3LVQE

The crystal structure of asap3 in complex with arf6 in transition state
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
476
structure length
420
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
total genus 126
structure length 420
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvqE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvqE04
1A1VA 3LBHA 2JLSA 5EJEA 1PJRA 1T8TA 2BCJQ 3W90A 1ZAKA 3BFXA 1G9XA 4EFLA 3HDTA 4AG6A 3MJHA 4A8JB 3TW4A 2CVFA 2V6JA 1TEVA 3IBGA 3OAAA 1Z0FA 4OHXA 3ZVNA 1X3SA 2J45A 2OLKA 4NZYA 4V03A 1MABA 1XD2B 4B76A 4LYJA 3MMPA 1GWNA 5HZHA 2TMKA 4FXPA 4Q03A 3B9PA 3TUZC 2EQBA 3PVSA 2JLRA 2OLJA 2CL6X 2JLVA 2F3TA 1W4BA 4IDNA 3FPAA 3VR1A 1F2TA 3F3YA 5JJIA 4HLUA 4KODA 3EZ2A 3PEWA 1FUKA 1KTVA 4F91B 5L3SA 4MA4A 1W1WA 4PR0A 1L8QA 3IHWA 2OE2A 1OIVA 4LSGA 1GKYA 2F1RA 2O5VA 5A5GA 4C0JA 1CP2A 1E9EA 2GCOB 1YJ5A 5A4JA 2ZVPX 2HLDA 4Q4AB 1ZNZA 3ZQJA 4DCNA 1W47A 2G9NA 3RNLA 1A7JA 2OCBA 3GLGB 1S1MA 4HLCA 1GSIA 3OF5A 1SKQA 4HB3A 4KVGA 2FH5B 4TMZA 1II0A 2JIZD 1UPTA 4LX0A 2F1HA 2GJAA 3C4JA 3I72A 4GDFA 5JS7A 3E70C 2ZREA 1GFIA 1MO3A 5K8IA 1NVVR 4KBGA 2J7PA 4URWR 3O8BA 3TW8B 3GEIA 2DB3A 1MR3F 3Q7PA 3ZS8A 5LBIA 2FJUA 1J8MF 3S1AB 3LW8A 4C2TA 4Q47A 2WWFA 3IUYA 3Q9LA 3I8XA 4AG5A 4D4LA 3GLHA 3U3OA 1Y63A 1KMHB 2QE7D 4TMVA 5CIWA 3U61B 2HYDA 3DKVA 5AUQA 5CIQA 3TVTA 1JR3A 3LFUA 5J47A 2P6RA 2OV2A 1T6NA 1T91A 2P3SA 4BQSA 4FMCB 4BFYA 1NNEA 4MGYR 5EXTA 4RD0A 2H5EA 3WNCA 3TSZA 1R5OA 2O8FB 2IUUA 3G0HA 4GBMA 1KI7A 3CPHA 3SFZA 3BBPA 3U3MA 4CEHB 3IQWA 4EKDA 5A0FA 4HAZA 1F2UA 2GTPA 2PEZA 2Q21A 1KK2A 3QKSB 4KU4A 1HTWA 2Y8EA 3SEAA 3CNNA 4DRZA 5EQTA 3CW2A 2HF9A 4YMVA 1Q44A 3UWKA 3SDZA 1WXQA 5IK2A 2JIZA 3Q5DA 2C98A 2YC2C 2F9LA 2PBRA 1N6PA 1Z2CA 4M4SA 5KDOA 1FMJA 1EFTA 4N1AA 1UAAA 4JLBA 2FZLA 2QBYA 2ZR9A 3KB2A 1R5BA 5K8UA 1GL9B 1Q1ZA 4EPRA 4PC7A 4P4SA 2FFHA 2I3BA 3AVVA 5JRJA 2ZSDA 1VTKA 4C3ZA 1I4LD 3BS4A 3K0AA 2XTNA 1OXTA 3SI7A 3PEYA 2XX3A 3T9KA 3I5YA 1IY2A 4L15A 3CLVA 2B7CA 4I1VA 1ZYUA 1AA9A 1NLYA 4O3MA 2OEPA 4J0QA 4TZ6A 5DIFA 4YMWA 3SBDA 3AF2A 1XTJA 3GFTA 2ZRHA 3PG5A 2J5XA 1E1RD 2FPMA 1ZD9A 3UG6A 1U0LA 2ZAOA 4PZYA 1G3IA 1Z0IA 2ZU0C 1X8JA 4ZIRB 4UJ3A 4Q9LA 4BLQA 4JYCA 5KOYA 3CUEF 3BFKA 1KI3A 1ANKA 2E9SA 5JECA 4DDUA 1KJWA 1FX0A 3ONWA 5KU1A 1NIPA 1ZRHA 3MWYW 3CKLA 4Q19A 1Q21A 3ZQ6A 1VYUA 3OE7A 1M34E 3KUDA 2IUTA 2C95A 1X86B 4A0HA 1OV4A 4XSHA 2ZS9A 4Q1BA 2EYUA 4QBIA 3C5CA 4A2QA 1SULA 1KYIA 3FMFA 2ZITA 1OIWA 1R4AA 5TY0A 2IS4A 2W58A 1MRNA 1J99A 2WIBA 2E87A 2ZRPA 4JLKA 1VHLA 3W8NA 4I81A 1LW7A 2J9RA 1BMFA 4C2UA 4ACAA 4PAMA 3WXMA 2DWQA 4IXNA 1U8AA 3K0FB 1X8KA 4Q4JB 4RD2A 1GRNA 3EWSA 3SFVA 4D0LB 2CNWD 1FNMA 2J59A 1UF9A 1ZC3A 4DLVA 3ND8A 1NP6A 3SQXA 2WJVA 1DVRA 1HV8A 2WSMA 1N6IA 4H1UA 3HYRA 1E96A 4ITRC 3DMDA 1NN5A 3VU9B 1YR7A 4JL6A 4LGMA 3E1SA 4DLTA 3AVPA 1KK3A 1NLFA 1BYUA 1RJ9A 1XTKA 2ZRAA 2B92A 2CLDX 2ZSBA 3B85A 5FOSA 4EIWA 4YXWA 1AS3A 3PQCA 4I1SA 1E79A 3KJHA 3KJGA 1DE0A 2R6GA 1IN4A 5L3VA 4EAQA 3TGPA 1NLZA 3BOSA 4KCGA 1T0HB 1Z8FA 1F5NA 4FW9A 1ZNYA 2F1IA 2JJ8A 3TE6A 1XWIA 1T3SA 3NXSA 4TSFA 2AKAB 2QQEA 4LV6A 1P62B 2W0MA 4XD7D 3WHLA 1G3UA 2Z43A 4D6PA 1U81A 3P4XA 4B43A 4KVAA 4PSVA 2H16A 3TR0A 2O8BB 3H1TA 1VYVA 4MH0R 1YZGA 3CM0A 4S2EA 5GJWC 4OKSA 2ZU6A 3UG7A 2ATVA 2FV8A 4BZXA 2EFCB 1Z29A 3R9WA 1MV5A 3HR7A 3X1ZA 1QF9A 3W3AA 4C0BA 4HLDA 1N5JA 1NKTA 2ZXUA 2D74A 1OKKA 3QE0A 1OW3B 1JR3E 3EAQA 4OJKA 3RABA 3EC2A 4KITB 4D26A 1G8YA 1EGAA 1CJMA 3QEJA 1NVXQ 1UEJA 4II7A 4XTRA 1KDOA 3LD9A 3LY5A 1NJGA 3GJ7A 1Z28A 1DPFA 2VLIA 1KJZA 1JQLB 4Q48A 1R7RA 1CR0A 2R62A 1NSTA 4ZDWA 2IYRA 1F3OA 3R9IA 2ZQ5A 2B0OE 1F2TB 1NMYA 3EIHA 4I99A 4NE2A 4IFBA 4HYYA 4TSFD 2GJ8A 2H57A 3N2IA 2VSXA 4LBWA 3TLXA 4LJ8A 2AWNA 1YRAA 2BVNA 2IS1A 3GJ8A 1GM5A 1SZPA 3CZPA 2GCOA 1G4AE 4GP6A 1AK2A 2JA1A 3B1VA 2ZI7A 3ZDQA 4F4JA 4M1MA 1BO6A 1FMLA 2GF9A 3C15C 3C5HA 2QPTA 3P4YA 4CYMA 4D81A 1RC8A 1LFDB 4MRRA 3S1AA 3GLFE 2Q9CA 2WAYA 2C5LA 1ZM4A 2O52A 1MABB 4WVFA 4ZCMA 4MGIR 1P9RA 2CL0X 4MGKR 4KSBA 3ZVLA 1TQ4A 2JJ1A 1FTSA 1HEIA 2AHOA 2W6ID 3HU1A 1KIMA 4GPTA 1CJKC 4UQOA 4I1UA 5SZHB 5H68A 3SHWA 3TSOA 5DN6D 3UPUA 3THYB 4TMXA 3UATA 3NHAA 5EUMA 5G3YA 4PTLA 2PLRA 2BEKA 1Z3IX 3AVYA 1LY1A 1RKBA 4V0KA 3CR7A 3X1XA 4LBYA 1OF1A 2GZAA 2KBFA 4DXAA 4JS0A 1E0JA 1H8ED 4GNKA 3DZDA 5LD2B 3DOEA 4NBSA 1B23P 3ADDA 1N25A 4H1VA 1AQUA 4JLJA 1KO7A 1NI3A 4YDSA 1S3GA 4TTRA 3B7GA 3LAWA 2QMEA 4R98A 5GVRA 2X1VA 2W2VA 2DR3A 2IW3A 5SZKB 1EXMA 2IYWA 2BCGY 5FOVA 2ZAMA 2XNSA 3GEEA 1IN6A 2HT6A 2EVWX 4PSKA 1E9BA 3SC3A 1YHNA 3TH5A 5E7IA 3KQLA 3MG9A 3QXJA 4OL0A 4XIGS 4ZV4A 4BLOA 2XGJA 4N3NA 2VO1A 4JVMA 3ZD6A 5H1YA 1L4YA 3WMFA 5FTNA 2FMXA 2IS2A 1W5TA 4JLOA 1W4RA 3HP1A 1XMVA 1U90A 1YZUA 3BB1A 2DFNA 4B6EA 3W6PA 3KKOA 3WYAA 2KB0A 2GHIA 3SJAA 5C4GB 1XJQA 3QI2A 5B58C 2UKDA 4DB4A 2OILA 3WMGA 3CRQA 1XRJA 2DY1A 3DZ8A 2WWWA 5HCIA 2UVQA 1KO5A 4JJZA 1M7HA 1GRRA 2CLSA 1XD8A 3QVVA 2H8KA 3I3SR 3PFIA 2VHJA 4RFSA 1F2UB 3EW9A 5LB4A 1XXHA 2PX3A 3GJ6A 3FE2A 2BIFA 1U94A 2VHCA 1E2HA 2GDJA 4MRNA 1IY1A 4KXFB 4TQUS 3CB4A 4YDHB 2RGCA 2NPFA 