3LVCA

Crystal structure of gfp-like protein acegfp_g222e (a. coerulescens). colorless form.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
226
Chain Sequence
MSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYFEFVTAAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Structural evidence for a dehydrated intermediate in green fluorescent protein chromophore biosynthesis.
pubmed doi rcsb
source organism Aequorea coerulescens
molecule tags Fluorescent protein
total genus 65
structure length 226
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3lvcA00
4ZF3A 4DXIA 3UG0A 3LVCA 3AI5A 1YJ2A 2Z6XA 4W6HA 3V3DA 1Q4EA 1JBYA 4KW9A 3LVAA 1W7UA 2QLGB 1KYRA 4HQ9A 3M22A 4RYSA 1EMFA 3GJ1A 5EB7A 1XSSA 4H48A 3SRYA 3S05A 2AH8A 1YHGA 3CGLA 4W6KA 2VZXA 3RWAA 3DQDA 1F09A 5DQMA 2VVHA 4W6PA 4W6GA 5DPJA 3K1KA 2HFCA 4TZGA 5EB6A 2YDZA 5LTRA 4LQUA 3DQ4A 4J88A 3LSAA 2ARLA 3CBEA 3SVOA 2HGYA 1KYSA 2YE0A 4H3NA 5H88A 2WIQA 4XGYA 1Q4BA 5HW9A 3DPXA 4W73A 3PJ5A 4W6DA 3PJBA 3SVDA 1W7SA 2OGRA 5BTTA 3U0NA 2A56B 1ZUXA 3OSQA 4KAGA 3DQ5A 3EKJA 4W76A 2G6YA 3DQUA 4W6MA 5HZTA 4IK5A 1HCJA 1RMMA 1XMZA 2G16B 5EXUA 2H8QA 4ZB1A 4EMQA 3EK4A 4W6IA 2GX2A 2AWKA 3SVUA 4PPKA 2QLHA 3SG4A 3DQFA 4W6TA 2Z6YA 5EXBA 3DQCA 4KW8A 1RM9A 4KEXA 1Z1QA 4ORNA 3SG6A 5T3IA 3E5TA 2H9WA 4DKNA 3CFHA 4KA9A 4LJCA 1H4UA 1OXFA 4IZNA 5DPHA 5H87A 4LJBA 4W6AA 4Q7RA 2POXA 2WHUA 2FZUA 2G6XA 3LS3A 3WLCA 3E5VA 4W6OA 3VICA 3DQHA 4XVPA 5LTQA 2AHAA 1YHHA 2HQKA 3LF3A 4JFGA 5DTXA 2DUHA 4W74A 5EJUA 2H6VA 4HQCA 3SG2A 5AQBB 4ZBLA 3I19A 4DXPA 1W7TA 4Z4KA 3SVBA 2QU1A 3M24A 4P1QA 1HUYA 4JGEA 2H5QA 4OQWA 4Q9WA 5F9GA 1EMLA 1EMEA 4W7EA 2GW4B 4Q7TA 4ZF4A 4W69A 3ZUJA 3CB9A 2YFPA 3WCKA 4JF9A 3VHTA 2P4MA 4W75A 2Y0GA 3SSVA 5BT0A 3EKHA 3SSHA 3SG5A 3DQ1A 2B3QA 3GL4A 4KPIA 3WLDA 4U2VA 1GGXA 3CFAA 2V4EC 3DQJA 1Q4AA 4W77A 4TZAA 2Z1OA 4OJ0A 1JC1A 2A50B 2H5OA 4W7FA 3TMRA 4B5YA 3SVNA 3DQMA 2IB6A 5BTTB 3CD9A 1B9CA 1GFLA 5DRGA 2A52B 2O24A 3A8SA 4OY4A 4H3MA 2C9IA 4L12A 3TMTA 1Q4CA 4LJDC 2C9JA 2IB5A 3EVVA 4KF4A 2FWQA 3CFFA 3BXBA 5FHVA 4JC2A 2OJKA 4UTSA 1G7KA 4KGFA 2VVIA 4IK3A 2OKYA 5HBDA 5DQBA 4N3DA 4ANJA 1MYWA 1KYPA 1GL4A 1EMKA 1KP5A 4HE4A 4W7DA 3ST3A 3RWTA 1ZGQA 2A46A 2DD9A 3EK7A 4GF6B 2QLGA 4JEOA 3G9AA 1YFPA 3EVRA 3DQIA 2WHSA 1EMMA 2DUEA 4B30A 5LTPA 3SVCA 2QLEA 4R6BA 3GB3A 3SG3A 2DUIA 2OTBA 5HZSA 3U0KA 1QYFA 2AWLA 4R6DA 2OTEA 1QXTA 2IE2A 3NT3A 3SV5A 5EBJA 3P28A 3W1DA 2HGDA 2WURA 3LVDA 3SVRA 4EN1A 3VK1A 2G2SB 3E5WA 3U8PA 2ZMUA 1EMBA 3VHTB 3NEZA 3W1CA 5BQLA 4PPJA 3SSKA 2EMNA 3DQ3A 2V4EA 4KF5C 3DQLA 2VADA 4RYWA 3ST2A 1F0BA 4EDSA 3CD1A 1RMPA 4GESB 4AS8A 2PXWA 4XOVA 1YHIA 3EVUA 4LW5A 3U0MA 1EMAA 2O2BA 4W6FA 5DTYA 2ZO7A 3BXCA 2G3DB 3DPZA 3DQKA 4L1IA 2ZMWA 2IOVA 3DQEA 5DU0A 3GEXA 2RH7A 4I2YA 4ZFSA 2DDDA 2QLIA 4J89A 2ICRA 2Q57A 5H89A 2A48A 5J2OA 2WSNA 2EMOA 4LJDA 3SSYA 3P8UA 2WISA 2DD7A 2FL1A 4W6SA 3H1RA 4HQ8A 4IK1A 2BTJA 4W7RA 3EVPA 4XOWA 2HPWA 2QT2A 5DPGA 1JC0A 2HCGA 2G3OA 1XA9A 3ST4A 3BX9A 4W7CA 3SS0A 3SVSA 3OSRA 3LA1A 4HVFA 3IR8A 3KCSA 4DXQA 4Z4MA 3DQ2A 3NT9A 3AI4A 4XL5A 2Q6PA 5FVFA 2H5RA 3O77A 3NF0A 3IP2A 2Z6ZA 3ADFA 4ZIOA 1MOUA 1Q73A 3SSTA 3SSLA 2G5ZB 3PIBA 1OXEA 2A54B 4B30B 3H1OA 3ZUFA 3DQ8A 4DXNA 3NEDA 1YZWA 5FVIA 4J8AA 3AKOA 4W6CA 1Z1PA 5FVGA 4Q7UA 4DXOA 1RMOA 1QYOA 4W6UA 2G6EA 3ZTFA 4OHSA 2O29A 3DQ9A 4H47A 4EULA 1UISA 4W6RA 3DQOA 5EHUA 4ZF5A 1RRXA 