3LVQE

The crystal structure of asap3 in complex with arf6 in transition state
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
476
structure length
420
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 126
structure length 420
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvqE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvqE04
3F0TA 3EA5A 1R2QA 1MABA 1U90A 1XP8A 2VL7A 2ZJZA 3BORA 3BFKA 1NN3A 2EWVA 1XRJA 3KFXA 1E69A 5EQTA 4DCNA 5A0FA 2NPFA 2FZLA 4MA4A 3DZDA 4AC9A 3KQNA 2ZSBA 1SXJB 1UFQA 3EC1A 4B75A 4LX0A 4DSNA 4QC2A 1F6BA 4WXRA 4LJ6A 3I62A 1FNNA 1NMXA 2WSSA 4DSOA 5IT5A 3TGPA 1G8PA 1U0LA 2IS6A 4LHZA 1ZM7A 4KXFB 3WBKA 3AVTA 4FWIB 2QUZA 5JEDA 3O8DA 3B85A 3SYKA 4FINA 3U4QB 4QGFA 1VPLA 4KFTA 5FR1A 2FNAA 4G3XA 2FE4A 2QTFA 5IK2A 2VP6A 1KY2A 2G77B 4Q00A 1W36D 2IC5A 1XXHE 2Z4RA 1ZBDA 2FPKA 1Q22A 1G64A 3OF5A 3AQ4A 1KI3A 5EE1A 5FTKA 3SC3A 2JJ1A 2JGNA 3Q85A 1OXTA 1OXXK 3K9NA 2ZE8A 3LW7A 2GF9A 4V0ME 3MDBC 1DADA 5J5CA 5JSZB 2PT5A 1BYIA 4H1UA 1P72A 1G3QA 4Q4LA 2ZRGA 2OV2A 1E2HA 3C14C 4BFSA 2YHSA 4YONB 3GEEA 3HU3A 2FU5C 3X1WA 2PMDA 2VHCA 1G8FA 3CBQA 1WF3A 1XTQA 4I99A 3B60A 1ZCAA 3VKHA 3T34A 4NTZA 3AV0B 2PX0A 2IW3A 3L2OB 4DCUA 1Q1BA 5HPYB 4DSUA 1D9ZA 4OK6A 4A8JC 4B76A 1XDBA 2YINC 3R9XA 1EFRA 1E4VA 4TYNA 2WSSD 3WY9A 4B3FX 5DH9A 4RD2A 2GZAA 3RS0A 2WAXA 1Z0JA 4Q66C 5BXQC 1S96A 5KNDA 4KHZA 1E2FA 2CL6X 2IYRA 4LJ9A 5TY0A 4ARZA 3U44B 5AJXA 5JJIA 1P61B 2CCKA 4GFDA 3RNLA 1YHNA 2ODEA 3TSWA 3A6PC 1HTWA 3WNDA 5FR2A 5E3HA 5JEEA 5IK2D 4BUJA 3K0FB 3GJXC 3VMFA 4J0QA 1NY6A 4FCVA 4JT2A 3V4RA 5EXXA 4C3ZA 1TEVA 3QPVA 1YR7A 2JJ1D 4OHZA 2H16A 1U98A 2ZS8A 2XB4A 1XMIA 3IPXA 5KSZA 2W2VA 3TAHA 2OILA 4QRHA 3R7WA 3U3OA 1J8MF 2G88A 5FFMA 4JL8A 4C9BA 1NY5A 4PO8A 4QHSA 4JSTA 1FX0A 4PQYA 1E9RA 5SZHB 4B2PA 5EP4A 3MFYA 1EXMA 3TR0A 1S9HA 2WKPA 3LFUA 4KJZA 2IXGA 4QJ4A 2IWRA 2WJYA 2QRZA 2YWHA 3ZGXA 4B71A 2GJKA 1GNRA 1QRAA 1QF9A 5EZ6B 5AJVB 4I81A 4ILEA 3W5IA 1CRQA 1EFRD 1YJ5A 1OFUX 4YC7A 1HQYE 2JLSA 3K0CC 4IKEA 4Q4HA 2F9LA 4QL3A 1NIJA 2ZSDA 3BWDD 1ZM4A 3ETLA 4B3XA 3NDBB 1T5IA 3S1AB 3I92A 2PT7A 4NYIR 3UMRA 3GLFE 4ESVA 2WTUA 2C95A 1NF3A 2ONJA 3UIEA 2AXPA 2PLFA 1XZPA 3QEOA 2QSYA 4BFVA 1FPMA 2BHRA 1YZTA 3QF4A 2YWFA 5IDVA 3LLMA 1KSGA 4R9UC 4D2IA 2WWIA 1DAIA 4OK3A 2A2ZA 2N42A 2ERYA 4IVPA 4UNSA 4E03A 2WJHA 2ZI9A 2QZ4A 4MKIA 3ZZ0A 4F1PA 1KOFA 2QNRA 2QP4A 5FOUA 1EWQA 1N6NA 3LX8A 4PR0A 3T5DA 1LV7A 4LHVA 5AJZA 4V0KA 4DDVA 1X1SA 1UDXA 1X3SA 4B74A 2GJAA 4X8MA 4OQNA 4QFMA 3E1SA 2G9NA 2JLWA 4OHWA 4D25A 2ZI5A 1Q57A 1OH7A 1KNXA 5B30A 2F1IA 3SJZA 1Z0IA 1ZNWA 1NMYA 2D2FA 3Q5EA 4RCZA 1R6BX 2CHQA 2CLDX 3HR7A 2V8OA 4EPTA 4MRVA 1R5OA 4C4PA 4ON9A 1OT3A 2J7PA 2QT0A 4PXAA 2ZRFA 1CLUA 5K8TA 4DUGA 2YOHA 4XVUA 3CKLA 1IN6A 3NC0C 3UMSA 3B9QA 3QBVA 3SHFA 1Z6GA 3CH5A 1VIAA 1OF1A 3QG5A 1MOZA 2VP2A 2FZ4A 2ORWA 2C2HA 3EIEA 1NI3A 1E3MA 4TQUS 2IYUA 3D8BA 3PJRA 3ICQB 1AS0A 2ZRPA 1W2HA 3AKYA 1KJWA 5C4GB 4KSCA 1JAHA 3BH7A 3CRW1 2PH1A 1EFCA 4DEYA 2R6FA 1SVSA 1VYTA 2GK6A 4QBIA 3H0KA 5E7MA 2ZSAA 4MRRA 2CHVA 3U4QA 3HU2A 5AR1A 2ZRAA 1IONA 3DO6A 4TQAA 4ITRC 3QE0A 3QG1A 3U60B 1XBTA 4JMPA 2CDNA 4NHOA 2F3RA 1QHHB 4JYCA 1XJCA 3GFPA 3CX7A 1NBME 2CCJA 3TE6A 3CPHA 4JBXA 3JZAA 1KSFX 2OCYC 1UDWA 5KHOC 1C4OA 1VG1A 4PTLA 1JR3E 3SI7A 3RRZA 4URVR 5JSZA 1I2DA 5FPYA 2J7PD 3W6PA 5BYJA 3FB4A 4DUGD 1SVWA 2GESA 1G291 1G1MA 2ZS9A 4Y0AA 2OO7A 2DFLA 4JLKA 4B3DA 3CF6R 1GDDA 3AUYA 1E2PA 1J8YF 1ZNZA 1NLFA 2FPMA 4G01B 4U7DA 1E0AA 2R2AA 1H8EA 2VSFA 1XEWY 2F1JA 1TNDA 1A7JA 4TN1A 1YRBA 4DKXA 4CEIB 5JECA 2YYZA 2VHQA 2QENA 3EXAA 3LAWA 3VAAA 5AUQA 3KQHA 5EE0A 3LV8A 1XTKA 3MMPA 3WNCA 2C77A 2GA8A 1CJMA 4MUBA 5KYKA 2QPTA 4UKDA 3PEWA 3FMFA 1FZQA 1ZVQA 2E9SA 3U44A 3ZQJA 2REOA 2V4ZA 4P3YA 2ODBA 2ZRLA 3BS4A 3CRRA 3DHWC 1A2KC 3SZRA 4C7OB 3PEVA 4QOSA 2ZYUX 5AJWA 3K0FA 4XH9B 2QT1A 2VHTA 1PLJA 3KKNA 3TVDA 2MSEB 2QAGB 1N5LA 3A1TA 1ZM3A 4WBSA 4BRWA 5C18A 4LYAA 5H70A 4I4LA 4EPRA 5TVKA 3LRPA 5LD2B 5G41A 2HCBA 2J0SA 3SJAA 1CJUC 3X1ZA 4AD8A 3GCGA 1I4TD 2RGGA 4PO1A 1G7CA 1N0VC 1CR1A 3NBZC 4JVNA 4B34A 2GZDA 4MDFA 2JAQA 3LX5A 1D2NA 1NVXQ 2XNSA 4M1KA 4CGZA 2BM0A 2IYTA 1FW6A 3WYAA 4PZYA 1SVMA 4QGAA 4B6FA 3FMPB 4M1YA 1H8ED 4XVQA 1HQCA 4HLQB 3AKEA 2IHBA 4DBLC 3AH8A 1QVAA 2AL7A 2W58A 3GJ7A 3ND8A 1ZINA 4YLGA 2V1UA 4LYHA 4LC1A 4Z1MA 4FCTA 4A9AA 4ZDKA 1KY3A 2IA5A 1Z08A 2JLXA 2IUSA 3G5UA 2ZE5A 4FW9A 1P73A 4EJSC 2IYQA 1J90A 3FMIA 4TTQA 2QP9X 3S1AA 3VX4A 2RHMA 3F5FA 2A5YB 1GRQA 4Q4AB 5EXTA 3QKTA 821PA 4BEJA 2VBCA 1ESNA 3CWQA 1F2TB 5FBVB 3FHCB 3K0SA 1KJYA 4TWZA 4BLSA 4ACAA 2ZANA 3EWAA 2JATA 4UNRA 1E2JA 2R6DA 5FUYA 4E5UA 1IJEA 3W6OA 3RHFA 1RKBA 2WWHA 2FSHA 1PV4A 1DO0A 4KVAA 4B35A 4QM6A 3DM5A 3N70A 3IO3A 1YU9A 4M1TA 1W44A 3FEHA 1GVNB 3A36A 1XFAA 3T06B 4JKIA 4QJ3A 5L3SB 1YVDA 3FGNA 3IEUA 4PQFA 3KJIA 4Z8XA 4G5SA 4M53A 1G7RA 4RD3A 3BIFA 1OB2A 3SEAA 4OYHA 4DB4A 3ZD7A 3DMNA 4Z1MD 1GFIA 4US1R 2OXCA 1DTSA 3ZZTA 4DJTA 3CRQA 4NPHA 4G5OA 1QZXA 2CRWA 4GNKA 2C04A 5DYGA 3RYTC 1VIYA 3THYB 1KI2A 4Q21A 1VHTA 1M7BA 2REXB 3SDZA 1E2QA 4LJ7A 5CB6A 1KZ7B 5FPTA 