1Q0UA 5C4MA 4OI4A 1COWA 1SVKA 4LHXA 1ZM7A 5FOTA 3FOZA 4PC1A 3GD7A 2QBYB 2VQSA 3IIKA 3ZIAA 3TIFA 3VQTA 3NC1C 2YJTD 2JCSA 4ASUA 4F1PA 1JPJA 2A5GA 2WMOB 2RAPA 1XNJA 1A5TA 2V7QD 1D2MA 4OBEA 4Q4JA 2PZGA 2OBNA 4WBSA 1P2UA 1OHHA 2CJWA 2IYZA 3JZMA 4N0DA 5DN6A 4EPYA 1T4GA 4NYIR 3REGA 1JJ7A 5G40A 4UNNA 1PLLA 4QNMA 3NBXX 4AY2A 5EZ6B 5CK5A 2WKPA 1NMZA 3K9GA 2ZTSA 3IO3A 3BJIC 2QTFA 4DLZA 2VBCA 4M21A 4GI7A 3KKNA 2MSCB 4LJAA 5CYOA 1HH4A 4U02A 2DWOA 1HURA 1CIPA 1F60A 3D31A 3QBVA 1N6LA 1KI9A 1KI8A 3KJIA 4C0HA 4JLVA 5AUOB 3B6EA 3O8DA 1G41A 1VG8A 2AWOA 2B8TA 3L8YA 4Q4HB 1G7SA 1XMJA 1QVAA 4A82A 1W4AA 1S9HA 5D3QA 4X8MA 2Q3HA 3A1WA 3Q3JB 1R2QA 2ZPTX 3N70A 1EX6A 1NN1A 5L3QB 4E07A 2FF7A 2CCJA 4V0ME 2XOKA 3TQFA 3MSXA 4JT2A 4C7OB 2N42A 1CJVC 1G19A 3AKEA 1QHSA 4PQYA 1E9RA 5GADl 2PH1A 3Q5EA 4TWZA 4A36A 1ZUHA 1W0KA 2BC9A 2O0JA 2CL7X 4HZUB 4NP6A 1XEFA 1S0UA 2VHQA 2PJRA 3BORA 1AS0A 1TQ6A 4P32A 1SXJC 1Z0KA 5F9FA 3PUXA 3T06B 3KQNA 3H4MA 2KE5A 1XD9A 1O3YA 1Q3TA 1JXMA 4IW3B 1EX7A 4G5RA 3THXB 3UMRA 4DB2A 2BOVA 3T1OA 1WBBA 1EWQA 3WNDA 2QPOA 4RJLA 3VX4A 3WP1B 3I92A 3GFPA 1G7CA 1WE2A 3SHFA 3IIJA 1E2LA 2WJJA 3O8RA 2QEQA 2Q9AA 2HEIA 2MSDB 1XDBA 2GA8A 2OZEA 3X2SA 3QENA 1N2CE 1U9IC 5BXQC 3TUIC 3QOFA 4QJ5A 5DI3B 4FN5A 2ATXA 3K70B 2QQ0A 2SHKA 4XWAA 3T1TA 2CCGA 3SE0A 3TSWA 1WQ1R 1QZXA 2AFHE 4URYR 4LYHA 4B32A 3BE4A 1I4DD 4PAOA 1C9KA 5HE9A 3SOPA 3OIUA 1XPOA 5B57C 5H8WA 2W00A 3DO6A 5H70A 5JJKA 4UNSA 2YOGA 4XVRA 4ASUD 3L0SA 2QPAA 2GK6A 4BEBA 1G7RA 2C96A 2GVDC 5TMPA 4C0KA 3VX3A 4MQBA 4BFVA 4HAVA 1IOZA 3BERA 5JSZB 2H7VA 1XTQA 2P6UA 1LNZA 3CRW1 3P32A 2ECKA 1NBMD 1N5LA 1UBGA 2ANBA 2LCFA 4M8NE 1CULC 5EE5B 3AGQA 4Q1AA 1US8A 1H8HA 2CRRA 1H65A 2AK3A 2EFEB 2JDIA 2ONKA 2ZRDA 3QPUA 4BZPA 3NEJA 2QP4A 1XP8A 2ZJ5A 4ZI3A 3FB4A 3LBNA 3TAHA 2ZYVX 1TF5A 4L9SA 1NL3A 1Y3AA 2ZSEA 4V0NA 3IIMA 5HTKA 3ZZUA 1VCNA 3A37A 4BFTA 1SKYE 4B44A 1IXRC 3QKUA 3A1SA 3WYGA 3MDBC 2JGNA 2VH5R 3KXKA 5JLJA 4NYMR 4US1R 2XNDD 2AKYA 5EXSA 5JWOA 4A0FA 4DBLC 3KKPA 3QBTA 2XXAA 2ORIA 2P2LA 2VIIA 4Q66C 2GCNA 1GOTA 1KSHA 1GKIA 4Y0AA 4BRUA 4O25A 3R9XA 1ZM2A 3DM9B 3X1YA 4PHFA 2QTVB 2QORA 2WJIA 3M0EA 2WPDD 1HE1C 4OQMA 4DUGA 1B0UA 1EK0A 4D0NA 1KKMA 1QHXA 2HLDD 1V5WA 2WV9A 1P72A 1I2MA 2RGXA 3ZVRA 3LX8A 3RRNA 3IEUA 3SJZA 1OKKD 2KSQA 3ZVMA 2FA9A 4C4PA 1G7TA 3FKSD 4RZ3A 2GEUA 4V0OA 1K8RA 1N5KA 4ZCIA 3FEHA 2H92A 4NPHA 2ORWA 1KNQA 2ZANA 1OFHA 3CR8A 2HT1A 2GF0A 1A4RA 1UFQA 5E3HA 3KDSE 5AJWA 2W83A 2W2TA 1PZNA 1SVLA 1EWRA 1OFUX 2ZRCA 3ZLJA 1LF0A 3AP1A 1E2DA 2QY9A 2P5TB 2ZUBA 3GJ5A 4LBZA 4KO8A 3RWOA 5J4YA 2HUPA 4LI0A 2R65A 3SYNA 1OFTA 4RD6A 4DLWA 3A4LA 3QG5A 1N0UA 3NHBA 1E4YA 1XBTA 5FBVB 4A9AA 5FPKA 3U7GA 5DSZA 3CONA 2NOAA 1ZUIA 2HJVA 2XTMA 3FHOA 4Y0VA 4FMDF 1NG1A 3GPLA 4XTCS 2ZE5A 1WA5A 2RB4A 2WWYA 3N5CA 4KFSA 4V0MA 2OHFA 3OEED 4YMSA 3R7WA 1XTSA 2VHUA 1Z07A 4IXMA 1CR2A 3F0TA 4JMPA 2WTUA 4AK9A 4QG7A 4RFVA 1TEXA 4HAXA 2GJSA 2QA5A 5TXGA 4ZI2A 3QVUA 1P4SA 4XSGA 1G8HA 1JEDA 2ZSFA 3DVLA 3LV8A 4AURA 2CJWB 5G53C 4WXPA 1TNDA 2L0XA 221PA 4ESHA 3Q7QA 3QPWA 1IHUA 2NO7A 1FZQA 2J0QA 1AZSC 4GRAA 1QBKC 1KDTA 3T61A 4M1TA 3WYFA 2GILA 4IOKA 2Z83A 1WBDA 1X1RA 1G6OA 1SVMA 4NCKA 4QHTA 4M22A 1TL7C 3U3KA 1SGWA 2JAQA 4LJ4A 4RY2A 1L7VC 3SS8A 1XJCA 4Q21A 1G5PA 5FTKA 1NIJA 1MO4A 1DARA 4RD4A 4EJSB 2FFQA 2BWJA 2R6CA 3HR8A 2F7SA 3SBEA 4NYIQ 2X77A 5HE8A 2GAAA 1OXXK 1ZUNB 2QSYA 4F92B 2C2HA 4JVLA 4CRWB 4A15A 2IYYA 2ZS8A 3LDAA 1ZJ6A 2V1UA 3WNBA 1OPXA 4K81B 3CO5A 2A3RA 5JI3E 2QTHA 2ODBA 1DAGA 4FINA 3VR2A 5J40A 2O8EB 5L3SB 5IT5A 4AI6A 5FTMA 2YZ2A 1P60A 2QM7A 2ZE8A 2I1QA 4E5UA 1OH5A 1XU4A 2I4IA 1CXZA 2ZI9A 4ZDIA 1KOFA 2J0UA 4EPTA 2G77B 3A4MA 3OEHD 3GJXC 1XEWX 3HYTA 3RDPA 4YXWD 2ZM5A 3CPEA 2OAP1 1FQJA 3BK7A 4Z1MA 4CVNA 2V6IA 3OE7D 3GLGA 3EPJA 4HDQB 4ZKEA 4MDEA 3OZXA 3WMEA 4O0MA 4CW7A 2WOOA 4M1YA 4D25A 1NKSA 2Z4SA 4AYTA 1X8LA 4RKFA 3I8SA 1E2JA 2I1VB 4ESVA 4JBYA 4DLUA 1BMFD 2IK8A 3QG1A 1KI6B 3AF4A 4GOJA 2ZJZA 1RIFA 2NO6A 3C41J 5AJXA 4OYHA 5EE3A 5JJLA 3F8TA 1W7AA 2QMOA 2GEVA 2ZEJA 1LS1A 4HDCA 1JECA 4LDJA 3TRFA 5F98A 5JZVA 4DSUA 5KPJA 1IONA 5FOUA 1I4TD 3X1DA 3RWMB 3MAAC 4F4IA 3CPJB 5JMTA 3OFNA 3MUFA 4Q7JB 1SKYB 3P26A 4W7SA 2ZRNA 4BASA 3CH4B 3GP8A 3NH9A 1RRCA 2PL3A 2IA5A 2D2FA 2GXSA 3EASA 3TKLA 6Q21A 2Q3FA 3ADKA 1WCV1 4HB0A 4WZBE 2CNWA 2C77A 2GZDA 1VCOA 3K53A 2NZ8A 1M8PA 1EFHA 2FG5A 1T8UA 3AF3A 2RCNA 4B73A 3ADCA 3KTAB 2J0SA 2F43A 1NSFA 2G0TA 4B47A 4JVNA 3RS4A 3D3QA 1FL9A 4BFZA 4IDOA 3GLHE 4K46A 2D2EA 3M1IA 3IPYA 3MCAA 3I5XA 2WOJA 1E79D 3X1WA 1ZCAA 1UEIA 4ACBA 2QNRA 3K0AB 1Q57A 4PHTA 4YONB 2VP0A 3ASZA 3BAFA 2ZJ2A 2XZOA 1RPZA 2IWRA 5JRZA 3MWLA 1IY0A 4PPGA 1P6XA 4L4UA 4IDHA 4G3XA 4GT1A 3I73A 4GOKA 1W0JD 3NDPA 5CB6A 4U00A 1EFRA 2P6NA 1OH8A 5AWFC 2VP6A 4D82A 2KBEA 2PX0A 1XX6A 1VECA 2RGGA 5DHAA 4CF7A 1MRSA 4A92A 5KNDA 2FU5C 2ZUCA 1Z6AA 1KMQA 1XCPA 3A1VA 3CF2A 4B3DA 1W49A 3BC1A 3K09C 1GRQA 5E95A 3R7WB 4OHYA 5SZIA 3M6AA 5CK4A 4ZPXA 4QGGA 4KFRA 4Q7LA 1NVUQ 4PO8A 5L8VA 5EE1A 4KBFA 3U3JA 4B48A 2XTZA 4JKIA 2JATA 4JLAA 1P2TA 3R8FA 4JKYA 1HUQA 3J81k 2WBLC 4NTZA 2QAGB 