3LVQE

The crystal structure of asap3 in complex with arf6 in transition state
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
476
structure length
420
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
total genus 126
structure length 420
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvqE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvqE04
4R71A 1FX0B 1GL7A 2X77A 1AA9A 1NBMA 1KDTA 1RJ9B 3ASZA 3GLFE 4C2UA 4MRRA 1DO2A 2VTKA 1G3IA 1XWIA 3PR1A 4DLUA 4KFTA 2CL0X 2KI5A 4TL8A 1BH2A 4Q48A 1TEVA 4QFVA 4KAXA 2ZRGA 1G64A 4M1WA 2DWOA 1XD8A 3V00A 2DR3A 4A15A 1G1MA 3L8ZA 4FN5A 3PENA 5EUMA 1VTKA 2YOHA 2VH5R 4IHQA 1U0HC 3PUZA 3QBTA 1X3SA 3KXLA 2F43A 2WPDD 2Q3HA 3GLFA 4JBXA 3L82B 1NIJA 4LHWA 2XNDD 2BC9A 2QPAA 2C5LA 3NVAA 3T9KA 4H1UA 4GMXA 1FUUA 1F2TB 3D8BA 1ZBDA 2PZEA 2RGNC 3CM0A 4B3FX 4TQAA 5H1YA 5B30A 2RGAA 4TMXA 1Q22A 1QHXA 2ZE8A 3C41J 3CPJB 2FFAA 3QIAA 2VEDA 3RS2A 1YKSA 1FTSA 1AKEA 2H1LA 2QM8A 4KCGA 1ZYUA 2QM7A 5EXTA 5FUYA 2H18A 2ZRFA 2AWNA 2AK3A 4PHGA 3LFUA 2HYDA 1WXQA 2IT1A 2QRNA 4D0GA 2GEVA 1D2NA 4LDJA 2XAUA 3OIVA 2CCGA 2K5UA 1X6VA 2AN9A 4BWYA 5H8WA 2RHMA 2BBOA 3BB4A 2DYKA 4PPQA 3UIEA 2JLYA 1IOZA 1TAGA 1U8YA 4PAQA 1ZU4A 4TL7A 5G3ZA 3T5DA 3MGCA 4LGMA 4TZ0A 3BFVA 2XSZD 4MKIA 2JIZD 4JVSB 3IO3A 2V55B 4TLEA 3N2IA 4QL3A 3NC0C 2ODEA 3GLHB 4KJZA 3C7KA 4OHVA 1WP9A 2I4IA 3OEHD 2J59A 4N0DA 5JBQA 1WB9A 1A2KC 1JR6A 4PPGA 4OHWA 2ZRLA 4B3BA 3IEUA 3OHMA 1ZP6A 5C4MA 1G21E 3B1XA 1E9EA 2X1VA 1D9ZA 1E1RA 2QAGC 4TQUS 2E87A 2IYQA 3CR8A 2ZRCA 1E2NA 3WNCA 2J0QA 4YLGA 1ELOA 4TMKA 2ECKA 2HF9A 1LY1A 3RRZA 2NO1A 3CNNA 4DB4A 4BFVA 1VCNA 1UKZA 2OAP1 2XTMA 4MYHA 5FR1A 3U3MA 3D6TB 3GJXC 3I5YA 3FFBA 2GEUA 1NBME 1T0JB 1ZNXA 4DXAA 4QHYA 2H8KA 3GEHA 4D2IA 3GLGB 1E2QA 1Z0IA 1BYIA 4KLZA 5JS8A 2GDJA 4D0LB 3U7FB 4ZDWA 1E9CA 1XTRA 1Z83A 1E2DA 2J0UA 4FCVA 3AVTA 4G3XA 2W6IA 3U3OA 2CNWA 1CF4A 4NHOA 1XD2A 2OILA 1X8KA 2ANBA 3W6OA 1IM2A 1GG2A 1G9XA 2B21A 3D3QA 3I8XA 1AM4D 1DS6A 5C4GB 1FW6A 1G3QA 1TUEA 3OAAA 1G3RA 1P2SA 3QG1A 5G40A 4TTRA 1U8AA 4TTQA 5TMPA 2OLJA 4TMVA 5JJLA 1VPLA 1AN0A 1T3LA 3PCRB 3K8YA 2D3WA 2F3TA 3BGWA 3E5HA 2XNDA 4JS0A 2IS1A 1M7BA 5KOYA 2OFXA 4CW7A 3RC8A 3B1VA 2OG2A 5CYPA 1BMFA 2GEDA 4JLBA 3THWA 2CHVA 1R5OA 3U3RA 1WE2A 3CO5A 2NGRA 4TLDA 4DDTA 4Q1FA 4IXMA 1G20E 1T9HA 3OE7A 1FUKA 2VQSA 2N42A 4IVRA 4W7SA 3ZH9B 5EP4A 3K70B 3TRFA 4JMPA 3O8CA 4NPHA 5FOTA 4O2LA 4WXRA 1QBKC 1X86B 2HJGA 2ZE5A 5JMTA 1Q0UA 4FMDF 3UWOA 4LWZA 2JJ1A 2OBNA 4PSKA 4URYR 5CIQA 5JRJA 1P9NA 2Q0HA 1SULA 4GMDA 1BS1A 5J47A 1H8HD 1RYHA 3NG1A 4Q9LA 1S1CA 1XTKA 3VMFA 4OI2A 3RHFA 1S9DA 3QQ5A 2R6FA 5P21A 5ANRB 3AP1A 1IY2A 1VG1A 2ZRMA 3NBXX 3UXMA 2V1XA 2XJ4A 2XZOA 2BOVA 1VCMA 3CONA 1G8YA 3WBKA 4ZCLA 4P0TA 1W4BA 4M21A 4LJ8A 1JNYA 1IHUA 1OH8A 3TK1A 1F6BA 1DBSA 1GNRA 2A2ZA 3SU8A 4B48A 5E95A 1GNQA 3LVRE 5HKKA 3I62A 4ACAA 1Y63A 1G7CA 2DWPA 3KB2A 4C0HA 3LXRA 2O8CA 5A0FA 1CRQA 1M7GA 2KSQA 2VP4A 2ZE7A 3AEZA 4B6EA 1VDZA 2Y8EA 4RD1A 1OH6A 4IOMA 4JVMA 1XRJA 1OFTA 1TEXA 3FE2A 1G7SA 2GCPA 2MMGA 1I4DD 2RH5A 4G0NA 1SKYB 3VR3A 4MKHA 1HQCA 3KQUA 1JJVA 1R2QA 1Z0JA 2O8EA 1W4AA 3DO6A 4WIAA 2QAGA 1KDOA 4LV5B 1XCMA 4R98A 4JL5A 2XNSA 1IONA 1U0LA 2YKGA 1Z6XA 3BH7A 1NN3A 2O52A 3B1ZA 2BV3A 1A7JA 1A2BA 3SYKA 1GZSA 5KUTA 1AS2A 4QOSA 5G3YA 1G291 2Z83A 4JSTA 2ONJA 3W6PA 2F6RA 4TSFD 2C04A 1XMJA 1E2HA 1T5IA 1W4CA 3U7HB 4M9ZA 3TSWA 1K5GA 4KU4A 3UK6A 3SEAA 4XTRA 4E03A 2YHSA 2GVZC 1JAHA 3H1TA 3CRMA 4EFNA 1SXJE 3BD9A 1KO7A 1QZXA 1K8RA 2XGJA 1IQPA 4Q4AA 5KYKA 4KYIB 3IILA 3K9GA 4TT3D 2YVUA 2P2LA 2CLSA 1YZGA 4B34A 3BERA 4GBMA 1M34E 2GAAA 5C18A 3CW2A 2ZR0A 2DBYA 1J8MF 3DM9B 1UKYA 2AFHE 3TW8B 2A30A 4OJKA 2ODNA 2OEPA 4XOIA 4U7DA 1R10A 2JJ8A 6Q21A 1W44A 1RRCA 3QF4A 2FJUA 4YXWD 3SYNA 2MSEB 1OXSC 3FKQA 1XEFA 3LA6A 4D4LA 3GFPA 3N70A 3K9HA 1NP6A 5AR1A 4BFZA 5DYGA 1AGRA 1QHYA 1IXZA 2N1BA 2D62A 4MH0R 3BWDD 4FMCF 2A78A 3CWQA 4UNQA 3CRW1 1UDWA 1S3GA 2YV5A 3ZVRA 3RANA 2O8BA 1JBKA 4UXIA 1IJEA 3FFAA 2HJVA 1K5DA 1KTVA 3R7WB 4EJSA 4C2TA 2AFIE 1R0YA 1P4SA 4G5QA 4L9SA 4ZCMA 4R2HA 2P57A 1KY2A 5AUOB 4BRWA 4F1PA 3RDPA 2J7KA 5JJIA 5FL3A 2H16A 2JJ2A 4EPYA 4EQ6A 1Z06A 2CL6X 4Z51A 1L4YA 5FTNA 3U6KA 5FPYA 3X1ZA 4WAUA 2VP2A 2QT0A 2PEZA 4ZKEA 4I1OA 1W0KD 4XH9B 5J5CA 4M22A 3TNFA 2C99A 2R2AA 4S2EA 2F9MA 3DKPA 1CR4A 3Q85A 4XTCS 5FBQB 721PA 2UZIR 5DLQC 3CBQA 4URUR 5LDDC 3A58B 3LXXA 1XJCA 2A5YB 1CLUA 4FCTA 4WXPA 2IUSA 3BFXA 4JLOA 1CBUA 2NO0A 4IDNA 3EPKA 4HI0E 2OXRA 3FPAA 1FMLA 1ZIPA 4XSGA 3VR4A 3QI2A 2ZSEA 5AJVB 5FTMA 3SHWA 3RWOA 1K6MA 4IRUB 3B82A 2NO6A 4Q7JB 3UPUA 2EWWA 3CRRA 2UZ3A 1W5TA 5HZKA 4HEJA 4B3DA 3RWMB 2PT5A 3C5HA 4HLCA 3WRXC 4CT5A 3QKUA 3TMKA 4PPNA 4ZI3A 1NLFA 4HDQB 3QBVA 3U7EB 4BFXA 5CB6A 1DTSA 3ZIAA 1V5WA 1NKTA 2ATVA 4A0FA 1G17A 3KX2A 1XXHA 1W47A 5H70A 4V0LA 2CE7A 1H65A 1XNJA 2FEOA 3NH6A 3CB4A 2AD1A 1R4AA 4Q1BA 3KUCA 2EW1A 5FUXA 2VF7A 4PZZA 2VA8A 4DUGA 5IHPA 2FFHA 5FFMA 4J0QA 3LVQE 3QPVA 5DE3A 1CTQA 3LQRA 2HYIC 1NIPA 1PUJA 2ZJ5A 2ZJ8A 3ECCA 5TDHA 3QVVA 4TWZA 1S8FA 1TMKA 4A2PA 2YJTD 3HU2A 1C4OA 1SKYE 2DWQA 4JL8A 2IWRA 