1XQMA 2HRSA 2QZ0A 2AWJA 2VVJA 3DQNA 3U0LA 1EMCA 3UFZA 1YJFA 1C4FA 3U8CA 3GJ2A 3DPWA 1ZGOA 3SSPA 2GW3A 4PPLA 3O78A 5HGEA 3ST0A 3LF4B 4GOBA 4KF5A 2V4EB 1S6ZA 4JRBA 4NWSA 2YE1A 1ZGPA 5DY6A 4IK9A 1XAEA 4H3LA 2GX0A 3KCTA 3DQ7A 4Q9XA 3EK8A 3OGOA 4OGSA 5DRFA 4W6NA 4W7XA 2AWMA 5DTZA 3DQAA 3SG7A 2VAEA 1H6RA 2DUFA 2OKWA 3U8AA 4DKMA 4W6BA 5KTGA 4AR7A 1EMGA 4P76A 5HZOA 2PXSA 4W7AA 4KW4A 2A53B 4W6JA 1Q4DA 1BFPA 3PJ7A 2WHTA 4IK8A 3BXAA 1CV7A 4LQTA 2WSOA 2JADA 4L13A 5HZUA 2QRFA 5DPIA 2EMDA 2DUGA 3SVEA 2HQZA 3ED8A 3MGFA 2HJOA 4KGEA 4W6LA 5DTLA 4EDOA 2DDCA 2ZO6A 1OXDA 2B3PA 4PFEA 4RTCA 4W72A 5EXCI 4IK4A 4DXMA 1QYQA 5LK4A 4BDUA 1QY3A 1JBZA 4ZINA 2A47A 3DQ6A 1MOVA 3ZULA 2H5PA
chains in the Genus database with same CATH superfamily
4ZF3A 4DXIA 3UG0A 3LVCA 3AI5A 1YJ2A 2Z6XA 4W6HA 3V3DA 1Q4EA 1JBYA 4KW9A 3LVAA 1W7UA 2QLGB 1KYRA 4HQ9A 3M22A 4RYSA 1EMFA 3GJ1A 5EB7A 1XSSA 4H48A 3SRYA 3S05A 2AH8A 1YHGA 3CGLA 4W6KA 2VZXA 3RWAA 3DQDA 1F09A 5DQMA 2VVHA 4W6PA 4W6GA 5DPJA 3K1KA 2HFCA 4TZGA 5EB6A 2YDZA 5LTRA 4LQUA 3DQ4A 4J88A 3LSAA 2ARLA 3CBEA 3SVOA 2HGYA 1KYSA 2YE0A 4H3NA 5H88A 2WIQA 4XGYA 1Q4BA 5HW9A 3DPXA 4W73A 3PJ5A 4W6DA 3PJBA 3SVDA 1W7SA 2OGRA 5BTTA 3U0NA 2A56B 1ZUXA 3OSQA 4KAGA 3DQ5A 3EKJA 4W76A 2G6YA 3DQUA 4W6MA 5HZTA 4IK5A 1HCJA 1RMMA 1XMZA 2G16B 5EXUA 2H8QA 4ZB1A 4EMQA 3EK4A 4W6IA 2GX2A 2AWKA 3SVUA 4PPKA 2QLHA 3SG4A 3DQFA 4W6TA 2Z6YA 5EXBA 3DQCA 4KW8A 1RM9A 4KEXA 1Z1QA 4ORNA 3SG6A 5T3IA 3E5TA 2H9WA 4DKNA 3CFHA 4KA9A 4LJCA 1H4UA 1OXFA 4IZNA 5DPHA 5H87A 4LJBA 4W6AA 4Q7RA 2POXA 2WHUA 2FZUA 2G6XA 3LS3A 3WLCA 3E5VA 4W6OA 3VICA 3DQHA 4XVPA 5LTQA 2AHAA 1YHHA 2HQKA 3LF3A 4JFGA 5DTXA 2DUHA 4W74A 5EJUA 2H6VA 4HQCA 3SG2A 5AQBB 4ZBLA 3I19A 4DXPA 1W7TA 4Z4KA 3SVBA 2QU1A 3M24A 4P1QA 1HUYA 4JGEA 2H5QA 4OQWA 4Q9WA 5F9GA 1EMLA 1EMEA 4W7EA 2GW4B 4Q7TA 4ZF4A 4W69A 3ZUJA 3CB9A 2YFPA 3WCKA 4JF9A 3VHTA 2P4MA 4W75A 2Y0GA 3SSVA 5BT0A 3EKHA 3SSHA 3SG5A 3DQ1A 2B3QA 3GL4A 4KPIA 3WLDA 4U2VA 1GGXA 3CFAA 2V4EC 3DQJA 1Q4AA 4W77A 4TZAA 2Z1OA 4OJ0A 1JC1A 2A50B 2H5OA 4W7FA 3TMRA 4B5YA 3SVNA 3DQMA 2IB6A 5BTTB 3CD9A 1B9CA 1GFLA 5DRGA 2A52B 2O24A 3A8SA 4OY4A 4H3MA 2C9IA 4L12A 3TMTA 1Q4CA 4LJDC 2C9JA 2IB5A 3EVVA 4KF4A 2FWQA 3CFFA 3BXBA 5FHVA 4JC2A 2OJKA 4UTSA 1G7KA 4KGFA 2VVIA 4IK3A 2OKYA 5HBDA 5DQBA 4N3DA 4ANJA 1MYWA 1KYPA 1GL4A 1EMKA 1KP5A 4HE4A 4W7DA 3ST3A 3RWTA 1ZGQA 2A46A 2DD9A 3EK7A 4GF6B 2QLGA 4JEOA 3G9AA 1YFPA 3EVRA 3DQIA 2WHSA 1EMMA 2DUEA 4B30A 5LTPA 3SVCA 2QLEA 4R6BA 3GB3A 3SG3A 2DUIA 2OTBA 5HZSA 3U0KA 1QYFA 2AWLA 4R6DA 2OTEA 1QXTA 2IE2A 3NT3A 3SV5A 5EBJA 3P28A 3W1DA 2HGDA 2WURA 3LVDA 3SVRA 4EN1A 3VK1A 2G2SB 3E5WA 3U8PA 2ZMUA 1EMBA 3VHTB 3NEZA 3W1CA 5BQLA 4PPJA 3SSKA 2EMNA 3DQ3A 2V4EA 4KF5C 3DQLA 2VADA 4RYWA 3ST2A 1F0BA 4EDSA 3CD1A 1RMPA 4GESB 4AS8A 2PXWA 4XOVA 1YHIA 3EVUA 4LW5A 3U0MA 1EMAA 2O2BA 4W6FA 5DTYA 2ZO7A 3BXCA 2G3DB 3DPZA 3DQKA 4L1IA 2ZMWA 2IOVA 3DQEA 5DU0A 3GEXA 2RH7A 4I2YA 4ZFSA 2DDDA 2QLIA 4J89A 2ICRA 2Q57A 5H89A 2A48A 5J2OA 2WSNA 2EMOA 4LJDA 3SSYA 3P8UA 2WISA 2DD7A 2FL1A 4W6SA 3H1RA 4HQ8A 4IK1A 2BTJA 4W7RA 3EVPA 4XOWA 2HPWA 2QT2A 5DPGA 1JC0A 2HCGA 2G3OA 1XA9A 3ST4A 3BX9A 4W7CA 3SS0A 3SVSA 3OSRA 3LA1A 4HVFA 3IR8A 3KCSA 4DXQA 4Z4MA 3DQ2A 3NT9A 3AI4A 4XL5A 2Q6PA 5FVFA 2H5RA 3O77A 3NF0A 3IP2A 2Z6ZA 3ADFA 4ZIOA 1MOUA 1Q73A 3SSTA 3SSLA 2G5ZB 3PIBA 1OXEA 2A54B 4B30B 3H1OA 3ZUFA 3DQ8A 4DXNA 3NEDA 