4P4SB 3IPXA 1OB5A 3U7EB 4CT5A 2JLUA 2H1LA 3HPQA 1SVOA 3IBYA 5JSZA 3V00A 4IVQA 2FOLA 1G16A 4TT3A 1JALA 2NO0A 1MO5A 2BJVA 3BH7A 3KL4A 1DOAA 4M9ZA 4NYJQ 3VKGA 1E9FA 4BECA 2CHGA 1U0HC 3T5DA 5BN4A 3RS5A 4NONA 3SUBA 2QROA 3SJBA 2QE7A 3EARA 1OH7A 1W2HA 2BHRA 2CRWA 2P5SA 1NVVQ 4L8GA 2AR7A 4AIIA 1RYFA 2YVUA 4Q02A 3GFOA 4IOMA 3ZD7A 4QOSA 1TAGA 1X6VA 5JS8A 1SVWA 1XMSA 3A4NA 3OFND 4GFDA 4KYIB 4X8LA 2RKOA 1XEXA 2RGNA 3T5GA 4FI3C 2X2EA 3T35A 3OIVA 1U8YA 1IJFA 1TUIA 2QUZA 1KO8A 1PUJA 1E2GA 3AGPA 4ABYA 2XXAB 4Z51A 5HKKA 1Z0AA 1FX0B 4FCVA 2Z0MA 4CT4B 5FUWA 1N0WA 4GL2A 5DH9A 4POAA 2ZE6A 1G8FA 5CLLA 1L2TA 2OFWA 3FWYA 1CJTC 1KAGA 2CHVA 2ZRLA 4UXHA 4G5SA 1JPNA 3H84A 2J41A 3W9YA 4Q9JA 1KI2A 2DHRA 3FGNA 2FNAA 3T12A 3LJUX 2DWPA 1AKYA 2VL7A 3L2OB 3QQ5A 4KLZA 4Q9KA 5CM8B 5FPHA 4JLDA 4PXAA 5GJCA 2WWXA 2ZYUX 1R8QA 3NC0C 1VCIA 4GSYA 1VYTA 1UADA 2IYUA 2GK7A 4AD8A 5KSZA 3IEVA 1KNXA 3D7MA 2FN4A 3C7KA 1II8A 5BYJA 5LDDC 3AV0B 4ZCLA 2BBWA 1XCMA 4QHYA 5FOWA 1XPUA 5JHGB 1Z2AA 2AXNA 2V4ZA 3TMKA 4ZKDA 4U7DA 5IDVA 3A1TA 1M1YE 5EXPA 4B3BA 5J4LA 2FPLA 3PUYA 2W2XA 4DCVA 4KFUA 4PSAA 4TMWA 1DS6A 4XJXA 4C0QC 2XZPA 1YR6A 2NGRA 1F48A 1G4UR 1KJYA 2OESA 2KJQA 1R6BX 2WAXA 4C9BA 1FQKA 2JLZA 3FMPB 2J0UB 2JLXA 1JNYA 2F9MA 4G0NA 3B60A 1K5DA 4URZR 4A0RA 3AUYA 1ZIOA 4B6FA 5JWRA 1QHYA 4QBFA 3FHTA 2BJWA 1OSNA 2V54A 3MD0A 3QY0A 3FDIA 1CR4A 1D9XA 2PZEA 2WIAA 1CEEA 4P31A 2OO7A 2GBLA 3C14C 1E2PA 4PPNA 2ZRBA 1P61B 5AUPB 3U60B 2OT3B 3FYHA 2V1XA 4Q00A 2QI9C 4PC6A 3UK6A 1YE8A 2JLYA 3SZRA 1ZM9A 2ERYA 1XFAA 1XEWY 2JJ2A 1VDZA 2VP9A 1IAQA 3U44A 2P57A 1UJ2A 2PEYA 5KNBA 2O8DB 3DDCA 4P4TA 3U7HB 4PZLA 5CJPA 1ZD8A 4OQNA 5EXXA 4ARZA 1T5IA 5L3RA 4RCYA 4EUNA 2AXPA 1LV7A 3TK1A 5BQ5A 3B2EA 4Q01A 4TN1A 4TYYA 2HJGA 1OFIA 1M6NA 1R0XA 4IEIA 1E94E 3NBFA 1A2KC 3AQ4A 3KQKA 1COWD 2OSBA 1E98A 1D6JA 1Q1EA 3FMOB 4W9MC 2A5DA 4RZUA 3TUJC 2ZRKA 4DT1B 4PZZA 2X19A 5LD2C 4XVUA 2BKUA 4BLSA 1J90A 2X2FA 1RZ3A 3HWSA 2J0VA 2BBOA 3IHLA 4DC9A 5HZKA 2OBLA 1OH6A 1WB9A 5DGXA 4AKGA 4TQ9A 5DO9A 5KUTA 2IHBA 1EFCA 1ZU5A 4LUCA 4N0EA 4DSOA 3GLFB 2VF8A 4LPSA 3HU3A 4JLNA 2AD1A 3AF0A 3CWZA 621PA 2BV3A 3FKQA 4UKDA 3DEFA 2HF8A 2PCLA 2XJ9A 3LW7A 3JVVA 1OYWA 2GJKA 2EWVA 4OK3A 1U0JA 5DYIA 2HXSA 2WWGA 3IDQA 4QGAA 4QXAA 5KDLA 4AKEA 4JZKA 2A2ZA 3CF0A 1TUEA 2IEZA 3RRMA 4A6PA 1U2RA 4KI0A 4LC1A 1CRQA 1YZTA 4M1KA 3L0OA 1VHTA 1HT1E 2G0NA 4KHZA 1UBEA 5IK2D 1JR6A 1MOZA 4M1SA 1FUUA 4CGZA 4TTQA 1NVWQ 1N6HA 3EZ7A 4BZQA 1KO4A 1GILA 3B82A 2IYQA 3U3RA 4G5OA 1P73A 1KI6A 8OHMA 2CE7A 2IC5A 3QIAA 1KDRA 2GETA 4R7ZA 1TADA 4I1OA 2GJ9A 4HSEA 2ZJOA 1SVSA 4Q5IA 4TLCA 3UMSA 2GNOA 4AC9A 3GJ0A 1CLUA 1KK1A 2ZVQX 4TYWA 3I32A 1E0AA 4JSTA 2IL1A 2HDNB 1XCGB 1XTIA 1BOFA 4R71A 3UWOA 1ZIPA 2NO9A 1G1MA 2ZI6A 5DNYB 4OQFA 2QRZA 2YV5A 3SYKA 5F2EA 3KKMA 2GXUA 4TMTA 3RC3A 4B3CA 3KXIA 4PC3A 3MWKA 3ECCA 2IS6A 3NIBA 4NCJA 3IO5A 3CRRA 4GMXA 5FBLB 3KTAA 2Z6VA 2YHSA 3FKSA 4Q1DA 2IXGA 1AJEA 2JJ1D 2ZI3A 2C99A 1FP6A 3A58B 3NG1A 4FMCF 1S2MA 4B3FX 3U6KA 4GZMA 2VSFA 3K0CC 4PHGA 1JR3D 3C16C 1JQJC 2A9KA 1ZCBA 4FWIB 1JAHA 4KAXA 3JZAA 1IQPA 1KZ7B 3RYTC 2HCBA 1KO1A 4QRHA 3O47A 1VIAA 3NDBB 1G5TA 4PHHA 2QMHA 4OK6A 1FFHA 2IYLD 1Z06A 1HQYE 5KSOA 2J46A 5C2JB 3PEVA 2J7KA 3LQRA 4OQXA 2RHMA 4RZ2A 3LA6A 5B30A 3FVQA 2QP9X 2OXCA 2H18A 1KDPA 2D06A 2QMUA 1OLOA 1IBRA 4H9GA 3H86A 2CK3A 1J70A 4TLEA 5K8TA 1ONBA 5FBWB 1Z83A 4DUGD 4W5WA 3GLIB 3VR6A 1DEKA 4NH0A 4AYXA 5JCZA 3AVQA 3BXZA 4DCUA 3L0PA 4R9UC 4URXR 1AM4D 2CMKA 1ZBDA 2A7QA 2LKDA 4NL4H 4Q7KA 1PLKA 3B1XA 4WIAA 5IHPA 1W0JA 2WSSD 1XF9A 3DL0A 4QFMA 3CX7A 3QUSA 5FR2A 1RVDA 4JYBA 3U7FB 1XXHB 2FPKA 2Q9BA 1SHZA 4D4MA 3UXMA 1E2QA 1E32A 4MITA 1K6MA 4WZ6A 5E7JA 1KSFX 2BM1A 5GJBA 4ON9A 2A78A 1W2GA 3BD9A 2ZJAA 4BLRA 2QAGC 5FTJA 1OXUA 2WPDA 2EFHB 1DAMA 3AP2A 4A1FA 1WF3A 1SQ5A 1S4QA 3A1UA 4KSCA 5TV2A 3TNFA 2LKCA 4YQFA 2DFTA 1HYQA 1XD2A 4A6XA 5EZ5A 1LTQA 3QKRB 2Z4RA 4DLYA 2FWRA 3K09A 2YKGA 3CZQA 5J4VA 3LO5A 4Q4HA 3RSLA 1Q1QA 3OHMA 4BRWA 4ERNA 3SN6A 4Q18A 4RD1A 2XB4A 5KO2A 3PCRB 3DOFA 2PLFA 1RW4A 1KSGA 1KY3A 1XPRA 1FP7A 3CX6A 4NYMQ 5KYKA 4O2LA 4HI0E 2JLWA 2W6JD 4LHVA 4DWJA 5L3QA 1ESMA 2F6RA 3AVTA 5J4KA 4BEJA 4OJQA 3THWA 4LV8B 3ZH9B 3OEEA 2D7DA 3PIRA 4M0LA 4RFSB 3D8BA 4JSYA 3PR1A 3EA0A 2CXXA 3T15A 3ZIAD 1K5GA 4V02A 1VKJA 1G17A 4YMTA 3OEHA 4JLMA 1TMKA 1D8TA 3JUEA 4I4LA 1SXJA 4QKQA 3U6BA 3PJRA 4ARZB 2C78A 3T1VA 1E6CA 4AKIA 1CRPA 2NG1A 2ODWA 3THXA 3ZJYA 2FSHA 2ZJBA 3DKPA 4MKFA 4PAQA 2HYIC 1FOEB 4DVGA 4U5XA 2NPIA 1ZNWA 4LJ6A 1KY2A 3NWJA 1ZM3A 2RGNC 1WMSA 2XAUA 1TF7A 4NHOA 421PA 4WAUA 3CWQA 2EWWA 1UKEA 2P0EA 1EFUA 2ASEA 4MUAA 3V4RA 4LJ5A 1QHHA 3O8CA 2C9OA 4QL3A 3RSOA 2ZSAA 3IKJA 2RH5A 1D5CA 4QBGB 1T9HA 2ZUDA 4P4UA 2CVHA 2BBTA 2W6JA 4IRUB 3GLFA 4KV9A 1PVOA 5K8LA 1ZU4A 3W8RA 3NTUA 3GQBA 1XZPA 5FI0B 3WBJA 5AJYA 4M2LA 3CIOA 3UIEA 2EW1A 3GCGA 1GVNB 1P2SA 3K0SA 1CKEA 4MKGA 3I61A 1II9A 2ZJYA 1YU9A 1YZKA 121PA 2IYTA 4G5GA 4F4CA 1Q3HA 2CEAA 2C04A 3F5FA 5FL7A 5FI1B 3E5HA 4LPKA 2B8WA 2FGJA 3I1FA 3B1YA 3AM1A 5CB8A 1US8B 2OFOA 1DG3A 1L4UA 4F7WA 1E2KA 4DZZA 4C7OA 2GEDA 2VP4A 