1VIAA 5GJVC 1ZM3A 2H5EA 1PVOA 3V9PA 1XZQA 4E07A 4V0MA 1FMJA 3THWB 2G0NA 4ZPXA 1ZM9A 1G41A 1KSHA 2RAPA 4PQYA 1P60A 4BECA 5EP2A 1IBRA 3RYTC 2DY1A 1WDTA 2V6IA 1A4RA 2QE7D 3AF0A 3F0TA 2DFKB 1UF9A 4DDVA 1TQ2A 1SVIA 2Q3MA 5EQTA 3UMSA 2NOAA 4DLRA 2VHTA 2XTNA 3QXXA 3CF0A 4OI1A 3SUBA 2DB3A 2XB2A 3Q5DA 2ASEA 4OK3A 3SR0A 2QQEA 2OBLA 4HAWA 4Z54A 5JEDA 2BBTA 2IS4A 3A37A 4DKXA 2QENA 1GWNA 2B8WA 3HJNA 2PZFA 2GXAA 2IYVA 1O3YA 2GF9A 2ZRAA 5L3RA 4UXHA 2JJ2D 4CIDA 4CVNA 1RE0A 4HAUA 1ZM2A 3D7MA 3P32A 421PA 4ARZB 5L3SA 4A6PA 4IDQA 1GRQA 3MJHA 1KI4A 2XZPA 4LYFA 3BB3A 1W0KA 4JYCA 3ZVLA 1R6BX 3WYGA 4LJ7A 4TYNA 2A9KA 3AUXA 3NEYA 2GILA 1C9KA 1VCIA 3LDAA 5DSZA 4KODA 4US1R 4URZR 3PEWA 4I81A 3QF7A 5AJYA 3ADCA 1N5JA 2ZEJA 4OQMA 1E2KA 2H57A 4AG5A 4DSUA 4M4SA 3QEOA 5JS7A 3B7GA 1KZGB 1E9BA 1KY3A 3HPQA 4P4SA 4ASUD 2GXQA 2GK6A 1M1YE 4DRZA 2IC5A 2VYFA 4JJKA 2ZRKA 5JI2E 4C30A 3T12A 3EIHA 4UJ3A 2F55A 4BASA 5DHAA 1FP7A 3ND8A 4F38A 5JWRA 4TYYA 2D2EA 1KZ7B 1TQ6A 1X1RA 3LNCA 2ZI5A 3KZ1E 3LW7A 4GZMA 4V0KA 4PQRA 1F60A 1UEJA 1XTJA 4QJ4A 3OF5A 1ODFA 5EJEA 4OHYA 3I1FA 2AWOA 4RZ2A 3RRNA 1U9IA 2VRWA 1S2MA 2X2EA 3RSOA 4G1UC 2CNWD 1F2UB 1KOFA 2H7VA 2YZ2A 3SS8A 3FVQA 4QNRA 4MYCA 1WF3A 1W4RA 3P4YA 2PCLA 2C77A 3TIFA 1KK3A 4Q4LA 3TE6A 1FPMA 2R9VA 3QENA 4OK5A 4EFLA 2ZI9A 1IN4A 3QKRB 4GOJA 4D82A 3FDIA 2FDCA 3GMTA 3TAUA 1CULC 3PITA 1J99A 5CLQA 2OXCA 2VP5A 4XD7D 3R20A 2FPKA 3SYLA 1FOEB 1WQ1R 3RS7A 4Q47A 4QBIA 4QRHA 4XIGS 1BMFD 3IIKA 3ASYA 4LOAA 3W8NA 1T3SA 3HU3A 3SQXA 3CR7A 2CRWA 5FI1B 2D2FA 3QXHA 3GPLA 2MSDB 4MUAA 3PUYA 2WMOB 4YMWA 3BXZA 1D5CA 3SBEA 1F2TA 5JJKA 3T34A 4B3CA 4CZ2A 2ZS8A 3ADDA 5SZKB 3NH9A 4Z8XA 1S96A 2DFLA 1W2GA 2OCYC 4OHZA 3T1VA 3NC1C 3ONWA 1UKEA 2ATXA 5D3MA 3O8RA 3OIUA 2YYZA 1P73A 4FMDB 2GZHA 3LQQA 2PLFA 4QXAA 1CR0A 2AKAB 3CIOA 3FB4A 1E98A 2DFNA 1N6PA 4UKDA 1L2TA 5JWOA 4PSAA 2ZJAA 4EJSB 4LZZA 1CJUC 1SVMA 1DG1G 1UAAA 3THOA 1CJVC 3GJ5A 2ERXA 3FYHA 3IQXA 4I1SA 1DE0A 5KPJA 3R7WA 4ARZA 5L3SB 1PLJA 3D31A 4QGFA 4MRSA 4EPXA 2PLRA 3LY5A 1IJFA 2GXUA 1DADA 5E7MA 1NSTA 2ZREA 3LRPA 4PZYA 4EPWA 3NBYC 1VHLA 4F4CA 2JLZA 3PFIA 4L4UA 4BUJA 3QVUA 4UJ5A 4A0GA 5L3VA 4US0R 1EESA 4AKIA 4D6PA 4LJ5A 3W3AA 1KMHB 2FH5B 1NVWQ 3T06B 2WBLC 1LF0A 2AKYA 2CEAA 2GCOB 3QOFA 4PO8A 3IO5A 2REBA 1P9WA 1P61B 5LPNA 2VPPA 3HWSA 2QP4A 2VHJA 5FTLA 2IA5A 2Z5FA 4LHZA 2WV9A 4CEIB 3BS4A 2QMUA 3KTAA 2EU8A 5KSPA 1N2CE 3H84A 2YWHA 3PG5A 4Q03A 4BLTA 4CEHB 2YC2C 2EWVA 4B47A 4OYHA 1N5KA 1XD2B 3M0EA 4ITRC 3ZGXA 2GCNA 4A6XA 1Q1ZA 3IPXA 4D25A 4HB0A 2J0UB 1E9RA 1RYFA 1W36B 1F2UA 1OJLA 1SVKA 4EJSC 4JKIA 1W5SA 2NPIA 4HLUA 1J7KA 2JCSA 4V0NA 1NLYA 4HLQB 1E4YA 1GL9B 2BMJA 4HSEA 2W2TA 2Q9CA 1VECA 4Q9KA 1CJKC 1NKSA 1KNQA 1JALA 3BIFA 2JLRA 4DWJA 4DVGA 4JBYA 5BW8A 1AS3A 1Z0FA 3W3ZB 4W5HA 3AVUA 4OKSA 5K8LA 3CRVA 2F1HA 5CITA 3A1VA 3EC2A 5KSOA 4TMZA 3MWYW 4E22A 1B23P 5HCIA 5EXXA 4B2IA 1HT1E 4P32A 2C9YA 4XVUA 3PJRA 1I2DA 2E1RA 1OHHD 3KQNA 4MRPA 1Q21A 1JECA 1EGAA 2J7PA 1HY3A 2CMKA 4DHEA 2WJGA 5LD2B 2BCGY 1DVRA 5EZ6B 2W0MA 5CDFE 1VG9B 1RRPA 3CH4B 4PHTA 2J3EA 3GJ3A 5CLLA 1JAIA 2WWIA 1TF5A 4LRWA 3X1YA 2FGJA 5UKDA 2BJWA 3PVSA 1A82A 1XJ0A 2IYUA 3SC3A 3WP0A 2FG5A 3GCGA 5CM9C 3ZZ0A 4KFRA 3M1IA 3FM8C 4B44A 3A1TA 3K09A 2XOKD 2CHQA 1EX6A 3LLMA 3T5GA 3DWDA 1YE8A 1YR7A 2P67A 3THXA 4V0ME 2O8BB 3LX5A 1Z63A 4MRNA 2G83A 1P2UA 4PC2A 1KMQA 3CX7A 1NRJB 1D9XA 4NCJA 5FBWB 3GP8A 1FP6A 2QP9X 1RPZA 3KKPA 3FHCB 4XD7A 2C03A 4EQ6B 1F3OA 2PT7A 1NN1A 1EFUA 3AB3A 2WVJA 1SXJB 5KSZA 3SQWA 1GSIA 1N0WA 1VHTA 3P4XA 3U4QB 1ESNA 2EFGA 4DSNA 2CLCX 4YC7A 3A36A 4IEEA 1W48A 1TPZA 2GZAA 2ZITA 3IIMA 5GADl 1SVWA 4DCUA 1L8QA 1E0KA 2C95A 3QXSA 4BGDA 1JXOA 1KO5A 2QORA 2HT6A 1AZTA 1T5LA 2F1JA 2NO9A 2HXYA 3B6EA 4P4SB 3TUJC 2CCKA 5BQ5A 4B6FA 1G8HA 2B7CA 1YZLA 1XMVA 2C96A 1Q44A 2PX0A 2WSMA 1OXVA 5KNCA 4C9BA 5TXGA 3KQLA 4U00A 1HA3A 4KXFB 1DAMA 2ZSAA 4W5WA 2VO1A 2ZAMA 2RCNA 4NTZA 4ZO4A 2RKOA 3NDPA 2W58A 5DGXA 1ZM4A 4TMTA 3VR2A 3RS4A 3BAFA 1R5NA 1AJEA 4DDWA 2FF7A 2X8AA 2ZJBA 2AX4A 2YOFA 4FCWA 2FPLA 2WOJA 4AYTA 1ZIOA 3TW4A 2ONKA 4EPVA 2B0OE 1GRNA 5CB8A 2FEMA 1HE1C 821PA 3AKEA 1OXXK 2ZU6A 1EFRD 4WW0A 3X1XA 4KV9A 2JLVA 2WWHA 5EE3A 3BB1A 4LHYA 4DSTA 1IN5A 5CK4A 5KNBA 3IBYA 4X8LA 4EDHA 1UPTA 1MO5A 3DM5A 3WRYC 4K8OA 4TLCA 3J81k 1UEIA 3TBKA 4R7ZA 3MAAC 3UKDA 1HURA 4LJYA 4MQBA 3CF6R 5HR5A 1S3SA 2QQ0A 5FL7A 1W49A 1ZC3A 1GM5A 1R5BA 1ZJ6A 4KI0A 3A6PC 2AXNA 1DAKA 3A4MA 1VYVA 3B8HA 1TL7C 4AIIA 5L3QB 1W46A 3I72A 4R9UC 3GLIA 2NMVA 621PA 3GD7A 2NG1A 2QTFA 1T8TA 2IYSA 1E1QA 4QNMA 1P62B 1SQ5A 4D4MA 1ZNWA 1RC8A 1XZPA 2IK8A 2WAYA 5C1BA 2J0SA 3CZPA 4LI0A 1NN5A 1NL3A 2XOKA 2EQBA 4PAMA 3BE4A 3C5CA 2FFBA 1FZQA 1GFIA 2PCJA 3IHWA 2JATA 4PC6A 5JZVA 4JKYA 3VHLB 5FOSA 1N6IA 2GRJA 3B1WA 3DHWC 4Q1AA 3EC1A 2BDTA 4MA4A 3R9IA 3KKOA 3LBNA 1B0UA 1AGPA 1QHIA 4CT4B 2Z4SA 4M1YA 1M6NA 3AF1A 1G8FA 3CUEF 1OKKD 1KJZA 2J1LA 3K53A 1XBTA 1MABA 2IW3A 4PTLA 3ADKA 1QG4A 1FQKA 1E3MA 2QROA 2FV8A 1PUIA 4E5UA 1MABB 2IBMA 1NF3A 2WSSA 2OT3B 1MOZA 3NKVA 1RKBA 3H86A 4B76A 3EA0A 5IRCD 1Z29A 2BEJA 4AKGA 3AKYA 3RC3A 2AD5A 