4AYXA 3SS8A 4BGDA 2CLSA 2FOLA 2WWFA 3HPRA 4OI4A 3LJUX 1VTKA 2HUPA 2OBNA 1FOEB 4XD7A 1F3OA 1N5JA 4C2TA 3LLUA 3OE7A 2DCUA 4RZUA 1X1RA 4UQOA 2P6RA 4RSGA 4TZ0A 3SU8A 2C98A 2WWWA 4JBWA 4B3BA 2CNWA 1L4YA 1C1YA 1Z6TA 3LDAA 3QQ5A 4DDTA 1MR3F 3UMFA 2F1HA 5B58C 2CBZA 4MGKR 1UBCA 3VHLB 1T91A 1TQ4A 4NCHA 3UXMA 3NIBA 1HUQA 4G5GA 1QHHA 2PL3A 1X8JA 4GI7A 4MYTA 1NIPA 4TLEA 1P75A 2NIPA 4XIGS 1WXQA 1P62B 1VYVA 2NOAA 5F9HA 1G5TA 3GLIE 4KFUA 1FTSA 2ORIA 4ASUA 3CX6A 2LKDA 1EK0A 4MGZR 1DAKA 4DXAA 3K8YA 1XTSA 1M1YE 3SFZA 2GVZC 2HF8A 4YDHB 3WNBA 1T0HB 1W48A 2RB4A 2QPOA 5EE9A 2P5TB 4Q1CA 3T1VA 1XXHB 3MGCA 4JLMA 4UJ3A 4HUTA 4XD7D 5F98A 1AKYA 2VTKA 3A4LA 5D3QA 4O0MA 3OE7D 1XCGB 2ONKA 2Z83A 4NYIQ 2O8DB 2B92A 4Q7MB 2B8TA 4I1VA 1HV8A 3B1WA 1RFLA 2CNWD 1Q44A 2G3YA 1NL3A 2BBTA 4LJ4A 1FUKA 5LB2A 1VCMA 3CW2A 3RS5A 3VQTA 4BFUA 1P7CA 1D8TA 1JR6A 1Q3HA 4HZUA 4C7OA 1E94E 4M9ZA 4OL0A 1P2UA 4JSYA 3PUYA 3EA0A 2QAGA 6Q21A 4DHEA 4DWJA 5GVSA 3H86A 3NC1C 5FUXA 1D6JA 1UKZA 2NZ8A 4ZO4A 1W36C 4AKEA 2QROA 4Q47A 5CJ2A 4KO8A 3BOSA 2XNDA 4ASUD 2QM8A 2G1KA 3QKUA 4LHXA 5D3MB 2ODWA 5FBQB 3RS7A 3C4JA 3AVVA 3TKLA 1WCV1 3W8RA 4WVFA 1TF5A 4F92B 4A15A 3EIQA 4QXAA 2ZE6A 1EGAA 1WBDA 2QQ0A 3WXMA 1J99A 2W6JA 1IXSB 3TNFA 1G8HA 3NKVA 3W3ZB 4BRUA 4AKIA 4M9XA 5FOTA 3FDIA 4KYUA 1MO3A 1OIWA 1XF9A 1UM8A 4IFEA 1R0XA 4MITA 1S3SA 1BKDR 3F8TA 3ZZUA 1DARA 1U0JA 4Q4AA 2RGDA 3TW4A 2GCOB 2UKDA 3WBJA 2ZRDA 1UJ2A 2IXEA 1KMHB 4MGIR 4WW0A 4PANA 1F2TA 2RGBA 4AKGA 1A5TA 1KDPA 1YZLA 1U9IA 4Q1DA 4TYQA 3EIHA 5TB5A 1PUJA 2RGXA 4HEJA 5E4FA 2GJ8A 4DLUA 1SVIA 4RKFA 1NKSA 2KWIA 2QE7A 4HDOB 2XNDD 2VP5A 2F7SA 1S4QA 4ESHA 3NBXX 1AN0A 1X6VA 4RZ3A 4ZPXA 1N2CE 3A1UA 5FTLA 1IY2A 2IQJA 4MDEA 1NG9A 1DO2A 2HJVA 5L3SA 4QJ5A 3GLFB 2W6JD 5P21A 4EUNA 3AM1A 3CH4B 1EG7A 2BCJQ 3ZVMA 1T0JB 2C9YA 2VO1A 3P4XA 3N2EA 2JLYA 3B2EA 521PA 3L8YA 4IVRA 1Q20A 1Z83A 3C5CA 5CLLA 4A4DA 3VKGA 1Z2CA 3O8BA 4BEBA 1GZSA 5CDFE 2OLKA 4CYMA 3TIFA 3THYA 1CRPA 2CEAA 2V9PA 2VP0A 1G18A 3EG5A 3TAUA 3KB1A 1FP7A 1CR0A 1CKEA 1PLLA 4HAXA 3QVVA 1J2JA 4IHQA 1OKKA 3ZVLA 1P2VA 3GP8A 1VCOA 1OB5A 1T9HA 1LW7A 4FMDB 1Z6XA 3T12A 4F93B 5KU1A 1J7KA 4L9WA 1RC8A 1E9CA 5CYPA 1ZYUA 1OIXA 1PLKA 2ZYWX 2ZSEA 3E5HA 4MRPA 4P33A 3WHKA 3B13B 2O5VA 4PC3A 4A36A 2HCJB 4CF7A 4C0BA 2J87A 3KTAB 3ZD6A 1JECA 4NYJQ 4OQMA 4JLDA 4ZIRA 2FFAA 3W5JA 4PHHA 1FTNA 2C96A 2H7VA 3HPQA 2JIZA 3EZ7A 2FGJA 1DBSA 1GL9B 3WHLA 2OCBA 2YWGA 3ASZA 1UKYA 1S0UA 1ZUIA 1MO5A 2CL0X 2ZJ5A 1DS6A 1SQ5A 4RD1A 2AWNA 2IWHA 1JXMA 1W0KA 1ZD1A 2ZYVX 1VHLA 5B57C 1KI1A 2DWPA 4AY2A 1JXOA 1NVVR 4MH0R 4TMTA 1OH5A 2J0VA 3P4YA 1RYFA 1E99A 2BKEA 4LOAA 4BZPA 3RS4A 5JJKA 1MRNA 1G7TA 2FX3A 1VCIA 2YOFA 1IXZA 1QVRA 2VQSA 4PZZA 3W9YA 1HEIA 3FM8C 1OKKD 3GJ6A 1XXHA 3KL4A 4GBMA 1UPTA 4JT4A 2ZUCA 3HYRA 1Q12A 1YR9A 2NPIA 3TUJC 2WJVA 1DELA 1HYQA 4E09A 1HH4A 1QG4A 4MKFA 621PA 1NN5A 3EPLA 1TEXA 1N6LA 2GZHA 3K9LA 4RD6A 3RS2A 3ZH9B 2ZR0A 3IBYA 2AHOA 2IXFA 2OUKA 4Q1EA 4NDZA 2JLZA 1ODFA 2BKUA 3ECCA 5J4VA 1GUAA 3KKQA 2XXAB 1R5BA 2CJWB 4A2PA 1GWNA 4C0JA 1II8B 1GG2A 2GBLA 4L5BA 4LJAA 3OFNA 5JFGA 1OFTA 2DFTA 1N6PA 1GNPA 1X8LA 2JIZD 4LV6A 4FWTA 3OEEA 2EFGA 1IBRA 2XTMA 4JLPA 2GJ9A 2P65A 2IYZA 4Q1FA 1RE0A 3BB3A 2QN6A 3HYTA 4YMSA 1GIAA 4KBGA 1XJ0A 3BK7A 4NMMA 5D3MA 3DMDA 1W0KD 1COWA 4OKSA 2ZEJA 3KXLA 1CU1A 4II7A 3EPKA 1E9SA 2ZUBA 1QDEA 1UF9A 2WM9B 2ZJOA 1OIVA 3U7GA 4EFMA 3AVXA 3BH6A 2AD1A 3DM9B 2V54A 2PCJA 4R7ZA 2PEYA 3BFXA 1CBUA 4YMWA 5GJBA 2ZJBA 1HURA 2WVJA 3SBEA 3JZMA 1G4UR 3IPYA 1DVRA 3T35A 3GLGA 4PHTA 1T6NA 5F2EA 3RDPA 3LD9A 3RANA 1G8GA 2ZRIA 3GJ3A 2D62A 2A30A 5SZJA 5GJCA 1G4AE 1PUIA 2GILA 3R9IA 2JJ8A 1FFHA 3OFND 4HB4A 3QKRA 1ZCBA 5HE9A 5L8VA 4LDJA 2GCOA 4F4JA 2AFHE 1KKMA 2D4HA 5SZKB 1KMHA 3TSZA 2YV5A 3AVYA 3OEED 1US8B 1JJVA 1UBEA 2CLCX 1G41A 1OJLA 2ODNA 1FMLA 1W7AA 2XEXA 3L0IB 2C5LA 1CXZA 1TQDA 1NLYA 3NTUA 4A6PA 2IYWA 4RZXA 3RAPR 1ETUA 4XTCS 5DSZA 1COWD 4NE2A 1G5PA 1N6HA 4PPGA 5FBRB 4DRZA 4KLNA 4TYYA 2RCNA 3CPJB 4L8GA 1SHZA 1AQUA 4MYUA 1DE0A 4X8HA 2WMNB 3D31A 1YZKA 3ADDA 1G5RA 2ZRKA 1LVGA 3FKQA 4D4KA 3QKSB 3GLFA 3QUSA 3CRVA 4PAMA 3T1TA 2F3TA 2PEZA 1U8YA 4Q18A 3UK6A 5AUPB 3P27A 1BOFA 4DLWA 4F4CA 1P9NA 4UNQA 1ZIPA 1G6HA 4QHTA 2O0HA 3AEZA 2UZ3A 4XWOA 1SZPA 2RH5A 3TRFA 3R9WA 3THWB 1U99A 1R5NA 2LWIA 2GEVA 5J47A 1Q0UA 4IXMA 3EWSA 3B1VA 5UKDA 5JMTA 3ADKA 4RJLA 2HYIC 4JL5A 2AFIE 5FUWA 5A5GA 3M0EA 4FMCF 3B8HA 1WA5A 3AF1A 1EX6A 4US2R 5TV2A 2QQEA 1R0WA 3UWOA 2ZM5A 4JLJA 5H68A 4DLXA 1IM2A 3AKCA 3DKVA 5FL7A 2IS2A 3U2QA 3CWZA 2B21A 2BWJA 1SGWA 4PC7A 1P6XA 3VR4A 5DISB 5FPSA 3W8NA 3OEHA 2GXUA 4IEEA 1MT0A 3KTAA 4M9QA 1DOAA 3LNCA 2ZRBA 1FUUA 3I72A 1HT1E 4OBEA 1KMQA 4Q19A 5G3YA 5FBLB 2XZPA 4CVNA 2NTYC 3UKDA 3QENA 3HDTA 4NCIA 3GFOA 4ZI3A 3IIKA 5KSPA 2OT3B 1A82A 5LBIA 4CT5A 5HZKA 2KB0A 4TL6A 5DGXA 1QHYA 5J4HA 3LBIA 2X1VA 4IVQA 1W5TA 2VLIA 4Q4JB 4WXPA 3LVRE 3ZVRA 1XD2B 4QM7A 1W4RA 4YXWA 2F1RA 3SUBA 1SXJA 1WMSA 2H92A 4LJ5A 4HDCA 5CM9C 1KI8A 3T5GA 1FQJA 2GCNA 4M21A 4M4SA 3PV0A 3CRMA 3AUXA 4FMDF 2R9VA 2O8FB 3BXZA 1II0A 4DCVA 3SR0A 1JQJC 4S35A 3V4FA 