4DEXA 3AVXA 1TU4A 3LVQE 2RHDA 2OM2A 1GL7A 4R2IA 4DLSA 4URVR 4DDTA 1YR9A 1UBCA 1DCQA 2VPPA 1QDEA 3CF6R 5ANRB 3B5JA 4EPXA 4UNQA 3QXHA 5F3WB 3N2EA 2RGAA 1U98A 4RVCA 1P75A 2WWIA 1G3RA 2XJ4A 2VHTA 2IF2A 4HAUA 3RRZA 2VEDA 4A8JC 4C0SA 4D0GA 1G5RA 2OCPA 1E0KA 1DG1G 1UDXA 5FR1A 4DJTA 1JB1A 3PUZA 2B6HA 4NKRA 3G5UA 4RKEA 2REXB 4QJ3A 2O8FA 2YNMA 4HAWA 3K70C 1T5LA 2YC4C 4X8HA 5CDFA 1KK0A 4CEHA 3WP0A 3B78A 2IHYA 4WZAE 3KKQA 3DM5A 5D3MB 1KHTA 2Q3MA 3K8YA 5DI3A 3GMTA 4GOXA 1JXOA 2WMNB 5E4FA 5UKDA 2IYXA 1HT2E 1J2JA 5FL3A 1PLJA 4G01B 1CTQA 4MUBA 2XITA 5G3ZA 3TVDA 1KMHA 1LS6A 1NJFA 4MRVA 1BIFA 1AS2A 2R6FA 2VA8A 4JJKA 1VMAA 2JLQA 4M9SA 1N6RA 2G1JA 2QU8A 1E9AA 1G3MA 4EQ6A 2NQ2C 1GDDA 2IQJA 2WJGA 1H8HD 5DI9A 2FE4A 4MYCA 2P65A 2QZ4A 4QGFA 3RS3A 1GZSA 4IDPA 4RZXA 2QAJA 1CJUC 4CEJA 2D7CA 2GESA 2GAOA 2ZETA 4O2RA 1JEEA 5CYPA 3SYLA 3VNVA 1X1SA 4LY6A 2IEYA 3KB1A 3PXGA 4DCSA 5JCPA 4OQLA 3BFVA 4ZO4A 1R10A 2XNDA 3EWAA 4DIDA 3QSYA 2FDCA 1S8FA 4FWTA 1E9SA 4EJSA 1G21E 4AWXA 1H8EA 3ETLA 4QFVA 3U4QB 4BPBA 4Q7MB 4US0R 4PANA 2ZRFA 1E2IA 3WHKA 5ELXA 4ZIRA 3Q72A 2QL6A 1OT3A 4OHWA 4TL8A 2PT7A 1DAKA 3VKWA 1DTSA 2C03A 3EXAA 2GBLC 1M2OB 4TQAA 5CJ2A 1EFRD 4QHSA 2ONJA 2F55A 1QHGA 3THOA 4NCIA 1JJVA 2GCPA 4B75A 3K1JA 1JI0A 1P3JA 3W34A 4D80A 4NYJR 5AJZA 5HCNA 1RJ9B 4CEIB 3EPHA 4LV5B 4Q1EA 3QKSA 2FZ4A 1UKZA 3WY9A 3HU2A 2ZRGA 2X8AA 3LXRA 2RGDA 3BWDD 1DAIA 1J7KA 2VRWA 1YQTA 1JAIA 1IN5A 5BWMA 3B8HA 3BIFA 3QJYA 3ICEA 1OIXA 2IXFA 3EZFA 1TQ2A 1UKYA 2QG6A 4E22A 1Z0JA 3TJZA 4LZZA 3L43A 1NY5A 3AKCA 3DPUA 4EDHA 2D62A 2ORVA 3DMNA 5AJVB 2WM9B 3L0IB 1IN7A 1TF2A 3Q85A 4TLAA 5FFMA 5C1BA 1IXSB 4B33A 4HB4A 4DSTA 4Q9IA 1FNNA 1SXJE 2ZS7A 3QF4A 2ODEA 1GKUB 3EC1A 3U5ZB 4OHZA 1Z5ZA 1WRBA 1C4OA 4KLNA 2EU8A 1EG7A 3OIYA 1XXHE 5LB2A 3LLUA 5KNCA 3R8CA 1GITA 1R0WA 1GUAA 2DBYA 1W0KD 2WKQA 2ZI4A 2O8EA 1TX4B 2VSOA 2CE2X 4TT3D 4TLBA 1C1YA 1IM2A 3B1WA 4HB2A 4RCZA 1W36D 1Z47A 3H0KA 4WXRA 2XSZD 3QKRA 1G6HA 4XVQA 3VR4A 3W6NA 3LX5A 2MSEB 3GJ4A 3IQXA 4FIDA 3CNLA 3EX7C 2RMKA 5DLQC 5FUXA 2GZHA 2WZQA 5AR1A 3W5JA 4LHZA 1LF5A 4JBWA 3M4YA 3RLFA 2V7QA 4DLXA 2N46A 2O8BA 4OK5A 4PPFA 3T1QA 3VU9A 4QBHA 3K9HA 4YLGA 5DYGA 3Q8XB 3QXCA 3MJRA 4TL9A 5KPDA 4KJZA 3VHLB 2AFIE 2FGKA 3L8ZA 1E1QA 2O8CA 2RGBA 1FPMA 2F43B 1AKEA 5FBQB 1OXSC 3MLEA 4DHEA 3AUXA 2V8OA 3C8UA 4D4JA 4TZ0A 1SHKA 1ETUA 2QGNA 3ND9A 1UM8A 1VG0B 2WJHA 2QT1A 1XTRA 1GIAA 2PT5A 5HR5A 4DLRA 4FCWA 1A2BA 4KFTA 1OXVA 3RRYA 2MMCA 4QM6A 1QHNA 5JFGA 2OCAA 2IT1A 3FMIA 4DEYA 1P7CA 2UZIR 1TPZA 2Q6TA 4M1WA 1D2NA 4BFXA 1DO2A 1YZQA 1CR1A 3BH6A 3MFYA 3EIQA 4HDOB 4RSGA 2YWHA 3NKVA 2FEOA 4NDZA 2PJZA 1KAOA 4B74A 4E09A 3TBKA 1M7BA 1UBFA 1YZLA 4ILEA 4S35A 3MGCA 1XB2A 1R8SA 1Z6GA 2IF0A 1GG2A 1LB1B 4PQRA 1E3MA 4QJ4A 1G20E 1AGPA 5EE9A 2C8VA 3EIEA 1CS4C 1NN0A 4HLUC 3RANA 4YC7A 4A2WA 3FHCB 4QGHA 1E1QD 1NRJB 1OJLA 1TU3A 1EESA 4EQ6B 4LJYA 2NIPA 2CDNA 4CDGA 2QAGA 1SVIA 3OIWA 3EZ9A 1XZQA 1SXJB 5GJVC 4EFMA 1T3HA 3ZYCA 3V9PA 4TLDA 3V4FA 2VTKA 1W5SA 2BDTA 4LK2A 3NVAA 4CEJB 3TAUA 5FBRB 3RAPR 1PV4A 2F3RA 2AK2A 3VHXA 4HAYA 3K9NA 1Z6YA 2D4HA 3UKDA 3RC8A 3QXSA 1DAHA 3SR0A 5TB5A 1M7GA 2HCJB 5EP4A 4R2HA 4NCHA 4PFSA 1BS1A 3RS7A 2FFAA 1N6NA 3UANA 1E9CA 1E9DA 4QNRA 4MRPA 2V55B 2WHXA 1E4VA 3VNUA 5FUYA 1SXJD 3ADBA 1RE0A 3AKYA 4B2PA 4HZIA 4LJ7A 1KSJA 3SJCA 3SNHA 4WA7A 1E1RA 1T3LA 3PUWA 5FUVA 3HPRA 5IF9A 1AIPA 4IVRA 5G41A 4OHVA 4B2LA 5P21A 2B21A 4CZ2A 1F6BA 2A5YB 1DAFA 2DFKB 1GNQA 1MO6A 3ZGXA 5AUNB 1IXZA 4PO1A 3ICQB 5D3MA 4KYUA 1UDWA 1VIYA 4PO9A 3GEHA 3LBIA 4DCTA 3W5IA 1ZMXA 1ZD1A 5CDFE 1E2MA 3SU8A 2V3CC 2OCYC 4LYAA 1QG4A 4FMDB 3K0CA 4OI2A 4LHYA 2B7BA 1WDTA 2YWFA 4LYFA 1ESNA 5EP3A 2J1LA 2WKRA 4LBVA 3HJNA 4UNRA 1Q1BA 4TYPA 4LJ9A 1W46A 2NTYC 5M04A 3OESA 1MH1A 2WJYA 3LXXA 5EP2A 3AVOA 2BMDA 2FSGA 4IFEA 4EFNA 1S3SA 4HUQB 3K70D 4PX9A 4WW0A 4D2IA 2O0KA 4F38A 3THYA 2EYQA 1OE0A 1BKDR 1QRAA 1YRBA 2A5FA 4MKIA 1RRFA 2IYVA 1YKSA 3L82B 4JBXA 2QSZA 5FPSA 2XB2A 2D3WA 2REOA 2VF7A 1CU1A 4M1OA 1DO0A 2KI5A 4TL7A 4L16A 1D2EA 3DWDA 3FFAA 3TR5A 3KQUA 5DISB 1AQYA 2Z5FA 1N0VC 3NH6A 1ZP6A 2R9VA 1KGDA 2OG2A 4ZDJA 2YOFA 2GXQA 2VYFA 3BGWA 3KZ1E 4XWKA 4HUTA 1ZC4A 2ZYTX 1UKVY 3QPVA 2YWEA 2P67A 3FM8C 4XH9B 1XMIA 2BBSA 2J87A 2E1RA 2N1BA 2YYZA 2ZE7A 2OAQ1 3KFXA 4L9WA 3CBQA 2NO1A 3AP3A 3PITA 4W5HA 1T0JB 4HLQB 2G88A 2H17A 4OI1A 5KTYA 1RYHA 3TQCA 4EPWA 2DCUA 3KJEA 4US2R 2Q0HA 4JL5A 1G291 1G18A 1CBUA 1DELA 1Z0DA 1ZINA 1MT0A 4C0LA 4YMUA 3KXLA 4AKHA 4MYTA 2EFDB 1VPLA 1IN8A 1ZVQA 4Z54A 3SQWA 1NBME 4BWYA 3U4QA 1G64A 1ZW6A 4LC0A 4NCNA 2HV8A 2DFLA 4QC2A 3AB3A 2FX3A 4BLTA 5B2ZA 1GP2A 1XEXB 4MGZR 4W5JA 3QF4B 1YVDA 2VP5A 3PUVA 5F9HA 3FFBA 4K8OA 5BW8A 1R0YA 1LVGA 1ELOA 3A36A 4PPQA 1G8GA 4B71A 2R6DA 2UZ3A 2RGEA 2ZRIA 4JLPA 2IXEA 2ZRJA 4IJMA 4EPVA 3LH5A 4CEIA 3H2YA 2CK3D 5BN3A 4IEEA 5JBQA 3E2IA 1QG2A 3T34A 4Z8YA 4NU0A 2O0HA 1QHIA 3KQHA 3W3ZB 3U44B 4HZUA 4Q4AA 3BRWD 5TDHA 521PA 4A8JA 1YR8A 5CITA 4IOLA 4HEJA 4L5BA 4LHWA 3BB4A 4LWZA 2W6IA 4GP7A 1Z6XA 2QM8A 2WSSA 5KHOC 3LLMA 2EFGA 5FPYA 1MKYA 4B2IA 4HATA 3I62A 5J4HA 2DYKA 1R0ZA 1II8B 