3LVQE

The crystal structure of asap3 in complex with arf6 in transition state
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
476
structure length
420
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
source organism Homo sapiens
molecule tags Protein transport
total genus 126
structure length 420
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvqE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvqE04
3L82B 2PLFA 3SU8A 2ZE8A 2IYLD 1YRBA 1OYWA 1QVRA 2ZI5A 2FOLA 4ZCMA 4BLTA 1E9DA 2EFGA 2QSYA 4WZAE 4BWYA 1KYIA 1XWIA 2CRWA 2QT1A 4MKFA 2XNSA 2WKQA 1OT3A 3Q5DA 1GP2A 2RCNA 3QNUA 2GEUA 2AD1A 2R6FA 3L0IB 2R62A 1MV5A 4PZYA 3KJIA 4I1UA 4N1AA 3LW7A 1SHKA 1XNJA 3KDSE 5J5CA 1UEJA 4HAUA 4QRHA 1X6VA 3LLMA 4TTPA 3SUBA 3BWDD 3U6BA 4ZV4A 3QIAA 4ARZA 3P26A 1G4AE 2WSSA 3CZPA 3N2EA 1WBBA 1DPFA 4IVQA 4CEJB 1UBFA 3ZGXA 2B8WA 1OB5A 2QAJA 3X1YA 3IILA 4B75A 1P5ZB 4A36A 2WSSD 3K0FB 5J40A 3QBVA 4QBHA 4TYQA 3WYAA 1ZAKA 4EJSC 5FI0B 5AJZA 4LC0A 2JATA 3RWMB 3EX7C 2GCOA 3D31A 1IN5A 2OXCA 4C4PA 3KUCA 5CM8B 2O8BB 1QBKC 4A8JC 3TUIC 2Q3FA 1QG4A 2LKDA 4HDCA 4NCJA 1N5IA 5JI3E 4C0BA 2IYYA 5CM9C 2WOJA 1G3QA 3AP2A 5FL3A 1W5TA 2IXGA 3GJ3A 3JVUA 4US2R 2BMDA 3M1IA 5FFMA 3EXAA 3JUEA 2VO1A 3K09A 4PC3A 4IOMA 1S1MA 4ACAA 1DE0A 2O8FA 1X8LA 2VP4A 121PA 2V54A 3A58B 4NP6A 4B76A 4DC9A 1Z63A 3QUSA 2CCJA 4DDVA 4Z8XA 1GKUB 3M4YA 4PSAA 2AR7A 4XH9B 3RYTC 3QXCA 3TAUA 5G41A 3UWKA 3KQNA 2PZEA 1M74A 3DEFA 2FGKA 4PHGA 1Z6AA 4TMKA 1CTQA 4KJZA 4PR0A 4TMZA 1KI3A 3L8YA 4OI4A 4I81A 4PQYA 3DVLA 1S2MA 4EIWA 2Q21A 1BYUA 4DEYA 1VHLA 4MITA 2ZU6A 4M21A 3GFPA 2I1QA 4LX0A 3K53A 3RC8A 1CR2A 4YMSA 2P0EA 1AQUA 1M7GA 1GITA 2N1BA 2OLJA 1HT1E 2J0UB 1Z0KA 1G5TA 2OV2A 2GHIA 2WPDA 3RRMA 3VNVA 1SQ5A 1DO0A 3EG5A 3PV0A 3RS3A 1DO2A 5KSYA 1RFLA 2HT6A 2C04A 1VHTA 2WPDD 4EJSB 1N2CE 2V3CC 3SJBA 1TF2A 4JBXA 1II0A 1G5RA 4A6XA 1NRJB 2BBOA 3FHOA 3A36A 4LI0A 4CGZA 5UKDA 2C9OA 3ZH9B 3EIEA 4US1R 1GNQA 2Q3HA 4HZUA 2W58A 3BFKA 5EZ5A 4AIIA 4MH0R 1U0HC 2PH1A 2H16A 2BVNA 2WKPA 2QTVB 5B64A 4LJ7A 5BN3A 3DZDA 3BGWA 5KPJA 2DFTA 3AH8A 3RS0A 4BECA 2HJVA 2VTKA 3I5YA 1EESA 2VSFA 4NONA 1AQYA 2RB4A 3WRYC 1KJWA 5EZ6B 2CHVA 4PZLA 5DH9A 4OI0A 4OQFA 5IK2A 4D25A 4HAZA 1QHHA 3MLEA 3LY5A 3W5IA 1G17A 2RGCA 4ON9A 5IK2D 4RD3A 1WA5A 1N0UA 3GLIA 2JLUA 3ONWA 2HXSA 1IXSB 3Q8XB 3SC3A 1QG2A 1GDDA 1RW4A 5FI1B 4IFBA 3LVQE 1E9BA 2G6BA 1DOAA 4CF7A 2HV8A 4L9SA 4NMMA 4P4SA 1NN3A 3CNOA 1UBCA 3MD0A 3PEVA 1OHHA 2GJKA 2XZLA 1E0AA 2EU8A 3NWJA 4Q4AB 4KFTA 5HTKA 3WXMA 3U4QB 2OFOA 1Z8FA 1OHHD 3I1FA 2QPAA 4BEJA 4K8OA 2GBLC 3AP1A 1WE2A 1EXMA 2OO7A 3QKTA 2YOGA 1KNXA 1RJ9B 2JJ2A 5B57C 3THWA 3NC1C 5L8VA 2W2XA 5EE1A 3EZ9A 2JJ2D 4JL8A 3DM9B 3SN6A 3A1SA 2X8AA 4S35A 5E4FA 3VU9B 4B73A 3KTAA 1FMLA 2R9VA 4CW7A 4B71A 5DGXA 4JMPA 1KK0A 1ZW6A 5KSPA 1KMHB 3ADBA 2XB2A 2IYTA 2UKDA 1U81A 4C0JA 3REGA 5JWRA 5DIFA 4QJ4A 2FG5A 4AYXA 2KWIA 1ZD9A 1WCV1 1T91A 4TZ0A 3KB1A 2IYRA 3IQWA 2ZRFA 3OE7A 2IYZA 4RZUA 1HYQA 2EQBA 2BC9A 3ND9A 3A4MA 5F9HA 4AKGA 2W00A 3OE7D 1DS6A 5CIWA 2X19A 2FFHA 5JFGA 4NHOA 2QE7A 4BASA 3BH6A 2GCNA 3SJZA 1KK2A 4LPKA 3K70D 4XVUA 2QE7D 4ZCLA 3B1WA 3EC1A 2OSBA 1LS6A 3TRFA 4U5XA 2JLRA 2VP2A 1K6MA 1L4UA 3MWJA 1DADA 1G9XA 2OWAA 1MT0A 1N5KA 1S1CA 1DAFA 3QEJA 3QY0A 4RCYA 1NG9A 3B9PA 4AC9A 2Q9BA 4KO8A 5D3MB 3GJ7A 2IYWA 3R8FA 3VR1A 1ZNXA 4DT1B 1CIPA 1B23P 4A0FA 3C41J 3CX7A 2XTZA 2J0SA 4R9UC 2QNRA 3SYLA 3W3AA 2A5DA 2WJGA 1IONA 3ZJYA 2EWVA 3EPLA 1DAMA 1DAIA 2ATVA 3U44B 2IBMA 2YNMA 4MDFA 4WIAA 4C0QC 2F43A 3AKYA 5L3RA 1TQ6A 2CL6X 3SYKA 2IS2A 1G8FA 2ZRAA 4L5BA 2W6IA 4C0AC 3CF2A 4MDEA 1NIJA 2BHRA 1E94E 4TQ9A 2W6ID 3X1ZA 5L3SB 4QM6A 1GKYA 4OI2A 1HURA 4PTLA 3UG7A 2ZRDA 2FU5C 4JSTA 4L8GA 1EGAA 2XAUA 4IOLA 4O0MA 4KU4A 5FR1A 4QKQA 2CVHA 4TLBA 1J8MF 2DB3A 4QFMA 3GD7A 3SZRA 4RKFA 3RC3A 4LC1A 4TN1A 5FUXA 3ADDA 4F7WA 3N70A 2G88A 2ANBA 4YXWA 5J4HA 1S9DA 1IBRA 4IDNA 4O2LA 4XD7A 3OEHD 4YXWD 5CB6A 3AUXA 3L0OA 4GI7A 4E22A 2XXAA 1EFHA 5FPTA 1WQ1R 4XD7D 4BLPA 3R9WA 1BS1A 3W6OA 3QEOA 4V0LA 2ZM5A 1ZCAA 3R20A 5HZHA 1LVGA 4PSKA 1VECA 2YWGA 4LSGA 5FUYA 4KVAA 1G18A 3P32A 1KI2A 4OJQA 4DSNA 1ZUNB 3FHTA 2F1IA 3LBNA 4OYHA 3ZZTA 4BLOA 1U0JA 1ZCBA 1GAJA 2XOKD 4HI0E 3PIRA 1LW7A 1UADA 4CRWB 2CCGA 4L16A 2ZITA 4DXAA 1PLLA 3T5DA 4W5JA 4BLRA 4TMWA 1U8YA 2CK3A 3KQKA 1OFTA 3SNHA 3GLFB 3AB3A 2ZS8A 5GJVC 5FR2A 2CK3D 2CCKA 3QKRA 4B2IA 3CM0A 2HDNB 1QHIA 1V43A 3WY9A 4A8JA 5LDDC 4HUQB 1OYYA 1P62B 4FN5A 1E2HA 2JEOA 1XJQA 3LD9A 3AF1A 2JGNA 5KNDA 3MDBC 1E2NA 3B1YA 3KFVA 1U98A 3GLFE 4YQFA 2NZJA 1JR6A 2OCYC 1VG9B 3KKPA 1S9HA 1VYVA 1NKSA 2C96A 1CS4C 2JA1A 1M7BA 1XEWX 1S8FA 1XD2A 4HATA 2OCPA 5TARA 1UBEA 2IWHA 4NPHA 2FH5B 4C0SA 3M0EA 5KO2A 5JWOA 4Q9KA 2Y8EA 1JXMA 2QZ4A 1R5NA 1SVSA 2KB0A 2RKOA 4ZIRB 4LV6A 4Z8YA 1I4LD 5DSZA 5FUWA 1A2BA 2R65A 2F3RA 3UIEA 4GNKA 3CH5A 1H65A 1KAGA 3EA5A 1GG2A 2WKRA 4EQ6A 4RD1A 2QRNA 2F7SA 3NIBA 1YKSA 1M2OB 3HR8A 3CWQA 1Z47A 2HF9A 3RABA 3IUYA 1IAQA 1SXJA 2FFQA 1MO4A 3HPRA 4Q03A 4Q9LA 1CF4A 3EARA 5FOSA 4NCHA 1SXJD 2A5YB 4Q4HB 5JEEA 5M04A 4JBYA 1T3SA 4Z51A 1KI6B 3NEJA 3K0AB 