1DARA 2ZSFA 3CPEA 2ZRIA 4RZUA 3MJRA 1NN0A 5F9HA 4PSVA 2HCJB 1E69A 2GESA 2QU8A 4DCSA 3I5XA 2H17A 1YVDA 1AK2A 1RFLA 3FKSD 2X19A 4BFSA 1YR8A 1OXTA 2OFWA 4RD2A 4IDOA 4P3YA 5GVRA 2W83A 2EVWX 3IPYA 3OEED 4CYMA 3VR6A 2HT1A 3I4LA 5DN6D 4ZI2A 1TQDA 4P33A 4C0AC 2JLXA 1ONBA 2IUTA 2ZI3A 4US2R 4GOKA 3BBPA 5BXQC 2QGZA 1KKLA 2R62A 3BFKA 4Q4HB 2P6NA 2W2VA 4MKFA 4FMBB 1E4VA 1Z08A 5JRZA 4MDEA 3I73A 4B33A 2GHIA 3BRWD 1JR3D 4TN1A 1NY5A 1P6XA 4X8HA 4PO9A 4PHFA 4WVFA 3QKSB 3NEJA 2OCBA 1RRFA 3GLHE 2R8RA 1KO4A 4KFUA 4D0NA 5IF9A 4NKRA 1FL9A 3LO5A 2IYLD 4IDHA 4B43A 5DISB 1N6RA 3ZQJA 5LD2C 1XB2A 1I2MA 5KNDA 2Q9BA 1ZAKA 5EE5B 2WKPA 3ZLJA 3A1UA 4U5XA 3RAPR 3I32A 1LW7A 5CIWA 5IK2A 4ZCIA 4XWKA 1GILA 1Q1QA 4NP6A 2FPMA 4MGIR 3I3SR 4C7OA 2FX3A 3BH0A 2QI9C 3CKLA 3K0CA 4G01B 3IEVA 2Z6VA 2A5FA 4LC0A 3LJUX 4L15A 4C7OB 4LBWA 3C16C 1VYTA 1OFUX 1T0HB 3E70C 1II9A 2AL7A 5TVKA 3WYAA 2FGKA 1HT2E 4LSGA 5GJWC 3CX8A 1T8UA 3WP1B 1VKJA 1U9IC 2C9CA 4BLSA 1OB5A 1RRGA 2EFEB 2O0HA 1W36C 3VU9A 2ZXUA 1V43A 3BH6A 4GSYA 5FPTA 5AUNB 2HLDA 1Z28A 2P3SA 2Q6TA 4JZKA 3BJIC 4DLXA 2O8FA 1OPXA 3I92A 5TARA 4BZXA 1NJGA 3BORA 2VP9A 1KO8A 4PC1A 3RRMA 2NO7A 3OAAD 4QFMA 3QG5A 1IXSB 2IF2A 3AF2A 4RY2A 2OESA 2ZI4A 1CP2A 2XJ9A 4PO1A 1GITA 3EARA 4DCTA 1SGWA 1ZUHA 4Q01A 4B71A 1G7TA 4H1VA 1LF5A 2BIFA 3A1SA 4KFSA 5AWFC 3TAHA 1PZNA 5JECA 1GDDA 2W6JD 5CJPA 2ZJ2A 1KI3A 4F93B 4K46A 1E1RD 4JLVA 1OYYA 3Q5EA 4AKEA 3K0CC 1TU4A 3AV0B 3FOZA 1NG9A 2ZIAA 4G5RA 2WKRA 5JLJA 2CCJA 4RD3A 2GCOA 4CDGA 2QAGB 2GAOA 4URXR 2FA9A 3PEUA 5K8IA 4HZUB 4LYHA 1P7CA 1KYIA 3MD0A 1RIFA 2IYRA 5AJZA 2RGBA 4B32A 1P3JA 1HEIA 2O8EB 3W9YA 3U61B 2FNAA 2ZYVX 4TYPA 3SJZA 3TSZA 1ZMXA 4HAYA 4O0MA 5DI3B 3SJCA 5FH9A 3KXIA 1IN8A 2EFDB 1R0WA 2ODBA 4KYUA 3E1SA 1TX4B 4BEJA 4DLWA 3G82C 4B2LA 4Y0AA 2REOA 5FOXA 5EUQB 4A82A 2ZE6A 1TADA 1G5PA 1NVUQ 2ORWA 3QUSA 2VIIA 2Q9AA 1G6HA 1XFAA 3ZZUA 1E0JA 1XXHB 2ZROA 4OJQA 1E94E 1S1MA 5FR2A 2C2HA 1CS4C 2KBEA 2ZI7A 1Z5ZA 1OKKA 4XWOA 1TUIA 5IT5A 2GETA 2NQ2C 3OEHA 2ZJZA 4GDFA 2ZRHA 5AJXA 5J4LA 3GJ4A 4LY6A 4YMUA 5BYKA 3FMFA 4DJTA 4EAQA 3EZ9A 1U8ZA 2IUUA 1Z2AA 1W0JA 4YMSA 5HE8A 2XXAA 1ANKA 1N5IA 1DELA 3BK7A 1G7RA 1GKIA 4I99A 2Z0MA 3THYB 3OZXA 4A8JC 3NHAA 3W34A 2V7QA 5IK2D 3EZ6A 5F9FA 4GL2A 4QKQA 4JSYA 2YINC 3MLEA 4RFSA 1DAHA 5KDOA 3UMRA 3JZMA 1GL6A 2I3BA 4TQ9A 3GJ0A 4PFSA 5BN4A 2FSIA 1DAEA 3B9PA 4LK2A 2QE7A 4A0RA 5A5GA 1D2MA 2GJAA 1GOTA 3TJZA 4Z1MA 3LBHA 2G77B 4R2IA 3DMDA 1Z8FA 2ORVA 2ZRPA 2F1RA 5FTJA 4DZZA 3DKVA 3KDSE 4OL0A 3TKLA 1QHGA 4YMVA 1YJ5A 4Q21A 4JLPA 4M1MA 3U60B 2VHCA 1SVOA 1JR3A 1DEKA 4GI7A 3U3JA 4FXPA 1UFQA 4EUNA 1R7RA 1IY0A 3HDTA 2PMKA 3REFA 3C4JA 4FMCB 2PJZA 2ZAOA 4DDUA 2JLSA 5JCZA 5DYIA 5KDDA 1XF9A 5A4JA 1Z0KA 2W6JA 1JQLB 2DFTA 1WCV1 1G3MA 1MO6A 1PLLA 4B74A 5HKKD 2D7CA 4M8NE 1W0JD 4MKGA 3LWNA 2AK2A 1GNPA 2OSBA 2QPOA 3QE0A 4Q9IA 4XJXA 1BKDR 5JWHA 5SZJA 2I1QA 1OF1A 5L8VA 2ZRDA 1OIWA 4TL9A 4M1KA 4LJAA 5IDVA 3AGQA 1S0UA 4ACBA 3GLGA 1COWA 2VLIA 4PAOA 2OWAA 4NL4H 1ZW6A 4OBEA 4CGZA 3EX7C 2WWGA 2ZANA 3ZD6A 4QG7A 2O0KA 4D26A 3CPHA 4QJ5A 5BN3A 1G4AE 3N5CA 1KSJA 5DH9A 2R6AA 3VNVA 4TYWA 3KQKA 3SOPA 4AYXA 1T3HA 2OUKA 1BOFA 3KFVA 3I8SA 4LJ6A 4FWTA 4M53A 3SN6A 2CVHA 3ZZTA 4MGYR 2ZR7A 3EPJA 1E96A 4F4IA 2QG6A 2ANCA 1EK0A 2BKEA 4A1FA 4DLVA 5EP1A 1LV7A 2JIZA 2XX3A 1XEXA 5G41A 1UADA 3QKSA 4GOXA 1DAIA 3T35A 3DOEA 4HLDA 3KQHA 1Q1EA 2W2XA 1QF9A 3NHBA 3ZJYA 4F92B 1ZU5A 2V4ZA 3AVVA 3QXCA 1QHSA 2OM2A 1SVSA 2LWIA 1OIVA 2XXAB 3OESA 2DCUA 121PA 3U3KA 1HUQA 4BFUA 1P75A 2WZQA 1PJRA 3THYA 2RHDA 2GTPA 2G9NA 1MO4A 4PPFA 4AD8A 3EXAA 1OFIA 2CRRA 2J87A 3QKTA 4YONB 4AK9A 4BZPA 4MDFA 4NCIA 4A8JA 2KJQA 2ZQ5A 4IOJA 3SI7A 1OIXA 1ZD9A 1YZUA 5FPKA 3A1WA 4PXAA 4IKEA 2QZ4A 2YWGA 4NYMR 3HP1A 5D3MB 2J46A 1U81A 2Z43A 1EFCA 2IXEA 5L3QA 2ODWA 1EWRA 2YC4C 3U7GA 1I4TD 2XTZA 4LHVA 2REXB 1II8A 2B92A 3WNBA 1GTVA 1XEWX 2QA5A 2G6BA 1XX6A 1G5RA 5SZHB 2NTYC 2PX3A 4N1AA 1II8B 1MO3A 2ZUBA 3ZIAD 4B2PA 4Q1CA 3PEYA 4DEXA 3AVPA 5J4VA 2PEYA 1DAFA 2GJSA 1WA5A 3UG6A 1YRAA 4BPBA 4HB3A 1Q20A 3GLHA 1ZNYA 3IUYA 4I1UA 4CRWB 2ZUCA 3AQ4A 3PUWA 1BIFA 1GAJA 1DOAA 2QAJA 4ZDIA 5JHHB 4JL6A 3UATA 1N3BA 1UBEA 3TVDA 1E79A 4NU0A 3EPHA 1BO6A 1VIYA 3H4MA 4IVQA 3T1TA 3U44B 4OI4A 4B75A 2VBCA 2R44A 4II7A 4QM6A 4M1TA 2EYUA 2PMDA 2IL1A 1QRAA 1YRBA 3GJ8A 2NIPA 4A4DA 3W8RA 4NCHA 4I4LA 2AXPA 4BFTA 4C0KA 2GBLC 4KSBA 1XPUA 1FX0A 1KI7A 1MH1A 1ZD8A 1A1VA 5LB4A 3LX8A 4DLZA 4UNPA 5G53C 3TUIC 4F7WA 4KITB 4IDPA 4KO8A 3PUXA 2ZJYA 4Q7LA 3CZQA 4DC9A 2IYWA 1R8QA 3UANA 1Z0AA 2GVDC 2LKCA 4NBSA 3KTAB 5JHGB 2F1IA 3ICQB 2IXGA 1GKYA 5AJWA 4HLUC 1HV8A 4Q19A 5FOVA 1S4QA 1S9HA 4JIMA 2QTVB 1ZRHA 1NNEA 1KAOA 1ZNZA 2A3RA 1W36D 3QPWA 1QHHA 3HU1A 4ILEA 3SFZA 2O5VA 1QG2A 1Z6TA 2RGCA 3Q8XB 1KI8A 4XVRA 4XVQA 3SNHA 2CXXA 1NSFA 2ZSDA 4RZ3A 1MV5A 1VG0B 2VSXA 3H0KA 3P1JA 1M8PA 1MRSA 5C46F 1XCGB 3MWLA 2CHGA 2IYZA 1XP8A 4KLNA 4JYBA 4TYQA 3WYFA 1E79D 1TQ4A 1N6KA 4HUQB 4N3NA 3FHTA 4AI6A 4DSOA 1UKVY 2QRZA 1H8ED 2BWJA 4QGGA 1Z6GA 3S1AA 5FBRB 3ND9A 4FINA 3L0OA 2JLWA 4G5OA 2ZYWX 1COWD 3AGPA 3GFTA 1T4GA 4JLMA 5E4FA 