1E2NA 2BMEA 1A82A 4IKEA 4BFSA 3MWJA 4XWOA 5JEEA 4B34A 2GVZC 5KSPA 2O8CB 2ZIAA 1O87A 4M53A 2AD5A 4TMKA 1R5NA 1Z6TA 4FMBB 4BFWA 4FCTA 1ODFA 3VMFA 2AX4A 1P9NA 4NMMA 2R6AA 3NEYA 2BMJA 4UXJA 2JEOA 3WRYC 1NMXA 1HE8B 1S1CA 3W6OA 5EE0A 3CRVA 2GWHA 4C30A 3QF7A 1VG1A 3CX8A 4DDWA 2ANCA 2QENA 4P0TA 1TQDA 2WWHA 4MYUA 3CNOA 4WOPA 4G1UC 3WRXC 5BYKA 1U9IA 1GNPA 3EG5A 4BLPA 2CHQA 3QNUA 1DADA 3ZS9A 3LQQA 2ZR0A 3QKTA 3ASYA 4Q4LA 1HA3A 3KX2A 1BH2A 2VP2A 4EJSC 1IJEA 1P5ZB 5CM9C 2IUSA 4OI0A 5B64A 5JI2E 2BEJA 4DDVA 2QRNA 2XSZA 1AN0A 2R44A 4IHQA 4PQFA 3RS0A 2O8DA 4BFUA 4XOIA 5JEDA 2JASA 3VAAA 4JL8A 3EA5A 4M9QA 3PENA 4TYQA 4TTPA 2CBZA 5KDDA 2ZR7A 3WBKA 2ERXA 2ZJ8A 3B1ZA 4P33A 4PC2A 3RS2A 2MMGA 3P20A 3B13B 4MYHA 4D4KA 1FTNA 1AGRA 1GAJA 2LWIA 4DT1A 4GZLA 2FSFA 5JHHB 2NMVA 2PZFA 3K9LA 4IOJA 4Q1FA 1YZNA 2BM0A 4A4DA 2OUKA 2G6BA 1E0SA 4B3XA 2HXYA 2QT0A 2OWAA 3VR3A 3RVBA 1N6OA 4JT4A 4Q9HA 3A6PC 2OBMA 2J3EA 1RRGA 5FL7D 2BMFA 5EP1A 2AN9A 2BKEA 5SZJA 1NY6A 1NF3A 1BYIA 4TYNA 1GTVA 1FW6A 2QP3A 4BGDA 5LPNA 4LRWA 4UXIA 2IX3A 1AZTA 4IDQA 3B9QA 3VTKA 3VFDA 1U8ZA 3NBYC 1Z08A 3REFA 1E2FA 2FEMA 3GLIE 4DKXA 1TTTA 2WICA 5FOXA 1CF4A 3EZ6A 1OHHD 3CRMA 3EPLA 2ZRMA 4TL6A 3AEZA 4M9XA 5GVSA 1NG9A 1E99A 5AK0A 1V43A 1HY3A 3GJ3A 1GL6A 4MKHA 4UJ5A 3QEOA 2IYSA 3P27A 3RHFA 1W44A 4Z8XA 4AYWA 2V9PA 5IRCD 1W4CA 2QGZA 3GLHB 4MRSA 4QM7A 2XZLA 3OAAD 2ZROA 2OFXA 3PEUA 4B35A 1DBSA 2YINC 2ZYWX 2FSIA 3MRSA 4F93B 4XD7A 5J5CA 4GMDA 2FFBA 3NBZC 3JVUA 4HUQA 4DSNA 4X8OA 2NZJA 1N5IA 2QN6A 3A8TA 1G8PA 2REBA 5FTLA 1Q20A 1Q22A 5EUQB 821PA 3R20A 1PUIA 2DPXA 1HQCA 3U2QA 5C46F 1Z22A 2AL7A 1P2VA 3KUCA 3VKHA 5KSYA 3FTQA 1Z63A 1S9DA 4BUJA 1Q12A 2A5JA 1N6KA 1RFLA 3CH5A 1OB2A 2ZI5A 1OYYA 2XOKD 3AF1A 4A0GA 3LRPA 2WVJA 1P9WA 2C9CA 3DHWC 4C0AC 5TARA 3AVWA 2PMKA 5C18A 1W48A 2PMDA 3VR5A 3D6TB 5HPYB 1W36C 2F1JA 1QVRA 1W36B 1KI1A 1S96A 3I4LA 1E2EA 4P3YA 3PV0A 4Z1MD 3K0FA 2G3YA 2ODNA 2R8RA 3G82C 4LOAA 2YOHA 1RRPA 2W0SA 3EPKA 2A30A 1JBKA 1J8YF 4JVSB 4FD2A 3GLGE 2CCKA 3KFVA 4CIDA 4URUR 4BE7B 2GXAA 4DIEA 5BN5A 2G83A 4A2PA 2IBMA 2KWIA 3AKDA 2R2AA 4G5QA 1KI4A 5FH9A 5HKKD 4Q1CA 2OXRA 1VG9B 1QHHB 1U99A 2JJ2D 5DE3A 1KKLA 5FPTA 3LVRE 2IWHA 4B3GA 2K5UA 1I2DA 1GNRA 3AVUA 3ZZTA 4LCBA 3THWB 1NN3A 5DHFA 2J7PD 3BB3A 1ZNXA 3IGFA 1KZGB 3BH0A 2CLCX 4JIMA 1G3QA 3AH8A 2PCJA 1XJ0A 5CLQA 1NBMA 1DAEA 3P1JA 1WP9A 4IVPA 4V0LA 4ZDKA 2G1KA 5JWHA 2YWGA 3IILA 2XEXA 1VCMA 1D9ZA 3LNCA 2JDID 5TVKA 3UMFA 5E7MA 2GKSA 4E03A 3GLIA 1M74A 4RD3A 3LWNA 4UNPA 3QXXA 1N3BA 3ZZ0A 1E69A 2C9YA 3K0EA 4MDFA 721PA 2GRJA
chains in the Genus database with same CATH superfamily
1PL0A 1JEOA 3S4YA 4KGXA 3BK1A 3T4PA 4JOSA 3LQJA 1Y89A 3F5QA 2O07A 3G2NA 5EJEA 4R8SA 2KFTA 3SM3A 5ENZA 1BD3A 1TMGE 1Y6JA 4RGBA 4HTAA 5LOVA 3QUQA 4O02B 1FMFA 3TW4A 1XC7A 3G3EA 2CVFA 4LADB 1DUIA 1QAMA 2V6JA 1TEVA 3NU1A 3R77A 4X97A 1Z0FA 4WXMA 4G84A 3W2HA 1X3SA 3F8WA 1GNVA 1LKZA 1RXCA 2WUDA 1SQFA 4R2MA 4V03A 4YYEA 4CMIA 1L7AA 2PIDA 3TWOA 4BEVA 4E31A 3T0IA 1ELRA 4LYJA 1QE3A 3MMPA 5CPFA 3MS7A 1V1RA 1Z13A 2CHXA 2D8SA 2MHKA 1E7YA 1YT5A 2R7MA 4FXPA 5K0ZA 2OMEA 1UJ6A 2EQBA 2BH2A 1TEZA 1H5UA 5AK4A 1H05A 2EGUA 2CL6X 1R88A 3TFWA 3OSZA 4F5EA 1VMIA 2B4AA 1OZHA 1SIOA 3FPAA 5FJIA 1NE2A 3R7NA 3SX2A 3VR1A 1F2TA 1STOA 3I76A 1O03A 2LDRA 1PT7A 1QZZA 4XE5A 1TYAE 3EB9A 1WIWA 1ZDMA 1MPTA 2YUIA 3CVUA 3WMWA 4X00A 2ZLBA 1E0DA 5LBUA 5LYYA 1X7YA 3U09A 3QWAA 3THYB 3UXYA 3IOCA 2FXVA 4QXOA 4C0JA 3A10A 4ARIA 3IAM1 5JC1A 5A4JA 2J3DA 2ZVPX 2D3TA 1ZNZA 4OHFA 3SJUA 2JIRA 3WO1A 1BEEA 3TXNA 5KS2A 1K6JA 1ELWA 1XP5A 3LGAA 3RANA 4JQYA 3GLGB 5AI5A 3NM6B 4V2IA 1I3CA 1YACA 4L72A 4I1PA 1H19A 5LU8A 3R0QA 4KRFA 4KNYA 4FYWA 4QT0A 1GPLA 3TD9A 5KKAA 2ZWOA 2YTZA 3WX0A 2JIZD 4R0NA 3COJA 1DO8A 5F2NA 5KSWB 2E4YA 2QN1A 3H5VA 1LXCA 1SBHA 3ONDA 4C2BA 4LGVA 3EF3A 4MULA 1Q16A 1NBHA 2HIGA 4HO1X 4QYXA 3C2QA 2J9YB 1C7FA 1GFIA 2WIDA 3CF4G 1BX0A 1W52X 2GPSA 1M2HA 4GQIA 4KWHA 1YL5A 3EJ6A 4RGQA 4URWR 3TBHA 3WLHA 4XIYA 2IIVA 2F3UA 1MR3F 2RJ3A 2WYWA 1X9HA 3VYVA 3GUVA 2FBNA 4TV9B 1Q0HA 2OHJA 2JUNA 3G9QA 4YCDA 5AKXA 2FMIA 3REQB 2AEMA 3T3GA 4EBFA 3D5QA 3HFSA 1S4MA 4NCXA 1YA4A 3S1AB 1XZMA 1KJIA 4Q47A 2ZETA 3WYEA 5CFLA 1LDBA 1XSEA 2EL9A 2O8VA 3GLHA 3U3OA 2QE7D 3W1VA 3O4IA 4BTAA 4D4LA 4QT4A 5J47A 4BERA 4G0ZA 4B4OA 1FJGB 3ZZMA 1T91A 1L3CA 2P3SA 3KAKA 4L51A 2QVGA 4GUAA 4KXVA 5IABA 3NYQA 4BFYA 1BDHA 1XVLA 4NJEA 2H5EA 3WNCA 4MMYB 2O8FB 2IUUA 4AN1A 1W73A 3GRPA 2WQHA 4PCLA 1WF6A 3GZJA 4N5HX 4NPCA 4YPOA 4MSXA 2HRZA 1KK2A 3C1UA 3N07A 4J7AA 1HTWA 4ZALA 4ZC8A 3RLIA 2Y8EA 3QFSA 1CEYA 3CNNA 4MCAA 3GA5A 5EQTA 2I4TA 4FR0A 4PBRA 4HTFA 6ADHA 3FIJA 1MB9A 4HJRA 4CGYA 2C98A 2FHPA 2YC2C 2PBRA 1N6PA 3PQ7A 4GYOA 4IQFA 3O8LA 4M4SA 1PTJA 4AUEA 2FUUA 1Z5SC 2JJQA 1EGMB 2ZISA 3HJAA 1U2QA 5C3MA 1L5KA 3IVXA 2QX8A 3WGQA 3D5TA 4ND6A 4EPRA 4KIJA 2V0GA 1L7DA 5CA0A 3GLUA 2YNMD 3SS9X 1UXKA 2O20A 1L5JA 3E5MA 1O97C 3VJKA 2GEBA 3OCXA 4ND2A 1JS1X 3T1NA 1PL6A 2XTNA 4IVNA 3ZTWA 4DQKA 1OXTA 5JD6A 4X41A 1TZMA 4EW6A 4FHEA 4ABNA 5CVJA 4Z6KA 4A6EA 4NXMB 4I66A 5FADA 2B7CA 2BY4A 3S27A 2OEPA 