5A0FA 5TY0A 4L9WA 1WDTA 2OFXA 3I61A 4EPVA 1D9XA 2ZU0C 1IQPA 3WNCA 2NQ2C 4QHTA 3K09C 4F1PA 1S3GA 2NPFA 4U02A 5KNBA 2HYIC 4Q7MB 2WWYA 2C9YA 5G53C 2ZETA 1BH2A 2ZRKA 3FGNA 1JI0A 1NN0A 3NBXX 3LJUX 3IIMA 3GMTA 3PENA 4DLUA 3OIVA 4LHZA 2IHBA 2V1UA 1CU1A 2O8DA 3GJ4A 3RRYA 2C78A 2QQEA 2WIAA 2CDNA 3V4RA 2VF7A 1ZRHA 3NH9A 4OJKA 2YYZA 1YZGA 1JECA 2ERYA 2ZI4A 2D7DA 5EP2A 2SHKA 2D4HA 4Q1BA 3TMKA 4YMTA 3AVUA 4ARZB 1P60A 4IRUB 5SZIA 3SR0A 1QZXA 4OQMA 4B35A 1HH4A 2X77A 2A5FA 3PUWA 4TLEA 2DWQA 5CYPA 4MRPA 3UG6A 3VAAA 4DLZA 1NIPA 1P4SA 1Z83A 4URZR 2ZYUX 3IO5A 2WJYA 2GCOB 1VKJA 1FOEB 2AFHE 4DIEA 3N5CA 4XTCS 5EE9A 5HKKA 5AUNB 3PJRA 1RRFA 1D6JA 2ZI9A 4W9MC 3KX2A 2ORWA 2CHGA 2VP6A 2C99A 2IK8A 2J46A 3W8RA 5HKKD 2GXSA 1B0UA 1Z2AA 3PITA 3VR2A 4B34A 1Z29A 1XJ0A 2GK6A 2QL6A 3BOSA 5BWMA 2O8FB 3HU2A 3K9LA 5HCIA 4HAVA 5LB2A 2OILA 5G3ZA 3UMFA 3BC1A 4RFSA 4UNSA 4UXJA 4WOPA 2IYXA 1KK3A 2HUPA 4M1WA 2CLDX 2QI9C 3BB4A 3F5FA 2A3RA 3ZZ0A 4GZMA 3IDQA 2FZ4A 1SVOA 1Q20A 2R6CA 2ZTSA 3N2IA 4WVFA 1RYFA 2ZJ2A 1E9AA 1OV4A 2DR3A 3KQLA 3QXXA 4DLYA 2GAAA 4E07A 4R98A 2HLDD 2P67A 1IJEA 1DAEA 1D2NA 3I32A 4X8LA 4FMBB 1XBTA 4TT3D 1NVVR 4QJ3A 3T35A 4PO9A 3REFA 4X8MA 1C4OA 4DLVA 4W5WA 4DWJA 621PA 5JS7A 5J4YA 1W1WA 3BJIC 2GK7A 4OK3A 4WW0A 4BGDA 1F3OA 5JI2E 1W0KA 3CLVA 1NSTA 4GOKA 4EFLA 2ZROA 1KI4A 1KAOA 4I99A 1G8PA 1YZNA 4V02A 4JIMA 4ABYA 4ZI3A 1SVWA 4ILEA 1P2UA 5L3QB 4Q9HA 1F2UA 2V7QA 4PO1A 2HEIA 3OEEA 5DISB 4XWKA 3GEIA 2QP3A 3LLUA 3CPEA 3EASA 3LDAA 3W9YA 3ETLA 3V4FA 1M6NA 2V7QD 3T15A 3OEED 2P57A 4HZUB 1XTJA 2P5SA 4D81A 2G3YA 4C7OA 2O8EA 3BH7A 4C0LA 4G1UC 4L15A 2IC5A 4HAXA 1Q3HA 1VCNA 3EAQA 4URUR 1XMSA 2PBRA 1G291 4MYCA 1CULC 1ZD8A 1VDZA 1F60A 3DZ8A 3KXIA 2B21A 4NYIQ 5AUQA 3C7KA 4M1SA 1SVKA 1XPUA 2OBNA 3THXA 1AGPA 3O8BA 1LY1A 1W2HA 5GADl 1COWA 1QHHB 3QE0A 4F91B 3RS2A 4QJ5A 3I62A 4AYTA 1OXVA 3CUEF 1MO3A 4BZPA 1Q22A 1COWD 3A4NA 1XMIA 1R8QA 2VP9A 3GLIB 1XTQA 4D2IA 5TDHA 3CH4B 5CK5A 4DSUA 2JLSA 2JLWA 2Z83A 4MRVA 4CEIA 1T9HA 1G5PA 3QQ5A 2C77A 1ZBDA 3TLXA 2WMNB 1QHNA 4P4SB 2O8CA 3S1AA 3CIOA 4PSVA 3E2IA 2ZRNA 1FW6A 1FZQA 2GETA 4ZDWA 4IXMA 3QPWA 1ESNA 2RH5A 3VKHA 3GLIE 3RSLA 1E9RA 1CJVC 4W5HA 1HE8B 3AVYA 3VX3A 2FE4A 2OAQ1 2VP0A 3MRSA 2FFAA 1XU4A 2IWRA 2QQ0A 1E0SA 2FPMA 2ATXA 1FMJA 4RZ2A 2BBTA 1G7RA 3OHMA 2REOA 1Z6XA 3THWB 2JLYA 3LA6A 2FA9A 3PG5A 4IVPA 3KXKA 4PPGA 1E0JA 3L43A 2IEYA 2ODNA 3KTAB 5SZHB 1EK0A 2GVZC 2E87A 2GKSA 2WWIA 1QHXA 1TUEA 4MRSA 4RZXA 3RHFA 4CDGA 3FM8C 1QHYA 3DPUA 2JCSA 4A0HA 2D3WA 5C2JB 2GRJA 5FUVA 3B8HA 4M1MA 4LCBA 5FBRB 3WYFA 4BFXA 1YR9A 2WTUA 4AURA 4B32A 1FUUA 2XNDA 2IA5A 2RAPA 1F2TA 2F9LA 3QXSA 4DDTA 3GCGA 1P9RA 1N6LA 3CR7A 1UDWA 1UDXA 1OIWA 2XNDD 2ZRBA 2JDIA 2ZSEA 1S4QA 4IOJA 4JVNA 2MSEB 4Q47A 1UKZA 3MWLA 4LWZA 4AY2A 1CR4A 1QHGA 4NYMR 2QMHA 3TVDA 2H17A 3C5HA 3EIHA 2JDID 5EP3A 3HU3A 1ZINA 3U7GA 4IW3B 5A5GA 3ZVLA 4V0KA 2HF8A 1SVMA 3K70B 2ZI6A 3ADCA 2EFDB 4D4JA 2CMKA 4YDSA 5LB4A 2FEMA 2ZUCA 3LBIA 3GEEA 3B6EA 3H86A 3TW4A 1D2MA 1IY0A 2FMXA 1OXXK 1W44A 2WOOA 5JRZA 3KQHA 4HAYA 5AK0A 1OW3B 1L2TA 3H84A 4LHXA 2GEDA 1MO6A 4DDWA 5JHGB 3BE4A 4KCGA 1YU9A 1ZM7A 1XP8A 2FSFA 2WJIA 3P27A 3RRZA 2Z4SA 1TTTA 1Q57A 2ONJA 4YONB 3GJ8A 2F1JA 2ZJ8A 4QGFA 1NLFA 4Y0VA 1RIFA 1Y3AA 2PX3A 5DYGA 3TSOA 1KHTA 1RKBA 2QG6A 1YQTA 3K0SA 2QRZA 3NXSA 4JVLA 1IM2A 2BM0A 4ITRC 4TQAA 1VTKA 3WNBA 4FCWA 1I2MA 4KSBA 2MMGA 5G3YA 3AM1A 2F43B 1R5BA 4QHSA 1JR3A 4PXAA 4M9XA 1LB1B 3AVOA 4FWTA 1JR3D 3P4XA 2OBLA 2MSCB 2QMUA 3A1TA 1F6BA 2ZE6A 4O3MA 4N0EA 721PA 2LKCA 5EUMA 2JLVA 3CBQA 3KKNA 4KYUA 2ZQ5A 3MUFA 2OUKA 4F4CA 1CJUC 1UPTA 2ZRPA 3IHWA 4A82A 2IF2A 3TBKA 5E7IA 4IHQA 2QEQA 3GLGA 3Q7QA 2JASA 2JLXA 3BS4A 4CZ2A 4M9ZA 4ZDJA 1R6BX 2VH5R 5EP1A 1CJTC 1GRNA 2OAP1 3K9NA 2VL7A 3ZD7A 2XXAB 2A5JA 5FTJA 2FX3A 5H68A 4DBLC 2NO7A 5HPYB 1T5IA 3NTUA 5LBIA 4LZZA 1R2QA 3KJGA 1MRSA 4II7A 2PEZA 1G20E 1M8PA 2WSMA 5GVRA 1JEDA 1YZKA 2OHFA 3OIWA 4JL5A 5JLJA 3HP1A 5FPYA 2ZXUA 1Q1BA 2ZEJA 4G5GA 5FTKA 1DAGA 1A7JA 1XZPA 3FOZA 1OSNA 4MKIA 4URXR 1P72A 3GJXC 1BOFA 2GJSA 4IXNA 4RVCA 1IXZA 1XB2A 4KI0A 1VIAA 2GJAA 3FKQA 1E79A 3SYNA 1E9CA 3U3KA 1SXJC 4PPNA 2ZS7A 1W36C 3OZXA 1Z0JA 2UVQA 5FPSA 4TL6A 1E79D 2P6NA 4LDJA 4LY6A 2YWHA 5A4JA 1E2DA 4BE7B 1QVAA 3QKRB 1FFHA 3QXJA 4GT1A 4PO8A 3FHCB 3VKGA 3L0PA 4A8JB 3DOFA 3NEYA 4JT2A 4F38A 4EPRA 4LBYA 2OM2A 2NOAA 3FKSA 4QNRA 3SI7A 2R6DA 5FBVB 4MYTA 1NMZA 5KPDA 2XTNA 2IXFA 2IF0A 3CR8A 2JIZA 2AN9A 3FKSD 4U7DA 2QBYA 3HYTA 5GVSA 3AVWA 4L4UA 1G8YA 3SQXA 4PAOA 3UANA 1HE1C 1JQLB 1Z0DA 1XCPA 2JIZD 3IKJA 3LWNA 4IEEA 4D4MA 3VNUA 1CXZA 4Y0AA 4RSGA 3VHXA 1P7CA 1XD2B 4MA4A 5B58C 5KDDA 3BK7A 1ZMXA 3ZVNA 5F98A 4Q1CA 5AUOB 1UKYA 1S0UA 4DLWA 1SKYB 4G3XA 1HQCA 4AWXA 3X1XA 1CR0A 1JNYA 2AHOA 3AVPA 3K9GA 2CE2X 2VSXA 3WHKA 5C18A 2RGXA 2VLIA 1KO5A 4LJAA 4GL2A 1IN6A 2XSZA 4M8NE 1TMKA 5AJVB 5AWFC 5LD2C 4UXIA 2ZE5A 3CRW1 1R7RA 2ASEA 2XSZD 1CLUA 4RFVA 4EQ6B 1NKTA 1UM8A 2QGZA 1YZLA 4XSHA 5SZJA 3MSXA 3LXXA 5HE9A 2QP4A 2TMKA 1SKYE 4CEHA 5F3WB 4JLVA 4Q5IA 4JLAA 3P4YA 3W90A 3AEZA 1OE0A 1XFAA 4JLNA 1SXJB 3ZVRA 5HCNA 1XJCA 3Q5EA 