1YZWA 5FVIA 4J8AA 3AKOA 4W6CA 1Z1PA 5FVGA 4Q7UA 4DXOA 1RMOA 1QYOA 4W6UA 2G6EA 3ZTFA 4OHSA 2O29A 3DQ9A 4H47A 4EULA 1UISA 4W6RA 3DQOA 5EHUA 4ZF5A 1RRXA 1XQMA 2HRSA 2QZ0A 2AWJA 2VVJA 3DQNA 3U0LA 1EMCA 3UFZA 1YJFA 1C4FA 3U8CA 3GJ2A 3DPWA 1ZGOA 3SSPA 2GW3A 4PPLA 3O78A 5HGEA 3ST0A 3LF4B 4GOBA 4KF5A 2V4EB 1S6ZA 4JRBA 4NWSA 2YE1A 1ZGPA 5DY6A 4IK9A 1XAEA 4H3LA 2GX0A 3KCTA 3DQ7A 4Q9XA 3EK8A 3OGOA 4OGSA 5DRFA 4W6NA 4W7XA 2AWMA 5DTZA 3DQAA 3SG7A 2VAEA 1H6RA 2DUFA 2OKWA 3U8AA 4DKMA 4W6BA 5KTGA 4AR7A 1EMGA 4P76A 5HZOA 2PXSA 4W7AA 4KW4A 2A53B 4W6JA 1Q4DA 1BFPA 3PJ7A 2WHTA 4IK8A 3BXAA 1CV7A 4LQTA 2WSOA 2JADA 4L13A 5HZUA 2QRFA 5DPIA 2EMDA 2DUGA 3SVEA 2HQZA 3ED8A 3MGFA 2HJOA 4KGEA 4W6LA 5DTLA 4EDOA 2DDCA 2ZO6A 1OXDA 2B3PA 4PFEA 4RTCA 4W72A 5EXCI 4IK4A 4DXMA 1QYQA 5LK4A 4BDUA 1QY3A 1JBZA 4ZINA 2A47A 3DQ6A 1MOVA 3ZULA 2H5PA
chains in the Genus database with same CATH topology
4ZF3A 4DXIA 3UG0A 3LVCA 3AI5A 1YJ2A 2Z6XA 4W6HA 3V3DA 1Q4EA 1JBYA 4KW9A 3LVAA 1W7UA 2QLGB 1KYRA 4HQ9A 3M22A 4RYSA 1EMFA 3GJ1A 5EB7A 1XSSA 4H48A 3SRYA 3S05A 2AH8A 1YHGA 3CGLA 4W6KA 2VZXA 3RWAA 3DQDA 1F09A 5DQMA 2VVHA 4W6PA 4W6GA 5DPJA 3K1KA 2HFCA 4TZGA 5EB6A 2YDZA 5LTRA 4LQUA 3DQ4A 4J88A 3LSAA 2ARLA 3CBEA 3SVOA 2HGYA 1KYSA 2YE0A 4H3NA 5H88A 2WIQA 4XGYA 1Q4BA 5HW9A 3DPXA 4W73A 3PJ5A 4W6DA 3PJBA 3SVDA 1W7SA 2OGRA 5BTTA 3U0NA 2A56B 1ZUXA 3OSQA 4KAGA 3DQ5A 3EKJA 4W76A 2G6YA 3DQUA 4W6MA 5HZTA 4IK5A 1HCJA 1RMMA 1XMZA 2G16B 5EXUA 2H8QA 4ZB1A 4EMQA 3EK4A 4W6IA 2GX2A 2AWKA 3SVUA 4PPKA 2QLHA 3SG4A 3DQFA 4W6TA 2Z6YA 5EXBA 3DQCA 4KW8A 1RM9A 4KEXA 1Z1QA 4ORNA 3SG6A 5T3IA 3E5TA 2H9WA 4DKNA 3CFHA 4KA9A 4LJCA 1H4UA 1OXFA 4IZNA 5DPHA 5H87A 4LJBA 4W6AA 4Q7RA 2POXA 2WHUA 2FZUA 2G6XA 3LS3A 3WLCA 3E5VA 4W6OA 3VICA 3DQHA 4XVPA 5LTQA 2AHAA 1YHHA 2HQKA 3LF3A 4JFGA 5DTXA 2DUHA 4W74A 5EJUA 2H6VA 4HQCA 3SG2A 5AQBB 4ZBLA 3I19A 4DXPA 1W7TA 4Z4KA 3SVBA 2QU1A 3M24A 4P1QA 1HUYA 4JGEA 2H5QA 4OQWA 4Q9WA 5F9GA 1EMLA 1EMEA 4W7EA 2GW4B 4Q7TA 4ZF4A 4W69A 3ZUJA 3CB9A 2YFPA 3WCKA 4JF9A 3VHTA 2P4MA 4W75A 2Y0GA 3SSVA 5BT0A 3EKHA 3SSHA 3SG5A 3DQ1A 2B3QA 3GL4A 4KPIA 3WLDA 4U2VA 1GGXA 3CFAA 2V4EC 3DQJA 1Q4AA 4W77A 4TZAA 2Z1OA 4OJ0A 1JC1A 2A50B 2H5OA 4W7FA 3TMRA 4B5YA 3SVNA 3DQMA 2IB6A 5BTTB 3CD9A 1B9CA 1GFLA 5DRGA 2A52B 2O24A 3A8SA 4OY4A 4H3MA 2C9IA 4L12A 3TMTA 1Q4CA 4LJDC 2C9JA 2IB5A 3EVVA 4KF4A 2FWQA 3CFFA 3BXBA 5FHVA 4JC2A 2OJKA 4UTSA 1G7KA 4KGFA 2VVIA 4IK3A 2OKYA 5HBDA 5DQBA 4N3DA 4ANJA 1MYWA 1KYPA 1GL4A 1EMKA 1KP5A 4HE4A 4W7DA 3ST3A 3RWTA 1ZGQA 2A46A 2DD9A 3EK7A 4GF6B 2QLGA 4JEOA 3G9AA 1YFPA 3EVRA 3DQIA 2WHSA 1EMMA 2DUEA 4B30A 5LTPA 3SVCA 2QLEA 4R6BA 3GB3A 3SG3A 2DUIA 2OTBA 5HZSA 3U0KA 1QYFA 2AWLA 4R6DA 2OTEA 1QXTA 2IE2A 3NT3A 3SV5A 5EBJA 3P28A 3W1DA 2HGDA 2WURA 3LVDA 3SVRA 4EN1A 3VK1A 2G2SB 3E5WA 3U8PA 2ZMUA 1EMBA 3VHTB 3NEZA 3W1CA 5BQLA 4PPJA 3SSKA 2EMNA 3DQ3A 2V4EA 4KF5C 3DQLA 2VADA 4RYWA 3ST2A 1F0BA 4EDSA 3CD1A 1RMPA 4GESB 4AS8A 2PXWA 4XOVA 1YHIA 3EVUA 4LW5A 3U0MA 1EMAA 2O2BA 4W6FA 5DTYA 2ZO7A 3BXCA 2G3DB 3DPZA 3DQKA 4L1IA 2ZMWA 2IOVA 3DQEA 5DU0A 3GEXA 2RH7A 4I2YA 4ZFSA 2DDDA 2QLIA 4J89A 2ICRA 2Q57A 5H89A 2A48A 5J2OA 2WSNA 2EMOA 4LJDA 3SSYA 3P8UA 2WISA 2DD7A 2FL1A 4W6SA 3H1RA 4HQ8A 4IK1A 2BTJA 4W7RA 3EVPA 4XOWA 2HPWA 2QT2A 5DPGA 1JC0A 2HCGA 2G3OA 1XA9A 3ST4A 3BX9A 4W7CA 3SS0A 3SVSA 3OSRA 3LA1A 4HVFA 3IR8A 3KCSA 4DXQA 4Z4MA 3DQ2A 3NT9A 