3RVBA 4JVNA 4GNKA 4Q7MB 3S1AB 1VCOA 2ZI6A 4A2WA 2A5DA 2RGXA 1SZPA 2A5JA 3WMEA 1CIPA 4ZDJA 2PL3A 4B3GA 4S35A 3QXJA 3Q9LA 3EASA 1NMZA 4Q18A 3DEFA 3VR1A 3KXKA 3JZAA 4DLTA 1JB1A 1KKMA 1XCPA 1E0SA 2YOGA 2FSGA 1NVVR 1GP2A 1H8HA 1Y3AA 4A9AA 2O8DB 4RKEA 4ZIRA 3KJIA 3UWKA 1EG7A 2J0VA 2HCBA 4NYMQ 2UVQA 4WA7A 5DI9A 1KI2A 1UM8A 2WM9B 4D80A 2WHXA 4MGKR 4UXJA 4WZAE 1VG8A 2RMKA 4AWXA 3B5JA 2QUZA 1N25A 3ZDQA 1G8GA 3FEHA 2KWIA 4L8GA 4LV6A 2V8OA 1D2EA 1XDBA 4FI3C 4XWAA 1YZNA 2B6HA 1E2MA 4RD6A 5GJBA 5CJ2A 1Q57A 1SXJA 1US8A 4KBFA 3IQWA 4TLBA 4DIDA 4ESHA 2JLUA 4LJ4A 1J70A 1US8B 3GJ7A 4RD4A 1X1SA 4LBYA 4AC9A 2QBYB 3OE7D 2CE2X 5DNYB 1E32A 1XPRA 3WBJA 5C2JB 4MGZR 2DPXA 3QEJA 2JEOA 2IWHA 4N0EA 1NBMD 1JJ7A 1AZSC 1XD9A 4EKDA 1TTTA 3NIBA 1F48A 2D4HA 3KFXA 2JJ1D 1C1YA 5BN5A 5E3HA 1U98A 2XZLA 1KO1A 4CEIA 3KJGA 1YR6A 2P5TB 1JQJC 3IGFA 5FPSA 3L2OB 2CJWB 1KNXA 1U2RA 4HB2A 3SJBA 3EW9A 3PV0A 4GFDA 2PH1A 4AKHA 1LFDB 3R9XA 4L16A 2QGNA 5K8TA 4QBHA 2FZLA 2UKDA 3MUFA 1M74A 1KK0A 221PA 2VL7A 1KK2A 3WHKA 1N5LA 1YU9A 5EXPA 4NMMA 4Q5IA 1IAQA 1UBGA 3VNUA 4NH0A 4JBWA 3HR7A 3HYRA 3GJ6A 1M7HA 1EFRA 1ZD1A 4O25A 2OV2A 1QVAA 3X2SA 3Q7QA 5KU1A 3VX4A 2QNRA 4DBLC 4NCNA 3RS5A 4E09A 2B8TA 3BOSA 3X1WA 2D7DA 5F98A 1YR9A 3CNOA 2JA1A 1H8EA 1L4UA 1XJQA 4JLKA 4LUCA 3HYTA 3I61A 1TU3A 4C0QC 2GKSA 4B35A 1WBBA 1GVNB 3SHFA 4YMTA 3PUVA 3DPUA 3QF4B 4JT2A 3H2YA 3KUDA 5FPHA 1LVGA 2Z4RA 1FNNA 4JLAA 4W9MC 3Q72A 3ZVNA 3ICEA 4U02A 2IYYA 3T1OA 2RGGA 4TZ6A 1E9SA 4HYYA 3RABA 3GLIE 5FTKA 3AVWA 2YNMA 3C14C 4Q02A 5TY0A 1GKUB 2B7BA 2R6DA 4V0OA 1N6NA 3FMOB 3UG7A 3MSXA 4G5GA 2ZUDA 3KKNA 2CDNA 3HPRA 3QPUA 1JR3E 4M1OA 3U2QA 1UBCA 4TMWA 1F5NA 2OE2A 4V03A 2GF0A 5HE9A 4PR0A 3TLXA 1HQYE 2OZEA 1A5TA 4Q9JA 1J2JA 2BEKA 3R8FA 3AVQA 1AKYA 4RCZA 1GRRA 1G8PA 2BKUA 3B9QA 3PIRA 2IQJA 1FQJA 1SHZA 3MRSA 3WMGA 2N46A 1ETUA 3IBGA 4OK6A 3LD9A 2EFCB 1LTQA 5KO2A 1P2TA 2BHRA 5KDLA 4WBSA 4ESVA 1Z6AA 1E2JA 3DL0A 4KVGA 1TF7A 2RGDA 3IIJA 2WJVA 2WWXA 4DLYA 5J4KA 1HH4A 1EFHA 2OO7A 1PV4A 3TSOA 3WXMA 2P0EA 1IY1A 4PC7A 2H92A 3K1JA 4QGAA 3TGPA 1OT3A 2W0SA 4XSHA 2ZS9A 4HDCA 1KHTA 2F7SA 1DPFA 3AF4A 1SXJC 5KSYA 1VMAA 2JGNA 2XB4A 4YXWA 1JEEA 3O47A 3REGA 4P4TA 4C3ZA 5LB2A 2IS6A 1NY6A 3P26A 2PJRA 2FWRA 3K09C 2P6RA 1UBFA 4QHTA 3KKQA 4C0LA 4C4PA 2QPTA 2HF8A 1W2HA 1ZC4A 3VKHA 3OEEA 4LCBA 2RB4A 4QBFA 5HZHA 5K8UA 2GXSA 1DG3A 1QHHB 5DI3A 4OQNA 2NPFA 4CEHA 3LLUA 1ZCBA 4Q4HA 3KJHA 4V02A 3K0SA 1FTNA 3SBDA 3EIEA 3EAQA 1KI6B 1QDEA 4UNRA 4QC2A 4ABYA 1OW3B 4DUGD 1N6HA 2FE4A 3QKRA 2QP3A 2V6JA 1QVRA 2WTUA 3RS0A 2OAQ1 1E9DA 4WZ6A 3QNUA 2CL7X 3GLGE 4DEYA 4HUQA 2X2FA 3WHLA 1XTSA 3SFVA 3DOFA 4MUBA 2WJHA 1II0A 4A0HA 2BMFA 1W7AA 1Z47A 2VSFA 3MDBC 1E2GA 3O8BA 4GP6A 4NONA 4RFSB 1Z07A 2V3CC 4JLNA 1IXRC 5B64A 3AUYA 3V4RA 1G5TA 1Q1BA 5BYJA 4Q4JB 4M2LA 3UMFA 3K0AB 1GIAA 2GJ8A 3B1YA 1Z0DA 3F3YA 5FI0B 2QT1A 2BBWA 4M9XA 4OQLA 1X8JA 4MITA 5CDFA 4LYJA 3GLIB 2BVNA 5ELXA 2FFQA 1TNDA 5EE9A 2FN4A 2GBLA 3TR0A 1LS1A 3AKDA 4C0SA 2CK3D 4HAVA 1CU1A 2HDNB 3N2EA 3VU9B 1YHNA 1U94A 4FW9A 4CF7A 3OIWA 2HV8A 2NZJA 2ZSBA 3FMPB 4HAXA 4PZLA 1D8TA 2ZPTX 3AF3A 2J9RA 4L9WA 3CNLA 3B78A 4WZBE 4D81A 5KTYA 5J4HA 3SDZA 1AIPA 4Q9HA 3MCAA 2R6GA 4X8OA 3DZ8A 1XPOA 2HEIA 1WBDA 1JPNA 3PQCA 3Q7PA 1G4UR 3C15C 1N6LA 3F8TA 5FBLB 1NVXQ 3W90A 3X1DA 2V1UA 2FSHA 4NCKA 3FHOA 3WY9A 1SVLA 1MR3F 3OFNA 3B13B 3B60A 5FBVB 1NLZA 4JLJA 3AVYA 5DO9A 4ZKDA 1OHHA 3OIYA 2BJVA 1P9RA 5J40A 4LBZA 2QMEA 2FZ4A 4BLQA 4IXNA 3TUZC 1ZCAA 3MG9A 2WIAA 1BYUA 2WKQA 4FD2A 1CKEA 1E9FA 2WWFA 4FIDA 1SKQA 2SHKA 1KDRA 2WWWA 2KE5A 4LV8B 2P65A 3EWAA 4MYUA 4HAZA 4EPRA 2PZGA 2C9OA 4YDSA 4DT1B 2ZYUX 4EPTA 4K81B 4M1SA 3AP2A 2DHRA 3T1QA 3K70C 1XMIA 5B57C 1E2EA 5KPDA 3IHLA 4GPTA 5SZIA 4DCVA 3EG5A 4RFVA 4B73A 4URVR 2IHYA 4TSFA 1EWQA 5LBIA 1OH7A 1KI6A 2WIBA 2G1JA 2CJWA 1OV4A 3IKJA 1XEXB 1ZM7A 4IJMA 1J8YF 4Q00A 3JVUA 3A4LA 4IFEA 1N0VC 2GA8A 3K0FB 4PQFA 3VQTA 5KHOC 4NDZA 3K0FA 4OQFA 2IF0A 4PC3A 2EFHB 3L0SA 2BMEA 4JVLA 4BLPA 2BMDA 4IFBA 4JLDA 1OYWA 4JJZA 521PA 2F43B 1YZQA 2G0TA 2ZRBA 1G18A 2A5GA 1E2PA 4A8JB 1Q12A 3RS3A 2TMKA 4RD0A 4UNNA 3E2IA 1E99A 4UNSA 5HPYB 3LV8A 1CRPA 2F3RA 4EIWA 3JVVA 3PEVA 1P2VA 1AS0A 2ZRJA 1UJ2A 1CXZA 4O3MA 4QGHA 2XEXA 2RGEA 4OQXA 2ZJOA 3L8YA 4Q4JA 5EZ5A 3FKSA 1G3UA 4IVPA 4GP7A 3AVXA 3AP3A 2FOLA 2IS2A 4Q7KA 1P72A 3TVTA 3DVLA 1LS6A 2ORIA 1ESMA 2Q21A 3IDQA 4M9SA 2D06A 2QN6A 3CLVA 5EE0A 3THXB 4IOKA 2ERYA 2QL6A 3M4YA 2ZRNA 1MRNA 2OHFA 1OE0A 1RVDA 2C98A 2WICA 1G16A 2D74A 3KL4A 4LHXA 4DIEA 1J90A 4IEIA 5AK0A 1XU4A 3NWJA 1Z3IX 1ZUNB 4NE2A 4Y0VA 3ZS9A 4DCNA 3LAWA 3LW8A 4M0LA 2O8CB 3BC1A 1SXJD 3NBZC 3QY0A 2W00A 3KB1A 4X8MA 1XTIA 2IHBA 1XXHE 3KKMA 3PXGA 4NYJR 1OLOA 2QBYA 3U4QA 2J41A 1LNZA 2IEZA 3U44A 3EZ2A 3DDCA 4M9QA 1VYUA 2AR7A 4YDHB 4ERNA 4NYIR 2IX3A 8OHMA 2Q3FA 5CYOA 1KSGA 3LBIA 4DT1A 1Z2CA 5GJCA 3ZYCA 4Z8YA 2HXSA 1U0JA 3Q3JB 3CWZA 5M04A 2GK7A 3P20A 4MRVA 1JXMA 1KSFX 3GEIA 3RLFA 2OBMA 1FFHA 2JASA 1AQUA 1AQYA 3K9NA 5J4YA 2CK3A 3NXSA 1E2LA 4BEBA 3CF2A 1OFHA 3TQFA 1FNMA 1R0XA 4TL6A 1YQTA 5B58C 1XMSA 3GQBA 3LH5A 2BM1A 