3SOPA 3ZS8A 3CW2A 1S3SA 5K8IA 5CDFE 4NYJQ 2IXEA 2DFKB 2VYFA 4LV8B 3X1WA 3GJ0A 3OAAA 1Q21A 1SXJE 3SS8A 3IPXA 3GQBA 2HYDA 3TR0A 3OAAD 1E32A 3U7FB 1AKYA 2XJ9A 2Q3MA 3T1TA 4BRUA 1VIYA 1OFIA 2UZIR 3OIYA 4AD8A 4HLUA 4HUTA 5J4KA 2O8DB 1E9FA 1Z0IA 1N6PA 4K81B 1U9IA 5J4LA 3ZDQA 2GJ8A 2EFCB 2AXNA 2BIFA 4BFVA 4OQNA 3AVXA 4D6PA 5HR5A 5EJEA 1G3MA 2J7PA 4JL6A 4GP6A 2YC2C 1YR8A 4PC7A 5LD2B 4DKXA 3SHFA 3QI2A 3AKCA 3HYRA 3DMDA 1KGDA 3IHLA 4I1OA 3GJ5A 1NY6A 1XZQA 1NVWQ 2ZIAA 2NGRA 1FX0A 5FOWA 2VHTA 4NBSA 4G0NA 2XZOA 1T0HB 4HLDA 1U94A 2GZAA 1TX4B 2IEZA 1TNDA 5DI9A 3QKUA 1SULA 1W5SA 4GBMA 4BLQA 1M34E 4OBEA 3DWDA 3SJAA 3MWKA 4HSEA 4A4DA 1S96A 2ODEA 4Q00A 4OHXA 2RMKA 4KVGA 4LV5B 2KSQA 3U3JA 3LQRA 4NDZA 4N0DA 1KJZA 5P21A 4Q66C 2GF9A 4RFSB 5CJ2A 4WAUA 3CRVA 4J0QA 1VMAA 3O8CA 1NJFA 1GNPA 1KSJA 4Q21A 2BCGY 2CJWA 4WA7A 4QBFA 1KOFA 2FPKA 4TLCA 3T1OA 5JZVA 1E3MA 3CZQA 1G8HA 4OKSA 4E03A 1N6OA 5ANRB 1U90A 5J4VA 1XPRA 3UKDA 3O8RA 1TUIA 2WHXA 4XWAA 1K5GA 1UKVY 2JLQA 3KJHA 3Q72A 5JJIA 1W49A 1G7CA 2IT1A 4TZ6A 5CJPA 2B92A 1G3RA 2B7CA 3BH0A 3EC2A 1VG0B 4AKEA 1HT2E 4BFWA 1H8HA 1GRQA 4B3BA 2OLKA 4JKYA 1RRCA 821PA 2A9KA 2O0KA 2XB4A 1F2UB 1H8HD 2W2VA 4GZLA 1XF9A 4KFUA 5C4MA 3RDPA 1Q1ZA 4E09A 3UMRA 4ZO4A 3UXMA 1IN8A 2IQJA 2O8EB 4C7OB 4PC6A 1E2IA 1G6OA 1ZC3A 3BRWD 2UZ3A 3LXRA 2NO1A 1GOTA 2WWGA 1XPOA 2IX3A 1E2JA 2X2EA 4LHWA 2CBZA 3THXB 1KY3A 3X2SA 1DTSA 4BFUA 4NE2A 2O52A 4A2WA 2BMFA 1AJEA 5AJXA 2O0JA 2ZRMA 4C0KA 3F3YA 2ZJYA 1GWNA 4MUBA 4NL4H 4PQRA 2E1RA 2GXQA 2Z6VA 1J8YF 1P2VA 4IDHA 2OG2A 5TMPA 3C5CA 5EP4A 4UJ3A 2BM1A 3EZ2A 2QU8A 1L4YA 4CEIB 2IW3A 2W0MA 3PVSA 4KYIB 4QXAA 2FDCA 4TL7A 1LFDB 1QHSA 4V0ME 2O8CB 3ECCA 3S1AB 2AKYA 1E1QA 2YINC 1NLYA 2H92A 4FCVA 4JS0A 2DY1A 2X1VA 3ASYA 3WMFA 5JWHA 3TQCA 4ZCIA 2ZRLA 1E1QD 2O0HA 3MGCA 1YVDA 4LJ9A 3R9XA 3RNLA 4M1OA 1X8KA 4R71A 1IOZA 1BYIA 1J90A 2H1LA 3LV8A 1CP2A 4KAXA 3CWZA 4OQXA 4LOAA 3J81k 1DEKA 1U8AA 1E98A 4EFNA 1NMXA 4DDUA 3U7EB 2IS4A 3OFNA 1XCGB 2QAGA 3PUZA 5EE3A 4D26A 5CYOA 1G8GA 4DB2A 2J1LA 3T5GA 3VX4A 3OFND 1E2KA 1JQJC 4BEBA 3MG9A 2A30A 4B6EA 2Q9CA 5BQ5A 1ESMA 1OPXA 1NSFA 1IY1A 2ZYTX 3H4MA 4IFEA 2P65A 2R2AA 1BO6A 3DO6A 4PANA 2QSZA 1U0LA 1WRBA 2NIPA 4C0HA 1FP6A 1RVDA 5B30A 3QVVA 4HB2A 3K1JA 2FF7A 4IJMA 3T06B 2V6IA 4GSYA 3UWOA 5CITA 5CDFA 5GJCA 5JEDA 4H9GA 1Q1QA 1F2TB 2GNOA 3TNFA 2VP5A 5FOTA 3HWSA 4P4UA 3W34A 2HCBA 4EKDA 1NI3A 5EXXA 3GJ6A 1ODFA 1U2RA 5CLLA 4PHTA 1PVOA 3JZAA 2Q0HA 5JCZA 2ZJOA 3AF4A 3I73A 5KHOC 4JLMA 1W36D 1EWQA 5FPKA 4YDHB 2REBA 2AX4A 1Z22A 1K5DA 2YV5A 1VCMA 4RD2A 3JVVA 1T4GA 1ZU4A 3PUXA 1NVUQ 2X2FA 3KFXA 4RD6A 4B43A 4IOKA 2KBFA 2QUZA 4KITB 2JLZA 1J70A 2RHMA 4O2RA 4V0OA 2QA5A 5CB8A 1J99A 4KBFA 4P33A 3U4QA 1PUIA 3AV0B 3CNLA 1XEXA 2PCLA 2ZAOA 5JRJA 1V5WA 2V55B 4OHWA 2QM8A 2IL1A 2ZUBA 4EPXA 3NC0C 2PT5A 4H1VA 3BB3A 5IRCD 5F9FA 1E9EA 2YHSA 3TUZC 1P9NA 3DKVA 1H8EA 3EA0A 3MFYA 3C15C 3IBGA 5TV2A 1RRPA 1H8ED 2ZSAA 1N5JA 3I8XA 4JLBA 2I4IA 2ZJZA 2L0XA 2ZREA 3ZZUA 5BN4A 1KK1A 4CIDA 5IT5A 3RRNA 3C14C 2W83A 2IUUA 3T34A 2WWXA 1HEIA 3VR3A 1KO7A 3LNCA 2ZR7A 1TF7A 1KZ7B 5AR1A 4D0LB 3U61B 3I3SR 3ZIAA 6Q21A 4OHYA 4FMCB 2OZEA 3L8ZA 4HDQB 1G7SA 2I3BA 2NO0A 1WBDA 2A5GA 4PPQA 4Q18A 4NCNA 3ZIAD 2BMJA 3MMPA 3FTQA 3TH5A 2XJ4A 3OF5A 1RE0A 3QF4A 3GFTA 1AS0A 2ZYWX 3I72A 1JR3E 2VHUA 1W7AA 4AYWA 2C98A 3GLGB 2QROA 1GZSA 1Q0UA 5JJKA 1G64A 3F8TA 2G0TA 2RGNA 1KI7A 3LRPA 1R4AA 3EWAA 3WMEA 3SFVA 5FBLB 4JYBA 1N25A 5E3HA 1YR6A 3SQWA 3RWOA 5KDLA 4B3XA 3C8UA 3FPAA 4KHZA 4UNRA 4FIDA 4B3GA 4IVRA 1GSIA 3QXHA 1ANKA 3GLGE 1PV4A 3PR1A 2AL7A 3R9IA 4Z54A 1FNNA 1LF5A 3ASZA 4HEJA 1NY5A 2DFLA 1UF9A 3B1XA 4FMCF 2WAXA 4UNPA 1NG1A 1P2SA 4V0NA 4R2HA 4US0R 2YC4C 4F92B 2VRWA 2R44A 4FCTA 4DHEA 1KDRA 3U2QA 1A2KC 2D2FA 2W2TA 4LK2A 2QPOA 5DLQC 1KDTA 2JJ8A 5FBQB 1SKQA 1W0KD 4G5QA 1RRGA 1NBMA 2AD5A 4B44A 4V03A 5CLQA 3LW8A 1Q12A 2BWJA 4NYIR 3F0TA 4Q4JA 2NO6A 3VQTA 1NBMD 1U8ZA 4D82A 3U3MA 2XX3A 3FFBA 1HTWA 5K8UA 2J0VA 1HQYE 1MO5A 2FZLA 1OF1A 3ZS9A 4GPTA 4HAWA 2AXPA 4RKEA 3W3ZB 3WRXC 4TYYA 2QBYB 1GKIA 3PFIA 4P32A 1MH1A 4B3CA 1XTRA 2ZRIA 4C30A 1KSHA 4MRRA 1N0VC 4LYJA 1Z08A 1IXRC 5KU1A 3DKPA 1X86B 1PLJA 1T5LA 3I4LA 1I4TD 4HLUC 3TIFA 2GESA 1IJFA 1NVVQ 4V0MA 4XVQA 1U9IC 3G0HA 1E2LA 1GRRA 1ETUA 2NZ8A 2OESA 4XVRA 3RS7A 3ZYCA 1CJMA 2VQSA 1ZM9A 4GFDA 2ZANA 1D9ZA 1P75A 3U60B 1G16A 5EXPA 3AF2A 3BBPA 2Z43A 2PMDA 1YR7A 2VHJA 3TW8B 4C2TA 3D8BA 1CJKC 4QNMA 3HU1A 4X8HA 4B47A 4CEHB 3SDZA 3TSWA 3ICEA 4AG6A 4Q1DA 4FMDB 2OCAA 3LBHA 4IDOA 3KXLA 1C1YA 3RANA 1VG1A 3RS5A 2V4ZA 3TKLA 5KDOA 3C4JA 4ZI2A 1II8A 3IEVA 1N6HA 4U00A 4F93B 1K8RA 2VBCA 5JHHB 1KKLA 4FINA 3KUDA 4B3DA 3NDBB 2QTFA 5K8LA 1AZTA 1ZM3A 3NVAA 1O87A 1ZIPA 2D06A 4P31A 4MUAA 1UFQA 4HUQA 4D80A 5JSZA 4YC7A 1JBKA 4GMXA 4DUGA 3B2EA 1RPZA 1XMVA 1CRPA 2QMEA 2XEXA 1R0XA 4JLPA 5DI3A 1AGRA 4MGZR 4DZZA 1NNEA 1KDPA 1JPJA 4DUGD 3V9PA 2PLRA 5H8WA 2EYUA 1G3UA 3IQXA 2XZPA 5HE8A 3K8YA 3DOEA 2CRRA 3SHWA 1KIMA 4A0GA 4WBSA 1DBSA 1ZC4A 4JYCA 4NU0A 5E7JA 1AIPA 2GAOA 1JEEA 1N6RA 1Z6YA 2ANCA 3TGPA 3QG1A 2AK2A 2NO9A 2OT3B 2GEVA 1EWRA 2YVUA 