3AI4A 4XL5A 2Q6PA 5FVFA 2H5RA 3O77A 3NF0A 3IP2A 2Z6ZA 3ADFA 4ZIOA 1MOUA 1Q73A 3SSTA 3SSLA 2G5ZB 3PIBA 1OXEA 2A54B 4B30B 3H1OA 3ZUFA 3DQ8A 4DXNA 3NEDA 1YZWA 5FVIA 4J8AA 3AKOA 4W6CA 1Z1PA 5FVGA 4Q7UA 4DXOA 1RMOA 1QYOA 4W6UA 2G6EA 3ZTFA 4OHSA 2O29A 3DQ9A 4H47A 4EULA 1UISA 4W6RA 3DQOA 5EHUA 4ZF5A 1RRXA 1XQMA 2HRSA 2QZ0A 2AWJA 2VVJA 3DQNA 3U0LA 1EMCA 3UFZA 1YJFA 1C4FA 3U8CA 3GJ2A 3DPWA 1ZGOA 3SSPA 2GW3A 4PPLA 3O78A 5HGEA 3ST0A 3LF4B 4GOBA 4KF5A 2V4EB 1S6ZA 4JRBA 4NWSA 2YE1A 1ZGPA 5DY6A 4IK9A 1XAEA 4H3LA 2GX0A 3KCTA 3DQ7A 4Q9XA 3EK8A 3OGOA 4OGSA 5DRFA 4W6NA 4W7XA 2AWMA 5DTZA 3DQAA 3SG7A 2VAEA 1H6RA 2DUFA 2OKWA 3U8AA 4DKMA 4W6BA 5KTGA 4AR7A 1EMGA 4P76A 5HZOA 2PXSA 4W7AA 4KW4A 2A53B 4W6JA 1Q4DA 1BFPA 3PJ7A 2WHTA 4IK8A 3BXAA 1CV7A 4LQTA 2WSOA 2JADA 4L13A 5HZUA 2QRFA 5DPIA 2EMDA 2DUGA 3SVEA 2HQZA 3ED8A 3MGFA 2HJOA 4KGEA 4W6LA 5DTLA 4EDOA 2DDCA 2ZO6A 1OXDA 2B3PA 4PFEA 4RTCA 4W72A 5EXCI 4IK4A 4DXMA 1QYQA 5LK4A 4BDUA 1QY3A 1JBZA 4ZINA 2A47A 3DQ6A 1MOVA 3ZULA 2H5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZF3 A;  4DXI A;  3UG0 A;  3LVC A;  3AI5 A;  1YJ2 A;  2Z6X A;  4W6H A;  3V3D A;  1Q4E A;  1JBY A;  4KW9 A;  3LVA A;  1W7U A;  2QLG B;  1KYR A;  4HQ9 A;  3M22 A;  4RYS A;  1EMF A;  3GJ1 A;  5EB7 A;  1XSS A;  4H48 A;  3SRY A;  3S05 A;  2AH8 A;  1YHG A;  3CGL A;  4W6K A;  2VZX A;  3RWA A;  3DQD A;  1F09 A;  5DQM A;  2VVH A;  4W6P A;  4W6G A;  5DPJ A;  3K1K A;  2HFC A;  4TZG A;  5EB6 A;  2YDZ A;  5LTR A;  4LQU A;  3DQ4 A;  4J88 A;  3LSA A;  2ARL A;  3CBE A;  3SVO A;  2HGY A;  1KYS A;  2YE0 A;  4H3N A;  5H88 A;  2WIQ A;  4XGY A;  1Q4B A;  5HW9 A;  3DPX A;  4W73 A;  3PJ5 A;  4W6D A;  3PJB A;  3SVD A;  1W7S A;  2OGR A;  5BTT A;  3U0N A;  2A56 B;  1ZUX A;  3OSQ A;  4KAG A;  3DQ5 A;  3EKJ A;  4W76 A;  2G6Y A;  3DQU A;  4W6M A;  5HZT A;  4IK5 A;  1HCJ A;  1RMM A;  1XMZ A;  2G16 B;  5EXU A;  2H8Q A;  4ZB1 A;  4EMQ A;  3EK4 A;  4W6I A;  2GX2 A;  2AWK A;  3SVU A;  4PPK A;  2QLH A;  3SG4 A;  3DQF A;  4W6T A;  2Z6Y A;  5EXB A;  3DQC A;  4KW8 A;  1RM9 A;  4KEX A;  1Z1Q A;  4ORN A;  3SG6 A;  5T3I A;  3E5T A;  2H9W A;  4DKN A;  3CFH A;  4KA9 A;  4LJC A;  1H4U A;  1OXF A;  4IZN A;  5DPH A;  5H87 A;  4LJB A;  4W6A A;  4Q7R A;  2POX A;  2WHU A;  2FZU A;  2G6X A;  3LS3 A;  3WLC A;  3E5V A;  4W6O A;  3VIC A;  3DQH A;  4XVP A;  5LTQ A;  2AHA A;  1YHH A;  2HQK A;  3LF3 A;  4JFG A;  5DTX A;  2DUH A;  4W74 A;  5EJU A;  2H6V A;  4HQC A;  3SG2 A;  5AQB B;  4ZBL A;  3I19 A;  4DXP A;  1W7T A;  4Z4K A;  3SVB A;  2QU1 A;  3M24 A;  4P1Q A;  1HUY A;  4JGE A;  2H5Q A;  4OQW A;  4Q9W A;  5F9G A;  1EML A;  1EME A;  4W7E A;  2GW4 B;  4Q7T A;  4ZF4 A;  4W69 A;  3ZUJ A;  3CB9 A;  2YFP A;  3WCK A;  4JF9 A;  3VHT A;  2P4M A;  4W75 A;  2Y0G A;  3SSV A;  5BT0 A;  3EKH A;  3SSH A;  3SG5 A;  3DQ1 A;  2B3Q A;  3GL4 A;  4KPI A;  3WLD A;  4U2V A;  1GGX A;  3CFA A;  2V4E C;  3DQJ A;  1Q4A A;  4W77 A;  4TZA A;  2Z1O A;  4OJ0 A;  1JC1 A;  2A50 B;  2H5O A;  4W7F A;  3TMR A;  4B5Y A;  3SVN A;  3DQM A;  2IB6 A;  5BTT B;  3CD9 A;  1B9C A;  1GFL A;  5DRG A;  2A52 B;  2O24 A;  3A8S A;  4OY4 A;  4H3M A;  2C9I A;  4L12 A;  3TMT A;  1Q4C A;  4LJD C;  2C9J A;  2IB5 A;  3EVV A;  4KF4 A;  2FWQ A;  3CFF A;  3BXB A;  5FHV A;  4JC2 A;  2OJK A;  4UTS A;  1G7K A;  4KGF A;  2VVI A;  4IK3 A;  2OKY A;  5HBD A;  5DQB A;  4N3D A;  