4J0QA 2XDQB 3IE1A 3HJFA 3HJCA 4TSRA 1U8TA 2EINE 1QH9A 3P5BA 1E1RD 2FPMA 1ZD9A 4EJ6A 4BMSA 3TGOA 2NXWA 4LHEA 1Q0TA 4UP5A 4I7DA 3FUMA 3KEOA 4B8ZA 5KIAA 2QY7A 2VNFA 1LFAA 3MTGA 2E0IA 2X8BA 3OD1A 5I48A 4Q9LA 1JVNA 3GV0A 2PZAA 3CUEF 1NPDA 1R0BA 4NOJA 4REMA 3LFTA 4OXYA 5K3FB 3VC3A 3VNAA 2N3ZA 4BNJA 3LPCA 4ECEA 2KREA 2EP7A 5G04B 2E9SA 4FFWA 3QPCA 4CKZA 2IXTA 1TCVA 5JQGB 3I8OA 3ONWA 2Q4RA 4RGYA 4E2FA 3AR9A 5JOQA 2DJAA 4DV3B 1ZRHA 3MWYW 3CKLA 3E2PA 5E38A 4Z99A 1M34E 3DMYA 1V8OA 2C95A 4YRGA 3GMIA 1MAWA 5JASA 2ZBRA 3AY6A 2DAPA 4A0HA 1OV4A 3LP8A 2WTAA 3G02A 1C9EA 1TIBA 3Q0TA 2VDVE 4XAQA 4CNBA 2XR1A 2V59A 1GPH1 3UT5B 3GCDA 5AN8A 5DM2A 3DBOB 2REQA 3B5EA 3CLTC 4H1WA 4QDJA 5CG2A 1RM3A 3GA0A 2IS4A 1H6CA 2F8YA 1J99A 1S8NA 4ALLA 3G2OA 3EYWA 1KTIA 4JLKA 3WDKA 4X9XA 4O08A 4ZQGA 2FR0A 3QVKA 2QLJA 1XCLA 3ZPV1 2ENUA 1BI8B 4L22A 2Y6UA 1E1MA 4GM4A 4ZVRA 2XEDA 3R5XA 4E85A 1HTTA 1YDMA 5C3UA 1U8AA 1UCFA 1VLVA 4UAGA 1E7QA 2CDBA 2GSDA 2BDUA 1GRNA 1OZFA 2WUWE 3QOYA 2I6HA 1G2PA 5JG6A 1YJQA 3L77A 3DEJA 3LG2A 3WS7A 4B7CA 2PUFA 1XA3A 3SF0A 3VPFA 1RQRA 1UF9A 2J59A 3IA2A 3T3PB 4DLVA 3HRAA 3ND8A 4GPZA 5HUHA 4WKCA 3SQXA 3RPEA 5ENTD 2LP4Y 2WSMA 4OBXA 2R8BA 1YJCA 1WO8A 1WUTA 3R5TA 3GW8A 4ITRC 2FEKA 4A7PA 4AJHA 4O5OA 2ACVA 2ZTLA 3E1SA 4DM7A 3HHMA 1NLFA 3AG3E 1IIRA 1BYUA 1RJ9A 2Q4EA 3E9RA 4DNXA 1F6DA 3V2OA 5FOSA 3ORRA 4YXWA 3ESYA 4I1SA 3QU7A 3KJGA 2O3TA 4PRKA 1DE0A 2R6GA 721PA 4I55B 1JH8A 1LDKC 1FFGA 3SIPA 3MAJA 3R74A 5IS2A 3KEMA 1Z8FA 3ND5A 1F5NA 2O19A 2V74B 4D99A 2F1IA 1D1QA 4M1EA 4JP2A 1QQ7A 1V8PA 2MINB 1R8YA 4R9RA 2LXPC 2GKGA 3JQEA 3LOQA 4I46A 1L5HB 3IAHA 4J0GA 2P9PG 3ASHA 3IHVA 4XD7D 2Z43A 3QVSA 4D6PA 1U81A 5BRNA 4RTJA 2RHTA 4KVAA 3RYFB 3Q1KA 2O8BB 3PLWA 4F3RA 2HWYA 1YQQA 2VLBA 2Y1EA 4M0CA 3GZNA 4S2EA 4X91A 1XRLA 5B7PA 1Z4IA 1V6SA 2P58C 1R66A 3PRKE 5DYNA 4YWHA 1E2UA 2J6IA 4AQDA 4F9TA 2YMQA 2KWOA 2AZ4A 2D0DA 1RCUA 3P9RA 3HR7A 3T5BA 3X1ZA 2GCGA 1JWFA 2WILA 2W98A 3OOJA 5IWCA 3K31A 1OXJA 4HLDA 4RAQA 1E5XA 5HS0A 3AIMA 2FWNA 2BGTA 2VNKA 3BMQB 3H04A 1EQ2A 3TL2A 5JAMA 2P3LA 1JR3E 2XMRA 3E1GA 5L4SA 4XDHA 3RABA 4RA6B 3EC2A 4D41A 1N8TA 3EXG1 1KIAA 1EGAA 3FDJA 3DYBA 5D5PA 3QEJA 1UEJA 4M88A 1V3TA 2OQRA 2FW1A 3CKCA 2ZIFA 4MKRA 1Z28A 2P40A 2QX6A 3M6IA 4PBTA 4RENA 1XCOA 1JQLB 4Q48A 3HV2A 1PGOA 3WLRA 4XYLA 2ECIA 2FUG6 3KYCA 1YQ9A 2ZQ5A 4XWTA 3KBBA 4XYGA 3SF8A 5LLDA 2CSYA 3LKDA 2UYCA 2JD1A 3NJRA 1C1DA 1NMYA 5B3KA 1N1MA 4WD3A 5AH0A 1J09A 4I99A 4NE2A 4XWYA 5E3JA 1RHRA 4LBWA 3OJCA 4PNEA 4YAEA 2H4WA 2RFAA 3I0ZA 5K5EA 4DL9A 1F0PA 4IRXA 3I1IA 4EY5A 3BHIA 2D6FA 5DNVA 5JYEA 2IS1A 2IFTA 1QGUB 3O4JA 2GN8A 4UUBA 1PK8A 3HSKA 2GCOA 4UE2A 4WN9B 4APOA 1AY0A 1G4AE 4GP6A 4MQUA 2YQMA 4EFDA 2EZUA 2ZI7A 3ZDQA 1XDSA 4ACKA 3DT6A 3WMRA 3ZUPA 4Y6GB 1Z9BA 1JHMA 2HU5A 2W8BB 1T4CA 4D81A 3ZCSA 2C1EA 3I0MA 5BO5A 1ZVKA 3ZCTA 1FVHA 3TQOA 4ALKA 3B7BA 1ZM4A 3MTIA 1MQAA 1MABB 1YL6A 4LJLA 3SSAA 1TN6A 4ZCMA 2R6JA 3PWZA 1P9RA 3PDIB 4GKBA 4KSBA 4OSOA 3Q7FA 2XY4A 2JFPA 4P7KA 4RPJA 5AVOA 3UN1A 3BCRA 2QZZA 4IHKA 2I2XB 3HB4X 4OXRA 1G63A 2AHOA 4K6FA 1MA0A 4X65B 4KPUB 2VAPA 1N7HA 1R8JA 1SQGA 3LWZA 5SZHB 3UM2A 1P4RA 1SN7A 1XHFA 1WCWA 4NNJA 4TMXA 3W7AA 4CKWB 4PTLA 4F56A 1AQ6A 1IHPA 3DWIA 3AVYA 1A8HA 3ZV6A 5IARA 4JPSA 4P58A 1E1CB 5C4IA 1YGPA 2PJDA 4N0QA 5BPPA 3EDMA 3E05A 3IPRA 4UMVA 3X1XA 1EFAA 2KBFA 1OCZE 3UM0A 3ZW7A 4BDTA 4S12A 3DZDA 5LD2B 4HDSA 3GT4A 3ZJ5A 1JXAA 4B93B 3ADDA 1HK7A 1NI3A 1KO7A 1V7CA 3FSRA 4ETIA 1BG6A 4TTRA 1MFZA 1EM6A 2PZJA 2QMEA 3QQPA 4R98A 4Y7CA 3SXUA 5CB0A 5LWQA 4UDNA 2GPJA 2X1VA 3BQNB 2KPOA 5BQOA 4RYLA 2XE6A 3R6WA 4KIFA 4MQ5A 5IM5A 1NVEA 2ATCA 3JQAD 3GEEA 3UUWA 1IN6A 4P80A 1Q2ZA 4AF8A 1ZBDB 3SC3A 3TDKA 4CF5A 1PKXA 3SMVA 4RIHA 3MG9A 4FC6A 2NAPA 3D4IA 3DE7X 1TLFA 4OL0A 4DIOA 1JJBA 2VAVA 1Q74A 4JVMA 1GY8A 4HXEB 3PNMA 4OGFA 3EXIA 4AZ0A 4HJXA 4Y2VA 5JXHA 4EYKA 5FTNA 5FQNA 2JW5A 3JQFA 3FGPA 1KYQA 3JZIA 4MGEA 4EH1A 2NSHA 2X23A 1EP9A 2R4QA 3KIPA 5J2UB 4CG1A 4G0QA 1YZUA 3BB1A 2PS9A 1UFKA 2PG3A 2DTEA 1HYJA 1N75A 2XS8A 1JEJA 1SD1A 1JA1A 3C3MA 4B6EA 4BGEA 3UTDA 4EEZA 5I5EA 3W6PA 3KKOA 3U1TA 3WYAA 5KTTA 2CUKA 3LKBA 3PDJA 1XJQA 2GWRA 4Q3LA 1RE1A 5SICE 1QFMA 3FI9A 4DX1A 2W90A 3WMGA 1B8NA 3CRQA 2HOQA 4IY1A 4HRAA 3NAWA 3EDOA 1UC9A 2WMYA 2X7XA 4MV5A 3R7DA 1JAXA 2PUJA 4O4LB 1M7HA 2X8WA 2XUKA 3RUEA 3LGSA 4CM3A 4ZHQA 5CG1A 3I3SR 1Y42X 2Y0BG 2XEVA 3HKCA 3WK4A 2CV0A 3C24A 5EX0A 2OYRA 4BCCA 5FB1A 1GZVA 4TRMA 2AEJA 3KR2A 4BN4A 1I4WA 5LQRA 3HUTA 2FQ1A 3D2BA 1T0BA 1BCSA 1WU7A 4PZPA 3WB2A 2BGJA 2JF0A 2PX3A 3GJ6A 3UPTA 4UWLA 3FE2A 2OXFA 1U94A 2DVMA 4LXHA 1E2HA 2HFKA 2GDJA 3BXOA 3B9RA 3TINA 3OZVA 1IY1A 3IP1A 4TQUS 1YC2A 4IPTA 1EVZA 2NPFA 2ROQA 2OECA 3QSGA 2DPHA 4NG5A 4UDOA 4ZA2A 1EAYA 5EQJB 5C4MA 1SVKA 4MI6A 5FOTA 2AG0A 3WGMA 4G81A 2M85A 4KIGA 3FOZA 1JQKA 1M6HA 4PC1A 1KVSA 4YGYA 1IHOA 2VQSA 3ZIAA 1X1EA 1OMOA 2JAPA 2OZLA 3GXOA 3NOQA 5KJNA 3TO5A 4P4GA 3BE5A 4ASUA 4K3UA 4AZVA 1QCCA 2A5GA 1V11B 1ISIA 2HUNA 3GA7A 2C82A 2PZGA 3L6UA 3TZKA 4ZEWA 4BU1A 3M1YA 2GSWA 3JZMA 4ND1A 3IHPA 1ZEMA 3MWGA 4RK1A 3UJNA 2JHAA 