4ZDWA 3VR5A 4EFLA 5JI2E 1KNQA 2KI5A 1KGDA 4QGGA 1OW3B 1NBMA 3VR3A 3GLHE 1JEEA 1HA3A 2ZETA 2OWAA 3QXXA 3AVPA 1N6KA 1XX6A 2HF9A 3D7MA 1CEEA 4MYHA 2TMKA 3KZ1E 2NGRA 2ZJAA 5FL7D 1UEJA 5EUMA 1JR3A 2QRNA 1M74A 1JI0A 4EIWA 3GLIB 3OEHD 2GAOA 1W46A 1Q1ZA 1TF7A 5KOYA 1XPOA 3T1QA 2XXAA 1XCMA 1AJEA 2CJWA 2WZQA 2GDJA 1N25A 2JLUA 3IDQA 2RGEA 2WWGA 2R44A 4AYWA 1B0UA 1OYYA 3QEJA 4P31A 2A5GA 2HDNB 1F5NA 5HKKA 1LNZA 4B3GA 4Q7KA 4O2RA 5F9FA 1TPZA 4PSVA 3K70B 1D9XA 2Q3FA 2XOKA 1E2IA 1W49A 4HB3A 3N2IA 1G3MA 4NU0A 4D82A 4HZIA 3Q72A 4RKEA 3QF7A 4JL6A 1TU4A 1MV5A 1ZM2A 4YXWD 2FSFA 1SXJD 4KAXA 1WB9A 4AI6A 1Z28A 3H2YA 4N3NA 5JWRA 2QA5A 3KQKA 3H84A 5FOXA 2UVQA 4HLCA 3OIWA 4TL7A 4TLDA 3PFIA 1AM4D 5CJPA 3I5XA 3I3SR 1ZC4A 2ZRJA 5FI0B 1RRPA 2IF0A 2XSZA 1FP6A 4GOKA 2AK2A 2D7CA 2ZTSA 2ORVA 4QKQA 3QBTA 2E87A 3K0AB 2HEIA 4QFVA 2EFHB 2GETA 1NBMD 2GXAA 4CEHB 2Q6TA 1NN1A 4R2IA 2IUUA 3WP1B 3W6NA 5EUQB 3TH5A 2ZQ5A 8OHMA 2CCGA 1JR3D 4JJZA 1M34E 1QHIA 4QBHA 5DN6A 1MKYA 5J4KA 4UJ5A 1XTRA 2N46A 3U6BA 3QPWA 3BGWA 4B48A 1T8UA 5HCNA 3EC2A 1Z6AA 1N3BA 2IHYA 3FVQA 4IDNA 5HKKD 4P0TA 4HLDA 2OAP1 4IDHA 2BMDA 1G21E 5CK5A 1W5SA 2XOKD 2J7KA 3WYFA 1QBKC 2DPXA 1US8A 4FIDA 4GSYA 1UEIA 4S2EA 2CE2X 1BMFA 3FTQA 1ZNYA 4DLTA 2VSOA 4KU4A 2DB3A 2ZXUA 5GJVC 5HTKA 4JVMA 1NKTA 4TSFA 2GEDA 4OHXA 1GILA 1UBGA 2OFWA 4FI3C 2ECKA 4H1VA 2JLQA 5TXGA 5KSYA 3ICEA 2A9KA 1WQ1R 4JYBA 1KI4A 1JPNA 2XSZD 1FNMA 3P32A 5JBQA 1ZW6A 1IJFA 3IHLA 2QGZA 1ZC3A 2HXSA 3B1XA 4TT3A 2KJQA 4L15A 4KODA 4DT1B 4KFRA 3U6KA 1KTVA 1CS4C 4PHFA 5FTMA 1NVVQ 2W0SA 4CIDA 4OHVA 3A37A 2FPLA 5B2ZA 3KQUA 5L3QB 3PR1A 1BS1A 1U8ZA 3KXKA 3SNHA 3B7GA 3ONWA 1JEDA 5JRJA 2FG5A 1XMVA 2QL6A 1YR8A 1XEWX 2EFEB 4TTRA 5IRCD 2D74A 2FV8A 1I4DD 1W47A 2V7QA 5C46F 2E1RA 1OXUA 4IOMA 3FHOA 3NBFA 4LI0A 3THWA 1KAOA 4JS0A 3KDSE 1G8YA 1BYUA 3TK1A 1FQKA 3I32A 3DDCA 4P32A 4AK9A 3QSYA 1X86B 2GAAA 2C9CA 2C99A 4LCBA 2PCLA 4LBWA 1BMFD 2QMOA 2HT1A 4Q1AA 1JALA 1TUEA 2QAGC 2V55B 3TQCA 3D6TB 2F43B 2IEZA 1ZUHA 1YZUA 4TSFD 3NWJA 4PFSA 4GL2A 2NO0A 3RLFA 5KDDA 5LD2C 4GP7A 1V43A 2R6AA 4D0NA 1Z0DA 2ASEA 2BCGY 2FEOA 4GMDA 2IYVA 4PPNA 3RRNA 1L8QA 3PENA 1SKYE 4D4JA 1AA9A 4TT3D 1IQPA 121PA 2QMHA 3WMEA 1GKUB 5KPDA 2NO6A 2CXXA 1G19A 5BWMA 5M04A 3WYGA 3DL0A 4RFSB 1GOTA 3QNUA 2XX3A 3OIUA 4Q4JA 3VHXA 4BLTA 4PPQA 2V3CC 3J81k 3BFVA 4F38A 4IOKA 1ZRHA 5A4JA 3Q8XB 1P3JA 2V7QD 2BMFA 3BB4A 1N6RA 2WMOB 3PIRA 2IF2A 4ZV4A 2WIAA 4CZ2A 2XZLA 2JJ2A 3CF2A 2O8FA 2F9MA 3Q3JB 2WSMA 1NSTA 1L2TA 2ZVPX 4AG6A 3SN6A 3MG9A 4P4SB 2H5EA 4G0NA 1XEXB 4I1UA 1P60A 3SQWA 3LQRA 1U9IC 1ZU5A 1GTVA 4BFZA 221PA 3FKSA 4YQFA 3L82B 2DFKB 2VP4A 4L16A 2G6BA 1AIPA 4NP6A 1TX4B 3GLIA 1E2MA 1LY1A 2YWEA 3FOZA 1E0SA 3BD9A 2J0UB 5EJEA 2O0KA 4Z51A 2IYSA 1W36B 5LPNA 1QHXA 3EZ2A 3EAQA 1U8AA 1LF0A 3Q5DA 1M7GA 1XWIA 5EZ5A 1ONBA 5DO9A 1R4AA 3I8SA 2BEKA 4CW7A 3PUVA 5FTNA 2XTNA 2BBSA 3W34A 1BO6A 2W83A 4B2IA 4C0SA 3AGPA 3GD7A 3ADCA 1IN7A 3NVAA 3GJ8A 3BJIC 3RC8A 2YC4C 3NH6A 4URWR 1I2MA 3QIAA 2Z43A 2PLRA 5GJWC 4CEIA 3LH5A 2EYQA 3DKPA 2JJ2D 4L4UA 2IX3A 4K81B 3CUEF 3B1YA 1QHSA 2AWOA 1CR4A 4HLUA 2QBYB 1Z3IX 2RHDA 3OIYA 3MJHA 2C03A 2WIBA 1MO6A 1SKQA 3GJ5A 1P9RA 1AGRA 4A82A 2X2FA 3AF2A 4JKYA 2HXYA 3E70C 4CEHA 3P1JA 1G3RA 4JLAA 3FKSD 3GJ4A 2WBLC 3KB2A 2X19A 1Z0AA 4BLPA 1GKIA 2F6RA 2HV8A 2Q3MA 3NEYA 4LJ8A 1CF4A 1N5KA 3DOEA 4UNPA 1C9KA 3MAAC 3MRSA 4RD4A 5B64A 4RFVA 4HAUA 2B7BA 4MRNA 1NVUQ 1SULA 3Q7PA 4PHGA 2PMKA 5CLQA 3K70D 1OHHA 3P20A 5BN5A 1DAMA 3PEUA 3LA6A 5EP1A 2GWHA 2A3RA 3PEYA 2AN9A 2BMEA 4F4IA 1U0HC 2QPAA 4LYFA 1AGPA 2XJ4A 2ZPTX 3MCAA 2JLRA 3RABA 1X8KA 2PBRA 1KO7A 3QI2A 4NYMR 3ZYCA 3QXHA 3CPEA 5BYKA 1AS3A 2C78A 4BFWA 2WJJA 4LHYA 4M22A 3TJZA 3BE4A 3UWKA 2ZROA 1TTTA 4JJKA 3OESA 2EWWA 2QGNA 4DT1A 4C0QC 1E1RD 5J4YA 1OPXA 2AK3A 5DHFA 2O8CB 2J46A 1TU3A 1JQLB 1KI6B 1ZP6A 2AXNA 1E9EA 4QNRA 4NH0A 1AZSC 2YZ2A 4ABYA 2XITA 1KHTA 4LYJA 1E79A 1E0KA 1L4UA 3RWOA 1M2OB 2GXSA 2RMKA 4EQ6B 3LQQA 1S2MA 2EU8A 1Y63A 2IYLD 2D7DA 1G9XA 1VCNA 4FMCB 2GBLC 4DZZA 5DLQC 3GEIA 4DDUA 1OHHD 4XSHA 5BN3A 1KK3A 2VHJA 2GTPA 1RPZA 3ZLJA 3R20A 4YMVA 5AUOB 4FCWA 4PQRA 4M8NE 3R7WB 2WJIA 4TZ6A 1E2GA 4PSKA 2F43A 3ASYA 1M8PA 3D3QA 3RWMB 2J45A 3HWSA 3A1SA 4MRSA 3K09A 1JPJA 4ZKEA 1WRBA 3NXSA 1ZNXA 1Z0KA 4YMUA 4Q03A 3MWJA 5CYOA 5CDFA 2VP9A 5JWHA 1GM5A 4IOJA 2W6IA 3AP1A 2OEPA 3SJCA 4QHYA 2EQBA 1OE0A 1M6NA 2O52A 3F3YA 3SFVA 3KQLA 3IQXA 1D5CA 4DLSA 4RFSA 5DI3B 4NBSA 4JZKA 4PC2A 1ANKA 4HYYA 1UBFA 2R6CA 3KXIA 4IDQA 2EVWX 3Q9LA 2D3WA 3SE0A 4Z8YA 3IEVA 2ZYTX 3A8TA 4TQ9A 3OZXA 4PC6A 1Q1QA 1E79D 5CIQA 2NQ2C 2OG2A 3I4LA 4O25A 4WAUA 4BZXA 3M6AA 5ELXA 1W2GA 4G5RA 4A6XA 4OI0A 4RD0A 3C7KA 1JAIA 1Z8FA 2FGKA 1UKVY 4BASA 3LBHA 4C0AC 4P4SA 5AWFC 1XEXA 4JBYA 3CZQA 4W7SA 4B47A 3QPUA 4UNNA 4U5XA 4OI1A 2PZEA 2P57A 4LBVA 5H8WA 4Q7LA 3AKDA 2WWYA 2O8EB 3REFA 1ZUNB 3CZPA 3CONA 2J0UA 4V03A 1V5WA 4GRAA 1JB1A 2HYDA 4HAWA 4D4MA 4PSAA 2W6ID 4Q48A 2ZITA 5DHAA 1S9DA 2MMGA 2W2XA 2BJVA 3CR7A 2KBFA 3RS3A 1U81A 5L3VA 3L0SA 5DNYB 4GOXA 1FMJA 4FD2A 2XAUA 5EP3A 4E07A 3IIMA 1XCPA 4A8JB 1VG8A 4W5JA 2OESA 