5DHAA 5D3QA 4KODA 4POAA 5DN6A 2EWWA 4HB3A 1IN7A 5FL7A 2GTPA 2O5VA 2C95A 1RZ3A 2ZJAA 5DN6D 1NF3A 2J59A 3B9QA 4HB0A 3I92A 5FL7D 2GZHA 3BFXA 3MAAC 1OXSC 2AK3A 2F1HA 4MGKR 3A8TA 2DYKA 2G1KA 1NVXQ 1T8TA 3B60A 3SE0A 5AJWA 4LBWA 3EPHA 3HR7A 2AFIE 2ODBA 1A82A 3KKMA 5DHFA 3FMFA 4OQLA 2RGBA 1AN0A 4I1VA 4YMUA 2OE2A 3BORA 1AM4D 2GXUA 4MRNA 2ZI7A 2ZUDA 3MJRA 1FTNA 3NG1A 2EYQA 4MYHA 4BFTA 4XJXA 2DBYA 3SBDA 4QM7A 2V9PA 2C9CA 2ZSBA 1E2PA 1DVRA 4MKHA 3O8DA 3THYA 1W0JA 2WAYA 4AKHA 4NZYA 4PFSA 5JJLA 4PAMA 5SZKB 2VEDA 4LPSA 3RAPR 3U5ZB 1W0JD 1T3HA 3HPQA 4PQFA 4URVR 2CJWB 2VHQA 1OKKA 5TXGA 2JAQA 3CF0A 2HJGA 1P61B 4B2PA 2Z4RA 5JECA 4M0LA 1OKKD 1FUKA 2GJ9A 3C16C 1XD8A 2WWWA 2HT1A 1SZPA 2QP9X 4BZQA 1JJVA 421PA 5FTLA 3QF7A 3IBYA 4P0TA 3NDPA 2NMVA 1WF3A 3DHWC 2AWOA 2QTHA 4BUJA 3W8NA 4B48A 1KJYA 1TU3A 3FYHA 3A1WA 2VHCA 1HY3A 3VHLB 4DCTA 1AZSC 1UBGA 1T3LA 2AWNA 4LBVA 2BJWA 2CHQA 5BXQC 2OFWA 3HDTA 4R7ZA 1E4VA 1SGWA 2ZRJA 1G7TA 1W4CA 2QAGC 2ZRHA 3NBFA 3AF0A 1VCOA 1I2DA 2YWFA 3PQCA 5IHPA 1ZYUA 4LJ6A 4A15A 3FVQA 4ZDKA 3EW9A 1FL9A 3KJEA 1ZM4A 2B7BA 2Z5FA 3H2YA 4PX9A 4C2UA 2GZDA 1Z2CA 1E4YA 2FV8A 4QG7A 1XEFA 5HZKA 1TL7C 3SEAA 1OH5A 2Z0MA 1LTQA 2WMOB 1W46A 3BD9A 2FSGA 2K5UA 1ZM2A 3T61A 1JALA 3M6AA 5H1YA 3KZ1E 3EIQA 1G1MA 3AQ4A 1R8SA 1E96A 1E2FA 3HJNA 4EDHA 2REXB 2FEOA 4D0GA 1OFUX 1GL9B 2CLCX 3K0CA 1CRQA 1UEIA 4WXRA 3VTKA 1TF5A 5DNYB 5KUTA 3LVRE 3IGFA 3T12A 4DEXA 2NG1A 4KFRA 2DFNA 2C5LA 3BIFA 2CEAA 2ZSFA 4AK9A 3CF6R 1WP9A 4OK6A 2FFBA 3NHAA 1XXHA 1DG3A 1R0ZA 2QAGB 1E2EA 4TMVA 4KLZA 5L3QA 2P6RA 3GLHA 1D2EA 2FPLA 3A4LA 1E2GA 2QT0A 3A37A 3RS4A 1YZTA 4LGMA 4QL3A 4QGAA 2H57A 1N0WA 2W6JA 1X1RA 1X8JA 3R7WA 4RY2A 2OCBA 4TQUS 2D2EA 5EQTA 3CX8A 4G5SA 4NYJR 2W6JD 4JLDA 4JSYA 3P1JA 1DCQA 2J9RA 2KI5A 1EG7A 4YMVA 5FBWB 4Z1MA 4ZPXA 4A6PA 1BKDR 3VMFA 1AS3A 2BBSA 3EZFA 3EZ7A 4MQBA 4DB4A 1W36B 2WV9A 2OBMA 2Q9AA 4Z1MD 3UPUA 2ZVPX 3L0SA 1MR3F 2D62A 2R8RA 3LFUA 1RYHA 4IKEA 2Q6TA 5KSOA 3KB2A 2F1RA 1DARA 3U7HB 2HCJB 1DG1G 1TPZA 4LHYA 1GIAA 2GCPA 4RD4A 4RD0A 4N3NA 4DSTA 3TAHA 2V6JA 4XOIA 4AKIA 2RGNC 3EPJA 3UATA 1E69A 1YZUA 3A1UA 4BRWA 3LX8A 3VR5A 1PUJA 4LRWA 1XEXB 3CO5A 3QKSA 3FMOB 4YMWA 2D7CA 4B74A 5E95A 1N6IA 3AF3A 3QJYA 5BN5A 2A78A 2CNWA 1MABA 1QDEA 2ORIA 3B78A 4WZBE 3G82C 2OXRA 3GEHA 4QGGA 4WZ6A 2ZS9A 2G9NA 2CNWD 1ONBA 5K8TA 2C2HA 4KBGA 2ZRGA 1DAHA 5EE0A 1NL3A 4Q4LA 5F2EA 1XRJA 4OL0A 1DELA 2J7PD 3BB1A 1FNMA 3WBJA 2WM9B 2CVFA 3VR6A 2FSHA 4CT5A 2BMEA 4KFSA 4Q02A 5EXTA 1GUAA 1PLKA 2I1VB 4QFVA 3B5JA 3PXGA 4DCSA 2P2LA 4B2LA 1SVIA 1GM5A 1OB2A 4P4TA 4OK5A 2FJUA 1KI8A 4G5RA 1KZGB 4QHYA 4Q48A 5FOUA 3TQFA 4DIDA 2IHYA 4HYYA 3QPVA 1A1VA 3VFDA 3QF4B 4JLOA 2V8OA 3TR5A 4JZKA 4FI3C 1VPLA 4QBIA 1Z5ZA 2GWHA 4A0RA 4UNQA 1W2GA 4E5UA 2ZE7A 1US8A 4D4KA 3E70C 2BDTA 3WMGA 1Z0FA 2CE7A 4LYHA 2G77B 3BFVA 3UMSA 3A6PC 4GP7A 1NN5A 4A1FA 1CEEA 5TVKA 3W6PA 5KYKA 1T0JB 3ICQB 2D74A 4Q9JA 2WIBA 3ND8A 4XIGS 2J5XA 3E5HA 2P5TB 1W4AA 221PA 2R6GA 2KE5A 4QOSA 4UQOA 3EPKA 4RZ3A 2VPPA 1PJRA 4Q1EA 5FTNA 1II9A 5JMTA 1UKEA 1XTIA 4RJLA 4FW9A 1DAKA 4DLXA 1P73A 2AKAB 2ZR9A 2RGAA 2H18A 2NPIA 4JBWA 4G01B 5DE3A 3PUYA 1J7KA 1XMJA 1X3SA 3D6TB 3TE6A 4JT4A 2QN6A 3AVTA 3D7MA 2ECKA 4C9BA 4M1KA 4AG5A 1Z06A 4CEJA 1QF9A 5C4GB 3Q9LA 2CL7X 3WBKA 1Q3TA 2HXYA 4QGHA 4Q4JB 3ZQ6A 3GPLA 3QSYA 3MCAA 1MRNA 3K0FA 3X1DA 2EVWX 1P2TA 2P3SA 2ZI3A 1M1YE 2F6RA 2WZQA 3AGQA 3I8SA 3K9HA 4I1SA 3PEWA 3CKLA 4GDFA 1GVNB 4D4LA 1GTVA 2O8BA 4TMTA 1OIVA 1P3JA 2QMOA 1CR1A 1NBME 1Z07A 4DSOA 4BPBA 4X8OA 1FP7A 3TUJC 4DRZA 4UXHA 2QENA 3KKQA 4HLCA 1MKYA 1YJ5A 2YZ2A 3SJCA 1JAHA 4GOXA 3LH5A 4LJ5A 3OEHA 3ZVMA 4YLGA 4ZKDA 4R2IA 2B6HA 1NJGA 2KBEA 2WVJA 1GNRA 1XTKA 1ZU5A 2NTYC 2ZVQX 1LNZA 2DCUA 2H8KA 2QY9A 3QG5A 1XX6A 4DCUA 1BMFA 2YJTD 3CPJB 1T8UA 1E2QA 3DL0A 1ZNYA 3NHBA 1OXTA 5IDVA 3CONA 1BMFD 1G21E 2IYQA 4TYWA 3WHLA 3RVBA 1GILA 2EFHB 5KNCA 2XOKA 2FSIA 3V00A 1L8QA 2LCFA 4CYMA 2IS6A 2VF8A 2PZGA 1IN4A 1J2JA 1II8B 2F3TA 8OHMA 4IEIA 2J0UA 2BEKA 5H70A 4Q7KA 1AS2A 3W5JA 2F9MA 2IYVA 5CIQA 1R0WA 3TJZA 4DCVA 4EJSA 1ZNZA 3AKEA 2R6AA 4O25A 3W6NA 3GFOA 1AA9A 5JSZB 2N46A 2F55A 1EFRA 3OESA 2XTMA 4TMXA 3WYGA 2ZJBA 4TTQA 1KDOA 1ZD1A 5DI3B 1EFRD 4FWIB 4EFMA 4DLTA 3IIJA 3DDCA 4AI6A 2CXXA 4D0NA 3KQUA 4PPFA 1Z6GA 2YOFA 1VYTA 3U3RA 1OIXA 3MJHA 2C03A 1ZUIA 2IUTA 3T1QA 1R0YA 3QVUA 4DLRA 1JJ7A 2PMKA 3DM5A 2B8TA 2PT7A 1LS1A 2BBWA 3OIUA 1F5NA 2PX0A 2BOVA 3AGPA 1EFCA 4Q1FA 3T1VA 2ZJ5A 4M53A 1TEVA 4EPYA 2CL0X 2BKEA 3R8CA 4NTZA 2ONKA 3B1ZA 2XITA 4DCNA 2YOHA 1BIFA 3ZD6A 1F48A 3FDIA 1W4BA 4PZZA 3THOA 4BZXA 3FMPB 5FH9A 4ESVA 4JJZA 2MMCA 4GOJA 1WMSA 1KI9A 4FD2A 1E6CA 4M9QA 3L2OB 1YRAA 4Q7LA 2ZPTX 5FOVA 2WICA 3AUYA 3B1VA 4Q4AA 5JBQA 4BFZA 2QM7A 1G6HA 1Q1EA 3LO5A 2GILA 3WP1B 2PJRA 4W7SA 2VSOA 1QRAA 1TADA 2J45A 2WJHA 4IDPA 1KKMA 4M22A 3AKDA 1JAIA 1TQ2A 4GMDA 4P3YA 1EFTA 1RJ9A 3FEHA 1W4RA 1L7VC 3NH6A 3THYB 3ZLJA 5DYIA 3B85A 4MKGA 1TEXA 4RCZA 2J7KA 2ZYVX 1R5OA 1WXQA 3CPHA 4TSFA 4QC2A 1CBUA 1XCMA 4KSCA 3VU9A 3H0KA 1NP6A 3WNDA 3KKOA 2V1XA 4EPTA 2ERXA 4ZKEA 4LJ8A 1P9WA 4TSFD 4I4LA 2RHDA 1M7HA 4A92A 