3FPHA 2VNJA 4BVLA 5CA1B 3T5VA 1MX5A 3KT3A 4N5NA 3ER6A 4ZT3A 3RD5A 3UK1A 2Q2WA 4QSMA 4BJHB 5J1SB 1SQ0A 1U9CA 4BVKA 4AY2A 2JHCA 1DRJA 3SBTB 3RYHA 5LA6A 5C1OA 2WKPA 1NQTA 1SKBA 3IH5A 3STTA 4I9HA 4KP7A 4ZU6X 3WLFA 2QTFA 3BZWA 2W11A 4DLZA 4JN6B 2R00C 1FDIA 1VL0A 2Q1TA 3BCUA 2GZRA 1ESDA 4IILA 2FUIA 1HH4A 2VRCD 3CVYA 4N49A 3UFBA 1CIPA 2SCUA 1EVKA 3JATB 4E33A 3U49A 2XVMA 4EOGA 3KJIA 3PTAA 4TROA 3F49S 4JLVA 3TD2A 3UWMA 4ZHSA 3I01M 3O8DA 4IIJA 2NUTB 1NFQA 1N8KA 4FS8A 2BDEA 2WLTA 1XMJA 3CVXA 4RETA 4FSXA 4EK9A 1W4AA 3IMKA 4GR4A 3FHLA 4DHWA 5D3QA 1N4RA 4MVTA 2Q3HA 3HVKA 4X8MA 4S1WA 1GG9A 1R2QA 1LDNA 2XRYA 1EX6A 1NN1A 1I0LA 2GUWA 1NKVA 4GZ3A 2P5UA 2PHZA 2CCJA 2YBEA 3NASA 4G37A 1W93A 3CXRA 1SKMA 1AGXA 1GPAA 2IO2C 3C7AA 3BMCB 3MSXA 1F2DA 3K2QA 3TSYA 4CKCB 4JZYA 1MM2A 1AB6A 1JPLA 1FFAA 1PWYE 3PPXA 4ISBA 1Q2UA 3MZLB 4RH1A 5D3KA 5EESA 2O0JA 4O4JA 3RTDA 4EYQA 2I80A 5B7GA 1DC7A 3Q7RA 2V3VA 3A27A 5AVQA 1LJUA 1TJPB 1TQ6A 4P32A 4UVDA 1SXJC 2VFAA 1Z0KA 3D2CA 4BO0A 1XTBA 1DXOA 2O2YA 3H4MA 2KE5A 2GRRB 1XD9A 1O3YA 3FHJA 1WTCA 1RR6A 4KH0A 5EIAA 4DB2A 5G0VA 1Q7GA 2EJBA 2XEEA 2BOVA 2QU7A 4YRJA 4OLAA 1WBBA 1PQ4A 4YLEA 3WNDA 3IA7A 4TVSA 3GIDA 5HKBA 2PYZA 1QX4A 3I92A 4MKZA 4U7WA 1G7CA 2CMHA 5M3BA 1ZUNA 3H4IA 1LTHR 3IIJA 1E2LA 2R1TA 3O8RA 5JE8A 1R64A 5EL0A 3NYIA 3OAWA 2MSDB 2GA8A 2OZEA 1XKXA 4HPXB 4NFSA 3AG5A 1N2CE 2BFCB 3R3WA 2CDRA 4KO2S 3X2SA 4QGSA 4QJ5A 4ERXA 2ST1A 1D8AA 1NA5A 1JMYA 2QMZA 3OF3A 4FN5A 5DI3B 5C8YA 1S8AA 1N2XA 3V1MA 5IC4A 1VKZA 5ARGA 3HCFA 4X3OA 5CNMA 5KHLB 2CCGA 3U5OA 2KBXA 1Y5NA 3DAGA 2AFHE 2IU0A 3KSRA 8LDHA 4EI7A 2BHTA 3BE4A 1GTZA 4AOFA 1DQZA 1C9KA 3GF4A 4PAOA 3OIUA 4XSVA 4GE0A 3ZU6A 4BTVA 1XPOA 4IQ0A 1QAOA 1Z82A 5F5XA 5H70A 1DJPA 1XQWA 3ZWPA 3B89A 4XVRA 1WEHA 3O2JA 1JVSA 2QPAA 4M0UA 2GVDC 4C0KA 4TV8B 3BT7A 1N2OA 2F3QA 1IOZA 3IVGA 3HL0A 4PUCA 1SBIA 4XX0A 4DJDC 5EJ7A 2VT3A 3ELDA 4U0SA 5FWAA 3TI9A 5BXUA 3ZKJA 5JNTA 2P69A 5LXTA 1G8JA 3DXFA 3KP1A 4I19A 3ZCXA 5CVTA 1UBGA 2ANBA 2GYUA 3BL6A 2LCFA 3LZCA 4I4TA 3P9SA 4JJFA 4K6CA 4LNUA 1CULC 2GAIA 4MVJF 4OATA 3S70A 5JAUA 1US8A 4F3NA 4U2FA 1JIIA 5H4HA 5DHSA 2B78A 3VNQA 1E61A 3V79K 3MRTA 5CP8A 5IMSA 4ANFA 5G2OA 4CLRB 4ZI3A 1XP8A 1YONA 2W6NA 3K3PA 3L46A 1E1DA 4QAQA 1CQWA 2ZYVX 1OI4A 4G1BA 3TAHA 4DIKA 2ZSEA 1DG9A 3AI7A 3IIMA 4O33A 4V0NA 1VCNA 2ZTMA 3WGYA 4WKOA 3MUNA 1OLSB 2GROB 2Y2VA 3P52A 3K6SA 3B7SA 3KXKA 3TB4A 1ECBA 2XNHA 3KZNA 4NYMR 5LX8A 1SUIA 5JWOA 4A0FA 2Y1CA 3R5FA 1J7JA 1QBGA 3EGXB 3B5IA 5D85A 5H3LA 2ORIA 1B2LA 2VIIA 3A4VA 4WMLA 2GI4A 2GCNA 1XZAA 5ADWA 2XIQA 5CURA 4DLQA 1VMDA 1ZM2A 5JVDB 5LM3A 5FKJA 2KS6A 4NDNE 1L6IA 3I37X 3N8IA 4X54A 3SEFA 1EBUA 3M0EA 1DC3A 2LNDA 1HE1C 4N41A 3K5WA 1LBSA 1W8DA 1G21B 4DUGA 1UIRA 2XTJA 3BQMB 2HMVA 1KKMA 4IV5A 4WZAA 2I1JA 1Q84A 4D0NA 2JD2A 2RGXA 2QZAA 3FAZA 5B4VA 3LCJA 1PJ3A 3ML8A 3NAQA 4NQRA 3SJZA 3VUFA 3ZVMA 3UOGA 1RPNA 5EIBD 2XNCA 4QD3A 4AM8A 5C9ZA 3ASLA 4M7WA 4NPHA 4Y6CA 2ORWA 5M29A 3GWGA 1C3VA 2ZANA 3NVMB 4G0OA 4L73A 3ZBUA 4AY6A 1UFQA 1M67A 1GLVA 3CRZA 1YTLA 4WT7A 1IC6A 4WZZA 1QANA 5CT8A 2UVDA 3QOWA 4X71A 2M6MA 1KC3A 1SVLA 2VDNB 3RSQA 2ZRCA 4OHOA 1UPAA 3UH1A 4TTVA 2Y9PB 2OCKA 4IIVA 1H5NA 1NX6A 2XUOA 3AP1A 1KMMA 2QY9A 4LBZA 4WKPA 4DR5B 4HNAB 1B6SA 4HQ6A 4KO8A 4CT4A 5J4YA 2IOYA 4CLEA 3H9CA 4N3AA 4M0EA 5JH7B 4NU6A 2R65A 2W4QA 2VZ9A 3AKZA 5K2MA 4RD6A 4PBSA 3CEJA 2LGKA 1CUYA 2JC3A 4X6LA 2ZSHA 1LK5A 1V4BA 3TEFA 3SR4A 3VR4H 4OLBA 3NHBA 2VSNA 3D6MA 5FBVB 5FPKA 5FWYB 5EIXA 1FT2A 5DMHA 2NOAA 3FHOA 4Y0VA 4MVWA 3FTYA 1HPLA 3A3YA 1A04A 1FBNA 1NG1A 4BO3A 2PQ6A 1WA5A 1SQSA 3OEED 4YMSA 4G8BA 3KS2A 2X0NA 1Z07A 2R1UA 3F0TA 1AA6A 5LLSA 3MUOA 3VSDA 4P29A 5EPEA 1KF0A 3TG5A 4QG7A 3ASUA 1BS9A 4ID3A 3UZUA 1Y1LA 3LJ3A 1WGMA 1UZNA 1SBCA 5CDYA 2QA5A 4D8TA 4LJRA 4ZI2A 1INLA 5KEIA 5ITZB 2E55A 1AT1A 4XSGA 5D01A 1Y4SA 2HXGA 1JEDA 1EU1A 3DVLA 3LV8A 2PY6A 2YXDA 2CJWB 3JQ8B 1M8FA 4WXPA 4BNMA 4Z49A 221PA 2Q41A 3I2IA 2CLOB 1EPUA 1IY9A 3CE6A 5CUQA 1DWPA 2C97A 5IVDA 2GPNA 1RC1A 1RJFA 1XQ9A 2J0QA 1QBKC 4FLHA 1SH7A 4M1TA 3WYFA 3QBEA 4MW0A 4J94A 4RF5A 1WBDA 4MK4A 3V31A 4NX2A 3S6JA 1K7XB 1KJQA 1APBA 2CNOA 1RLIA 2JAQA 4GVPA 2AW6A 1L7VC 1P29A 4DMKA 3FVTA 1MO4A 1N2CA 3PRHA 4ER0A 5HXAA 3NTOA 2R6CA 4B83A 5U9CA 2O54A 3FPLA 3L17A 2VJNA 4Z4QA 1JCSA 2DBAA 1RYDA 2IKSA 2M6RA 3JTMA 3L1KA 3SBEA 4NYIQ 1WXGA 3JYPA 2X77A 4PLPA 5EJFA 2GAAA 1OXXK 5EMNA 3TQRA 5B3SE 2JCVA 5C1DA 1IUNA 4EZJA 3USZA 3GUYA 3KSLA 2ZS8A 4QARA 3ZXUB 4HQKA 4BB0A 1JWGA 3OT4A 4F4HA 3H4TA 3H2ZA 1VRWA 2A3RA 1KIFA 4G0VA 3C6QA 1DAGA 1ZGBA 2O3UA 3L8CA 2G6TA 6ABPA 5L3SB 5IT5A 2JG3A 5F3RA 2O8EB 5FTMA 4E5UA 2I1QA 1JPVA 2QICA 3OZRA 5I9LA 4S04A 1KE2A 2QYUA 2EBHX 4V3IA 3VU8A 5HDQA 3P4UA 3WJ7A 1KOFA 3HVUA 3A4MA 3OEHD 4PYNA 3L0ZA 3KV1A 4EKGA 1BAPA 1C1XB 2HBZA 3A04A 1P0PA 3BK7A 3S7BA 3D1JA 4M1QA 3OE7D 1I2ZA 3U7IA 5K6AA 2VOJA 5DP1A 3C1OA 3D7NA 1Z4MA 3DVQX 3KZXA 4ZKEA 1GFSA 3GDFA 1DV2A 3LUGA 2CKLB 1XELA 3OTOB 2VJCA 2PMFA 5HIMA 3WMEA 3QLJA 2WOOA 4M1YA 4BQIA 1DJLA 3RSEG 2Z2JA 3DZCA 3GPCA 3ICVA 2X0IA 1CF2O 2AJDA 4RKFA 1TOAA 3Q8MA 4R5HA 3I8SA 