4ANJ A;  1MYW A;  1KYP A;  1GL4 A;  1EMK A;  1KP5 A;  4HE4 A;  4W7D A;  3ST3 A;  3RWT A;  1ZGQ A;  2A46 A;  2DD9 A;  3EK7 A;  4GF6 B;  2QLG A;  4JEO A;  3G9A A;  1YFP A;  3EVR A;  3DQI A;  2WHS A;  1EMM A;  2DUE A;  4B30 A;  5LTP A;  3SVC A;  2QLE A;  4R6B A;  3GB3 A;  3SG3 A;  2DUI A;  2OTB A;  5HZS A;  3U0K A;  1QYF A;  2AWL A;  4R6D A;  2OTE A;  1QXT A;  2IE2 A;  3NT3 A;  3SV5 A;  5EBJ A;  3P28 A;  3W1D A;  2HGD A;  2WUR A;  3LVD A;  3SVR A;  4EN1 A;  3VK1 A;  2G2S B;  3E5W A;  3U8P A;  2ZMU A;  1EMB A;  3VHT B;  3NEZ A;  3W1C A;  5BQL A;  4PPJ A;  3SSK A;  2EMN A;  3DQ3 A;  2V4E A;  4KF5 C;  3DQL A;  2VAD A;  4RYW A;  3ST2 A;  1F0B A;  4EDS A;  3CD1 A;  1RMP A;  4GES B;  4AS8 A;  2PXW A;  4XOV A;  1YHI A;  3EVU A;  4LW5 A;  3U0M A;  1EMA A;  2O2B A;  4W6F A;  5DTY A;  2ZO7 A;  3BXC A;  2G3D B;  3DPZ A;  3DQK A;  4L1I A;  2ZMW A;  2IOV A;  3DQE A;  5DU0 A;  3GEX A;  2RH7 A;  4I2Y A;  4ZFS A;  2DDD A;  2QLI A;  4J89 A;  2ICR A;  2Q57 A;  5H89 A;  2A48 A;  5J2O A;  2WSN A;  2EMO A;  4LJD A;  3SSY A;  3P8U A;  2WIS A;  2DD7 A;  2FL1 A;  4W6S A;  3H1R A;  4HQ8 A;  4IK1 A;  2BTJ A;  4W7R A;  3EVP A;  4XOW A;  2HPW A;  2QT2 A;  5DPG A;  1JC0 A;  2HCG A;  2G3O A;  1XA9 A;  3ST4 A;  3BX9 A;  4W7C A;  3SS0 A;  3SVS A;  3OSR A;  3LA1 A;  4HVF A;  3IR8 A;  3KCS A;  4DXQ A;  4Z4M A;  3DQ2 A;  3NT9 A;  3AI4 A;  4XL5 A;  2Q6P A;  5FVF A;  2H5R A;  3O77 A;  3NF0 A;  3IP2 A;  2Z6Z A;  3ADF A;  4ZIO A;  1MOU A;  1Q73 A;  3SST A;  3SSL A;  2G5Z B;  3PIB A;  1OXE A;  2A54 B;  4B30 B;  3H1O A;  3ZUF A;  3DQ8 A;  4DXN A;  3NED A;  1YZW A;  5FVI A;  4J8A A;  3AKO A;  4W6C A;  1Z1P A;  5FVG A;  4Q7U A;  4DXO A;  1RMO A;  1QYO A;  4W6U A;  2G6E A;  3ZTF A;  4OHS A;  2O29 A;  3DQ9 A;  4H47 A;  4EUL A;  1UIS A;  4W6R A;  3DQO A;  5EHU A;  4ZF5 A;  1RRX A;  1XQM A;  2HRS A;  2QZ0 A;  2AWJ A;  2VVJ A;  3DQN A;  3U0L A;  1EMC A;  3UFZ A;  1YJF A;  1C4F A;  3U8C A;  3GJ2 A;  3DPW A;  1ZGO A;  3SSP A;  2GW3 A;  4PPL A;  3O78 A;  5HGE A;  3ST0 A;  3LF4 B;  4GOB A;  4KF5 A;  2V4E B;  1S6Z A;  4JRB A;  4NWS A;  2YE1 A;  1ZGP A;  5DY6 A;  4IK9 A;  1XAE A;  4H3L A;  2GX0 A;  3KCT A;  3DQ7 A;  4Q9X A;  3EK8 A;  3OGO A;  4OGS A;  5DRF A;  4W6N A;  4W7X A;  2AWM A;  5DTZ A;  3DQA A;  3SG7 A;  2VAE A;  1H6R A;  2DUF A;  2OKW A;  3U8A A;  4DKM A;  4W6B A;  5KTG A;  4AR7 A;  1EMG A;  4P76 A;  5HZO A;  2PXS A;  4W7A A;  4KW4 A;  2A53 B;  4W6J A;  1Q4D A;  1BFP A;  3PJ7 A;  2WHT A;  4IK8 A;  3BXA A;  1CV7 A;  4LQT A;  2WSO A;  2JAD A;  4L13 A;  5HZU A;  2QRF A;  5DPI A;  2EMD A;  2DUG A;  3SVE A;  2HQZ A;  3ED8 A;  3MGF A;  2HJO A;  4KGE A;  4W6L A;  5DTL A;  4EDO A;  2DDC A;  2ZO6 A;  1OXD A;  2B3P A;  4PFE A;  4RTC A;  4W72 A;  5EXC I;  4IK4 A;  4DXM A;  1QYQ A;  5LK4 A;  4BDU A;  1QY3 A;  1JBZ A;  4ZIN A;  2A47 A;  3DQ6 A;  1MOV A;  3ZUL A;  2H5P A; 
#chains in the Genus database with same CATH topology