1LTQA 1W4AA 3GLHB 1GRRA 4U02A 2P2LA 4LJYA 1GITA 1WBBA 3KJEA 4DIDA 2LCFA 4M9SA 2BC9A 5BW8A 2KSQA 4A0HA 1E32A 2YJTD 2I4IA 3LVQE 2Z0MA 5F3WB 1DAEA 5KSOA 4Q9KA 3EZ6A 2O8DA 1PJRA 4V0MA 1ZU4A 4Q9HA 1E2LA 3WRXC 1AZTA 3FFAA 4DLRA 4OQXA 1SVOA 2QBYA 4MUAA 4B44A 3UG7A 1KKLA 3JVUA 3T9KA 2ZJ2A 4KITB 1P2SA 4A2QA 3IUYA 3PUWA 4HAVA 3THXB 4HAZA 3N5CA 2H18A 1Y3AA 1NMZA 2BMJA 1DG3A 1TF2A 2A5JA 4A92A 3NH9A 3GPLA 1DEKA 1N0UA 2QG6A 4GZLA 1UKEA 2DY1A 4ZI2A 4HB0A 2VRWA 3MWKA 5TARA 4DLYA 2W0MA 3C8UA 2Z6VA 1VG9B 2W2TA 1KYIA 1AKEA 4D0GA 1XPRA 4B32A 5DYIA 1OFHA 5KUTA 1R8QA 1XD9A 3SBDA 4C30A 4AYTA 4M1OA 2QU8A 4M1MA 5FOVA 4URXR 2P3SA 1G3IA 3EPJA 3EARA 4RY2A 3R8CA 4LUCA 3I61A 2R65A 4D26A 1O3YA 1GSIA 1SXJC 1W1WA 1OXVA 3ZJYA 1Z6YA 4P4TA 2BM1A 2VPPA 2ANBA 3RRYA 3VFDA 4D6PA 4C0LA 2YKGA 4RCYA 1T5LA 1CR2A 1R10A 2ZREA 2BV3A 2J59A 2VEDA 3K53A 4NKRA 4IXNA 3CNOA 1D2EA 2FA9A 1G16A 2ZRMA 4R2HA 2FFQA 5H1YA 2FJUA 4Q9IA 2RGNA 3TLXA 2IL1A 2Q9AA 2G1JA 3CF0A 2DFNA 2O8CA 2CL7X 2EYUA 1XMSA 4WOPA 1KO5A 2Z4SA 3UPUA 2PJRA 1KI6A 1PZNA 2JCSA 4ACBA 2ZJYA 4CT4B 2G0TA 4ZCMA 5CIWA 3BAFA 3VNVA 2R8RA 1QG2A 3MJRA 3X1DA 1EFTA 2CHGA 4F7WA 3DOFA 1S1CA 4GZMA 3AVWA 1R7RA 4EQ6A 4UXJA 5EXSA 3C15C 5E95A 3RRMA 2CK3A 3GLGE 4URZR 4K8OA 2OCAA 4LC0A 4ZDJA 3CR8A 4KLZA 5FTJA 4BFTA 5JS8A 2VYFA 5LDDC 2FFBA 1H65A 2OXRA 3BH0A 4XTRA 4NCNA 2IYYA 2NO9A 4OHYA 1KO8A 3WMFA 1Z06A 1RJ9B 2BBOA 1KJZA 4IW3B 2FMXA 1CJVC 3KFVA 4AURA 4M1WA 2NZJA 3TW8B 3OAAA 4OJQA 3A4NA 3CIOA 3QOFA 4OQFA 2H1LA 4LHWA 3LW8A 3T61A 3DWDA 2X77A 4TL8A 4U00A 2VF7A 3U5ZB 2O0JA 2X2EA 3EZ9A 1YZQA 4V0LA 2NMVA 1KK0A 5AJYA 3FYHA 1N6OA 2GRJA 1ZIOA 1XPUA 1S8FA 4K46A 5SZIA 1E9AA 2OSBA 1KSJA 4JLVA 2RKOA 2ZI3A 3M4YA 5DI3A 3WRYC 4AIIA 1LS1A 3UANA 1G20E 3GMTA 4B3CA 1W4BA 2IBMA 3ZS9A 3W3AA 2YOGA 3B6EA 1OSNA 1KDOA 1IN4A 5FUVA 1W4CA 3BBPA 3TBKA 4M1SA 1G7SA 4DSTA 3EPHA 3K0EA 4LWZA 1SKYB 4F91B 1Q1EA 1VKJA 2CK3D 3V00A 1XTJA 3FWYA 4OI2A 1RRFA 3R8FA 4A0RA 1AK2A 2H17A 1CULC 1CTQA 1LF5A 3GEHA 4Q9JA 1MH1A 2AR7A 5JRZA 5G53C 2GF0A 2ZI7A 5EXPA 2O8EA 3IQWA 1ESMA 3OAAD 5KDOA 3MWLA 1KI7A 3I8XA 1B23P 3T15A 4DLZA 1BIFA 2GNOA 4C0HA 4O3MA 3MSXA 2PJZA 3VU9B 2WKQA 5IF9A 3LBNA 3FMOB 4KVGA 3REGA 3AP2A 3FFBA 4DLVA 2VA8A 4NYMQ 4A8JA 5FI1B 4A2WA 4R98A 4OK5A 3GLHA 2AKYA 2Q3HA 1XB2A 4M2LA 1CJTC 4PAQA 2P67A 1E6CA 4X8LA 2XTZA 3ZS8A 1OXSC 2DWQA 3U3MA 2DYKA 1ZD9A 3VX3A 1Z2AA 1LS6A 2QY9A 1E4YA 5GVRA 4V02A 5JHGB 4EPVA 5DIFA 4EAQA 1Q21A 4GP6A 2A7QA 3PQCA 1A4RA 5G40A 4EFNA 1E1QA 3KJHA 1A1VA 2ZVQX 4HUQB 3QXJA 1U2RA 3O8CA 1SVKA 1O87A 2OAQ1 1SVLA 3THOA 1N0WA 1KI9A 2A78A 2ERXA 2GCPA 4PZLA 4E22A 4CRWB 1DAFA 1II8A 4D80A 1SXJE 4V0NA 4HSEA 3THXA 4I1OA 2MSDB 4C0KA 2XJ9A 1J70A 1DG1G 4B73A 3I73A 1T3SA 2GKSA 1Z22A 2ATVA 3A1VA 2ZR7A 1N6IA 2OM2A 1EWRA 3LY5A 4Y0VA 1IY1A 3K1JA 3QXCA 4KV9A 4DIEA 1TAGA 4EPXA 4Z54A 2FEMA 1XZQA 2VIIA 3SOPA 3RC3A 3ZDQA 2GXQA 1BH2A 2ZAMA 1E9BA 3WP0A 1YZNA 1L7VC 5C4MA 3O8RA 4IDPA 1KK2A 2QM7A 2ZUDA 3JVVA 4XWAA 5DE3A 5DN6D 4EPWA 1GL7A 4DB2A 5CB8A 1YE8A 4EDHA 3DPUA 3IHWA 4ZCIA 2BVNA 3B82A 4LPSA 3UG6A 2OBMA 3K0CA 4BFXA 2QMUA 5TMPA 2ZRCA 5EE5B 4EJSB 2YVUA 2V6IA 1E9FA 5FOSA 1DAHA 4DEXA 4ZCLA 4ZDIA 1A2BA 1OFIA 3Q7QA 3C41J 4N1AA 1E1QD 3A1WA 4G5QA 2EFCB 4BWYA 4BZQA 3LXRA 4A0GA 4XJXA 3KX2A 5DI9A 4B2LA 5JCZA 3L43A 2N1BA 4GMXA 4HI0E 4DVGA 1M7HA 1NLZA 2P0EA 1CJKC 3M1IA 2DWOA 3A58B 3AP3A 3PUXA 1K8RA 2LKCA 5HCIA 1K5GA 2MMCA 3TVTA 3PXGA 2ZRNA 4IEIA 2BOVA 2CVHA 3RSOA 2OLJA 2DHRA 2ZRHA 1Z5ZA 3U61B 2WKRA 3ZVNA 4A0FA 1K6MA 2FSIA 4HZUB 1Q3TA 4EPYA 2XGJA 5FH9A 1F48A 4US0R 3U3RA 1TL7C 1RVDA 1WDTA 4KSBA 3NBYC 4UXHA 4WA7A 5CK4A 1OH8A 1F2UB 3DZ8A 4Q1BA 4WZBE 1JJ7A 3CO5A 1YR6A 5JI3E 1S3GA 4D4LA 2ZI6A 2ZE7A 1D2MA 1G17A 3AGQA 2HT6A 2B0OE 4NYJR 3GJ0A 5KDLA 5K8IA 2XZOA 2R62A 4TYWA 4FMBB 1R0YA 4LRWA 3I1FA 4L9SA 3K70C 5JWOA 1E98A 1RJ9A 2OFXA 3QKSA 3H4MA 4RZ2A 1RZ3A 5IHPA 1YZGA 5JJLA 3LO5A 5JHHB 3PG5A 3BERA 1P4SA 1H8HA 1KO1A 4TMVA 1W0JA 2FN4A 3ZIAA 4B33A 1KK1A 4AG5A 4GOJA 3KKMA 1KDRA 2W00A 2ZJ8A 2RGCA 2IS1A 3I5YA 1Z29A 2P6UA 1RIFA 3L0OA 4HLUC 2Q9CA 4IOLA 1AQYA 3FHTA 1JNYA 4UXIA 1XNJA 2UZIR 1YRAA 1LB1B 1P2TA 2WV9A 2NG1A 3G82C 1WP9A 3L0PA 3FPAA 2BBWA 2AX4A 1OYWA 4URYR 1HE1C 4CEJB 2CVFA 1GP2A 1RRGA 2J0QA 3KUCA 1RW4A 2QSZA 4XSGA 1ZD8A 2ZAOA 2KE5A 4W5WA 2K5UA 4X8OA 2L0XA 3IBGA 3NEJA 4C2UA 4IDOA 4BQSA 1P5ZB 4TLCA 3WMGA 1EFUA 2R6GA 2ANCA 3KUDA 1DPFA 2HLDA 1QHGA 2CRRA 4NCKA 1E2DA 3TUIC 3ZQ6A 5JZVA 5FOWA 1IY0A 1H8HD 1IAQA 1XU4A 2O8BB 2GHIA 4A1FA 2REBA 3ZIAD 1W0JD 2XB2A 1N5IA 3CNNA 1GAJA 4Q7JB 2OZEA 2BIFA 1E2NA 2FFHA 2Q21A 4Q01A 1NVWQ 5BQ5A 5C1BA 1XD2A 3PVSA 1EX7A 2WOJA 2X8AA 2YC2C 4IJMA 3MD0A 3VU9A 1JBKA 3MWYW 4LPKA 4AKHA 4W9MC 3H1TA 2QTHA 4D0LB 4KCGA 4MKGA 4CDGA 3VR6A 1CIPA 1NJFA 1DAGA 1II9A 1E96A 2IK8A 1XD8A 4TMKA 3K9GA 4AWXA 5TDHA 3CX8A 3KKOA 4TLBA 4TTPA 1Z07A 2D2EA 2WPDA 3VNUA 4LSGA 2G0NA 4TMWA 2IYXA 1MRSA 4KBFA 3HR8A 2ZS7A 3GQBA 2DBYA 3AF3A 5KTYA 3IGFA 3DVLA 3A4MA 2BJWA 2I1QA 4HUQA 2ZR9A 4OQLA 1IHUA 2WICA 1T4GA 2FF7A 3E2IA 4LBZA 1VDZA 4QG7A 2P6NA 4QNMA 1NN0A 3KJGA 5KO2A 4JLBA 3RSLA 3SJBA 