKMA 2QCNA 5XIMA 3MJYA 2BHYA 2I1OA 2O0TA 5M1TA 4UTFA 2DV0A 2WBGA 4NASA 1XIMA 4JHOA 1V6YA 1UKTA 1JG9A 3ABZA 3VOGA 3OBEA 5C5YA 4W8LA 4KS0A 3UETA 2NLYA 4DF2A 4W85A 4S3KA 2A6LA 2X0HA 2PDMA 3F5JA 2UY3A 3OP2A 1WDSA 2NUYA 2DT0A 2IUZA 4GZIA 3TXVA 1UR0A 1V3JA 3PBWA 4PMRA 1PZ0A 3PTQA 1RY8A 1XG4A 1EJXC 5CGQA 1WCGA 3ALGA 4B92A 1WX0A 3LMZA 3LOTA 3TQ0A 3EA2A 3M43A 2YKKA 3W7HA 3SRDA 5BMWA 2YSWA 2PLJA 3RF9A 3CQKA 1VBGA 4N6EA 4M24A 3WCZA 5EMUA 3A13A 5IHSA 4PBGA 2YDSA 3SUVA 4WCJA 3ZLGA 3V1HA 4AD5A 1O1HA 3IACA 3OYXA 4LAUA 3UG3A 4GBUA 3C86A 4PMOA 3MHFA 1R3VA 4JTUA 3UYCA 4ATLA 2VOMA 2GK1B 2C16A 1CW2A 1B5TA 2DIEA 3U0HA 8XIAA 3JZEA 1DIOA 2QCEA 4FLRA 2QCFA 3WENA 4L9ZA 4L9XA 2Y5EA 4AXNA 4C7FA 3BW4A 1V3IA 1A5CA 4A2SA 1DOSA 2P53A 4I3GA 4MMWA 2PP1A 1E56A 2QUUA 1EF3A 4FLOA 3WF3A 3NOEA 4MVAA 2BBFA 2GUUA 1LOSA 3TV8A 3W7DA 4JPGA 3RR1A 2WKLA 3ARYA 2DY3A 1VLWA 3WL1A 1O5RA 4WVXA 5IBXC 4DUWA 4AF0B 4DO6A 3VD4A 3M0JA 3THDA 3U6WA 1A3XA 1LOLA 2WVVB 5GPRA 4U28A 3VIMA 5HJYA 2O9TA 3WFZA 3LHUA 3VZXA 3WUGA 4UBPC 2WMIB 4I9MA 1UOKA 2YL6A 4F79A 4LUIA 4X9YA 1JI2A 3P14A 3M5XA 3TTOA 1NDVA 1HKIA 4OTKA 5A6MA 3T0TA 4UFIA 3EMQA 2ACUA 5DMMA 3WNMA 5KZEA 4WDUA 2XSBA 5F4WA 1TCDA 2DH2A 2HE8A 1XKYA 4CNNA 3M07A 1V51A 2YL9A 3VGHA 3EEZA 1ZLPA 4GQRA 1PJ9A 3HQNA 3I6TA 1UJPA 3WQ6A 1S1PA 1ECQA 3PSWA 4KETA 5E0CA 2PURA 2Y5SA 4GI4A 1MVYA 4MM1A 3GAKA 2OO0A 1R2RA 3VNYA 3W82A 1MQQA 3TA6A 4YLWA 1KB3A 2ZC8A 5CPQA 1E40A 1J0JA 3A4JA 4E4UA 6XIAA 1ODUA 3T40A 1W9PA 2WVUA 5AHFA 5GNXA 2FJUB 3QY8A 2V5DA 5LA2A 1NAL1 2WC3A 2XVNA 1C8QA 3FK4A 1OYCA 3C3UA 2VX5A 4S3BA 5CAHA 5AVHA 3E96A 5A2AA 1OX4A 4WZHA 1SZRA 4RLIA 4JTAA 4KH2A 2W63A 1JDFA 4XX6A 4DZIA 3WLMA 1MUWA 4DB7A 1UCWA 3WQ5A 2CZDA 4NZ4A 