 4ZF3 A;  4DXI A;  3UG0 A;  3LVC A;  3AI5 A;  1YJ2 A;  2Z6X A;  4W6H A;  3V3D A;  1Q4E A;  1JBY A;  4KW9 A;  3LVA A;  1W7U A;  2QLG B;  1KYR A;  4HQ9 A;  3M22 A;  4RYS A;  1EMF A;  3GJ1 A;  5EB7 A;  1XSS A;  4H48 A;  3SRY A;  3S05 A;  2AH8 A;  1YHG A;  3CGL A;  4W6K A;  2VZX A;  3RWA A;  3DQD A;  1F09 A;  5DQM A;  2VVH A;  4W6P A;  4W6G A;  5DPJ A;  3K1K A;  2HFC A;  4TZG A;  5EB6 A;  2YDZ A;  5LTR A;  4LQU A;  3DQ4 A;  4J88 A;  3LSA A;  2ARL A;  3CBE A;  3SVO A;  2HGY A;  1KYS A;  2YE0 A;  4H3N A;  5H88 A;  2WIQ A;  4XGY A;  1Q4B A;  5HW9 A;  3DPX A;  4W73 A;  3PJ5 A;  4W6D A;  3PJB A;  3SVD A;  1W7S A;  2OGR A;  5BTT A;  3U0N A;  2A56 B;  1ZUX A;  3OSQ A;  4KAG A;  3DQ5 A;  3EKJ A;  4W76 A;  2G6Y A;  3DQU A;  4W6M A;  5HZT A;  4IK5 A;  1HCJ A;  1RMM A;  1XMZ A;  2G16 B;  5EXU A;  2H8Q A;  4ZB1 A;  4EMQ A;  3EK4 A;  4W6I A;  2GX2 A;  2AWK A;  3SVU A;  4PPK A;  2QLH A;  3SG4 A;  3DQF A;  4W6T A;  2Z6Y A;  5EXB A;  3DQC A;  4KW8 A;  1RM9 A;  4KEX A;  1Z1Q A;  4ORN A;  3SG6 A;  5T3I A;  3E5T A;  2H9W A;  4DKN A;  3CFH A;  4KA9 A;  4LJC A;  1H4U A;  1OXF A;  4IZN A;  5DPH A;  5H87 A;  4LJB A;  4W6A A;  4Q7R A;  2POX A;  2WHU A;  2FZU A;  2G6X A;  3LS3 A;  3WLC A;  3E5V A;  4W6O A;  3VIC A;  3DQH A;  4XVP A;  5LTQ A;  2AHA A;  1YHH A;  2HQK A;  3LF3 A;  4JFG A;  5DTX A;  2DUH A;  4W74 A;  5EJU A;  2H6V A;  4HQC A;  3SG2 A;  5AQB B;  4ZBL A;  3I19 A;  4DXP A;  1W7T A;  4Z4K A;  3SVB A;  2QU1 A;  3M24 A;  4P1Q A;  1HUY A;  4JGE A;  2H5Q A;  4OQW A;  4Q9W A;  5F9G A;  1EML A;  1EME A;  4W7E A;  2GW4 B;  4Q7T A;  4ZF4 A;  4W69 A;  3ZUJ A;  3CB9 A;  2YFP A;  3WCK A;  4JF9 A;  3VHT A;  2P4M A;  4W75 A;  2Y0G A;  3SSV A;  5BT0 A;  3EKH A;  3SSH A;  3SG5 A;  3DQ1 A;  2B3Q A;  3GL4 A;  4KPI A;  3WLD A;  4U2V A;  1GGX A;  3CFA A;  2V4E C;  3DQJ A;  1Q4A A;  4W77 A;  4TZA A;  2Z1O A;  4OJ0 A;  1JC1 A;  2A50 B;  2H5O A;  4W7F A;  3TMR A;  4B5Y A;  3SVN A;  3DQM A;  2IB6 A;  5BTT B;  3CD9 A;  1B9C A;  1GFL A;  5DRG A;  2A52 B;  2O24 A;  3A8S A;  4OY4 A;  4H3M A;  2C9I A;  4L12 A;  3TMT A;  1Q4C A;  4LJD C;  2C9J A;  2IB5 A;  3EVV A;  4KF4 A;  2FWQ A;  3CFF A;  3BXB A;  5FHV A;  4JC2 A;  2OJK A;  4UTS A;  1G7K A;  4KGF A;  2VVI A;  4IK3 A;  2OKY A;  5HBD A;  5DQB A;  4N3D A;  4ANJ A;  1MYW A;  1KYP A;  1GL4 A;  1EMK A;  1KP5 A;  4HE4 A;  4W7D A;  3ST3 A;  3RWT A;  1ZGQ A;  2A46 A;  2DD9 A;  3EK7 A;  4GF6 B;  2QLG A;  4JEO A;  3G9A A;  1YFP A;  3EVR A;  3DQI A;  2WHS A;  1EMM A;  2DUE A;  4B30 A;  5LTP A;  3SVC A;  2QLE A;  4R6B A;  3GB3 A;  3SG3 A;  2DUI A;  2OTB A;  5HZS A;  3U0K A;  1QYF A;  2AWL A;  4R6D A;  2OTE A;  1QXT A;  2IE2 A;  3NT3 A;  3SV5 A;  5EBJ A;  3P28 A;  3W1D A;  2HGD A;  2WUR A;  3LVD A;  3SVR A;  4EN1 A;  3VK1 A;  2G2S B;  3E5W A;  3U8P A;  2ZMU A;  1EMB A;  3VHT B;  3NEZ A;  3W1C A;  5BQL A;  4PPJ A;  3SSK A;  2EMN A;  3DQ3 A;  2V4E A;  4KF5 C;  3DQL A;  2VAD A;  4RYW A;  3ST2 A;  1F0B A;  4EDS A;  3CD1 A;  1RMP A;  4GES B;  4AS8 A;  2PXW A;  4XOV A;  1YHI A;  3EVU A;  4LW5 A;  3U0M A;  1EMA A;  2O2B A;  4W6F A;  5DTY A;  2ZO7 A;  3BXC A;  2G3D B;  3DPZ A;  3DQK A;  4L1I A;  2ZMW A;  2IOV A;  3DQE A;  5DU0 A;  3GEX A;  2RH7 A;  4I2Y A;  4ZFS A;  2DDD A;  2QLI A;  4J89 A;  2ICR A;  2Q57 A;  5H89 A;  2A48 A;  5J2O A;  2WSN A;  2EMO A;  4LJD A;  3SSY A;  3P8U A;  2WIS A;  2DD7 A;  2FL1 A;  4W6S A;  3H1R A;  4HQ8 A;  4IK1 A;  2BTJ A;  4W7R A;  3EVP A;  4XOW A;  2HPW A;  2QT2 A;  5DPG A;  1JC0 A;  2HCG A;  2G3O A;  1XA9 A;  3ST4 A;  3BX9 A;  4W7C A;  3SS0 A;  3SVS A;  3OSR A;  3LA1 A;  4HVF A;  3IR8 A;  3KCS A;  4DXQ A;  4Z4M A;  3DQ2 A;  3NT9 A;  3AI4 A;  4XL5 A;  2Q6P A;  5FVF A;  2H5R A;  3O77 A;  3NF0 A;  3IP2 A;  2Z6Z A;  3ADF A;  