1G3IA 1KMHA 1G41A 3GP8A 2IS1A 2J41A 1E9SA 2QORA 3AP3A 1JB1A 4JKIA 2P6UA 3K0CC 4B3FX 3P20A 2PEYA 3UK6A 4Q1AA 5FOXA 4ZDIA 1OH7A 2XGJA 1TQDA 2KJQA 1W48A 1ZUHA 4BFSA 1HV8A 2A7QA 3KL4A 4PC2A 3RLFA 2GA8A 1TU4A 3EWSA 1U99A 4UKDA 4KV9A 2LWIA 3AVQA 4K46A 5L3VA 1FQJA 1W47A 4HB4A 5TB5A 4DJTA 1KSFX 1T6NA 1ZJ6A 2DHRA 4B6FA 3AVVA 4PHHA 4EUNA 1NN1A 2GBLA 4LUCA 2G1JA 4Q7JB 5EE5B 1EX7A 4A9AA 5BYJA 1AKEA 4OI1A 1EX6A 1D8TA 3H1TA 3U6KA 2ZR0A 5B2ZA 1XD9A 2WJJA 1NLZA 2ORVA 1YE8A 4PHFA 5D3MA 5EUQB 1ZIOA 2W0SA 5LPNA 3BXZA 4DT1A 3PEYA 1C9KA 4M1YA 3EZ6A 4ASUA 3WP0A 5GJBA 2PL3A 1O3YA 2C8VA 4ASUD 1NMYA 2JJ1A 5DO9A 1YZQA 2GDJA 2PCJA 1WB9A 4NCKA 2HLDA 5AUPB 2WBLC 3IPYA 3QBTA 4EAQA 3U44A 2JJ1D 3BAFA 4TTRA 3T9KA 1E1RA 4TLDA 4F4IA 5ELXA 4TT3A 3Q3JB 1FPMA 5J47A 1ZNWA 2IYSA 2WWHA 4Q9IA 3ADKA 1E1RD 2CLSA 3Q7PA 4HLQB 1EFUA 1SHZA 1G19A 1UJ2A 2A2ZA 3B7GA 3QENA 4HZIA 4LYFA 4TWZA 4BQSA 5FPHA 3Q85A 4G5OA 1Z3IX 2GXAA 4NKRA 4M9SA 5L3SA 3TVTA 1N5LA 2ZRCA 4F4JA 4Q19A 4PAQA 1IHUA 2PJZA 1XXHB 3B13B 3CRRA 4LBZA 4EPWA 4DLSA 4XWOA 2VA8A 1XDBA 4UJ5A 4MGIR 4XTRA 3I5XA 1E2MA 3GLHB 3PEUA 5BYKA 1KO1A 4Q01A 4BLSA 2YWEA 3VKWA 3IEUA 1OH6A 1KI1A 1X1SA 3R7WB 4B33A 3LX5A 2B0OE 1Z28A 2EW1A 3B82A 4A2PA 4C3ZA 5KTYA 5AJYA 2YKGA 1XXHE 2IUSA 4DVGA 1FQKA 2IYUA 3MWYW 3SBEA 4URWR 1E99A 5C1BA 5JCPA 1JXOA 3BERA 4TLAA 2BCJQ 1HA3A 1LV7A 1LF0A 3FB4A 3GLHE 2WJVA 1G4UR 2MSDB 3TK1A 1IY2A 521PA 1Y63A 2WWFA 3E1SA 4JJKA 1GL7A 1KTVA 3FFAA 4NCIA 4JVMA 3RSOA 2J3EA 3SFZA 5CK4A 1OLOA 2N42A 2ODWA 2FN4A 2ZAMA 4TYNA 3CRMA 4KXFB 1MOZA 3NBYC 3FMIA 2GF0A 1OH8A 1KO8A 1HUQA 4NH0A 1PZNA 4LYAA 3U3OA 4LHVA 4PC1A 3GLFA 3VR4A 1ZP6A 1KNQA 2E9SA 1GL6A 3K0EA 3QOFA 4BFYA 1KY2A 4ERNA 1VYUA 3NBZC 5JS8A 1A4RA 1KO4A 1N6KA 1RC8A 3K70C 1N3BA 3TSZA 4IDQA 2BKUA 4XSGA 4S2EA 3IO3A 4H1UA 5G40A 2FNAA 2FGJA 1JPNA 4A2QA 3QKSB 4MYUA 1A5TA 1Q44A 2GVDC 4LJ4A 1KSGA 3LAWA 5FTMA 1MABB 2BJVA 1TQ4A 1VG8A 4UNNA 2VIIA 3PCRB 5GJWC 2BV3A 4TYPA 2ZSDA 1N6NA 3CNNA 1OFHA 4FMDF 4HDOB 2RGEA 3FWYA 5KOYA 5E7MA 3A1VA 2OEPA 2BEJA 1AK2A 2FWRA 4OHZA 1E0KA 4URYR 1KMQA 2H5EA 4ZIRA 2RGGA 4CVNA 2J0QA 4ACBA 4FXPA 2G0NA 1XTSA 2RGDA 1P6XA 2H7VA 1FX0B 4CT4B 4M4SA 5KSZA 4JLKA 2DWOA 2QPTA 3CRQA 1VCIA 1Z0AA 3PUVA 1D5CA 4JLJA 1R10A 2DWPA 3CX6A 4KLNA 2DPXA 4OHVA 5BW8A 2EFEB 3D3QA 4ESHA 3FE2A 3JZMA 1ELOA 1YHNA 1FTSA 1OXUA 4TL8A 1SVLA 5EXSA 4WXPA 1XEWY 2J87A 3NKVA 1Z6TA 4QBGB 3DMNA 3O47A 4GRAA 4Q4HA 1I4DD 1GFIA 3LQQA 1US8B 3IIKA 1KI6A 3K0AA 1ZVQA 4LJYA 4MGYR 3ZQJA 2QGNA 2G83A 4M2LA 5IF9A 4TL9A 1CKEA 1UAAA 3G5UA 4M1TA 3CB4A 3QPUA 5C46F 2PZFA 4JVSB 1OJLA 4NYMQ 1TAGA
chains in the Genus database with same CATH superfamily
1E5LA 2I4NA 1U1EA 4HB5A 1L8XA 4XZ3A 5ED0A 5EEHA 1IB6A 4JP8A 2GTHA 2GEUA 3L0IB 1K3FA 1UBKS 3CLRC 3PLRA 2DQSA 3QX7A 5GZ6A 4ARZA 1G4AE 1UBFA 3N58A 4WESA 2WSSD 2XHZA 4JJFA 1WF6A 1AKWA 2WM3A 4ZK6A 1QVVA 2EG5A 1YA6A 4JLWA 2HNAA 3GJ3A 1F7VA 2F00A 1F0YA 1M2FA 4IOMA 2V54A 1KRWA 5BMVB 4OYYA 3AU8A 4NOJA 3V2HA 4PHGA 5C1OA 2Q21A 3KEMA 1KPSB 2FEWB 4JQZA 2F4NA 4CIYA 1DO2A 1RI3A 3L4BC 3N86A 4BXOA 2O2EA 3RIGA 3AM5A 2P6OA 1TF2A 3A36A 4UBKA 2EW8A 2HRZA 3CF4G 3ZCUA 1FDUA 1WHSB 2H63A 2UUCB 4LJ7A 3USZA 1J5EB 2HJVA 4RK6A 5HGJA 1XVVA 2OGUA 1E1NA 4YUVA 4B8CB 1O95D 3EVFA 3DVAA 5DGCA 2H0RA 1GCAA 4C1BA 1RW4A 4UUMA 5CNKA 4RF3A 2G6BA 4XDHA 4NMMA 5E1DA 1OHHA 4KFTA 2LSVA 3BSWA 3TG4A 1S64A 2YOGA 2J6CA 5IVPA 1QX3A 3NC1C 1PR0A 1HRDA 4U04A 3A1SA 4QXMA 4BVKA 4B6GA 3RG8A 5SV2A 1Y3FE 1KMHB 3MYRA 4ZEXA 3QFTA 4LZWA 1W29A 3REGA 2RR4A 4KOEC 1NI5A 3GVHA 2HHAA 3RVKA 2MUMA 4C29A 1HYQA 2NAFA 3HJGA 3CE9A 5CIWA 3KS9A 4ZU6X 3IOCA 3QA9A 5EZYB 2I9CA 3A06A 1ZH8A 4AF6A 1I8TA 3V4SA 1OWMA 2G04A 3PD0A 1MT0A 4R68A 1I0IA 5IHXA 2HSGA 1C9MA 4A0FA 2WHQA 4JR2A 2O3TA 2OFFA 3PXXA 3BDIA 4G4GA 5JSFA 3UMCA 4JC8A 4EA6A 1TCAA 1TQ6A 5TQVA 4B94A 2HU5A 2W6ID 2YYSA 1HURA 3TNYA 4ZOLF 4O0MA 4KU4A 5KVVA 3HB4X 1M8JA 3O0DA 3H5LA 3ADDA 3N70A 2G88A 4YXWA 5FPQA 5EQJB 1YQWA 4E22A 5FPTA 4RQIA 1UP4A 4EBFA 1JE1A 2L7PA 4RTRA 5A6VA 3LBNA 3GJYA 2FPSA 1UADA 4CRWB 5BW8C 3NNSA 1U8YA 4JI1B 3EAGA 2O7VA 1GTG1 3ZX5A 4J03A 2AN1A 1LH0A 4A8JA 1C7EA 4YCSA 5K09A 1WV0A 5EKTA 5DSXA 4N40A 1B7GO 3LRQA 1Z26A 3RYHB 2IQIA 1C3EA 1QIEA 2ZXFA 2Q5HA 2O07A 4BEWA 3NGMA 4FJ1A 4Q4DA 2XCBA 2C9ZA 2J07A 3NIBA 5ENSD 1UBJS 1BQ4A 4LYDA 1Z47A 3OM1A 1RXIA 5B6IA 1YA0A 3GF4A 4RH1A 3GDWA 4P5PA 4QHTA 2QTRA 4MS6A 3ZR4B 3SZOA 1BH2A 2DTDA 3GMTA 1IY8A 4NG5A 1EIWA 5A6SA 3O7WA 3SYTA 4B8WA 1ZOPA 4MVWA 4P98A 3H4IA 3SXPA 3DO8A 3AHFA 4BN0A 2D4HA 2P8SA 2PSJA 4J8EA 4L3OA 4K5QA 2NYVA 4ZVUA 2ZIEA 4GBJA 2OBBA 2PBZA 2JIDA 4AB1A 4QX6A 1FJXA 3SVZA 4EEKA 3OPYB 4C7BA 3IPLA 3PCTA 1J8VA 4DIEA 1AO3A 5EE9A 1V7ZA 4X3OA 1H5QA 3PGMA 5H81A 4AU1A 3B20A 4HAVA 3WGHA 1MC8A 4KREA 5AM0A 4M0MA 4L74A 5EJ2A 1PGOA 4QSMA 4E07A 4HXYA 1FTWA 4J2HA 1TLLA 2AI2A 2CV2A 4DLKA 4XVCA 1IKND 1QK5A 2GK7A 3DHNA 3DZBA 4ND8A 1PNQA 4V02A 4F96A 3TLYA 2XNHA 4KFCA 3BMNA 3T3OA 4AKSA 1UK7A 4PO1A 5DTQA 5JY6A 4WK4B 2V7QD 3T15A 1J8DA 4IRXA 2ZKIA 3BH7A 2JI7A 2BL4A 5C8ZA 1ULAA 1CULC 1P1RA 5AT1A 3M49A 4FJ2A 4GWLA 2OBNA 3THXA 3E7XA 3UK7A 