721PA 2A5FA 2HLDD 1UAAA 3B78A 1UADA 1IN5A 3TMKA 2GJSA 1E2KA 2JDIA 1I4LD 2IEYA 4KYIB 2PZGA 1HY3A 4N0EA 1T3LA 2Y8EA 3OIVA 4HAYA 3CB4A 1DCQA 2NO7A 3QY0A 3CM0A 4EKDA 4ZIRB 2G83A 4H9GA 4DC9A 5GADl 1NSFA 4ERNA 4DCSA 1RYHA 1MABB 3NHAA 5AUNB 3U7HB 5JCPA 2ZI4A 2J41A 2V6JA 3K09C 3VR2A 1XJQA 3EZFA 4TYPA 2Z5FA 2MSCB 4PAOA 1TUIA 1U94A 4V0OA 2OBLA 3NDPA 2QI9C 3MLEA 4IRUB 1TADA 4I1SA 4ZKDA 4W5HA 1R8SA 4RVCA 3HU1A 3LXXA 1Z63A 2CMKA 3VTKA 4LZZA 4FXPA 1QHNA 3T1OA 1LFDB 5FPKA 4POAA 1TMKA 2WPDD 3DEFA 1KZGB 3BRWD 3K0AA 4MQBA 3V9PA 4EJSA 5HE8A 4WIAA 3BB1A 3AVUA 1MO4A 3IIJA 3QXSA 3PUZA 1SHKA 2B7CA 3GFTA 1E1RA 2SHKA 4MKHA 2JASA 2J5XA 1OLOA 1GNQA 3X2SA 2P5SA 1Z0FA 5J4LA 1E0JA 2PZFA 1HE8B 3SHWA 2OE2A 2A5DA 4Q5IA 2QP3A 2J3EA 2VF8A 4YMTA 3UATA 2KBEA 3C5HA 2FSGA 4QBFA 5CM8B 2PX3A 2JDID 1E2EA 4O2LA 3G0HA 2RGAA 2JA1A 4LK2A 2GVDC 2H8KA 4HDQB 3NG1A 4PO9A 3TR5A 5HR5A 1NNEA 4N0DA 2VHUA 3ND9A 3VKWA 1NJGA 5KNBA 1R0ZA 3P26A 1YKSA 3ADBA 1IXRC 3TSOA 3IO5A 421PA 1CP2A 2B6HA 4NONA 2QTVB 4GT1A 3KKPA 5AK0A 2ZIAA 4LY6A 1WE2A 4QGHA 4P4UA 4TL9A 4BPBA 1F2UA 4G1UC 4BLRA 3AVOA 2DR3A 1NRJB 3B5JA 1F60A 2FH5B 2VSXA 1GRNA 4WZAE 4PPFA 1VYUA 1GL6A 3X1YA 4BECA 3HJNA 4Q02A 1KSHA 4KI0A 3LWNA 1KAGA 1GKYA 3VR1A 5E7IA 1T8TA 4BLQA 5J40A 2IUTA 4LV5B 1TQ2A 2EW1A 1NP6A 3AF4A 4BLOA 4JIMA 4JVLA 4HATA 5FBWB 5L3QA 4ARZB 1KDTA 5HZHA 2D06A 1K5DA 1ZAKA 5FPHA 2GEUA 2YNMA 1Z47A 2OFOA 2QEQA 5K8LA 3IKJA 1YQTA 2C8VA 3GLGB 2BDTA 2F55A 4KFSA 1KO4A 4NCJA 2QORA 5BN4A 3NHBA 3O47A 1KIMA 2RAPA 2V1XA 3U3KA 2WHXA 2J9RA 3B9PA 3QKRB 1E9DA 3AF0A 4CEJA 5EP2A 2J1LA 3FE2A 1XMJA 1FX0B 2ZU6A 3PITA 5G3ZA 5JLJA 3RVBA 1OH6A 4PX9A 3BC1A 2CE7A 3TQFA 1IOZA 4QBGB 1ZJ6A 2QMEA 2JLVA 1VG0B 3QVUA 3K9HA 2BEJA 4FN5A 3U7EB 4PC1A 3TUZC 4JLOA 2ATXA 5FL3A 4BFYA 3OHMA 2WWXA 5L3RA 2QAJA 4DCTA 4GDFA 4LV8B 4TMXA 1EFHA 2AD5A 3SYNA 4R71A 2NO1A 5ANRB 1HT2E 2ZSFA 1G3UA 3CNLA 4LBYA 3AVQA 4XOIA 2I3BA 1FL9A 5E7JA 2O8BA 3PCRB 1IN8A 4Q4HB 4NL4H 5K8UA 2Q0HA 4IFBA 1VECA 3CLVA 5LB4A 4MGYR 2WAYA 4GPTA 5C2JB 4JVSB 4D81A 5EE3A 1NG1A 4LGMA 1PVOA 3EW9A 3L8ZA 1S1MA 2WOOA 4OJKA 4XVRA 2H57A 1TQ6A 2FDCA 3AB3A 5KPJA 3JUEA 2EFDB 4JLNA 1ELOA 3QJYA 4XWKA 3IILA 2IT1A 4BE7B 3QF4B 5CITA 3C16C 4B43A 3EX7C 5KNCA 1P9WA 3HP1A 2RGNC 4URUR 2B8WA 2GK7A 3X1XA 1EESA 3MUFA 3W90A 2JEOA 1T3HA 1ZM9A 3U7FB 2ZU0C 4NZYA 2VH5R 2OHFA 2C9OA 4TLAA 5JS7A 1RRCA 2FWRA 3B1ZA 4MYCA 4HB2A 4Q9LA 1AS2A 3U3JA 3SQXA 4YDSA 2WJGA 2QE7D 2IS4A 2I1VB 4DDWA 1XTIA 2HJGA 4B6EA 3EASA 3SYLA 4M0LA 4WZ6A 2AKAB 2OCPA 2Q9BA 1G6OA 1VMAA 1XEFA 4TMZA 1ZMXA 1OV4A
chains in the Genus database with same CATH superfamily
4BAGA 4AULA 2VL7A 4MQMA 3WGIA 1XPJA 1PKEA 3DOJA 3CLSD 4MUGA 5A0FA 2GD2A 4MVJA 4P22A 4CIYA 2RI0A 4AC9A 2YQ8A 1ECBA 3OURA 5L4NA 3DEOA 1SZJG 2HBRA 4OVVA 4HO1X 5JQGA 3IKLA 3WBKA 1C81A 4BO1A 5JEDA 3U4QB 5AKHA 2JK0A 3KL2A 2IC5A 3T94A 5B37A 1KKUA 3OOHA 4JB0A 4RNDB 3QYAA 2HWYA 4MVJD 3VKHA 4WBNA 2PX0A 4B76A 1JGTA 3UTMA 4XARA 1CUUA 1Z5VA 4CV1A 1F0NA 5TJHA 4GFDA 1YQ9A 1J8FA 3VMFA 4ANFA 4Y1FA 2ZXEA 1TEVA 4QQ4A 5H16A 3FWHA 2I3AA 1CY6A 4EA7A 4M7CA 2VOJA 3EFOB 4E31A 1J8MF 5FFMA 3WWZA 1WMFA 3D7SA 3H5TA 1C7QA 3CGHA 1E6KA 2YXDA 5B76A 4C04A 4NFHA 2YWHA 4RH3A 1MJGM 4RQIA 5ALLA 1VLMA 1MCZA 4UI9B 1C9JA 2XT0A 1Z8DA 1PCXA 1PT6A 2V4LA 2I55A 1V55E 4LCJA 4TXMA 3BULA 4B4DA 2HSWA 1NURA 3GLFE 1T9CA 2PLFA 3KOZA 3JPYA 2HA6A 1WG0A 2VJLA 5CJJA 4IVPA 1K6JA 2WJHA 1GPBA 4R83A 1FDIA 4EBAG 3M4XA 1X3SA 3JTMA 1PJZA 3EHMA 5CA1B 3IB3A 4OG2A 1O0BA 5B6IA 1HOXA 1T36A 2GRRB 4W9NA 5DNCA 4N4AA 1KY4A 2GRLA 2ZBFA 4CM3A 1ORHA 1V16A 4M0PA 2OPHA 3FNQA 1WIMA 2VJYA 1IH8A 2EL9A 3WL3A 5DP1A 2J3DA 4KT6B 3QE0A 1KE1A 7AT1A 1ZVKA 3KT6A 4HRLA 1IB6A 2CCJA 2IIVA 3CQCB 2Y1NA 1UDWA 2XEUA 4R4JA 1FVXA 1JR3E 5CEAA 1UC8A 4JA2A 5BYJA 3AX6A 1K86A 4LI3X 3WNVA 2JKZA 3AYZB 2N1MA 2GN1A 2FPMA 2I4RA 4G89A 3R7FA 1K7XB 1JPVA 2EA6A 4Y7CA 2XUIA 5EJ2A 3LRQA 1KA9H 1RLMA 1TO2E 4JQSA 4RKWA 1LPBB 3FNIA 2GK3A 3KKNA 3E7FA 2ZBVA 3HGTA 4XB1A 4J8EA 3W06A 5AH0A 1L4GA 3WGLA 4P7JA 3FZEA 5BSEA 4J0DA 2SICE 2Y92A 1DWPA 2V7GA 1ZJZA 4MDFA 2NTNA 4BERA 4B6FA 3AH8A 4RC9A 4LYHA 3UYLA 1BCRB 2PQNA 1M2NA 1Z08A 3D6NB 2JLXA 5B3AA 1L7RA 1QH0A 1SA0A 4QE3A 4EP1A 3R3HA 3FNRA 5AFSA 5D8DA 2ZB3A 5DM60 2EKBA 4MW1A 1EPUA 1WXFA 5EOVA 3QVGB 1UPXA 3ZPJA 1DO0A 4KNWA 1QGZA 4M1TA 5HRUA 4QTXA 1ZD4A 3A36A 3OHSX 3G13A 4QJ3A 4UPDA 3HKEB 1WEMA 4DLAA 4G5SA 1GW6A 4P3KA 1OB2A 1U2GA 1YKFA 4MV3A 1W73A 4MP8A 4IHJB 2NVBA 2PQMA 1KETA 1DBQA 1FU8A 4OBWA 4DA6A 1IPEA 2OSVA 1VIYA 3THYB 1V6CA 2IOQA 2AIRA 4LJ7A 3SS8A 1R6TA 2B25A 2VBFA 3ZHOA 3A28A 3LLUA 4ARUA 4JBWA 4G5FA 4ETNA 1UBCA 3VHLB 2VJ8A 2IU4A 4KR9A 3A9CA 3VZRA 3QMWA 1CF2O 1N8KA 1V5FA 4CTMA 3T5XA 3CX6A 4XIFA 2YREA 4IXTA 1XTSA 4IMPA 3QEBZ 4YDHB 2H08A 2I0FA 4BKUA 3N1UA 4ZQHA 4YYEA 5JANA 1AKYA 2F37A 2W2QA 4RHCA 2AJ8A 4V3IA 4KXUA 5T67A 2YWCA 4IH4A 2E37A 3VQTA 3ONKA 2PL9A 3E7DA 1EXWA 2GSDA 5LR6A 2C7OA 3NJ4A 1WY6A 1P2UA 2Z6AA 3GY0A 5AK5A 5LQUA 3JYSA 2HNBA 1ZQ1A 2RFLA 3QKUA 3AVVA 3R7QA 4W5RA 3UJ8A 5ARDA 3LWZA 1L1EA 1EU1A 2ZXFA 2BFPA 1K8ZB 3WXMA 4R8PK 1TCUA 1X0XA 