3EA5A 2R65A 1CEEA 1CR2A 3TR5A 1DO0A 2G3YA 1KGDA 1NG1A 4BQSA 1DAGA 1R8SA 4P31A 4HATA 4B3XA 3ZQ6A 5JSZB 4NYIQ 1NI3A 5HCNA 4NZYA 1DCQA 3ADBA 1T6NA 4QM7A 4LPKA 1PLKA 2JLQA 4Q4AB 1KI9A 2A7QA 5F3WB 3OFND 1NJFA 4DB2A 5FOUA 3SE0A 3T61A 4LBVA 4IW3B 5JEEA 5JCPA 1IN6A 3CX6A 1OXUA 3VHXA 2J7PD 4RKFA 2IYTA 3B85A 4RVCA 2EYQA 5CK5A 2PBRA 3DZDA 3GFOA 3NDBB 4BLRA 4LPSA 5GVSA 2VF8A 2JAQA 4OI0A 3VTKA 3U6BA 3K0AA 2P5SA 1KIMA 1MKYA 5AUQA 4ASUA 4O2RA 2GWHA 3GEEA 4HDOB 3JUEA 4BZQA 1RZ3A 2VP0A 1Q3HA 4PHHA 4BFWA 1CJTC 3HR8A 3CRQA 3R8CA 1E2FA 3L0IB 1KJWA 2G88A 2BM0A 2GZDA 4G5SA 4HZIA 2F9LA 3B2EA 1G19A 1N6OA 1T91A 4HB4A 3VX3A 2ZVPX 5EP3A 4BLOA 1TF2A 1HE8B 3K9LA 3SJAA 2O8FB 5BWMA 2KB0A 1P5ZB 4QHSA 4Q1EA 1KI1A 1XEWY 3QSYA 3VKGA 1KDPA 2C8VA 2FSFA 3FTQA 1QHNA 2HLDD 3AH8A 4ZIRB 1RW4A 1E0AA 2YWEA 1HYQA 1KAGA 3EWSA 1MT0A 1KJYA 3MWJA 4GZLA 2HUPA 2MSCB 2WMNB 4WOPA 2E9SA 2MMCA 1KK1A 1R0ZA 2AHOA 2ZM5A 2QTHA 3RRYA 3AM1A 2KBFA 4NYJQ 3VKWA 4KHZA 4QJ3A 2FMXA 1GUAA 5F2EA 1Z22A 4HUTA 1XTQA 3WMFA 1D6JA 3NTUA 4BE7B 2JDIA 2WAXA 3L0PA 4OHXA 2J5XA 2CLDX 3NBFA 3F5FA 3G5UA 2WJIA 4I1VA 4TLAA 2WOOA 1EXMA 2RGNA 4Q66C 2OCAA 4L5BA 4CEJA 4HZUA 3K70D 1OH5A 3SZRA 5JFGA 2LCFA 2NZ8A 4MYTA 3CH5A 3A4NA 4CEJB 1RJ9A 4LX0A 3ZD7A 3ZS8A 3U5ZB 1E6CA 2QSZA 2G1KA 2QEQA 2BCJQ 3O8DA 1OB2A 1WMSA 2ZYTX 2YWFA 3ZVMA 5EE1A 5FUVA 2IYXA 1Q3TA 4F91B 2QMOA 1NMYA 4D4JA 4RSGA 2I1VB 4GRAA 2OLKA 4PANA 2LKDA 1Z6YA 3MWKA 3W5JA 4D4KA 1ZINA 2GJKA 4A36A 2QY9A 3FGNA 2GNOA 3RSLA 1JI0A 1EFTA 1N0UA 4LJ9A 4P4UA 2J45A 2BBSA 4RCYA 2XSZA 5FUWA 4C0BA 5JSZA 3FMIA 4KVAA 4AURA 2FU5C 5D3QA 4BFYA 4AYWA 2VP6A 1ZVQA 1U99A 4LC1A 3A8TA 4QBGB 3C8UA 3GLFB 3L43A 2ZTSA 1G6OA 5DIFA 2IEYA 4URWR 1M2OB 3W5IA 2WPDA 4DLSA 4TT3A 2OFOA 1YZTA 3EZFA 5TB5A 1W1WA 3DMNA 2JDID 3M6AA 3MFYA 4A2QA 3EPLA 4PX9A 4H9GA 4IOLA 1OSNA 1YZKA 5FL7D 3FWYA 3QJYA 1HTWA 2CBZA 2QMHA 1O87A 3RNLA 2V7QD 2ZR9A 3R9WA 3TH5A 2CVFA 4FWIB 5FOWA 5JI3E 2V9PA 4ON9A 3W6NA 2ZETA 2R6CA 1E1QD 2WJYA 4RZXA 5E7IA 3WNDA 3AVOA 1JPJA 3MMPA 1L7VC 1E2IA 3P27A 1NVVQ 4AY2A 4ZV4A 1NMXA 4Z1MD 2QSYA 5DN6A 2IXFA 5EXSA 2W6ID 1E9AA 1WRBA 2XITA 1SHKA 5B2ZA 2O8DA 3ETLA 4LYAA 4GT1A 5HTKA 3T15A 4AG6A 4C0JA 2C78A 2ZVQX 5DHFA 5TV2A 3V4FA 4ZDKA 2VHUA 3EIQA 4POAA 1CJMA 3KJEA 5CM8B 4TTPA 4EFMA 4Q1DA 3VR5A 4YQFA 2ZU0C 2VSOA 3TQCA 5E7JA 2GJ9A 5AUPB 2WSSD 3VAAA 1ZUIA 4UQOA 4KBGA 2P6UA 2VHQA 4KSCA 2V54A 4W5JA 1LB1B 2WWYA 1X8LA 3G0HA 3AKCA 1UDXA 1EX7A 1U90A 4JT4A 4BRUA 1KMHA 4F4JA 5H68A 2OCPA 1JEDA 3VFDA 1IN7A 4A92A 1CR1A 2WJJA 2L0XA 3EZ7A 2O0JA 1I4LD 2ZS7A 4RJLA 3K0EA
chains in the Genus database with same CATH superfamily
1KTIA 2WHYA 2FLVA 1GL7A 2ATCA 4C7KA 4H7KA 4K5CA 1J97A 1NBMA 4IGIA 2GD1O 5AOBA 4DV7B 4K9KA 5HXAA 5BV8A 4MRRA 3RSSA 2NQTA 5FWXB 4QG3A 3R9XA 4IJ5A 1KFKB 3BMXA 4BL5A 5CFPA 1RKVA 4YPFA 1XWIA 4CMBA 1XK7A 1VM6A 3QYPA 4RLQA 3MWGA 4DLUA 5T57A 2YNQA 1U04A 3E5MA 3PWSA 5AKYA 5BSFA 2VDOB 5JVDA 3F6RA 3M4NA 1TKBA 5BR7A 5AQ9A 4IXDA 1T24A 5DW3A 3EXHC 2MR5A 4N76A 2IHUA 4HLEA 3AEXA 4J3JA 2DWOA 1N3LA 1TJPB 3BMOB 1L5RA 1QANA 2BKXA 4R01A 3V8BA 3LPNA 3KQIA 1V45E 3L8ZA 5DEOA 1IBLB 5ALWA 3JQ9C 1N33B 4IHQA 5C1IA 1JYSA 1U0HC 4DIMA 4BO1A 3ZDAA 2CKLA 4IHJA 3WK6A 4JOCA 2BKKB 3IBSA 3R9MA 4JUFA 3PPWA 2ODAA 2IV3A 1JJIA 1GQRA 2J3HA 3MS2A 4MQEB 2WIKA 4XVCA 1LSJA 4E51A 3I76A 3CG0A 2XNDD 3M2PA 4TRNA 1QX4A 1OD6A 4AXXA 1JEYA 4GMXA 4I4NA 3A1CA 1M5RA 5TDRA 1V7ZA 3C0KA 5BV7A 5CA1B 5G1PA 5AVVA 4DJFC 5KEIA 3O7MA 5H1YA 2BF0X 2UZ4A 3TL2A 5JH7B 4J3NA 2RGAA 3OF2A 2DBAA 1WIWA 2V7EA 1CZRA 2FFAA 2JIDA 3ZGLA 1U1IA 2OUIA 2VEDA 4IILA 4F6CA 2PUBA 2XOEA 4XEIG 3UFBA 4FK5A 1AKEA 1FTSA 1F8YA 3VR3D 3ZI0A 1DMRA 4JEUA 3VR6H 2JCBA 2QM7A 3LZ6A 3TVYA 5EXTA 3WOHA 4C88A 3G0GA 2ZRFA 1NC3A 1WM1A 3K1YA 4PHGA 1WY7A 2MYUA 1MZCA 2HYDA 1YDMA 2QRNA 4KI7A 1ZOPA 1Z34A 4CYMD 2IDMA 3MT0A 4I50F 2XUDA 4CN9A 5C5IA 3FNIA 3RIEA 3ACBA 2K5UA 4O1MA 3WIOA 2AN9A 3QJZA 4RLFA 2GRNB 3OG9A 3TOZA 3E82A 2RHMA 4HK4A 2PKWA 2Y1KA 5AW8A 2QZZA 2HMSA 4K6MA 3MTAA 4PPQA 4UMEA 3G49A 1X0XA 4FZ3A 1U8YA 4E2XA 1ZRMA 4Y9UA 3T5DA 4IJWA 4IV5A 3IDOA 2FP3A 3MWEB 2XSZD 3CLRC 3IDSA 3AUKA 3KELA 3QA9A 2OV4A 4JVSB 1V71A 5IWCA 3PDWA 1XDGA 2RG7A 3VTXA 1G1AA 1LD8A 2ECJA 3E8MA 3G9QA 3HDVA 3LHDA 1AZLA 3N2IA 3Q9UA 4G6ZA 4YRFA 5FADA 2X5KO 4O5AA 3NC0C 2QX4A 3OZ7A 1NQXA 4C2AA 5M2QA 1T2VA 1IXKA 1BE1A 3BRSA 3OOSA 3OX3A 4UATA 3C39A 3C1OA 5EHNA 2VCHA 3NQ41 5SVIB 3OEHD 3PD0A 1ENZA 4IIEA 1AQNA 1WB9A 1RPTA 1Q0RA 4BGIA 3OJLA 1JR6A 3V2XA 4OHWA 4B3BA 1CV2A 3MLAA 4D42A 1OX4A 2X1VA 7AT1A 4TQUS 4YGYA 3KAKA 2E87A 1CG6A 2IYQA 3QHQA 3CR8A 2ZRCA 3WNCA 1JH9A 2OPBA 5TE9A 2HU7A 3RRZA 3B20A 2NO1A 1S7GA 3CNNA 2ERCA 1CERA 2W4QA 1UKZA 2OAP1 3PQDA 4DV4B 4GE0A 4EHNA 5B7GA 1A9XB 3D6TB 1XU9A 3TJMA 3FFBA 3I5YA 2GEUA 3OMWA 4MMXB 3ER6A 1ZNXA 4DJJA 3F6BX 4DXAA 4H16A 4J0KA 1OXKB 2WXKA 3OZCA 3D9OA 1SUDA 1Z6ZA 4KLZA 2RK4A 3AOGA 2GBPA 2YJ4A 4D0LB 4PW0A 3ZW3A 2G72A 4OXRA 3U7FB 2DJ5A 4QPPA 1E9CA 2PPVA 1H94A 1N54A 3NATA 1G66A 2QVBA 2HYZA 3LKUA 1WU8A 2W6IA 3UB4A 4BIIA 2CNWA 2JB9A 1XD2A 3JPWA 3O1JC 2P78A 4HRAA 4EW3A 4EITA 2WIDA 1X8KA 