1XDDA 4AS3A 4U7JA 4AT1A 4AYTA 5ENPD 1TK9A 2B5WA 5IJ0A 4IQGA 3TLXA 5FQ4A 2XUHA 1V26A 4C0XA 2PGXA 1UQTA 4IXMA 3ZHBA 1JWGA 3UW3A 1KS2A 1GPMA 1EGVB 4FNGA 4MGEA 4IIHA 2GKSA 4C76A 4P7JA 3NHMA 4S3OC 4TSRA 1EM8B 4L0DA 2MD7B 2YNMC 1X13A 2NTJA 3CR7A 2GK3A 1UDXA 3HCWA 3S28A 2ZRBA 4JVNA 1R6VA 4AM9A 5CFOA 4WX2B 3HU3A 1LBQA 4BB0A 1QTNA 4ARVA 4R1OA 2ZI6A 2V6FA 2RKBA 3H86A 2PKRA 2ZG6A 3P9IA 1ARZA 1IY0A 1OXXK 1UG3A 4K2HA 1PQYA 4IH1A 1RWPA 4PG4A 2WJIA 4NXNB 2R97A 4HKTA 4Y0VA 5DYGA 4ZO9A 3CLTD 2WU3A 3AIIA 4EF6A 2D8MA 2QRMA 5SYMA 5CIYA 1B73A 2F43B 4YRZA 3WQBA 2SNIE 1SWVA 1B89A 3P4XA 3ABQB 4O3MA 4YUAA 2OUKA 2IHZA 4KZKA 4ZA2A 4BATA 3FNBA 2JASA 4PLZA 1G20B 2I1WA 5EJ8A 2LBPA 1NPYA 2NYJA 1RHKA 4U95D 2HJHA 4MVJF 3MPOA 5JLJA 1I32A 4I1MA 1IM8A 3IHTA 5FTKA 4ZCTA 3FSEA 3RSSA 4RVCA 1BOFA 4B3IA 1XB2A 5CJJA 5CA1B 1E79A 5KTTA 4GTOA 2ZSJA 4DUZB 5FT9A 1U7DA 5IYZA 3U31A 4U7HA 1NNLA 4AJ4A 5CLGA 3QX8A 1A8PA 3H9QA 5FBVB 2XTNA 4GWKA 4YO8A 1IHDA 3DO5A 3U7JA 1XA0A 4QA9A 1JQLB 4ANWA 1NQOA 3QU4A 3ZY4A 5L3ZA 2M6LA 5AJVB 2XSZA 1DHTA 4B84A 3ZX4A 2QGZA 2WMYA 2Z2KA 1YZLA 2PNFA 3F6SA 3P4YA 1I1NA 1U3GA 1SXJB 4LN1A 3K9IA 3QJ5A 1I6MA 4M76B 3V43A 4LV8B 3G2HA 4HK4A 3OAAA 3OICA 4GVLA 4ZQCB 5JAQA 4BO5A 3FJOA 3RTRB 3UCFA 4ZAYA 5A1TA 2NNLD 4HFMA 3HTKC 3PYLA 5T57A 4FYWA 3MQ2A 1NVFA 1Z5NA 2CB9A 2IH4A 4DOMA 1P0FA 5T6BA 1BMDA 1XZQA 1MJGA 4MS4A 4YCMA 4NBSA 3K7EA 1MV8A 3KKZA 1YGPA 1SCAA 3EBOA 5EA2A 3WFJA 3OI7A 5EMNA 2YXPX 4KXKB 1NQVA 4KT6B 2XV1A 5HRAA 4Q66C 3KVYA 1DDIA 3S81A 3U4GA 1U28C 4DNFA 3FUKA 5A4MS 1BH6A 2QJTA 2AN5A 2ORED 1KSJA 5LQUA 3F6CA 3T1OA 1N6OA 3PURA 2JS7A 1RWQA 3DMYA 5JJIA 1CS0A 2VXOA 1L5LA 7AT1A 1F2UB 4HRNA 1O5OA 4RMGA 2K2QB 1RDFA 1JFRA 2GUWA 1COZA 1GDHA 1E2IA 2ZBFA 3Q15C 2WWGA 3QU9A 4MDYA 2CBZA 4AP4A 3WDKA 4PSDA 2XVAA 1GWNA 5IKEA 1NHWA 5JQGB 4NOKA 1DSSG 3U1TA 3ITNA 1ZBDB 1M5RA 2ZSHA 5IJ9A 4KQEA 1QFSA 4LXUA 5LMZA 3ZHQA 5JWHA 3RJMA 4FILA 5KYYA 4JHLA 3PRJA 1QP0A 2RBKA 1XCGB 3IKLA 3ZK8A 1OPXA 1Y8QA 2P65A 1WRBA 4HRAA 2NUTA 1GGMA 5CITA 1NW6A 1PZEA 3FL2A 4DREA 4MVJM 4FEGA 2XQVA 4CXMA 3PREA 1P7PA 4JBLA 4BNLA 4LJSA 1YJQA 4GTTA 3AV0B 1JAYA 1XEXA 4YDEA 3GP3A 3ZDFA 5CCEA 3F3KA 3UA3A 2C4NA 2P27A 3IIIA 5SY9A 4R9RA 1JLSA 3G0BA 3I8XA 4KR3A 1HLFA 5AVXA 5EIEA 1N4RA 3PLAE 3V80A 3I3SR 3E7DA 4OHYA 4FMCB 4HDQB 3RU0A 1QYXA 1KARA 3U4AA 1XK6A 2VDLB 4TXHA 3IBCA 3I72A 1DWOA 5DRTA 1Q0UA 4E46A 3ETHA 5EXEA 1KOGA 4K5CA 4Q3LA 3PKZA 1ANKA 3PR1A 4Y18A 5KTPA 5KAMA 4HH4A 5C7OO 4D4GA 4GOMD 2VRWA 4DHEA 2GLXA 4UUNA 3BK2A 3WL6A 5DLQC 4WGFA 1MDBA 2JFYA 2AD5A 1GKKA 4Q4JA 1HT0A 2HQSA 1L5HA 1YUNA 2BEVA 1EQ2A 2I7TA 4J8FA 3PDCA 4I1AA 1JDBC 3WRXC 5J59A 4JFAA 4LYJA 2MYNA 2CG3A 3I58A 2JZNA 4BWFB 2XP0A 3DTTA 3LKZA 2QVYX 3BQNB 2WP8J 2NZ8A 1H2HA 1D6NA 3AF2A 2L0IA 1IQUA 2XUKA 2VHJA 1U2SA 4DGQA 3GJQA 4RH3A 1FU8A 4LDRA 4JI3B 1VMEA 2YN4A 2O48X 4L5YA 4FINA 2ZVJA 5CCDA 1DFGA 1ONNA 3V1LA 2FZVA 2ODPA 5JSZA 4WK6A 5DNEA 2Y0DA 5INTA 5IX8A 1SOMA 1KDPA 4G8JA 3DSWA 5I7RA 1C7QA 1G3UA 3SHWA 1A76A 5DHPA 1ISSA 3CR3A 5F73A 3ESRA 2AK2A 2OG1A 5DHAA 5DTEA 5FL7A 3H17A 5DN6D 1SHJA 3D3WA 4RVGA 3A70A 3LG2A 3W5HA 4PIMA 3BORA 2GXUA 2I8AA 4HI9A 1SUFA 1EDEA 3EQ2A 1N34B 3THYA 4PQFA 2CJPA 1BFKA 1EHYA 3R7FA 5JECA 1OKKD 3NS7A 4IHAA 4Z4HA 3C16C 2IQCA 1SD2A 2C84A 1GPH1 5I9SA 3DRAA 4EG0A 1RYZA 3OTGA 3NTLA 2BFEA 5I7SA 3N2GA 4LTDA 3N3BC 3OOWA 4ARCA 4LQDA 2Y1CA 3PHHA 1E4VA 5J23A 5ALEA 1UDBA 1YTUA 1NZFA 3TNJA 4UOZA 1SKBA 2Z1NA 2H2GA 2LAHA 1E7VA 2ZBPA 4L5AA 3DEIA 1I4EB 4YDOA 4AJIA 3SOZA 3VAZA 4B1FA 3QV1A 3FIJA 1XTVA 3ZHUA 3KU1A 4MQEA 3V5NA 4BV8A 1KS9A 1JPVA 3C3QA 1ZWLA 3KM0A 2QAGB 3EODA 1DUVG 4CM9D 3VVMA 1D2EA 3LUDA 3A04A 2XODA 4RANA 4OJNA 5CBNA 1CETA 5I3ZA 4YY3B 5FYDA 2HM8A 2M3HA 3FMGA 3N2YA 3NIWA 2KI5A 1H2RS 2O5EA 2BBSA 5EMHA 2PS0A 4LDNA 3PT9A 5JPIA 5B3JC 2FJPA 2R8RA 3O38A 4LXTA 2C4HA 4IKEA 2D5CA 5IM4F 4HNRA 4B46A 5BMOA 2ZBRA 2QLTA 2YQLA 5DBKA 3WFIA 3UATA 4YJKA 2X8WA 3SLGA 2R4UA 1A8UA 1HG5A 5EJ4A 5F5XA 1R6UA 5DCUA 3OHSX 3RBZA 2ECFA 4BYGA 5EE0A 5F3RA 1U8CB 4MYRA 4Q4LA 2A33A 5JH7A 1S8AA 4PYNA 3WBJA 3BMOB 2WM9B 2FRDC 3A05A 3PR2B 4CT4A 3GA0A 5ALVA 5BO5A 3KJXA 5FOUA 4N4FA 2WF6A 2V8OA 1YASA 3RIXA 3CGWA 1CZKA 1RXWA 4X95A 4DNXA 1D09A 3S44A 1YONA 5SVYA 3AHEA 4GI3A 3IR6A 1GSHA 3A9UA 4FJCA 5FCDA 5KYWB 2B5OA 1C3LA 3G68A 2BFFB 4CLXA 4DLXA 4G8DA 5F1OA 3K0BA 3VJMA 2YMMA 4B89A 3WBKA 3DCJA 3RB8A 3QSYA 2J9FA 1HFWA 1VL0A 5UKDA 2VPBA 1CQXA 1QAOA 4E31A 2PXHA 4D4LA 1IY9A 5AKXA 2BONA 4RPKA 2QMZA 4OQZA 3K96A 1GTL1 3SVLA 1P91A 2LGGA 1MKYA 4DGSA 1KH1A 1T9GS 2J3QA 4H7KA 2JK1A 3SHVA 1Z4KA 1BMFA 4G0YA 4EBAG 5IDVA 3CONA 1G21E 3O7AA 2BUGA 1K3TA 2H6IA 2QZSA 2IS6A 5AVUA 4NJOA 1I24A 4MMYB 4YJ3B 4OHRA 1VLMA 4WAFA 4JJ8A 2R6AA 2PUWA 1KYQA 2W4QA 2XDQA 1EDOA 4WFQA 2RSDA 2DZNA 1JILA 1XXLA 5T5QA 3RRFA 4D8TA 4JPSA 3OLQA 3QNWA 1EJBA 3WLSA 4B3JA 4WK0B 2ZT5A 3QMPA 2B8TA 4A55A 1XZNA 4MRAA 4K1XA 4QEZA 2ONKA 4DQDA 2YOHA 1RWBA 5K3SA 5AVJA 2RG7A 1QH1B 1YRAA 3CHOA 2EBHX 4EG4A 2P4UA 4JODA 2QVLA 2R84A 3N2KA 3CWCA 3FEHA 4EO7A 4XYLA 1IRXA 3I2FA 4B45A 3OQHA 1GZDA 2AFVA 3H0KA 1D6SA 4EPTA 4ZKEA 2RHDA 