1JD9A 3B4YA 3AIQA 1HJVA 5CBBA 4HYVA 2YW3A 3PJTA 1ME8A 1JNDA 4BQ5A 4TVCA 3OPSA 1HVQA 1XM3A 4FX7A 1JZ5A 1IGSA 1ZBKA 5EA9A 1ZRQA 2OYKA 4JKKA 1C8YA 1THFD 3RAOA 1CDGA 2VT0A 2HXUA 3M1ZA 2WQDA 4IT1A 3T8LA 4BI5A 1TVLA 4AD3A 4A4AA 4XKYA 1FTXA 1NH6A 1XYFA 4NG3A 5AOUA 4KGLA 2C79A 3AIEA 1K4GA 4GY1A 3GQYA 1QNOA 3BCDA 3OGRA 1HJUA 4D6DA 1XLLA 4F2UA 4B5WA 5IXEA 4S2BA 2BXZA 1H61A 2Y88A 1ODZA 3AMGA 3EWXA 2FDMA 4EANA 4ADSA 5U4NA 1DWIM 4LAKA 1TTQA 3A24A 3LXBA 4AWTA 3O15A 4DBWA 2QR6A 3WQCA 1XC6A 1WZLA 3B06A 2CZ5A 3R12A 4LFYA 5HDRA 4LYQA 3CB3A 1U83A 2VQTA 5DT5A 1FXPA 3THUA 1E5NA 1EOKA 2MANA 3GH4A 3A5FA 2Z27A 1A0DA 4M19A 1LL7A 1PL9A 3TNOA 4QE5A 1R7OA 3LTPA 3ITOA 5DCBA 3EDKA 3G3MA 3AHZA 1DXIA 2ZRXA 1PCWA 1X6LA 4JQ1A 1QTWA 1E6XM 4UTTA 1XUZA 3LEPA 1H62A 1Q6OA 3MI6A 3B9OA 2E28A 4GNKB 3KCJA 3MA8A 4KGJA 3RPTA 1LWHA 1PX3A 2NXIA 1J93A 2XTKA 4J4KA 5F2GA 4LYRA 4AWUA 2X09A 1TPFA 1NOUA 3TN6A 4AIUA 1IT7A 3IWPA 4H19A 2A79A 3P62A 1LCOA 4PA8A 5FJTA 3QXBA 1NDYA 1B54A 4HA1A 4MUZA 5I77A 3FA5A 4HU0A 3NZ1A 3UP8A 3AHXA 5AYZA 4DZAA 3MDUA 4TX8A 3QHOA 1CXKA 4B4FA 3BAYA 2IKHA 4XD6A 1F7BA 4LWWA 5T9BG 4NL1A 2ZX7A 3BV7A 3G1SA 2ZE0A 3COTA 3LZ3A 3GDMA 3DFHA 4GCXA 4D6CA 4HA3A 1EJSC 1EIBA 2A7PA 3USBA 2J7DA 4B2DA 3IK2A 4Z2JA 1OYBA 3GTNA 3NM1A 2ASHA 3SURA 1S2UA 2Z26A 1CXLA 4JY9A 3VDBA 1SFJA 1IIHA 2DPEA 3TLQA 2OTDA 3WQ8A 2ABAA 3UWVA 5C9UA 4Z1AA 3NL3A 4PCFA 4GXMA 3CK5A 4G7EB 1VJSA 4FX6M 4S3EA 2NZLA 3CHFA 4HD5A 4RZ6A 1TYGA 3CLMA 1JPMA 4KRUA 1QBAA 4HNLA 3KBNA 1VYRA 3UG4A 3DI1A 1DIDA 1R3WA 1JCTA 1FXQA 3DYPA 1KCLA 5I5RA 4F9DA 7PTDA 1F07A 3UWYA 1IWPA 3CUXA 3RPDA 3ORWA 2A85A 4W7WA 5A2BA 4Q8PA 1PTAA 2V3EA 3PK7A 3W7PA 1YTEA 4HNVA 4O1AA 2J24A 4LAMA 1R87A 2F9RA 3B9EA