3I9OA 4FP9A 1H1LA 4MS1A 1GG2A 4ZVUA 3D3QA 4BVBA 4Z1OA 1K4MA 5FOQA 2E1PA 1ABBA 1G3QA 1FNSA 1G3RA 1P2SA 4LZPA 5G40A 4AXHA 2BKLA 4TTRA 4IJKA 4TTQA 1INZA 1C30B 2CFRA 4TMVA 1HYIA 2W8BB 1D0IA 3GNTA 4KYTA 5JJLA 3KWJA 1AN0A 3OFKA 3PCRB 1JI3A 2YJ5A 3GW8A 1EEHA 4OJNA 2FX2A 1ZL2A 3ABRB 4WZAA 3ANYB 3RC8A 1FSFA 3H1BA 4GU5A 2OG2A 3UBTA 2WP8J 3IE0A 2GEDA 1G42A 4IZ6A 4R8RA 2J6BA 4RGVA 2UUOA 2HHAA 2F1KA 5EIXA 4LEIA 3UA3A 2R4QA 2NGRA 1FE8A 1G2OA 4Q1FA 1V96A 3QNWA 5B3JC 2YHAA 3HXLA 4F6RB 3KOWA 4Q0MA 4EQFA 2N42A 3ZH9B 2ZYAA 4IUCS 4KE7A 3WQHA 3K70B 1NUUA 4FGUA 2QUBA 2Y1FA 4HWOA 2EF0A 4IH9A 4QAQA 2V5FA 1SWWA 3EEYA 1JS1X 2VDQB 5FOTA 2XBLA 2Y0EA 4IJUA 1XU7A 4NBTA 4CR8A 5JMTA 4ALMA 4W5RA 3HYMB 5JG6A 4LZNA 1FDUA 3EXG1 2RBGA 4JOQA 2X42A 3NXKA 4G1BA 4LWZA 4PSKA 4Q3BA 5CIQA 3ZI4A 3DLIA 1VRWA 2A33A 1SULA 3ZVZB 2Y4OA 3ABME 3F6QA 1BS1A 3TNYA 5KTPA 3QYFA 2YIJA 1VJTA 2C57A 5J47A 1LQ2A 1OAAA 1Z4PX 4IM7A 3QVJA 3MHTA 4Q9LA 1NFIE 3ZDBA 3VMFA 4X1IB 4PN7A 2PANA 4DC1A 1VBKA 2WG1A 4DR4B 1PGNA 4OHFA 1TN8A 3SSOA 4U0JA 4D8WA 3MZ0A 2VNAA 1J1ZA 1F8GA 1JTVA 4E32A 3PZRA 2XZOA 2V1XA 2XJ4A 3FVTA 4UHFA 3HU5A 1VLMA 2HRZA 2H0AA 1JNYA 4BO6A 1A98A 3SU8A 3I28A 3NASA 3V5NA 4AXBA 5E95A 1GNQA 2M3HA 3UNXA 4LAFA 3ENQA 3V42A 1U7HA 2I4TA 2WJPA 1KKUA 3F97A 3KB2A 4I36A 4CR7A 5SICE 4J0DA 4YADA 2VDRB 1M7GA 3ZX5A 1YCFA 4IIYA 2Y8EA 4NIMA 4IOMA 4JVMA 1QZ2A 4KRXA 5JAQA 3REQA 3U7JA 3E81A 4OVVA 3MTIA 4KMSA 5IKEA 3DMRA 1G7SA 4ALLA 2BTDA 3ZR4B 2WLSA 3DXYA 3GJQA 5FI5A 3VR3A 5ESDA 4MKHA 1HQCA 5EI5A 4U2GA 3KQUA 1JJVA 2P4UA 2YW2A 5T6MA 1W4AA 2AMVA 4WIAA 2YNMC 2QAGA 4U2KA 1R1DA 3V4LA 3DZHA 1XCMA 3R5FA 1E5TA 3FKJA 4FOTA 2W48A 5ER9A 5DNCA 2GZ2A 3BH7A 3EIWA 5HM8A 2NAPA 4BX3A 3AETA 3URKA 2Z5VA 3NHRA 5ECGC 3SYKA 2ONJA 1VLZA 5A6CA 3DBOB 4JSTA 4M36A 3IVAA 3ASDA 2W70A 2OC9A 4FA6A 3WDMA 2C04A 4QZVA 5ICCA 4K2AA 5G4KA 1XMJA 2YJGA 1E2HA 4BVLA 2H29A 3DEZA 3JQ7B 1W4CA 3U7HB 4OFXA 3TSWA 2OQVA 1T29A 4E03A 3D6AA 4O5OA 2GVZC 3O3CA 3WKCA 4ZMBA 1YBAA 4XB6B 4EFNA 3R1IA 3I09A 1SXJE 1P0CA 2VDKB 4I8IA 1QZXA 5B79A 4NJEB 5BV1A 1BCSB 1ZW1A 2CLOB 1M2KA 3T8MA 3LFTA 3PGKA 3E1GA 4Q4AA 5KYKA 1U5CA 2G07A 1U6KA 5F7OA 1R37A 4ARIA 4XYEA 3WWYA 2YVUA 5I4KA 2VTDA 1JHQA 1C41A 1DIHA 4X1YA 4BNVA 4YPOA 3DTTA 2VXOA 5ICGA 3NETA 4M0FA 4GX2A 3G8CA 1WUTA 4PVCA 4RGQA 1FCJA 1WTCA 3OSUA 4NBRA 5A4IS 3H3JA 1R9NA 4M0CA 3BQOA 3F67A 4LE2A 1LA2A 4A2CA 4LDNA 2Z2YA 5AO9A 2CXNA 1S89A 2A30A 2QU7A 1TUGA 3FFWA 4UVIA 4U7DA 2XPYA 3Q8LA 3PE6A 4H7XA 1R10A 2PGXA 1D1QA 5ENTD 2C2OA 2QL9A 1L5QA 2J3MA 2JJ8A 3C6XA 3O03A 4KQCA 4L75A 4WESA 2B5OA 3W2EA 2FEZA 4D9HA 4UTVA 2H65A 4U2CA 3HVEA 3SYNA 2MSEB 5SYNA 1ZITA 3L0BA 4E1AA 1MEEA 2JGKA 4B6QA 2JS7A 1K6IA 3K9HA 3N70A 5KOJB 5DYGA 1HYBA 1IXZA 4MWEA 3B7TA 4WADA 6REQB 1Z7BA 2FPPB 3KT0A 3P71T 1AT1A 1G60A 1KU0A 1V3QE 4Q6WA 3B5EA 4JHLA 1EK6A 1AGXA 1KMMA 2WR8A 1VJGA 3BMNB 1UG3A 2WJAA 4ZV7A 1IYGA 3I6QA 4F4DA 3RFTA 3FA2A 4UM9B 4QJIA 2C2LA 1YJXA 2P77A 3INNA 4ISBA 3LHFA 4O3FA 1HLPA 4ZCMA 4MI3A 4EGCB 2P57A 5LDHA 1NXQA 3Q12A 5EXDA 3I34X 4EUEA 2J7KA 5AUOB 1RXVA 5JJIA 4DPLA 4EZLA 4PLVA 1WP4A 1W75A 2CL6X 4A5OA 2ZQZA 4DADA 3WWDA 8LDHA 3CS3A 2A3NA 3OOWA 2KWNA 2MYTA 5CCLA 1QGAA 1X1TA 2QT0A 3DKRA 1FP2A 1GDHA 5ALQA 3I9FA 4M22A 3TNFA 2C99A 1ZESA 4EO7A 3MT8A 3O82A 5KH9A 4KXQA 1V2HE 5TT0A 2QT9A 4E70A 1WW3A 3ROMA 1EU1A 1WVGA 4YAWA 1LNQA 4Z0PA 2BF7A 5DEIA 3STXA 4NZPA 1D6SA 2OHXA 2C5BA 3BF8A 4PINA 5E9AA 4HNAD 5CM2Z 1V35A 3BJEA 4ZXPA 1FXWA 4O02B 3K15A 3HDHA 2Z08A 2O1WA 4KQ9A 4F56A 5J08A 5C80A 5IH7A 4JI2B 3EPKA 1GEGA 2OXRA 3FPAA 1TNBA 1C4KA 1FMLA 1ZIPA 1X3LA 3NHYA 5E6UA 3NVKI 3MA5A 1TYZA 4G5HA 3RWOA 3URZA 4BHWA 2AJTA 1XZJA 1Y98A 2LAIA 2J3IA 2PQ2A 2PT6A 3B82A 5ABPA 2A9PA 2EWWA 5AI0A 1WSAA 3H6GA 3DLAA 3LQYA 4OBXA 5TR9A 1S4MA 3QLTA 3RWMB 4PG5A 1JDZA 3FIUA 4MI1A 1T4MA 3C5HA 1T25A 4HLCA 2OPHA 3TLMA 1IATA 2AGVA 4YJ3A 1U0FA 1Z7WA 3OUTA 3QBVA 2CB0A 3KQTA 4BFXA 1VA5A 4WXEA 3Q78A 3H5IA 4LNBA 4A0FA 1DC5A 2HJWA 2NUAA 3BD7A 1BS9A 5DBGA 5DW0A 3DMPA 2UVDA 5IKPA 1UZMA 1MMFB 3NB0A 2CNKA 4CF3A 3IVGA 2ZIWB 4HYEA 5FTPA 1NW5A 1IVNA 1E59A 4CMJA 5FUXA 3EDTB 4PZZA 1KDYA 3FEYA 1QX3A 3F5QA 4NQZA 4DE5A 5BV0A 1B8PA 4J0QA 1DKQA 3KT6A 2FWIA 5DE3A 5HGJA 1EVEA 4CM3A 1NIPA 3VUFA 4YUWA 2P3OA 5B7QA 2ZJ5A 2ZJ8A 2CLIB 4QGSA 2XRZA 4RORA 4JD2G 1OYVA 2PZJA 1U7ZA 4TWZA 2Y0DA 4A4CA 1TMKA 2FW9A 3HU2A 1ZKMA 1T9CA 2JIBA 2YFYA 1ADFA 2IEIA 2VRCA 4B94A 3BMCA 1VIAA 4KB5A 3HCUA 1ULBA 2H5EA 1T13A 5GJVC 2AUNA 5A3RA 2B4RO 3VISA 3DHNA 1XZQA 3NS7A 3N0VA 2CHFA 4I9GA 1O95D 2G0NA 4WWHA 4UUNA 4QQNA 3QVXA 2HWKA 4RETA 4QT4A 3UHFA 4UDNA 4CMIB 3BWBA 3U4MA 1IBRA 4TMFA 2P9PG 2E4XA 2IZ7A 5C34B 1KEKA 4Z99A 3RAFC 2PK3A 2Y6VA 3GK3A 3L06A 3O4ZA 4RMJA 4DDVA 1BHJA 1TFRA 4IVNA 4D3SA 5AW3A 3BVPA 5I9TA 4O2AA 1QV9A 2PX6A 1PT5A 2IOSA 5EQTA 3TSAA 3LPCA 5AESA 3R2JA 2XTNA 2GX6A 3HBLA 3UJ3X 4KR3A 3IAM6 2DB3A 1AA6A 3D7KA 3GN2A 3IEXA 2QTCA 5BNZA 1JNXX 3VYTB 1GUBA 4K9PA 3ER9A 3PDIA 1ZAYA 4U2DA 1IH8A 2XNHA 2OBLA 1U9CA 3UW3A 4Z54A 3H9QA 5B7NA 5JEDA 4BXOA 3JARA 3M1YA 2OQRA 3A37A 1ZBQA 4FYYA 2QENA 4Y6SA 1E3DA 1LPOA 