2X0NA 1JB1A 1SVXA 4TM8A 4WN9B 4ZDIA 2G5CA 1T4DA 2XD4A 1DC6A 4GPBA 1H23A 2W48A 2PM7A 1WMAA 4N3CA 2MWMA 2ZFUA 3AVVA 2EF1A 2G1JA 3PLWA 1B8PA 3MTGA 1V48A 1Y8MA 4M38A 4C6RA 4FQ7A 1NMYA 1YZQA 5F1KA 4NFYA 3GFSA 3Q3JB 1I2BA 1WVGA 1XJ5A 3TEFA 4OLBA 1UDRA 4FT4A 5B3KA 2F2TA 1U63A 2MA6A 3TIVA 2HC9A 3UWSA 3BXGA 5HMMA 2HNBA 3H2GA 4MQMA 4X1IA 3H5VA 4XTRA 3NHRA 2ILVA 4RLSA 2A9FA 4TS9A 2YWEA 3IEUA 3W05A 4M0DA 4Y7DA 5IKXA 2X5XA 5KTYA 2H3HA 3PQ8A 1LLDA 2G08A 2FPPB 2QG9A 3FETA 5DGHA 4BY9E 5COQA 4YRAA 3QZVA 4ROSA 4KXFB 3T54A 3JAWB 3VR4H 1P1HA 3LJNA 4OM8A 2B78A 4ERNA 2WU4A 3Q4GA 4HADA 3K70C 1N3BA 3T5TA 3P0JA 4XSGA 2VSYA 2OGZA 4DBZA 4QTTB 1JPNA 1MMFB 4XGIA 4OXQA 2N3ZA 4IC2A 4P80A 1FVXA 5GJWC 2BGKA 1O2DA 2QM3A 1BXKA 3ND5A 3ZHXA 1FUIA 5I7EA 5CM2Z 4J3FA 3DR3A 3ZBPA 2CDRA 2WM2A 3CX6A 1CDZA 3O1IC 4S05A 1OXUA 1SVLA 3AZQA 4C4XA 3KPYA 3LQQA 4XIYA 3IIKA 3HNPA 2DETA 2LR0A 1O97D 4EI8A 2X0KA 3UT7A 1MZVA 3LUGA 2VO1A 1YRBA 3KDEC 5KH9A 4BLTA 4ISBA 1DT3A 2R8OA 4EUFA 1YCGA 1XWIA 2CRWA 4ZVKA 1OLXA 4GOLD 1YB5A 1ZWKA 1GP2A 4J1NA 4Z9AA 3K20A 3GVXA 2AFHA 3WZLA 3U6BA 4C9BB 3W78A 4XE0A 5JROA 2E2EA 3X1YA 4R8KA 3WYAA 5AJZA 4U0SA 1QG4A 3OZUA 4HDCA 1N5IA 1RVV1 2IXGA 3IALA 3M1IA 2QRLA 1GZUA 2VH2A 3A58B 4DAOA 4DC9A 3QUSA 3IQZA 2PM6A 1GA1A 1NNUA 2O4CA 1YKGA 2C4VA 3QXCA 4N9QA 1XAHA 5IT9A 4OI4A 4HWTA 4MNTA 3G23A 1RBMA 3GFPA 5ER6A 1M7GA 4OAVB 4QQFA 3H9GA 5ALDA 5FJYA 2ZCUA 4L4SA 3FPKA 3ZE7A 2HT6A 4PX2A 5LWHA 2PZ8A 4A6XA 3ULYA 3R7SA 2VJMB 3G79A 1JFTA 3I1IA 4QTZA 1DBPA 4QDZA 4IZ6A 1WR8A 1HTTA 2X6IA 4RGVA 1KJWA 1KPGA 2JEZA 4KMSA 2CLMB 4OYLA 3BXOA 4KEAA 5IK2D 4RD3A 2CNLA 3ISVA 1DEAA 2XR1A 2DH5A 4EP1A 5K0LA 1QLWA 3I1FA 4XLLA 2GBLC 1NW4A 1R88A 3IUNA 2P1DA 3PDUA 1JR4A 1FYVA 1N5OX 5AOAA 1KNXA 2C2BA 2NU7A 3GZ2A 3EIOA 5E4FA 4F97A 2B8JA 3MS4A 5IU6A 1KK0A 2YUCA 5AD1A 3LF2A 3HSSA 3T7LA 3DE5X 2I6FA 5A03A 4F56A 1GLGA 2ZYIA 5IVHA 3OE7A 2NU8B 2XTAA 3L7YA 3ICOA 1ENZA 2BEWA 4C7VA 3BH6A 4JQOA 3SJZA 1MEEA 2GRAA 1WX1A 2OXIA 2OSBA 3SR3A 3HIZA 3LBFA 3QEJA 3QY0A 1B14A 3NPAA 3W7AA 2A14A 4EGQA 4JT9A 5ALSA 5F2OA 3IT0A 1NBIA 1L7MA 1DAIA 4O4JA 5D0QD 2RGYA 2Z5GA 1C9DB 1O9HA 3CHSA 3R40A 3U9TA 3VZQA 4IJVA 4QM6A 3TR6A 5BW6B 3UG7A 3BMCB 4CMCA 2RI0A 4QFMA 4LC1A 2R2LA 2Y0BA 4JXJA 4PNZA 4NZNA 1TTHA 4BQQA 1KY4A 3NDIA 2H4ZA 2XXAA 4CHGA 3CQGB 2IDKA 1W52X 2Q6IA 2AZMA 4FYXA 3TZCA 5AK3A 3BF7A 4RQTA 3LPZA 3BRQA 1FDOA 4HI0E 2MYPA 3NX4A 1EA7A 4HX9A 5HMLA 4TMWA 3FWNA 1B15A 1RJDA 1GDTA 3TJMA 1P8JA 1U98A 1N2JA 5AW6A 1M7BA 1NYLA 3UT4A 1S8FA 5DBEX 3QVGB 3M0EA 2COKA 3W9BA 3PNLA 3ZDCA 3HVEA 1V1RB 3C87A 1R15A 5FUWA 5K3CA 3RFCA 4AP9A 2R65A 2WKRA 4RD1A 2CKLB 5A5VA 2C94A 1TAQA 2ARKA 1NU6A 4N0MA 5EIBC 1CF4A 1ZS9A 1LQ2A 4BU1A 3L4EA 2V7BA 5TY0A 4Z51A 3APFA 4U8YD 2FEKA 1L1QA 3ZDEA 3MILA 1RZ4A 2ZRKA 1NN0A 3OIVA 1CU1A 3NHLA 2QQEA 3RVRA 1RU3A 4GF5A 3NYRA 2O7SA 4JI4B 4TLEA 3ZJUA 2QJFA 2AGVA 4OSOA 2RI7A 2YXDA 4N5DA 2L42A 1ZL0A 1CQPA 5HKKA 2E2WA 3GRAA 4GNRA 2XKJE 4A23A 4J0FA 2XYPA 4Z9XA 2Q3LA 2Q1UA 4OP3A 1PBTA 1JAXA 4UXJA 1TRKA 5ALPA 3FYDA 5A3VA 5ES4B 4ZVOA 4GD3Q 5KJLA 3UENA 4LHSA 3X0DA 1N8SA 2E61A 2EGUA 1SIWA 1NVVR 2QV0A 3RPGC 1CB7A 3TWWA 2Z2YA 1FRFS 4UTOA 1C3OB 4CM5A 4HX5A 1LBEA 2B3DA 1MX5A 5DISB 2HDPA 3L5KA 4XWKA 3GEIA 3V4FA 5EESA 3OEED 3QYFA 2P5SA 4ZVSA 4IYRA 3HKCA 3KC2A 2J30A 4O59O 5EWLB 4REOA 5C4IA 4XZ4A 4FHDA 4PLTA 3C7KA 3IDAA 3DNMA 4WUYA 3C8DA 3RS2A 5L6MB 2GKGA 4UVEA 5E4YA 4XFDA 1QPZA 2IPLA 2BLLA 1E2BA 1JL3A 1MN6A 4AWBA 1RBZA 4LMPA 1C7ZA 1EP3B 5FLEX 4FS3A 3D8HA 1A77A 4HTFA 3E3LA 2JZCA 4JWKA 3DE3X 4EW3A 4GMRA 2IEYA 1PL8A 3ZWBA 2XQ0A 1WZEA 2E87A 1TM2A 2JCSA 3LY9A 3B8HA 3R0XA 3NWPA 4BFXA 1EA5A 5KHLB 3DLIA 3ZGQA 1T5TA 4G26A 1DJQA 4FEAA 3WA7A 3SLKA 2X2PA 4V0KA 3K70B 1IRIA 3ADCA 2CMKA 5LB4A 3EJWA 4L08A 1TNZA 1IWPB 1D2MA 1W44A 5BUZA 1OW3B 1K6IA 4FNAA 3JQ7B 1QYCA 1U4SA 1JXAA 3PGXA 3UJ6A 3KLMX 1BEEA 1ISMA 2QG6A 2HJ9A 3PWTA 3L7BA 4NOLA 5CPFA 1NA5A 4TQAA 2QUKA 3WNBA 4FCWA 1QH8B 3OJ0A 3FVVA 3FSJX 3ZBTA 3LQIA 3M7KA 4CI9A 2JKVA 1Z5GA 4PLVA 4R2JA 2HKIA 1UPTA 4HS9A 4JUDX 4CZ2A 1LSUA 4ZDJA 1MXFA 3I28A 2A5JA 1WTCA 3G85A 3TOSA 3NTUA 3RGGA 4EVSA 5CX1A 5U4XA 2E4XA 5B53A 3FANA 1OBHA 1UPFA 4MVXA 4BV2A 4TL6A 4NRDA 2V7UA 3KR9A 4OHMA 2I6HA 2I22A 4LBYA 1FLVA 1SZDA 4C89A 1WM5A 1JM7A 4L4UA 1G8YA 4DA8A 1BI7B 5DKAA 1UFVA 4Y0AA 3B7BA 3V7FA 4E21A 3DBLA 5DNUA 1UPUA 4EQZA 3P2EA 3K9GA 5GONF 1IN6A 3RSEG 1NKTA 1UM8A 1V2GA 5CFQA 5ERGB 3ZWNA 4W5OA 3AEZA 4B81A 5G1NA 1C3JA 4FFBB 3RF6A 2IXEA 2QD4A 1S2OA 3DMGA 1OWPA 3W2GA 1QU2A 2LTAA 2UZIR 3KSZO 5MF6A 3FTCA 5AW9A 2O8DB 1U9IA 3ZDQA 2J7PA 3KV6A 1FC0A 2AFIA 4L72A 4AAYA 3C39A 4J8DA 1OWNA 4RACA 5NLLA 2DLNA 4CKWB 5DI9A 4QVIA 3WKEA 4WBNA 1GFZA 1K7CA 2BR3A 3G3EA 3OWOA 2EJCA 4BNDA 2ACWA 2E18A 2PYIA 1KJZA 4ATZD 4DX1A 3O75A 4PLYA 3O8CA 1L5RA 2JI9A 1U4NA 2XCTB 1HMYA 3WLNA 2O5RA 3O8RA 2ON6A 1SUSA 1Q1GA 1PRYA 2ISQA 3UJ9A 4BMCA 2X7JA 3MELA 5EQDA 4ZVNA 4XKBA 5BR8B 2K1JA 5C4MA 4WKCA 1C0KA 2ZWPA 1XR3A 4PC6A 1Z5WA 2X38A 1P0QA 1EP1B 1N2GA 1WEVA 3N2ZB 3OPYI 2GOYA 1EI9A 2BTDA 5JFTA 2ZRMA 3ZDYB 2CXHA 1ZD5A 2E1RA 3FPJA 1UZNA 2GXQA 2WF7A 