4ZIO A;  1MOU A;  1Q73 A;  3SST A;  3SSL A;  2G5Z B;  3PIB A;  1OXE A;  2A54 B;  4B30 B;  3H1O A;  3ZUF A;  3DQ8 A;  4DXN A;  3NED A;  1YZW A;  5FVI A;  4J8A A;  3AKO A;  4W6C A;  1Z1P A;  5FVG A;  4Q7U A;  4DXO A;  1RMO A;  1QYO A;  4W6U A;  2G6E A;  3ZTF A;  4OHS A;  2O29 A;  3DQ9 A;  4H47 A;  4EUL A;  1UIS A;  4W6R A;  3DQO A;  5EHU A;  4ZF5 A;  1RRX A;  1XQM A;  2HRS A;  2QZ0 A;  2AWJ A;  2VVJ A;  3DQN A;  3U0L A;  1EMC A;  3UFZ A;  1YJF A;  1C4F A;  3U8C A;  3GJ2 A;  3DPW A;  1ZGO A;  3SSP A;  2GW3 A;  4PPL A;  3O78 A;  5HGE A;  3ST0 A;  3LF4 B;  4GOB A;  4KF5 A;  2V4E B;  1S6Z A;  4JRB A;  4NWS A;  2YE1 A;  1ZGP A;  5DY6 A;  4IK9 A;  1XAE A;  4H3L A;  2GX0 A;  3KCT A;  3DQ7 A;  4Q9X A;  3EK8 A;  3OGO A;  4OGS A;  5DRF A;  4W6N A;  4W7X A;  2AWM A;  5DTZ A;  3DQA A;  3SG7 A;  2VAE A;  1H6R A;  2DUF A;  2OKW A;  3U8A A;  4DKM A;  4W6B A;  5KTG A;  4AR7 A;  1EMG A;  4P76 A;  5HZO A;  2PXS A;  4W7A A;  4KW4 A;  2A53 B;  4W6J A;  1Q4D A;  1BFP A;  3PJ7 A;  2WHT A;  4IK8 A;  3BXA A;  1CV7 A;  4LQT A;  2WSO A;  2JAD A;  4L13 A;  5HZU A;  2QRF A;  5DPI A;  2EMD A;  2DUG A;  3SVE A;  2HQZ A;  3ED8 A;  3MGF A;  2HJO A;  4KGE A;  4W6L A;  5DTL A;  4EDO A;  2DDC A;  2ZO6 A;  1OXD A;  2B3P A;  4PFE A;  4RTC A;  4W72 A;  5EXC I;  4IK4 A;  4DXM A;  1QYQ A;  5LK4 A;  4BDU A;  1QY3 A;  1JBZ A;  4ZIN A;  2A47 A;  3DQ6 A;  1MOV A;  3ZUL A;  2H5P A; 
#chains in the Genus database with same CATH homology
 4ZF3 A;  4DXI A;  3UG0 A;  3LVC A;  3AI5 A;  1YJ2 A;  2Z6X A;  4W6H A;  3V3D A;  1Q4E A;  1JBY A;  4KW9 A;  3LVA A;  1W7U A;  2QLG B;  1KYR A;  4HQ9 A;  3M22 A;  4RYS A;  1EMF A;  3GJ1 A;  5EB7 A;  1XSS A;  4H48 A;  3SRY A;  3S05 A;  2AH8 A;  1YHG A;  3CGL A;  4W6K A;  2VZX A;  3RWA A;  3DQD A;  1F09 A;  5DQM A;  2VVH A;  4W6P A;  4W6G A;  5DPJ A;  3K1K A;  2HFC A;  4TZG A;  5EB6 A;  2YDZ A;  5LTR A;  4LQU A;  3DQ4 A;  4J88 A;  3LSA A;  2ARL A;  3CBE A;  3SVO A;  2HGY A;  1KYS A;  2YE0 A;  4H3N A;  5H88 A;  2WIQ A;  4XGY A;  1Q4B A;  5HW9 A;  3DPX A;  4W73 A;  3PJ5 A;  4W6D A;  3PJB A;  3SVD A;  1W7S A;  2OGR A;  5BTT A;  3U0N A;  2A56 B;  1ZUX A;  3OSQ A;  4KAG A;  3DQ5 A;  3EKJ A;  4W76 A;  2G6Y A;  3DQU A;  4W6M A;  5HZT A;  4IK5 A;  1HCJ A;  1RMM A;  1XMZ A;  2G16 B;  5EXU A;  2H8Q A;  4ZB1 A;  4EMQ A;  3EK4 A;  4W6I A;  2GX2 A;  2AWK A;  3SVU A;  4PPK A;  2QLH A;  3SG4 A;  3DQF A;  4W6T A;  2Z6Y A;  5EXB A;  3DQC A;  4KW8 A;  1RM9 A;  4KEX A;  1Z1Q A;  4ORN A;  3SG6 A;  5T3I A;  3E5T A;  2H9W A;  4DKN A;  3CFH A;  4KA9 A;  4LJC A;  1H4U A;  1OXF A;  4IZN A;  5DPH A;  5H87 A;  4LJB A;  4W6A A;  4Q7R A;  2POX A;  2WHU A;  2FZU A;  2G6X A;  3LS3 A;  3WLC A;  3E5V A;  4W6O A;  3VIC A;  3DQH A;  4XVP A;  5LTQ A;  2AHA A;  1YHH A;  2HQK A;  3LF3 A;  4JFG A;  5DTX A;  2DUH A;  4W74 A;  5EJU A;  2H6V A;  4HQC A;  3SG2 A;  5AQB B;  4ZBL A;  3I19 A;  4DXP A;  1W7T A;  4Z4K A;  3SVB A;  2QU1 A;  3M24 A;  4P1Q A;  1HUY A;  4JGE A;  2H5Q A;  4OQW A;  4Q9W A;  5F9G A;  1EML A;  1EME A;  4W7E A;  2GW4 B;  4Q7T A;  4ZF4 A;  4W69 A;  3ZUJ A;  3CB9 A;  2YFP A;  3WCK A;  4JF9 A;  3VHT A;  2P4M A;  4W75 A;  2Y0G A;  3SSV A;  5BT0 A;  3EKH A;  3SSH A;  3SG5 A;  3DQ1 A;  2B3Q A;  3GL4 A;  4KPI A;  3WLD A;  4U2V A;  1GGX A;  3CFA A;  2V4E C;  3DQJ A;  1Q4A A;  4W77 A;  4TZA A;  2Z1O A;  