3HC7A 5JZSA 3VPHA 3CEQA 4JITA 4OKIA 1BKDR 5DEOA 4CG1A 5KTTA 3BSFA 4DNFA 3LMKA 4CF6A 4GCOA 3VU1A 2XHZA 2BGUA 3HCPA 4RKFA 4FDLA 1EE1A 2W2OA 3WFZA 1OWMA 3P52A 1U7HA 4QXPA 4ESHA 4CCSA 2HJVA 5L3SA 4O2AF 2F8SA 2C5BA 4AQYB 3O26A 4OXRA 4ZK6A 1DDIA 4PWYA 4K0KB 1NQOA 2ZSIA 1PLKA 4P33A 4TUMA 2A1UA 3M89A 4KPUB 5EKUA 1X4JA 3ELBA 3CEMA 3ASZA 4YRFA 1HMPA 3OH8A 3OM8A 1MO5A 4H35A 1DS6A 1VHLA 2I6UA 2Y0DA 4PS0A 1BDHA 3FTFA 1G7TA 1F51E 1HEIA 4J2TA 1ATIA 3TUJC 2UY1A 5HQ3B 1D07A 5ESRA 3S8EA 4MHOA 3F1KA 5A5DA 2NZUG 2G28A 2BKUA 3T1YB 2RGUA 3PT9A 5BRNA 4JXXA 4AJJA 4O1MA 2VQFB 1LPNA 3BB3A 5LP6F 2P9YA 4E2ZA 2W48A 4Z0RA 2QF7A 2ZUBA 1ZMOA 4HMQA 4PEVA 2HIMA 3N9PA 4XX1A 3W9BA 4MUKA 3ZXUB 3GJ3A 2XAAA 3R9IA 2W8BB 4M1QA 4V1CB 4WNCA 2PKRA 2D4HA 3GP5A 2L17A 4ND2A 1PSDA 1FS6A 1CERA 3ZWQA 4IZOA 1SHZA 3LX4A 1BDBA 3ADDA 2SCUB 4NWIA 1T5BA 4EG7A 4CXMA 5AUPB 1GA6A 1KZHA 1TKAA 4MIYA 1PFKA 1PWYE 3DTVB 2AW6A 2QV0A 2P7HA 5K3EA 2BGJA 1NM5A 3HNPA 1PT8A 1U99A 4K28A 2WQHA 2W6QA 2PQ2A 3D0QA 4OH7A 4EATA 5A5GA 3ZLBA 1JMYA 4ZCTA 4FMCF 3B8HA 2ZCJA 5TV2A 3IEGA 4JLJA 3UH1A 4KGXA 1C8KA 4J7AA 3DNMA 1FUUA 3I72A 4OBEA 4AY4A 4N3BA 1ILWA 3BRSA 4YAJA 4CVNA 1QK4A 5I3CA 4NCIA 3DL2A 3IIKA 1QGUB 1SVNA 5KSPA 4CT5A 3LKZA 3HWRA 1OY1A 3UGJA 4IVQA 4FONA 3LVRE 3VSBA 1P7PA 5C8XA 4UI9C 3VYVA 5E75A 3CKKA 2A4KA 3DQVR 4BQPA 1O1YA 3SYTA 2C8LA 1E0DA 1T2CA 3A6EA 4H4EA 2HB6A 2OWAA 3QXXA 1ZOOA 3K92A 2QMYA 1JQ3A 2QRNA 1W30A 4YJFB 3WV5A 4F1KA 1Q1ZA 4IIHA 4ZEOA 3Q6MA 1F38A 3OP4A 3LZCA 4B3GA 3JARB 3IPAA 4B0PA 5FOXA 4TLDA 4DC0A 4LLBA 3TQSA 5KHLB 1GQ2A 5JQWA 4F7DA 3WRYA 4RDHA 4NBRA 2IUUA 3W6NA 4GMJA 2DBZA 1O1TA 4UQLA 3LQYA 3DD1A 5NLLA 3MWFA 2BMDA 3LI2A 3ELYA 1UFOA 3ZQKA 2OHOA 1WCIB 1BWPA 3V1KA 1JFVA 1EJ0A 1ZW6A 4PLGA 4AM8A 2AWIA 5JS2A 3W05A 1CZKA 1H1LB 5DM0A 4DQUA 2X6RA 3LPCA 1M5RA 2Q8PA 1U8FO 3FHOA 1A9YA 1I5OA 1X86B 1H2RS 1Y3FE 2OR3A 4JX9A 3FA2A 3V30A 2COEA 4ZOLB 2X3MA 3L04A 4TXNA 2YHBA 2FEOA 2IYVA 4N82A 5CA0B 4GUDA 1O4WA 2QM0A 4X62B 1M2VA 2IY0C 2BZ1A 1GOTA 3VHXA 5A6SB 5CCBA 1ZRHA 2O54A 4YCAA 4GLFA 1YO6A 2XZLA 2Q27A 2TMGA 3CB2A 4UBOA 5TX7A 3CMCO 5HA5A 3UCXA 4G0NA 1S2IA 4RLFA 3ZR4B 3Q3CA 221PA 4OP1A 3WDLA 4FADA 4BCBA 3M4JA 2VP4A 2D13A 1P4JA 3DLBA 1JLMA 2FWIA 1CK4A 2V5QC 4PHCA 2M85A 4BNKA 4CF3A 1R4AA 2BEKA 3ZHQA 3QAQA 3NG2A 3KKZA 4YATA 4E5SA 5ICSA 2QLTA 4IJ5A 1DKPA 4K26A 3CUEF 5KAPA 1SCIA 1C3OA 3RVNA 4DBLE 4AJ9A 1VDMA 3D0OA 3E84A 4JKYA 1EVQA 1FFSA 1QDLB 2WBLC 5GOZA 3ROGA 1NFQA 4IL5A 1CF4A 5A3SA 4UNPA 4IIXA 4RFVA 1C8LA 4LG1A 2EW8A 2PMKA 1VA5A 4X44A 5U4XA 2P9GA 4YRCA 1E7YA 3CUSA 3ASVA 3KR9A 3KYDA 4HXEB 1BWQA 1G5QA 3KLOA 3HA3A 1D04A 2EBWA 3GNQA 1J8QA 3P0IA 4NMLA 5H1VA 4MB0A 1QRSA 2QGNA 4P53A 2VSXE 3KSZO 1R27A 1Y8QA 3O9ZA 3U4GA 4Y1RA 5IYZB 2J85A 3MLBA 1QX4A 2QLLA 4C29A 2AXNA 3RD5A 2IDAA 2GXSA 5DM1A 2WKWA 2VHJA 3CK8A 4YMVA 2IEBA 2EFYA 1M8PA 3OZCA 4JI2B 3BGSA 3FDJA 1QIJA 4FOTA 3FGOA 5JBNA 3H2GA 3IFSA 2OXTA 1VJDA 4YQYA 1WENA 4Y9RA 4PC2A 1Z37A 5F12A 3II6X 1Q1QA 5A5FA 4N18A 5AQEA 3TG5A 3PCXA 3NP9A 4OI0A 2YJGA 5EVJA 3TM5A 3HSKA 4P4SA 1XEXA 2KZTA 2W9XA 4TV8A 3TLAA 2AG0A 1Y80A 1YQUA 3EIXA 4PYNA 4HEA6 2ZITA 1ZGHA 3RS3A 3GT0A 2P1ZA 3SFXA 4W5JA 1VBNA 2P2LA 2DWUA 1N5OX 2QM3A 4A4BA 1PJRA 3IP5A 4MVWA 3ASHA 4EQFA 4QASA 3GQVA 4ZDTA 1DBWA 3K94A 1YS1X 3T0FA 1K8YB 5C9ZA 1RADA 3CBGA 2BHSA 1UKEA 2KMLA 1GNLA 1XU9A 1Y8MA 3K9BA 1USKA 3JQGA 3JW8A 1QTQA 2ID8A 3UAXA 3UBTA 2ZTMA 3EARA 1O3YA 4ONEA 2APJA 4CV2A 1C3EA 2JCBA 1XRRA 3ZCUA 1AXEA 2AMFA 1CEXA 5K6AC 2QRMA 3O5AA 3N8NA 1U6GB 3W9SA 1J2RA 1G16A 2ORED 4MHSA 2FJUA 1Y8AA 5LA6F 4CT4B 3BAFA 3IQZA 3PFFA 1QG2A 2ZWMA 1NVMB 2G07A 1S1CA 2X5OA 2ETVA 3AVWA 4L3WA 1BXKA 1BG6A 4ZDJA 1QGYA 2VT3A 3LHIA 4K40A 5JS8A 4FHGA 1NTOA 2FK8A 3G88A 5EHNA 3CISA 3ABKE 3OAAA 3TW8B 3A4NA 3AHCA 3OKAA 4U00A 2BKAA 2NYRA 3KETA 1EQUA 3MK31 4K46A 3T7EA 3M4YA 3S28A 3L1HA 1W4BA 1ZNQO 1XTZA 1BE8A 4HI9A 3B6EA 1Z36A 3ONFA 4RGQA 4MW4A 2WXKA 2LN0A 5FUVA 3K0EA 4LWZA 4UZFA 1Q1EA 3KM0A 2L18A 5IJ9B 2JRCA 4CFZA 4BTEA 3ZI0A 1MH1A 5G53C 3OAAD 4WACA 1QU3A 3U4TA 5E8JA 4HV4A 2NTJA 3PREA 2YS7A 2GCIA 1L0BA 1XA3A 2Q3HA 4DPRA 1Q0QA 3R9AB 4Y18A 3AQIA 2EZ8A 3OZUA 2NO5A 3DMRA 3E6AA 3FSRA 1OGYA 2WG1A 2PE5A 3IIIA 3N8GA 3FUFA 3NUQA 1MYOA 3WYDA 4Z54A 2VIIA 3HB1A 3RASA 2YFKA 1E9BA 2QX4A 3Q4AB 3ETNA 4G2TA 3RUDA 3UK2A 2YVUA 5EVCA 4DEXA 4EMSA 1WOYA 4QDXA 4EL5A 4WHMA 4N8EA 4M1EA 4TTIA 1KAHA 2H59A 1A17A 5A4FS 4XFDA 1OWLA 3I5MA 3PXGA 3RSOA 1RKQA 4JC0A 4ZVMA 9ABPA 5EWJA 1H2UA 4NAVA 2JLAA 2SNIE 3OXGA 1DU4A 1YRHA 5KYNA 4KEAA 4NI5A 4DADA 5JAHA 3DZBA 2YJ4A 4N76A 4D4LA 3IAS6 2XZOA 4INJA 5ULLA 3IAM1 4G0YA 2GPNA 4OQYA 3Q0TA 1TDJA 2OFXA 3V1YA 3ZN2A 2Q07A 2GEJA 3V3KA 3E2DA 2W00A 4F5WA 2P6UA 4HWRA 5FEYA 4FEGA 2WV9A 4DX5D 3QBDA 1XVLA 1HE1C 3RS9A 4RM2A 1FLDA 1GP2A 2MNZA 1WF6A 4BQSA 16PKA 3WMGA 5CPFA 2HLDA 3HJCA 2OMEA 2E49A 4WNFA 1IY0A 3ZHRA 2Z04A 2FFHA 2YSJA 3LK6A 1O58A 4XKCA 4YJ3B 3KRTA 4QREA 1YWGO 4Q6WA 4RQTA 4YJGB 1D8DA 3V2GA 3EUWA 1EZ1A 4INAA 5IXJA 3HGQA 2NU8B 3V80A 3JQ1A 2HLDD 2YJ6A 5HM6A 3HCRA 4M0DA 1T3LA 2H52A 2ETBA 3RU2A 1JHZA 2BUGA 1XNGA 4RZHA 