2WFAA 3P2MA 3EZ2A 1RWOA 3QLJA 4P6VF 4LOHA 5CNJA 2Z57A 5ICGA 1VJ0A 3HCSA 5CP8A 3BL6A 1Z6QA 1E7WA 4ADSG 4GR9A 1B6SA 4KYTA 4WXYB 4XLTA 3DEJA 1NQUA 3EWIA 2IOSA 4OQXA 1C7RA 3I2YX 2XEHA 1ODJA 5LBTA 1U5AA 4FLEA 4Y2YA 3HFGA 3T5GA 3C1OA 2Z56A 2QKYA 1IY1A 2R2AA 1I7LA 1V3UA 4YVQC 4RFLA 3O8QB 4HB2A 3T06B 3U16A 5JPDA 4U9IS 4QREA 1DTEA 3LKDA 3WYCA 1JX6A 1GAXA 5ALHA 4P4GA 5CLLA 3JZAA 3UHAA 4C6SA 1EWQA 4TV3A 1BCRB 3ORSA 2PYDA 1FMCA 5AHWA 1CCWA 1MX3A 2V97A 2X3MA 4KPEC 1KJQA 4A3VA 4DV7B 4BO0A 5IRCD 1ISPA 4LX8A 4AVYA 4WHMA 3R3WA 2NTEA 3UKOA 4DM3A 3TZEA 1KE1A 1TIBA 1WB4A 3SZ7A 3ZZUA 1WXEA 1J25A 5BN4A 2KWJA 3LNCA 1P5JA 3U7RA 2ZQZA 3SM9A 1G7SA 1XELA 2YZNA 2R79A 3IQGX 5DF1A 1XQVA 3OF5A 3D0QA 3DSRA 3H9BA 1I3KA 3AEQB 2XGOA 2GAFA 3QYJA 2ZOSA 1R4AA 3DFKA 2GJ4A 3O73A 4RS4A 1MO2A 3LC2O 1KPHA 3LSTA 3SQWA 4Q15A 4DIOA 4YAJA 1MW8X 4DARA 3A0RB 3NLLA 1O94C 4L9RA 2BUCA 5K05A 1QQ7A 4FCTA 1L5YA 2W2TA 2EP8A 5CMWA 3KZCA 1W0KD 2QYUA 2FUIA 4EJFA 3C6MA 4IYJA 4ZQIA 1NBMD 4D82A 2XX3A 2FW8A 1HQYE 2VJKA 3W3ZB 4WEOA 1A7UA 2JFNA 4LNUA 3PL5A 4INAA 1Q84A 3FTSA 1P74A 3CSSA 1ZM9A 2R00A 2VAXA 1HYEA 3IP3A 3W1VA 4EMBA 3UKRG 4CEHB 3DYBA 3EGWA 2GHTA 4J07A 4ZQEA 4KQIA 1SXHA 4AN1A 5K8LA 1QF7A 1Q91A 1ZM3A 5LKZA 3U5PA 2HLPA 5T4BA 1HFEL 4GMXA 1PD0A 1J23A 4Z99A 2FK7A 4P58A 3ZVYA 4A0GA 3UXYA 2IODA 1N8TA 1EWRA 5L53A 5D3QA 3VYUB 1QYDA 2GZHA 1FFWA 1WL8A 3QOUA 3B9BA 4TKPB 4RZQA 1TGYA 3AL2A 2RAUA 1S2NA 4HWPA 2Y1NA 3SS9X 2EYQA 4WUVA 4XASA 4DLNA 3ZPVE 1WDYA 4KACA 4CEMA 1BJTA 1U2EA 1U5BA 4ILKA 2WAYA 5D3KA 2AN6A 2JAQA 4B2PA 3L8HA 5U1PA 1AKMA 3S4YA 2OZPA 4M0LA 3PB3A 4J7XA 5KVCA 1UZAA 3IB3A 1IPFA 4BZQA 1YFKA 4Q16A 4CBVA 3MKQA 5IAEA 2LXHC 2QTHA 2ODTX 4LG1A 4D9NA 2GLTA 1UBGA 1U0FA 2O57A 3EQZA 4LSWA 4YMIA 2QIZA 3L3BA 4LJ6A 2VUIB 2WTEA 3EB9A 4U0JA 3C7CB 1Z7GA 5FHRA 3P2JA 4IQ8A 2P2YA 2XIQA 1E96A 1IIRA 2XUQA 2ETBA 3AXSA 4JGBA 4FE7A 2FEOA 4RQAA 2A0KA 3K0CA 4UEQA 4GKBA 4PCUA 1SIOA 3TIGA 2HE0A 4P2BA 3ASGA 3NYQA 3ZHSA 2XMDA 4D0SA 5DX0A 3FFWA 4X7MA 3P9PA 4KLZA 1Y9EA 3I12A 1DT5A 3C6QA 1RXYA 1D0IA 1QR6A 1B1CA 1EG7A 2GF2A 4ZPXA 1BKDR 2CL5A 4ENRA 1MR3F 3DBRB 2P9IG 1JEQA 5CXUA 2PRSA 1HSZA 3ZDXB 3W5AA 1T6YA 1S70B 4N03A 1N0IA 2HPHA 4LXIA 5ELLA 2WB2A 1N6IA 3F6QA 3E1KA 2UV8A 1BWSA 2FOXA 2ZS9A 4CMIB 4BIMA 1O5IA 4MRMB 1NNI1 4WLVA 1AC5A 2WQ6A 3AESB 3TLGB 1SA5A 4HEA6 2BMEA 4DCSA 2RFLA 4P4TA 3P9CA 2OCXA 1LCIA 3SQVA 3K92A 3OZVA 5KQLA 4KH0A 4CQLB 2GWHA 4K9PA 2PPVA 5C0OE 2QL5A 2CF5A 3TTXA 1Z0FA 3AOEC 2DVWA 3SEFA 4F2HA 1L8OA 3UMYA 3ICQB 3L4JA 1M10A 4XIGS 1XAJA 4GC9A 2RKKA 3FUXA 4BX2A 1PJRA 4Q1EA 2X5OA 1F38A 2VWHA 3IR7A 1P6UA 1MB4A 2Y99A 3AY7A 2P4QA 1VP3A 5IXYA 3WBFA 2ETXA 4KXVA 4E13A 4DDMA 4MVJH 4JYAB 4J0HA 3K0FA 3KQWA 1K2FA 4G07A 1LC0A 2K4MA 3KQOA 1R4NB 2PVSA 2XAAA 1DIHA 5FTWA 4HLCA 1AQ6A 4EWLA 1PSWA 2WVJA 1XTKA 2NTYC 1QIFA 3UWMA 2CZGA 4BNNA 1OXTA 1K6JA 3RVBA 1QIHA 3AYXB 2WYIA 3V00A 3FHEA 5KOHA 4CYMD 4HDKA 3L5OA 4D7AA 3NTRA 5D5QA 4MA5A 4KW7A 2JH3A 3U17A 3RYIA 4YLEA 3WKBA 5CDYA 3WYGA 4ND4A 1KDOA 4X1OA 4DLTA 3IT3A 4D4HA 4J8YA 4UDNA 1B93A 1W8DA 5HFNA 4Y2QA 4Q37A 1OIXA 3MJHA 2E5LB 4J75A 4CN9A 3GVPA 2X9LA 2TSYB 1EUQA 1M2GA 2FY8A 3CN9A 2FDXA 4M53A 3E3NA 2J6IA 5CD1A 1A17A 3QW2A 3UM1A 4DC0A 2CEKA 3AUYA 1FPQA 1WM1A 1J8FA 2QXUA 2PJRA 2XA2A 1AQJA 3AKDA 3DBIA 3SBOA 1TQ2A 1ZG3A 3I04A 2XVXA 3WLMA 1GYPA 1OCCE 2P9SG 4HVLA 1G3IA 2IS1A 1CT9A 4MJLA 2J3DA 4DI4A 1ZA2A 1DBVO 2HO4A 2B9VA 4KRFA 2IPOA 3MZ0A 3WR5A 3R3VA 3BFPA 4IAOA 1H2BA 1RPJA 1SVUA 3PTZA 4E2FA 4UE3S 4X62B 5B2ZA 5GINE 3ZHOA 1MA3A 4M7OA 3KALA 2FQQA 1J42A 5GJBA 3ZLBA 3DLCA 1Y6JA 2JJ1A 2PL2A 1R3UA 2UZAA 4EAQA 2GRUA 1CVLA 5FQOA 3R6LA 5E75A 1EUCA 1FPMA 2NNWB 1SHZA 3T7EA 3UINC 1LDJB 4WNAA 1Z6PA 1WCIA 3ZW9A 2PJZA 4X85A 1XDBA 3I5XA 3QWFA 2ODAA 2E21A 1GGNA 4EJ0A 4B33A 3HO1A 5LDHA 4DVGA 3MWYW 3NBNB 4I5DA 4URWR 2E4UA 1LV7A 1RHJA 2BSXA 4YUZA 1IBCA 3T9BA 4MUFA 2IPAB 3UJ8A 1WZ2A 3JD1A 1KO8A 4XM1A 1BX1A 1KY2A 2YSMA 2BLNA 2VZ0A 1VE6A 5ALZA 4MR9B 3OE5A 2FGJA 2JGFA 3D7RA 3FAZA 4LJ4A 3ROZA 1BSVA 3D6MA 3P0FA 2BV3A 3U5MA 5JC8A 4OQQA 1OFHA 3E34A 1Z4LA 3F6BX 5I01A 2NAAA 2J9YB 3GDGA 1H2AS 1P6XA 3P2YA 5TRTA 5CBPA 2XUFA 1B2RA 4HLEA 4R51A 3OWXA 3FE2A 4JI8B 4YCJA 1XAIA 2XT9A 4OM7A 4R0MA 4FQ8A 1KI6A 1LRKA 1X7HA 2V0PA 4WT7A 2Y92A 5F5LA 2PLFA 5BP7A 2EFGA 5EVCA 2H1WA 2R4QA 4KGZA 1UDAA 1URPA 1X15A 5J5CA 1THZA 1X6VA 4EA7A 4EKEA 1XP5A 3CZPA 2YVAA 3MGKA 2X0IA 1QZUA 4RYDA 3GT7A 2WAAA 5J1SB 4IV5A 2YASA 4RTNA 2O8BB 3TRHA 4I4IA 3EXAA 2W43A 4DDKA 4GTVA 1P1CA 1YDWA 4DDVA 1EJ0A 1VA4A 3HZZA 2F42A 1UBOS 5JBNA 1MQSA 1XL1A 3U3ZA 3RUFA 1CTQA 2Q7DA 5DXFA 2KLHA 4Y1GA 1V7QA 2Y1DA 1E3WA 2P0EA 1G5TA 1LI4A 1X0VA 3DCIA 3E22A 3THSA 1U7PA 2X3UA 4PYOA 1ZIYA 3EIEA 4YADA 4HZUA 2C2GA 2W58A 4BQEA 2H6FA 1B76A 1OZFA 2H16A 1UMBB 3TGWA 5B64A 3D6NB 3DZDA 4JL0A 4BECA 3O4GA 4G4JA 3UFXA 3QYAA 4XSVA 3IFSA 5BXYA 1P5QA 4LF6B 4N41A 4LJKA 2EIJE 2NUBA 3Q8XB 3NANA 4ZO8A 5L4LA 1W5AA 5KINB 4NQ0A 2HV8A 4GC5A 4LF4B 4OLAA 5JFOA 5AXDA 4G0OA 3NWJA 4FDLA 5JS1A 1N3IA 4HS2A 2R4TA 1L7PA 5C35A 2QMYA 5ITWA 3EZ9A 4CQMD 3BRSA 4B2YA 4CW7A 4YRIA 4I2VA 1HX7A