4MVYA 5D0QD 1DLIA 4TS3A 1P4AA 2QK4A 2F8XK 1IMOA 1SC1A 4MWZA 2HA2A 4JBYA 4O62A 2C1ZA 2IK8A 1EK6A 3AF4A 2G9VA 3HBNA 3ZVKA 4UUNA 5DEOA 3IBTA 1Y1PA 3WK7A 4IJ6A 2VS1A 3C41J 2H9AA 5EE3A 1JA0A 4LA4A 4KMMA 3G2VA 1NNUA 1KQNA 5FWXB 4FM9A 3BVPA 1PS8A 3TOZA 2ZEJA 2VT2A 1JWLA 4F4DA 1WETA 1JECA 3T8MA 2FHSA 3FH0A 4LDJA 3T3DA 4H6VA 2WDZA 2ZPUA 4FK5A 4YDWA 1T2AA 4PYKA 4N47A 3WLPA 1EP1B 3LYHA 2IJGX 3HKBB 4IUBS 4QYTA 3PZDA 3FAKA 1HRKA 3FD8A 3WNVA 3X1DA 4RK5A 4YT8A 3C97A 3MAAC 4AUKA 3JQDA 3TG8A 2IU4A 2PUBA 3A9WA 1BORA 3DAOA 3HV0A 4TS1A 3Q3VA 5JVDA 4URHA 1SUDA 5AJUA 2P27A 3DBSA 3M89A 3OLZA 1EVYA 2O14A 3CH4B 4HN2A 4ODIA 1KY5A 2PWBA 3NH9A 3ROKA 3GP8A 3QEAZ 1I9GA 2PL3A 3FN4A 3CC8A 2D2FA 3EASA 3DFIA 3PNBA 4X94A 3GUHA 3V4VB 5FAXA 5LZ4A 4TRQA 2Q3FA 1KEVA 1U3UA 3ADKA 3JASB 4LCEA 3QX3A 3H2JA 3ITNA 1OXKB 5BV8A 1K2WA 1CQXA 1Y4UA 3X44A 1VCOA 4EAAA 2NZ8A 1M8PA 2FG5A 2H4FA 3AF3A 3ZE9A 4YT4A 5EQFA 5J08A 2QUKA 3DOOA 3HXCA 2CNBA 2VJQA 3JY6A 3LX4A 1NUQA 2WFAA 2LCQA 4C4YA 2F43A 1PV1A 3DDOA 1NSFA 3NAZA 3OKFA 3TNYA 5KVSA 2F6NA 1Y81A 1R8XA 1U0NA 1NZFA 2NV6A 3KDPA 3UMVA 1MMFB 1FL9A 2FG6C 4GVXA 4BFZA 2VCHA 1KEKA 2NYJA 4HGQA 3MWFA 5T6BA 1MTOA 1FSGA 4UFPA 1HDRA 4D3SA 5K8CA 1YA8A 4A1SA 1I2CA 1K9VF 1TMOA 3S5JA 2C7PA 3T3OA 5ICFA 3O7MA 5LDHA 2OOKA 3ANNA 1C81A 3OXGA 1UEIA 2B4RO 2QNRA 4J9VA 4ZRNA 3PFFA 2CXTA 5TT0A 1E6LA 4NMHA 1CSEE 1PL7A 1DV1A 1RPZA 2NXCA 1TYQG 1D03A 1IH8A 2UDPA 1ATIA 3WLJA 5I47A 3E53A 4PPGA 3ACBA 3VDNB 3HGQA 1Z4OA 1W0JD 2HNAA 2JEZA 2I4NA 4BV2A 4RSRA 3RS9A 2P6NA 5GV8A 3KV3O 3K2IA 2KBEA 3MBKA 2PX0A 2F1KA 3MLAA 4Y9UA 5J5AA 4MMXB 4CF7A 5DHAA 3WVNA 1MRSA 2OYCA 4A92A 1ZKMA 5KNDA 1YA6A 3CF2A 3G0OA 3QLEA 2PAFA 4MQEA 4RQAA 3NRBA 4BQPA 1RTTA 3U4HA 4EO4A 1WESA 5JIBA 4KFRA 2ZJ7A 2JKZA 3PLNA 2DERA 3DRAA 4Q7LA 3LQHA 2P3OA 3CLSC 2X9QA 1I3LA 4KBFA 4OB7A 4B48A 5L8VA 2JATA 1P2TA 5LZ9A 3R8FA 1NUUA 2QS9A 3J81k 2DBRA 1M5UA 2WBLC 2WWTA 2XCLA 4OO3A 4B76A 4PONA 5IG2A 1OB5A 4BX3A 4HH1A 1PG0A 4CT5A 2L18A 2KXPC 1ODKA 1SVOA 2CD7A 3GJTA 5JSZA 4IVQA 2XDAA 3DLIA 1G16A 1Z26A 2QTLA 2YCBA 2YW9A 3HB1A 1JCRA 2BJVA 4HWSA 1YB6A 4JI1B 4LF9B 3F1KA 1I7QB 2C7GA 1UOHA 3A7DA 2Q2QA 5JS7A 4BECA 2PUEA 3DXKG 2QVBA 5CNJA 1NATA 3OBBA 3RS5A 4NONA 4EUSA 3FMVA 3WYCA 3SJBA 1XROA 3EGDA 1PSZA 1U7DA 3JWJA 4QO8A 3ESZA 3FB1A 5KJMA 1W2HA 4L8GA 3NVKI 5LKTA 1NVVQ 2RI0A 1J1UA 1WCXA 1NRIA 4CF3A 3QA9A 2R03A 3RTRB 4XX1A 4YWJA 3QKYA 2B99A 2ZBDA 3GFOA 1OBHA 1P1BA 4M9CA 4Q02A 1VGVA 4B1FA 1RU3A 2QNIA 5SY4A 3K71B 3A4NA 1HOXA 3OFND 2RKOA 1KH2A 2RGNA 4G1TA 3L08A 2GBIA 3LMKA 4OGGA 1KDYA 4FI3C 4LX8A 5DGIA 5HNKA 5CECB 1RNLA 3TX6A 2GM4A 4J90A 4NQZA 3PVZA 2PUHA 2QT9A 2SKCA 4CYMD 4FCVA 3CV0A 5EYLA 1NR5A 2GK4A 3WZMA 3MGAA 3F6EX 4YMHA 1IZ0A 1CUZA 5ALUA 1EE2A 2MU1A 1L2TA 3FWYA 2A9PA 3WC4A 2CHVA 3DQZA 1FSZA 2IHZA 5T3RA 3O4RA 2IPOA 3ZUVB 4FBLA 4RVBA 3W9YA 3FVVA 4D6YA 1K7CA 1KI2A 1TLLA 1XQXA 4Q9AA 2FNAA 1Z18A 3LJUX 2JD0A 2O6HA 1L7NA 2DWPA 1IZ7A 2YVRA 4U9IS 5COBA 2H2IA 2XT0A 2FPUA 2VL7A 3L2OB 1JU9A 1VKNA 3R3YA 4KLZA 4EYSA 1WOMA 3O4GA 5CM8B 3RODA 4JLDA 4P9NA 3RTGA 3ZD9A 5DM60 4YALA 2WXIA 2XH8A 4DIMA 2ZYAA 4D97A 1VCIA 4GSYA 3KYIB 3MCVA 2IYUA 1I6WA 1PAUA 3AYXB 3L1VA 3K6RA 4DLPA 1KNXA 4HDRA 1NNSA 2FN4A 3D7MA 1NUSA 3WQSB 1II8A 2ZYDA 1RXEA 2IYPA 1H69A 4URFA 3UX4A 1U28A 2BBWA 3FPSA 1XPUA 5JHGB 2V4ZA 2R7AA 1CDDA 4C4ZA 4ZKDA 3K8QA 3A1TA 1M1YE 2X13A 3OE5A 3HS3A 4ZVNA 5JDIC 1WLSA 3DZKA 3NGLA 3PUYA 3WR5A 4PSAA 4DCVA 1HMPA 4JUDX 3HCCA 4C0QC 5CB4B 2HSGA 5LJLA 1RI5A 5AM4A 2B1IA 4LS3A 1P3Y1 2O2CA 1R6BX 4C9BA 1EWKA 1FQKA 3CHRA 3EQ9A 2WTMA 2J0UB 2EP8A 3I2KA 2NZUG 1TVMA 2JHGA 4G0NA 1L4EA 2IEDA 1TC2A 4HBDA 4URZR 2XMGA 4A0RA 5CLGA 6GPBA 4FLFA 2WFZA 3WGJA 3W04A 4B6FA 4ZQEA 1M2FA 1HZ4A 1QHYA 2R68A 4AP4A 1O96A 4YGXB 1U11A 3MD0A 5KVVA 3QY0A 2RH4A 4MA5A 3R75A 1CEEA 1KWGA 2BYTA 1IEWA 2A84A 3D9KA 4MCHA 4BY9E 5C8XA 1PZGA 1E2PA 3C14C 1YA0A 4MAMA 4QYIA 5BW6B 3Q15A 4HX5A 4B0OA 1QUEA 3U60B 4OCZA 1EUCB 4Q00A 2HO1A 2JLYA 4PC6A 1YE8A 1YHZA 3UHAA 3U56A 2V6BA 3M9WA 4XYBA 1X39A 1XFAA 2JJ2A 1O6FA 1VDZA 1H6PA 2AFVA 1IAQA 4BO4A 4F1KA 4A55A 4K5QA 2O8DB 3DDCA 3KJNA 4RGVA 4XFJA 3U7HB 1KP9A 3IP7A 5K3EA 2G4CA 4H18A 1WTAA 1PT5A 3EPRA 4UVIA 2C4NA 5DASA 1T5IA 2HQSA 4K88A 5FNZA 4JXZA 4LN1A 4RPCA 2Y1FA 5EZQA 1T2FA 4I50B 5B37A 3TK1A 3M4ZA 1LLQA 2JI4A 1QKKA 5A9TA 2JCBA 4TN1A 3VVCA 2CWDA 2P4HX 3VAZA 2JFOA 4HNTA 1FDVA 4ENTA 1M2KA 3VTXA 3PKZA 4EATA 3NBFA 3CEQA 1RPTA 3KQKA 1P77A 4WTOA 1Q1EA 2H06A 1R15A 3Q1LA 1H6BA 2HX1A 5IH3A 5JVDF 2A5DA 2P9TA 3FZGA 5BWBA 1E7SA 1GPKA 1SPBS 2BKUA 2Z95A 4BLSA 4XVUA 2JHFA 5DNEA 1RZ3A 4ZZ3A 1Y3BE 3RT1A 1EFDN 2BBOA 3FI0A 2QN8A 3WGLA 4DC9A 5IXJA 1TLTA 4C6TB 1WB9A 4MVJH 2QIPA 5DO9A 2KCLA 3WRYA 3JWEA 4LUCA 3NP7A 3OWOA 4M7RA 4N0EA 1OFUA 4QAJA 3ZWQA 1DKNA 3UT0A 4JFRA 3DE4X 4YJHB 2FUKA 621PA 2AI1A 1LPNA 1QO9A 4QJIA 1P2FA 5JYCA 2QL9A 3ZU3A 3GEMA 2HF8A 1AVTA 2XJ9A 2V5UA 4ZFNA 3JVVA 4JX8A 3C3AA 3LPMA 1U0JA 2HXSA 2X1HA 4AKEA 3M6MD 2I76A 3PGMA 4AJWA 4O2AB 1FYXA 2A2ZA 3V8EA 1F4LA 2OD9A 3EDCA 3RU0A 4TUUA 5IDWA 4AQYB 3RRMA 4A6PA 1AV6A 1BKYA 1Q7EA 2KLHA 4HOSA