4OJ0 A;  1JC1 A;  2A50 B;  2H5O A;  4W7F A;  3TMR A;  4B5Y A;  3SVN A;  3DQM A;  2IB6 A;  5BTT B;  3CD9 A;  1B9C A;  1GFL A;  5DRG A;  2A52 B;  2O24 A;  3A8S A;  4OY4 A;  4H3M A;  2C9I A;  4L12 A;  3TMT A;  1Q4C A;  4LJD C;  2C9J A;  2IB5 A;  3EVV A;  4KF4 A;  2FWQ A;  3CFF A;  3BXB A;  5FHV A;  4JC2 A;  2OJK A;  4UTS A;  1G7K A;  4KGF A;  2VVI A;  4IK3 A;  2OKY A;  5HBD A;  5DQB A;  4N3D A;  4ANJ A;  1MYW A;  1KYP A;  1GL4 A;  1EMK A;  1KP5 A;  4HE4 A;  4W7D A;  3ST3 A;  3RWT A;  1ZGQ A;  2A46 A;  2DD9 A;  3EK7 A;  4GF6 B;  2QLG A;  4JEO A;  3G9A A;  1YFP A;  3EVR A;  3DQI A;  2WHS A;  1EMM A;  2DUE A;  4B30 A;  5LTP A;  3SVC A;  2QLE A;  4R6B A;  3GB3 A;  3SG3 A;  2DUI A;  2OTB A;  5HZS A;  3U0K A;  1QYF A;  2AWL A;  4R6D A;  2OTE A;  1QXT A;  2IE2 A;  3NT3 A;  3SV5 A;  5EBJ A;  3P28 A;  3W1D A;  2HGD A;  2WUR A;  3LVD A;  3SVR A;  4EN1 A;  3VK1 A;  2G2S B;  3E5W A;  3U8P A;  2ZMU A;  1EMB A;  3VHT B;  3NEZ A;  3W1C A;  5BQL A;  4PPJ A;  3SSK A;  2EMN A;  3DQ3 A;  2V4E A;  4KF5 C;  3DQL A;  2VAD A;  4RYW A;  3ST2 A;  1F0B A;  4EDS A;  3CD1 A;  1RMP A;  4GES B;  4AS8 A;  2PXW A;  4XOV A;  1YHI A;  3EVU A;  4LW5 A;  3U0M A;  1EMA A;  2O2B A;  4W6F A;  5DTY A;  2ZO7 A;  3BXC A;  2G3D B;  3DPZ A;  3DQK A;  4L1I A;  2ZMW A;  2IOV A;  3DQE A;  5DU0 A;  3GEX A;  2RH7 A;  4I2Y A;  4ZFS A;  2DDD A;  2QLI A;  4J89 A;  2ICR A;  2Q57 A;  5H89 A;  2A48 A;  5J2O A;  2WSN A;  2EMO A;  4LJD A;  3SSY A;  3P8U A;  2WIS A;  2DD7 A;  2FL1 A;  4W6S A;  3H1R A;  4HQ8 A;  4IK1 A;  2BTJ A;  4W7R A;  3EVP A;  4XOW A;  2HPW A;  2QT2 A;  5DPG A;  1JC0 A;  2HCG A;  2G3O A;  1XA9 A;  3ST4 A;  3BX9 A;  4W7C A;  3SS0 A;  3SVS A;  3OSR A;  3LA1 A;  4HVF A;  3IR8 A;  3KCS A;  4DXQ A;  4Z4M A;  3DQ2 A;  3NT9 A;  3AI4 A;  4XL5 A;  2Q6P A;  5FVF A;  2H5R A;  3O77 A;  3NF0 A;  3IP2 A;  2Z6Z A;  3ADF A;  4ZIO A;  1MOU A;  1Q73 A;  3SST A;  3SSL A;  2G5Z B;  3PIB A;  1OXE A;  2A54 B;  4B30 B;  3H1O A;  3ZUF A;  3DQ8 A;  4DXN A;  3NED A;  1YZW A;  5FVI A;  4J8A A;  3AKO A;  4W6C A;  1Z1P A;  5FVG A;  4Q7U A;  4DXO A;  1RMO A;  1QYO A;  4W6U A;  2G6E A;  3ZTF A;  4OHS A;  2O29 A;  3DQ9 A;  4H47 A;  4EUL A;  1UIS A;  4W6R A;  3DQO A;  5EHU A;  4ZF5 A;  1RRX A;  1XQM A;  2HRS A;  2QZ0 A;  2AWJ A;  2VVJ A;  3DQN A;  3U0L A;  1EMC A;  3UFZ A;  1YJF A;  1C4F A;  3U8C A;  3GJ2 A;  3DPW A;  1ZGO A;  3SSP A;  2GW3 A;  4PPL A;  3O78 A;  5HGE A;  3ST0 A;  3LF4 B;  4GOB A;  4KF5 A;  2V4E B;  1S6Z A;  4JRB A;  4NWS A;  2YE1 A;  1ZGP A;  5DY6 A;  4IK9 A;  1XAE A;  4H3L A;  2GX0 A;  3KCT A;  3DQ7 A;  4Q9X A;  3EK8 A;  3OGO A;  4OGS A;  5DRF A;  4W6N A;  4W7X A;  2AWM A;  5DTZ A;  3DQA A;  3SG7 A;  2VAE A;  1H6R A;  2DUF A;  2OKW A;  3U8A A;  4DKM A;  4W6B A;  5KTG A;  4AR7 A;  1EMG A;  4P76 A;  5HZO A;  2PXS A;  4W7A A;  4KW4 A;  2A53 B;  4W6J A;  1Q4D A;  1BFP A;  3PJ7 A;  2WHT A;  4IK8 A;  3BXA A;  1CV7 A;  4LQT A;  2WSO A;  2JAD A;  4L13 A;  5HZU A;  2QRF A;  5DPI A;  2EMD A;  2DUG A;  3SVE A;  2HQZ A;  3ED8 A;  3MGF A;  2HJO A;  4KGE A;  4W6L A;  5DTL A;  4EDO A;  2DDC A;  2ZO6 A;  1OXD A;  2B3P A;  4PFE A;  4RTC A;  4W72 A;  5EXC I;  4IK4 A;  4DXM A;  1QYQ A;  5LK4 A;  4BDU A;  1QY3 A;  1JBZ A;  4ZIN A;  2A47 A;  3DQ6 A;  1MOV A;  3ZUL A;  2H5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...