3OE5A 4CFZA 5LP1A 4MUKA 3HL4A 3KR2A 2GF9A 5KMGB 4LUNU 1MBZA 3JD2A 4G0UA 2AHRA 3RVKA 2JFOA 5CG1A 5E1MA 4YTEA 1KJIA 4L08A 1RZ4A 3P32A 4XIJA 4GXNA 4IDQA 4E11A 3L9XA 5KNHD 1QKIA 1OR8A 2VNHA 2XZPA 4WZ3B 1QK4A 2WIGA 2ZT7A 3BB3A 2J6CA 1R6BX 3HL0A 3V4PB 1KZ9A 5DLYA 1XYVA 3MUEA 5LYJA 2A9KA 3ROTA 1ADYA 2GILA 5LFAA 2YN2A 1N78A 5U1PA 5ALKA 4X7MA 3QF7A 2RARA 5AJYA 2ZEJA 4OQMA 4KIGA 5LA6B 3I9KA 4M4SA 4G09A 3NAGA 4GUAA 1KY3A 3UM2A 2WRZA 4AY4A 1LTXA 1ECBA 4RA6B 4W4UA 3TPZA 2QV7A 1K3ZD 4WWNA 2GK6A 4DRZA 1KVUA 2LGVA 2IC5A 4I3FA 1DI0A 4DWVA 5JI2E 5LNK6 4H3HB 3BDVA 3BG5A 1DEOA 3DNPA 3EIHA 2YV2A 3P1JA 3TTVA 3WADA 2PTHA 1FDSA 1RT9A 1S3FA 3LK6A 2CBGA 3L8GA 6ADHA 2V59A 3E34A 3Q15A 1J0AA 4GZMA 4K86A 5HS0A 1YUMA 3LCUA 1R3UA 3PDNA 4PQRA 3LWZA 1XTJA 1TGYA 4EGAA 5K0TA 2A4MA 4EA8A 1KARA 1ODFA 1FU7A 1PD1A 4OHYA 2MT9A 5B3JA 2OOSA 2WTAA 3D7SA 1W59A 4QVGA 3RRNA 5IUNC 3K9BA 3D5TA 1CB7A 3Q9NA 3B3QA 4WFIA 1WDWB 1KOFA 2H7VA 4IGFA 4I1YA 1FDTA 4XR4A 2RKKA 1EMDA 4B5KA 5EJIA 2VWPA 1DHTA 1SR8A 1W4RA 1WF3A 2HV9A 3AEQA 2PLWA 1GO2A 1Z9BA 1BQ4A 2NUBA 3CZ5A 2R9VA 3PK0A 3QENA 4X1KA 4OK5A 4EFLA 4Z7NB 5AVXA 5BPPA 2NYAA 3FDIA 2FDCA 3UUEA 3V2HA 1Y8AA 2AOUA 1HDCA 1CULC 5E9WA 3PITA 3CV3A 4U0SA 3MHSA 1CPYA 3B89A 5CLQA 1HDIA 2VP5A 3RWBA 3VV3A 4CFYA 2D00A 1OLUB 3IP1A 2GBIA 3R20A 5BW6B 3RT1A 4IH4A 3DEPA 2HPVA 4KVFA 3SYLA 1WQ1R 3A2KA 4I43A 2Z2XA 3S70A 2QN3A 3INGA 3JD1A 4GR9A 3DEOA 3IIKA 5F33A 4PZCA 1T3SA 3HU3A 1U7WA 2CF6A 5HIJA 3SQXA 3GPLA 4MDHA 2VDUE 3PUYA 5LYJF 2Q5CA 4FYPA 1D5CA 1FDWA 4ZHSA 3CVJA 2VF4X 3MWDB 4RMIA 4B3CA 3H6HA 4JYMA 5DHTA 1UJNA 1KPIA 2ZS8A 4CZ2A 5JCXA 2QB5A 1S96A 1Z7GA 1M6VB 3IRVA 3I5UA 2DFLA 4HL6A 2N9UA 4KR6A 5HBGA 1WUIS 3UB2A 3NC1C 4S1PA 2C9BA 4UBIA 4BJ6A 5JSFA 4ZTZB 4C01A 1D4FA 4D3FA 2W8ZA 4OOFA 1K9SA 2BFFA 2ZIFA 3Q49B 3OIUA 1M72A 3C2QA 3IMGA 2L80A 1PK9A 2PLFA 3LQQA 4QVKA 3K16A 5P8WA 3V8QA 2GA9A 2PFKA 3FB4A 3WKAA 2H1VA 1A1SA 2IITA 2RC6A 5JW6A 4AP2A 1ZO8A 4EKGA 4PSAA 2AFVA 4EJSB 2A7XA 2G28A 2MYOA 6LDHA 3CLUD 4JROA 3RAEC 1CJUC 1DG1G 1IBMB 1UAAA 3GJ5A 1QIFA 2VNSA 4FKMA 1RXYA 4IP0A 4UVHA 4ZT3A 2O3QA 2XCUA 3AB8A 1FX1A 2HK9A 3F5MA 4WDRA 4S1VA 1P5FA 4ZALA 4DRXB 2NN3C 5KPJA 2RR4A 2UXCB 2AX3A 3NOXA 2HMYB 3HJFA 5JIBA 3LY5A 2GXUA 3HDJA 5K51A 1FCHA 3EGEA 3CK9A 4L85A 3QBEA 4PZYA 3DGEC 3L7AA 1GYRA 4F4CA 1JHMA 3PRYA 4W5TA 2JLZA 4ZCPA 3Q9SA 4WKNA 3UT0A 4AKIA 4MLPA 2FEPA 3IP9A 4NESA 2Y0BA 1Y81A 2GN9A 5IMBA 5L7TA 4R7LA 1A17A 1KMHB 1TJFA 5CERB 1NVWQ 4IMIB 3ZZMA 4HDNA 1YA0A 1Y3HA 4XIFA 1Y9DA 1LF0A 3HWX1 3QOFA 3IO5A 1HZ4A 2REBA 3HZZA 1P9WA 1P61B 3R3JA 4Y6CA 4BWRA 2AG8A 5ARFA 1A2QA 2WQHA 1ZEMA 2GWRA 3AW8A 4AY5A 3DTYA 3HWSA 4ZT2A 3L8HA 3MCXA 1N77A 2IQIA 2KYRA 2Z5FA 3LPMA 2X1MA 3IR5A 3OOYA 2PO7A 3DPLR 1I1HA 1U0EA 2G04A 3KTAA 1W581 4L5CA 1ZR2A 3DT6A 2ZAIA 3H84A 2WABA 1DRKA 5FV7A 4GP9A 1YB5A 2LN0A 3ABLE 1D2GA 4Q03A 1MAWA 3VC7A 4DGQA 2FPGB 1U2SA 2EGGA 1QV7A 4ZREA 3QSGA 3VRHA 4CHGA 3S8YA 5B3SE 3EIOA 2QUAA 3K5HA 3BTVA 1VB5A 4PICA 3ZGXA 4EJ0A 2VSYA 2HR2A 1EVYA 1MNAA 1Q1ZA 3A31A 1ZWKA 1C29B 3AHGA 1GPMA 3W6UA 3AKZA 3ZIAA 3ZE6A 4F72A 1IYMA 1T9GS 1RYFA 1Y3DE 2ZW9A 2ZU6B 3QVTA 1F2UA 4CETA 1WXWA 5CRUA 5AI9A 1Z5OA 2NPIA 3PGA1 3TMAA 3ZEFA 3OCWA 2QC9A 4V0NA 3KQVA 1P7VA 1ST2A 4HLQB 4MWDA 4D8YA 4HSEA 2HBRA 1XHEA 2Q9CA 5T6BA 3ZTGA 3T7LA 2AN6A 2R1VB 4IIHA 4BKPA 2UWJG 5JROA 3UPTA 5TABA 1XR3A 3L3BA 3LKDA 2FUIA 3LP6A 4JBYA 4PZUA 4KXWA 1Z0FA 5HOQA 5B3LA 5H80A 3FTVA 4RULA 1AXEA 2QRMA 3AVUA 4GPIB 3OZGA 3P1UA 2F1HA 2IPNA 2VK4A 2XVMA 4TUUA 3L0CA 4Q1VA 5TEWA 4GX1A 4MQEA 4G11A 4LZJA 5EXXA 4B2IA 3ZQUA 4N41A 3D9JA 3E33A 3Q1LA 4RIHA 5TBNA 1SHLA 4CNBA 1R4NA 4DR2B 1OHHD 4KX5A 1Q2UA 1SG0A 6GPBA 2ZCJA 2VNIA 4MRPA 1Q21A 2E89A 2PKXA 4NV1A 4XCVA 4YCJA 5CXXA 5F12A 1IYZA 2WJGA 4DHEA 5LD2B 3UWMA 1Y3FE 3P2JA 4MQMA 5JH7A 1DVRA 4ZOQI 3KIPA 1G6Q1 3L6CA 5CH8A 1VBFA 2OD7A 3PGXA 1RXEA 5CDFE 4BJHB 1E7MA 5ENQD 2IZZA 3OTNA 3GJ3A 2VSNA 4ECAA 3V1MA 1N32B 1SB9A 4FS3A 1V25A 2NWQA 4LRZA 3ILXA 5FH9A 1LU9A 4JP3A 1SCAA 2VHXA 4TRMA 5UKDA 3PVSA 5DTIA 2G70A 1XJ0A 2GASA 2IYUA 3TN7A 2CXTA 2GTHA 2FG5A 3GCGA 5CM9C 5EVCA 1I13A 3ZZ0A 3M1IA 4UE3S 3W5DA 1J09A 3GNQA 3A06A 3A1TA 1G3NB 2XOKD 3I9V6 4RK5A 1XDZA 2NUPA 3LLMA 1S2IA 2W2LD 2Z1NA 3B9RA 4DMHA 4KO3S 3RUHA 1UOQA 3TX2A 3V6LA 1RYEA 4FR0A 4TV9B 1XAHA 2G8LA 1Z63A 4MRNA 1ELKA 2G83A 4RPGA 3MWEA 3CX7A 4PC2A 4PGHA 5IKMA 5JD4A 1NRJB 5K0FA 4P2GA 3EHNA 4LKOA 3WLAA 3AR6A 1HFAA 1P0QA 4F2HA 3Q7SA 5L40A 2WM9A 1WEMA 3F9IA 4KO2S 4EQ6B 1YOBA 1KFCB 2D8MA 1WHSA 1EFUA 2D54A 2QG4A 4OREX 2HRBA 1K88A 3PZ4A 1CHDA 1E6UA 5GPBA 4S05A 3M2TA 1N0WA 5GOTA 2EFGA 2REQB 2ACWA 2W2KA 3AUAA 5CMYA 3JY6A 3MSCA 3H4VA 1I0IA 2DG2A 1W48A 4MV4A 4GC5A 3Q7AA 1KMCA 2C95A 3USES 3N2KB 4BGDA 1JXOA 2BRUA 3QEMA 4KW7A 1JBEA 2HT6A 3UJ6A 1GNLA 1T5LA 3EZNA 2XCCA 3CY6A 3AYZB 4N6OA 4NOJA 1CS0B 5KNCA 2XD9A 1OXVA 4U2BA 1D07A 1KHHA 3U37A 2P35A 5TXGA 1OXMA 3LSYA 5D5QA 3ONLA 2WUEA 3O75A 1ZD2P 2DCMA 2IVZA 4RH0A 4WE3A 4FEAA 5IYZF 1Y89A 1RZRD 2G17A 1JEQA 3CGWA 3VBCA 1WW2A 4CIYA 2BTQA 3M6WA 4ZO4A 4CLRB 3P9ZA 2DCPA 3MS4A 4EB6A 1DRVA 4B3MB 1MA0A 