3HU1A 2PZLA 2O1WA 3O1HB 1Z6PA 3K0AA 1YZ3A 1WUTA 3IQGX 5JQGB 4HS4A 1QGAA 4NG4A 2P4HX 2JASA 3GRFA 5KX5F 3HABA 4GAAA 3SR4A 3G0HA 2H8KA 3C7TA 4N0DA 1RI2A 1RQNA 4NONA 4GT1A 4MKXA 1F2UA 3TRKA 3ZI7A 4JC8A 4PPFA 2JM3A 5LZ2A 1BXZA 5I9TA 3HJNA 4DA9A 4Q02A 3E3NA 2IUTA 1TQ2A 1MC5A 3WZMA 1VLHA 4IV0A 1VSVA 2GEUA 4Y9DA 4TSRA 3TS1A 2QORA 3FUDA 4HOQA 3JQRA 1P2GA 2AN5A 3ANYB 3V46A 2J9RA 1XMPA 5EP2A 3GEGA 1WS6A 3RVBA 3JX9A 4D6XA 1ZD2P 4NZ9A 4YAFA 4ALLA 3VC2A 2BEJA 3Q3HA 4PC1A 1MB0A 1YFZA 1G20B 3CNLA 4LBYA 3GZ4A 4NL4H 4Q3KA 5F9MA 5IAJA 4MGYR 4JVSB 1VIVA 2JFFA 3M82A 1TQ6A 3JUEA 3ORSA 5CITA 4X3OA 1RHRA 5KNCA 2VXCA 1T3HA 2JI6A 3QEKA 4NZYA 1TPYA 3SQXA 3VYWA 4PLFA 2CBXA 2ETAA 3E5MA 3EDOA 1BA2A 2O3UA 2IZ1A 2J3HA 2UXDB 2GQ0A 4F97A 4XQGA 3IEIA 2QTBA 2M2IA 3K20A 1T36B 2ZJZA 3HE3A 5SYAA 1AC5A 3STUA 2F8MA 4NN2A 1V16B 1SXJB 2ZSBA 4EOGA 4B75A 1CSEE 4LX0A 4DSNA 1YR3A 2JBAA 2RCYA 4B6RA 4CR7A 5KNCD 4LN1A 3TLKA 3WB0A 3ZXXA 4I1YA 4KUHA 3BEOA 1U0LA 1Q7TA 1UBJS 3TQTA 4IHKA 2AXVA 1VB3A 2P2NA 1V7ZA 4KFTA 3WGTA 4G3XA 1DG9A 2G77B 3DPIA 4C88A 4RCVA 3VA7A 4LRZA 5EE1A 1MGPA 3RSSA 3GEDA 3UNXA 4N6GA 2GF9A 3F5DA 3DSSA 3BHMA 3DEAA 1NW3A 1PAUA 4W6QA 2X2PA 3PDHA 5F7JA 4DCUA 3EVTA 2QVXX 1DRVA 3A4YA 2VF2A 2PGNA 4L4YA 3S8YA 5ER6A 3KXPA 5JDCA 2QYUA 3A6PC 1V9SA 1ZMRA 2ODEA 1M9NA 1N36B 1KEUA 4BQRA 5TDRA 3CR3A 2V5AA 1XMIA 2W2VA 4ZVUA 3DKIA 4C9BA 5SZHB 4CTJA 1K8KG 3N5KA 1CF9A 4B71A 3PZDA 4JD2G 1JWBB 4I5FA 2R4QA 5DK6A 1GV1A 5K3QA 2UZ0A 4P5OB 1Q7RA 2J3QA 4IWXA 3EF3A 4PPEA 2YICA 2QSYA 4G1BA 4BFVA 3CV0A 4QPPA 1OTHA 1I33A 5F5XA 1BD8A 5FOUA 3T5DA 2ZSKA 4ME6A 4X8MA 3E1SA 5BQXA 1NA0A 4DRXE 3ZVKA 3OZSA 4IC2A 2PS1A 5HFNA 1N2GA 1L4HA 1X8XA 3ENZA 1F5SA 3NC0C 1WCXA 3E3AA 1O1SA 2VNFA 1JA9A 1Y5MA 2O57A 2QFCA 2RHCA 1L7NA 2ZSAA 4MRRA 1T24A 4I55A 3GAFA 4AEZC 2IH4A 1U1IA 4BHTA 4PNHA 2H1FA 3PX3A 1KSFX 5I8WA 3TZEA 5EPEA 3LBFA 1KPSB 1MM2A 4DN6A 1PHPA 1GDDA 3C4VA 4BX3A 2VJCA 3B38A 4R8SA 2QENA 5AUQA 4GS5A 4EW6A 4U2CA 4MVJP 3HRIA 1BHO1 1ZVQA 1FP0A 3DHWC 1CD5A 4XH9B 2PLAA 2I71A 4Y2HA 5CLIA 5I8PA 3MWDA 4MW2A 1QRDA 3X1ZA 1G7CA 4S2UA 4L6AA 3VJKA 2BTQA 2BCEA 2DLDA 2BELA 5T57A 3HXMA 5L4SA 4G0MA 2PVPA 5A05A 4FSXA 1Z7EA 4J7WA 1KY3A 1E7QA 1HNZB 4U2GA 3FRIA 2PUTA 1CY0A 1BH6A 4OUDA 4MHTA 2XCCA 5AM3A 5FUYA 4E5UA 2PGAA 4EDFA 4B35A 5DOZA 1YU9A 5JAIA 3A6DA 3E3LA 3KPYA 5L3SB 4DI3A 4S0ZA 1VL8A 4B8YA 1DTSA 4J7CA 4RYLA 1PS8A 4GNKA 2REXB 4ZGGA 3C45A 1XQ9A 2GHQA 1X7GA 2BONA 2P9UG 5AOCA 2A1UB 3GNLA 2JCVA 1FBNA 3DA8A 1T91A 2LDXA 5DIZA 1A9TA 2PZIA 4LGVA 4C4AA 4ZAXA 1CY7A 3W77A 5M3BA 4GM0A 2PSSA 1Z82A 5D86A 1M2JA 3L7KA 2R2LA 1XO1A 1EBUA 3FOEC 1UXGA 3NXKA 3K2QA 1YZFA 2HF8A 1W48A 4Q1CA 3GH1A 4CG0A 4UJ3A 4NU8X 2UY1B 1BXGA 5B1BE 4KMRA 3HL4A 4LJ4A 2I3ZA 2BBTA 1Z6ZA 1HF8A 1V7PC 5FADA 3ZGYA 4BFUA 1JR6A 2K4MA 1GG5A 3UUGA 2QN9A 3APCA 2O8VA 5EXDA 1HTTA 1U2VG 1NTRA 2NUPA 5AHRA 1Q0HA 1PFWA 5AP9A 2ODWA 1TF5A 2DIWA 3EODA 3UMCA 1XC7A 4QJIA 2CHWA 1O6FA 2Z95A 3UJAA 1NVDA 1PDOA 4JB3A 1OA0A 5H81A 5A5EA 4C6RA 4EY7A 1PT9A 1M5UA 1LZKA 4ZI7B 1DCTA 1UJ2A 2HLHA 3BN3A 3INNA 3BA6A 3G2TA 1QR2A 4DLUA 3LVFO 3N28A 4HDOB 5ALJA 3V4VB 1N2CE 2VUTA 3ENQA 1O95A 3ZVMA 1PZHA 2NUTA 5B8DA 2BLNA 2JLYA 1TT5A 4MLDA 2D8MA 3SM9A 3OLXA 1GZSA 1H0AA 3D7NA 1ZR4A 4PICA 1WAMA 3ZVLA 1F8GA 2WIGA 3IOBA 5FPQA 1ZYUA 3DBLA 2YIJA 2VDKB 3RK6A 2JLBA 1LEHA 1K06A 2A0WA 4UBMA 1V9LA 2PL5A 1O95D 2XQ0A 1U1FA 1HYEA 3EXG2 3U3DA 4IRUA 1YAJA 2CYCA 3JXEA 4ZAVA 1TJCA 2J6HA 4PN3A 4R1PA 1AMOA 5ADHA 1VLVA 5JJKA 3S7BA 3HCAA 2JHFA 3HYRA 1NV8A 4MKFA 1Z38A 3L22A 2ZR0A 3UCEA 1GG2A 2GBLA 3FAZA 1OFTA 2VWPA 4WUTA 4JEMA 1S6YA 4KHPB 1XF1A 2I33A 4GZDA 3TEMA 1PG2A 1RE0A 2ZIXA 1SD1A 4YMSA 1H6DA 3HA2A 3D0KA 2Q4BA 3KXLA 3KG2A 1OIVA 3LOUA 2BEWA 4W9NC 4C5BA 3SBEA 3D1VA 1G4UR 3RKUA 1HLGA 1T6NA 2PXCA 4QA9A 1L7QA 4EZEA 2PZAA 1L8AA 5SZKB 4MVJG 2HQSA 5CNJA 2WPNA 4LRTB 1ZFNA 4XTCS 2KKYA 5EEHA 4L8GA 5KTPA 4ZYYA 3GWGA 1YZKA 5AXCA 1KFJB 3V2OA 1P1CA 1G4HA 5B2EA 3P27A 2ZIUB 2XMRA 3VKVA 2Y1EA 2VP3A 3OZWA 3UWPA 1HDIA 3BDAA 3F9CA 3KEZA 1IBCA 2VPDA 2OV6A 3B1VA 2CF5A 4RJLA 4JL5A 4RXUA 3OZGA 1Y3CE 5JSYA 2QQEA 3EISA 4TWAA 2PFGA 1SGWA 4OVKA 3W8NA 3RVDA 1R50A 4BNUA 3CVUA 1O1RA 3ESDA 3UMJA 2YUTA 2RDMA 3UKDA 1PZXA 1T2NA 1FYDA 3OHPA 1M2VB 3FCAA 1UPBA 4NEGA 2X1VA 3VHXB 5GWXA 3WK6A 4PX3A 2O7QA 4RL6A 3R76A 5DW0A 2FEKA 1Z5NA 1RXIA 1QZTA 4ZDWA 4DX2A 3OPVA 4Q16A 5KSWB 2B5OA 2TMKA 1T0BA 3OF2A 2ZJAA 4MCAA 2OYCA 3VYTB 3FNEA 2GDJA 1YTUA 2JEZA 4I4TF 4Q7KA 5FWXA 1TIKA 4PX2A 3DLTA 4HB3A 3N2IA 4GTPA 1MV5A 1U2GC 1S5PA 3KQKA 3U16A 2HA2A 5D51S 2Y43A 3EVEA 1C3OB 1I24A 5H4HA 1HX7A 3D9OA 2Z08A 3DMHA 1WLYA 1GPDG 2HSEA 3SHTA 3O94A 2HPVA 4ER6A 3EQ2A 1MOPA 5EJGA 2IH5A 3SBSA 2OAP1 4W8OA 1VA4A 4NECA 4G36A 4MB6A 4RANA 4DLTA 4HH0A 4LXIA 3KYDB 1GV0A 5B1AE 3IHPA 5EX3A 3EAFA 1PP4A 3U0BA 1IJFA 4AJ1A 3B1XA 1KS2A 2C3MA 3LC0A 2FP4A 2OVFA 2VT6A 4PHFA 4OHVA 5B2ZA 1Y8QB 4Y1RB 4XCVA 1Z60A 1P7VA 4YGXB 3DAYA 2QUBA 4GRDA 5EFZA 3S2EA 1XMVA 3KTOA 4U6NA 1EIZA 2DGDA 1A9PA 2FB9A 1L4FA 1G8YA 1YQEA 5HKAA 1YA4A 1VHJA 3WDKA 2OENG 5DT2A 1B8PA 4HDMA 2M1ZA 1B16A 5GMOA 