3ITDA 1H22A 1YIAA 1X80A 3PP8A 4OMCA 3RS4A 1AJEA 4DV2B 4FJCA 3ZHEB 4E4YA 4TWRA 4EY5A 3V8MA 5ED4A 1ODLA 4I4TA 1SXQA 4FCWA 5HMLA 4EWLA 5H83A 3IXLA 4QDZA 1I7QB 4CTNA 2X9GA 2ONKA 3KZCA 3PL1A 3ZCUA 1MXHA 4EPVA 1H4SA 3MF4A 2FEMA 821PA 5KTRA 1RQXA 3OP1A 5FUQA 5B1BE 2FEAA 4GKVA 5BT8A 1P3DA 2IHZA 4IBOA 2I2BA 2ECVA 4S3MA 3D8NA 2B2CA 1UJ6A 3F3KA 3K2BA 5KNBA 3IBYA 2R17C 5T5QA 4PYIA 3O90A 2H7CA 4Y0NA 2XMZA 5G0TA 1GNSA 3DM5A 1QYIA 4UAJA 3WRYC 4K8OA 1UMBB 4DJ5X 4ZAWA 4MSXA 3GD5A 4PLPA 1NONA 3QV2A 3LJKA 1I4WA 5T41A 3M6VA 3ZOKA 3AEKA 3SJ7A 1HURA 1USVA 1BWPA 4D10C 1XZ8A 4WXHA 5H82A 5HR5A 3PWKA 7MHTA 5AHKA 3S2UA 3ZHOA 2WB2A 4BV2A 1L7NA 3FNRA 4GYYA 1FLDA 4FFWA 4HH4A 1DAKA 1VYVA 3DGFC 1C9EA 1WZIA 1NNI1 4MUNA 1W46A 3I72A 5IP5A 3INRA 4C78A 1QE0A 3HI6A 2NMVA 1BX3A 1W93A 2X7JA 621PA 3GD7A 1N95A 3NTVA 4JA7A 4XWGA 3ZHSA 5KTOA 1KZ6A 1P62B 1S3IA 5KC9A 4B6JA 1U3CA 3E48A 4MWTA 1YWGO 1VMIA 3UPVA 4OU4A 3DZFA 5A9SA 3UQYS 5A62A 2K17A 1NR7A 2P9IG 2ENWA 2R85A 3BE4A 2PGIA 4RABA 1AKQA 1KP9A 4RU1A 1M2GA 5K8VA 5AK5A 1Q7TA 1LDBA 3BJMA 4H35A 5KTKA 3W5AA 2LGGA 4MQ4A 4O63O 4HNSA 1L5GB 1DRJA 1NATA 4XCXA 2BFNA 4Q69A 4RGBA 2BDTA 4ROSA 3KKKA 4GLLA 4BEWA 1GZDA 5IZ4A 2N3ZA 3STVA 3UGQA 4W1PA 5I8ZA 3JQFC 1KMIY 4CMCA 4YRGA 3BZWA 1QG6A 1M6NA 2WK1A 1G8FA 3A9TA 3I01M 3GUHA 4YUAA 2J1LA 2V65A 2VTEA 1EX9A 1WVMA 3D1VA 3HKBA 2QROA 2NADA 1K6JA 2PUYA 4KQKA 5LUBA 3Q1DA 3KYJB 5L4LA 1P91A 3KZXA 2FTKE 2QN2A 4HN2A 1QQAA 2C0PA 2WSSA 2OT3B 3K8ZA 4GKJB 1ODSA 1MN6A 1RKBA 3EGWA 2IHNA 4B76A 2J31A 3EA0A 3PC7A 1LWOA 3BK2A 2O2EA 1Z29A 4BVJA 4LQDA 3WFJA 3AKYA 3FYTA 2AD5A 3HA7A 1EP3B 4L95C 3FRHA 3B3FA 4IDAA 1UFKA 2ZRIA 3L9TA 4HDKA 3HGTA 4RZUA 2YZGA 4JUBA 4RK4A 1AKTA 2HCJB 4MPDA 3A1EA 4JW1A 1Q16A 2E6RA 2QU8A 3JSAA 5T8IA 3T7SA 4DF3A 4BFSA 1WFKA 1E6MA 3L8CA 4P3KA 1OXTA 1NYQA 3UUWA 3ZCTA 2QYSA 2DX8A 3AFGA 2EKDA 1KEWA 2VQ3A 3OPMA 1EJ0A 4TS1A 1NQ5A 4HNVA 1C7RA 3K1TA 3GFGA 3PF8A 3F6SA 2HT1A 1P6UA 2C1XA 2OEWA 1TQDA 4V1CB 4P33A 2JLXA 1KYWA 2CW5A 4WCFC 2R60A 3K9QO 2ZI3A 3BTSA 3GRUA 1BXGB 5E6SA 2X6JA 3BBPA 3UJAA 2QY6A 3GFVA 4EOGA 2QGZA 1KKLA 5CX1B 4Q4HB 5A5DA 2ZDHA 2P6NA 4MKFA 4MV0A 4QRDA 4WLEA 4NAUA 1VSVA 3D43A 2QD5A 4QDKA 3ZHYA 5H1UA 3GDGA 2A67A 4R54A 5JDIC 5C2YA 4CUKA 1WOYA 3OQVA 1N4DA 3EK2A 3OPYA 2P9BA 3VU8A 2X76A 1UC5B 5BPHA 3IUBA 3T7IA 2J3KA 5IHPA 3TGLA 1NAIA 4HGOA 4CKCA 1CP3A 2QTRA 5K0JA 4TV3A 1BGWA 1JLKA 2DR0A 4HN4B 4KFUA 5CA1A 5IF9A 3AJRA 3NNSA 3N8KA 3I37X 1JXQA 2LXNA 4UMFA 1REQA 3B53X 3A2LA 1AN9A 5K0BA 4CKBA 5HQ8A 3RU3A 1XLUA 1BW9A 4HLNA 2EBWA 2VUHB 1CSEE 3RAPR 4D9MA 3PJEA 4GL2A 4R6XA 1TLFA 3HVHA 4XR9A 4HOQA 1C80A 1GILA 1E5LA 1T4CB 2P2ZA 4OXXA 5DP2A 3T1NA 3UZUA 5JY1A 1WPQA 3W8FA 4ZTBA 2ZIUB 5KJEA 1TVEA 2QI9C 3BH0A 3CKLA 4LJRA 3IMCA 4L0CA 3ABZA 3DE2X 4C7OB 5AHWA 2ZZMA 1T0HB 1X19A 3BIJA 2G67A 1YA8A 2AL7A 2JCYA 4ZCSA 9GPBA 3SEFA 5LMUB 4AMVA 1DDGA 2V6MA 3COPA 3C43A 2EARA 1C9YA 3EG9A 3UJ8A 1VKJA 2Y93A 4UEQA 5FTWA 2YWBA 1LCIA 3P2YA 1N2IA 1RRGA 2R8OA 4R1NA 2ODQA 4TTJA 1XWHA 3ZRHA 3EXHA 1D2CA 5A0TA 4JJ7A 1T0PA 5DBEX 4G8DA 1V43A 3CNHA 4ZVQA 1LPSA 2F6NA 3ZZNA 3N39C 4FQ7A 5KWVA 2HLDA 2QRQA 3DC2A 4D9IA 4X62B 4D9EA 1P80A 1OPXA 2XCQA 2L6BA 2YZNA 5NLLA 5TARA 1UPUA 1KO8A 1SA4A 4BZXA 4EDFA 5IU6A 1BA3A 3EIFA 2FZVA 2NO7A 4QFMA 5CLFA 2R8EA 1CUFA 5E2BA 2IF2A 3AF2A 3B52X 4WL0A 5K3QA 2ZI4A 4Q4CA 4WK4B 5JT1A 2GRUA 3SQMA 3V8NA 1ZUHA 5EPOA 1EJ2A 4EECA 2BIFA 7ADHA 2NSDA 4JUDX 3D64A 3TAHA 2Y4TA 1PZNA 2ZSHA 1FU8A 4XYBA 3HXPA 1E3IA 2Q4TA 5CJPA 3L7OA 3RYIA 3SVZA 3TQRA 1IE3A 2QVLA 4YP1A 1TDJA 2OL4A 2ID4A 3I42A 5FEUA 1RLUA 4A63B 3Q5MA 3I8OA 1TYAE 3K0CC 1TU4A 3DSSA 3AV0B 3O74A 3Q5EA 5IJAA 1KEEB 1S7CA 3SXUB 3V3KA 2M32A 1DTEA 1G8SA 4D92A 1O6BA 4JT9A 5EZYA 3ROQA 2AMFA 5HG0A 1QS0A 2GAOA 2YWJA 4Z68A 2FA9A 3C3XA 3PEUA 4YUYA 3DBLB 3TZQA 3G5LA 1OTHA 3MD0A 2IYRA 3GXOA 3LFHA 3OZRA 4B32A 3RUPA 3ROKA 3ASGA 5JQWA 1SEVA 1C0LA 1TE2A 3CZRA 4GYJA 3T99A 1LBIA 3U61B 2O8EB 1T10A 2PGJA 4AUMA 3FL2A 4FNOA 1GUDA 3TSZA 1WEHA 2QLLA 2GRMA 4TXRA 3MUOA 3NTOA 4D5GA 3O7AA 3IDFA 1IN8A 4BRSA 2HDPA 3JZIA 4D9GA 1UANA 1TN6A 2ORED 3E1SA 3TIXB 1X2BA 3G82C 1BQEA 5T8KA 5FOXA 4O29A 5EUQB 3AHDA 3VK6A 1FMFA 1MO2A 3H13A 4LFBB 4R1SA 2P40A 3NTRA 3P2EA 3QUSA 2VIIA 3NHLA 1NQAO 4BKQA 5T4YA 1G6HA 1XFAA 1NI5A 1SQMA 5E3JA 4OHKA 2VQ2A 2ZUEA 2ZI7A 2BW0A 1Z5ZA 3DHYA 4G4IA 3DS8A 1KVRA 2GETA 3KEAA 3OEHA 1ULAA 1G98A 2C4NA 2OV1A 2XMCA 2ZRHA 3O9MA 1P19A 4XX0A 4YP5A 2I2DA 5FQ6A 5AJXA 5JD3A 5J4LA 5BYKA 2VDJA 4Z3DA 1U8ZA 1Z2AA 1IEXA 1ZOSA 4AG3A 3J80A 3RIGA 1BI7B 4APFA 2GCEA 3RGGA 3SF8B 3DV0A 3QKYA 2QRGA 1OA1A 2Z0MA 3RPGC 3THYB 4A8JC 5LQKA 3U26A 2Q7FA 1HE4A 1R8YA 2WT8A 2V7QA 3COVA 3EZ6A 2DUUA 2FAXA 2R66A 1K3TA 3K20A 2VJEB 2PXXA 2KGGA 3C3BA 4Q3KA 3MLEA 4RFSA 1TJNA 4MQFA 1T2NA 4F12A 1E7RA 2DHDA 3JZMA 2Y68A 3I23A 1SK9A 3R77A 1L5KA 3JXEA 3CKKA 2J09A 1U7OA 2FSIA 4LK2A 4UDOA 1TAUA 2R0QC 2M6KA 5JCJD 2WC1A 1O9HA 1GOTA 4XGNA 4ZK6A 3Q3GE 4Z1MA 4R2IA 1C3XA 3DMDA 3G2TA 1Z8FA 3LT5A 5KVSA 2ORVA 2ZRPA 4WKBA 3KB6A 3U40A 1SUPA 1MAUA 2F1RA 5FTJA 4DZZA 5BQFA 2B35A 3DE3X 4AZVA 1N0HA 3AQIA 4L9PA