4KXKB 4MZXA 3U39A 5FEMA 4BVBA 1XAGA 4R2KA 4H4CA 4YAGA 3WYGA 3FU6A 3OIUA 2B35A 4PPQA 1FYWA 4QTUB 2DZOA 3U7QA 2I3DA 5LQRA 2VDRB 1NNUA 3LGSA 1SQFA 5CMYA 4P4SB 2WXGA 1XEXB 3Q2KA 2X7JA 3ERCA 2KZTB 4OV6B 2WXHA 1GSOA 4TV8B 3FKSA 1J4AA 5B1YA 4NDAA 3DBRA 1QF7A 2VUHB 3NGLA 2ECWA 2BI8A 3Q40A 1M6WA 1GAEO 4C0SA 5JXWA 2XMPA 2H6EA 3K30A 2ZYDA 3QKWA 3B1YA 4ITUA 1CR4A 1LD8A 1MO6A 2JAWA 4JYMA 2VPEA 3FKSD 3LCAA 3A32A 3WJ2A 2V59A 5IVHA 1TJ3A 1YI0A 5JJCA 2NV6A 1EFPB 2WDPA 2VF4X 4V3CA 3PYMA 4R40A 3URKA 1IZ9A 5AW0A 3LHKA 1R12A 4BP3A 3NM6B 3P9YA 3W4JA 2MYUA 2C78A 2Q5QA 2ZPAA 3EXEA 5B3JA 1JXAA 2BKGA 3RIGA 2QR3A 1FRZA 4LDZA 3BYZA 4DIMA 4M37A 4FZJA 2OKCA 1TAQA 2GRPB 5K3DA 1PL7A 2GK4A 4PQRA 3CXUA 2VATA 4KACA 4TZ6A 1MOQA 1TGVA 3KZKA 4BMYA 4UCFA 5CH5A 3RWMB 4J03A 3HWSA 2O2SA 3UQZA 4G5YA 5CLHA 2DJ5A 4IDFA 1MZCA 2VP9A 3ZIMA 3C3XA 1P1FA 4OU5A 3FCYA 3WZLA 4RFSA 4HYYA 5I7AA 4EARA 1E1YA 1UP4A 2Y9MB 3L4KA 1WETA 3PQ8A 3VZDA 1NYTA 5C5CA 4YT5A 4UBKA 3VKUA 3JQ9A 4MUJA 4JBYA 3BGVA 1NKVA 3TTUA 3AKDA 2JIOA 5J58A 3REFA 1YS2X 1L4EA 4GRAA 2Y1GA 1JR2A 3HBNA 3VBEA 1LTQA 1SIWA 2W93A 2J3JA 1RBYA 3WGKA 1WHTA 1CQXA 2KSQA 4A0HA 1CIVA 4YASA 2I4IA 2F62A 1NM5C 1AP7A 1E2LA 1AZTA 4OTZA 4FDTA 3UG7A 4FYPA 2G8LA 2G82A 2VHZA 1A5EA 1P2SA 1Z7WA 1J2TA 1Y3AA 5DDIP 2A5JA 2NVUA 4HP8A 1SZ9A 1BSVA 2Q3JA 4J0FA 3C8UA 3FFTA 2QX8A 5DYIA 4B32A 1ZLYA 3TINA 5A1TA 3MQFA 1FS4A 3K31A 3SQLA 4JWKA 4C30A 2P3SA 5ETJA 2ZPUA 4D26A 4M9UA 1L7BA 3H5VA 4RJJA 1T9GS 4B7UA 1ORVA 3AUTA 4BVGA 5IDXA 3ENEA 3A9UA 4RCYA 2J59A 3GEMA 2EIXA 4C0WA 1H5UA 1E4EA 4Q9IA 2DFNA 3U9LA 5EWJB 4FOSA 1V26A 3IJRA 5EYPB 4C4XA 1SG9A 3RG8A 3JU3A 6AT1A 2D5CA 2FFBA 1SMKA 1I3NA 1AHNA 4N5QA 1H0RA 3MBKA 5CEFA 1N32B 3U5ZB 1SBTA 1R88A 3FYHA 2WEKA 5DVZA 1E7VA 3OZFA 4AO7A 2BMVA 3WRYC 3TBFA 3GMTA 4B3CA 1IBKB 2X7HA 3UB2A 1MM3A 4JJFA 3I1IA 2G9UA 3BE6A 4IF6A 1DQYA 4CQMA 2HHJA 1OASA 3DHEA 3MRVA 5KYGA 2X8BA 3BICA 1IOVA 4PNEA 4HGQA 4YCNA 1FB5A 3GEHA 1OOEA 1P4RA 4GZ6A 2ZI7A 4OHRA 3IEMA 2XBMA 3MWLA 3VSDA 1B23P 4YRIA 2KCLA 3AP2A 3RUCA 4PAQA 2LXNA 4QPDA 4DWWA 1VBFA 1NBWB 4CQMD 3ROMA 2YNQA 2CDCA 3JAKA 3JQDA 4E08A 3G2JA 3HY3A 1O87A 1N0WA 4YA6A 4MCJA 1RJFA 4ZQCB 3TEJA 1VC2A 2XJ9A 3ESLA 1X74A 1TVEA 3OA2A 1S8NA 3RC3A 4IDPA 5DE3A 3NHUA 1YE8A 3DYIA 3IHWA 4REQA 4DX7D 2FUCA 4COOA 1HFEL 1JSRA 4G5QA 1CZHA 3A58B 1K8RA 1YA8A 1U0EA 2PKYX 3OX3A 2FEPA 2CFOA 2FEXA 1GY8A 1JJFA 1E3QA 1F2UB 4Q1BA 4NOMA 4A4CA 4ZALA 5F7OA 3ZU7B 4LRWA 1A4UA 2IYNA 1JWGA 3U9WA 1FDSA 2XWSA 1KO1A 2CONA 3ZIAA 3LCUA 1KDRA 4O4LF 1KC1A 2QC9A 3N05A 2AX4A 3O9VA 4BNJA 1PJQA 3WGHA 2Q5LA 3EDTB 1JP7A 2EOAA 4XSGA 2ZAOA 2E4AA 4OM7A 4IH1A 3DXXA 5FOWA 2QRHA 2BRUA 4TS3A 3CY6A 3TN7A 1FTWA 3ZIAD 3HMKA 3BIJA 3QOYA 2WOJA 2H9AA 4HNHA 1U9JA 2ONYA 5BXYA 5LOZA 3QOXA 1JIUA 3B2QA 1LV8A 4RMJA 2IK8A 2DLNA 2GBPA 2ZBPA 4P7BA 5H9MA 2BJWA 3AW9A 4HUQA 4F3KA 3G2PA 2PGXA 5KO2A 3H65A 2FFRA 3KYIB 3UT4A 1EFDN 4EKDA 3FHJA 5JISA 4DCSA 4JXZA 3EZFA 2BFBA 4A5OA 3SJ7A 5EX0A 4W5HA 1DJOA 1PJCA 3P2OA 5CG1A 4TUYB 2PWAA 4G4GA 4LZZA 3NOQA 4H6PA 3C85A 3T7AA 2NTVA 1SHKA 3GFTA 3CU5A 4W5TA 4L72A 1XZFA 3QNMA 3F4KA 2BGRA 3ZBUA 1GL3A 2QOEA 4KYOB 2CF6A 1J5XA 1JFFB 4YR7A 1RXVA 1R0ZA 2Z30A 5M72A 1EYZA 4ZAYA 2ZIAA 3K16A 5EKDA 1JIIA 2VNSA 3NVMB 3T6KA 4LZPA 5K3OA 4FLEA 3TOSA 1J1IA 3MS7A 2WIDA 1FBVA 1FXSA 3KD2A 3CE6A 3K0KA 4MWDA 1DUIA 3HYNA 4FFBB 4LV5B 2FZEA 3EGDA 2NT4A 5FWQA 4R0VA 4UBIA 1P5HA 5KC9A 1ABFA 5BN4A 2WXRA 4GNDA 1W35A 4MRAA 4LE2A 3O47A 1Q0ZA 3NB2A 1FCJA 1QJ4A 3U56A 2P9IG 4FN5A 4ZYUA 3DF9A 1EE2A 1H4TA 5ENRD 3IYLW 3L1ZB 4HG2A 2C3YA 4HH4A 2Q0HA 4A73A 1PN3A 4RTMA 5TABA 3ZW9A 4F7AA 5AIAA 4EY6A 3PC3A 2JEOA 3QPBA 2ETCA 1YIOA 3BF8A 3T9DA 3PTLA 1U6JA 2OCPA 4JXKA 1EK1A 5LMUB 2CXUA 1XP8A 2XZDA 1MHTA 1XRJA 1E69A 4NRHB 5GIPE 3DW3X 1UFQA 4N65A 1H2XA 1XL0A 3FCUB 1NMEA 3DKKA 5A6CA 5CDTA 4KRXA 3CA8A 4OA8A 1U5AA 2IS6A 4EUKA 2BE7A 4NURA 2I91A 4AU1A 3BX1A 3H97A 2OHHA 2FE4A 1ORIA 4OB7A 5FTKA 3NS7A 5GZ6A 4RW0A 3HADA 3L17A 1P72A 3FCSB 3DFMA 1E2HA 3C14C 4JUDX 1V87A 2B1RA 4G86A 1MW8X 1BD4A 3H7IA 2BFWA 3R9XA 5KJ6A 1EFLA 4J7XA 2G9QA 1OVMA 2CL6X 4Y67A 1RQ7A 4ARZA 1QAQA 2HDHA 3PR2B 2LV9A 2RI6A 1N0HA 4HDNB 3MMZA 1TTPB 2FWJA 3MWDB 2OILA 1FFXA 5JJ6A 2BMWA 3KVOA 3SIPA 3KSRA 3TR0A 1ZRNA 4A0QA 4RPHA 4N48A 3ZGXA 1F0KA 1GNRA 5KCMA 3QIVA 3BT7A 4I81A 3W5IA 3K5IA 4RKQA 4DQ0A 3K2BA 3FDZA 5LX8A 1FVOA 5LP0A 3DE5X 5AKKA 1U2EA 1E64A 3WWYA 2WTUA 4OUDB 2HIAA 4V3KC 2GH1A 1OAAA 1MIOB 1ULSA 4UNSA 3OPNA 2ZI9A 4OHBA 4REMA 1EK5A 4E03A 1XQYA 4TV9A 1EWQA 2B83A 2HQ1A 2BF4A 2DY0A 3VUFA 1QUFA 3QUQA 3T7TA 2X40A 2Y0CA 4EYEA 4C4PA 1MC8A 3SCZA 2YTZA 1JBEA 2YZNA 1XHEA 2GARA 3UMSA 2FSUA 3STVA 1QPBA 1M6VA 1B43A 4K9SA 2XE6A 3LL7A 1T9GR 4KSCA 3JCKC 1KFCB 4QBIA 3H0KA 3O92A 3LPZA 4RTRA 3UAZA 3OT4A 3W1EA 2WHRA 4CM9A 4JMPA 2KX7A 4KXLA 3GFPA 1QK3A 4BYMA 4RTOA 4JBXA 1JCSA 5KHOC 4PTLA 1N8SA 4GA1A 3FB4A 1QO9A 2HO5A 1X1CA 2PX5A 5LOVA 3AUYA 4GXQA 1ZNZA 1J1ZA 1TNDA 2IQIA 3AI3A 1BXGB 2VHQA 3EXAA 2BKKB 2W8ZA 4GXTA 1T4DA 1U7OA 4UCWA 3ZHEA 4HN2A 2QPTA 4JDPA 3P8ZA 4UKDA 3U44A 1KEPA 1A2KC 2MT5A 4CM9D 2QT1A 1Y98A