3LVQE

The crystal structure of asap3 in complex with arf6 in transition state
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
476
structure length
420
Chain Sequence
b'DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 126
structure length 420
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvqE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvqE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvqE04
1NMYA 4GL2A 3W90A 3QENA 1YZTA 3UPUA 5KPJA 5JRJA 3B78A 3EX7C 4EPXA 2IYRA 1W0KA 2Q0HA 2QT0A 4N3NA 2IWHA 1N0VC 4LBWA 3QF7A 4II7A 2HJVA 3KJEA 2F9MA 5AJWA 1KO7A 2FSFA 1GP2A 1GITA 4M9QA 2WJJA 2W6JA 2WWYA 3OIWA 2AL7A 3KKMA 2A5DA 2ZE5A 2QTVB 5FTKA 3X1YA 1E32A 3BB1A 2XTZA 1UEJA 3SFZA 4F92B 1PV4A 2H16A 4DBLC 3CRW1 1VMAA 2XITA 5E7IA 4A8JB 4AG5A 5FUVA 3OEHD 1OB5A 2J0UB 4DLYA 3I72A 4HAXA 2P6NA 3RNLA 5HE8A 2F55A 2LKDA 1CLUA 3QF4B 2ZR0A 2AWOA 3GLIA 1JPJA 2JLSA 2Z0MA 2WWWA 4OL0A 3P1JA 2P3SA 4NMMA 3H1TA 2V6IA 3DMDA 5SZIA 2JLUA 2ASEA 4P4SA 2ZU0C 2REXB 2ORIA 2WV9A 1HA3A 2BC9A 1FUUA 1ONBA 3QJYA 4U5XA 3VX4A 4BFTA 1I4LD 3T06B 1LB1B 4GBMA 2ZI3A 4TQUS 4PHHA 1D2EA 1AZTA 3BXZA 1G17A 1W5TA 3PUVA 1MO6A 3M0EA 4TLEA 4QFMA 3PUXA 2CL6X 2NGRA 4B3FX 3NH9A 3ICQB 4F1PA 1I4TD 4MGIR 5DN6D 1RC8A 1KDPA 1IXRC 3W8RA 3MWKA 1NIPA 3NHAA 1KKMA 2QE7D 2ZJOA 3HJNA 1QVRA 1CULC 1Q44A 2E87A 2ODWA 2RGNA 1IN5A 3HR7A 3HWSA 4ZI3A 3WNDA 5KSZA 4V0MA 3WYGA 4DB4A 1OFTA 3NXSA 3U6BA 4HAVA 4KJZA 3QI2A 3A4NA 2FG5A 3B13B 3QPVA 4YMTA 1P61B 4CGZA 2CRRA 1ZUNB 2QGZA 5G41A 4Q01A 1R4AA 1E1QD 5IRCD 2GVDC 5FBRB 5B2ZA 4M2LA 5L3QA 1P9RA 1JEDA 4Q9LA 4QKQA 1NMZA 3IEUA 3GCGA 3QKUA 3ZH9B 2R2AA 3W6OA 4B48A 1ZJ6A 1E69A 3I4LA 5FTNA 3T1QA 4DCUA 3WRXC 4P33A 1L4YA 2WMOB 1LY1A 4C0BA 2FNAA 3X1DA 1XPOA 3VR1A 2QROA 4EFMA 1TQ6A 3FPAA 5F3WB 4B3XA 1XZPA 2X19A 2WSMA 4LHZA 2IYVA 3LV8A 2CHQA 1OXSC 4Z54A 5JS7A 4GT1A 4V0KA 4HEJA 4KODA 4QBIA 4M8NE 4PO1A 1DAHA 1QG2A 2G0NA 1MO5A 4G3XA 1XTRA 5KDLA 4EQ6A 1XF9A 5AJVB 2ANCA 4PR0A 1CIPA 1OXTA 5BYKA 2ZAOA 4ARZA 4KV9A 3G5UA 2BCJQ 2D2EA 2OFOA 1W49A 4LX0A 4OJKA 1T8TA 2CNWA 5CK4A 5C2JB 4UJ5A 2IS1A 1ZM9A 3AVTA 2RHMA 2H57A 1O87A 1JPNA 3EXAA 3REGA 2JAQA 4P32A 3AVUA 2WJHA 2ZTSA 3VR2A 1XJCA 3SJCA 3FE2A 3MRSA 1Z2CA 5JFGA 1OT3A 3L43A 1G5PA 3ND8A 4PC3A 3X1WA 1FW6A 1A1VA 4L5BA 1M74A 3SU8A 3K0AA 4HSEA 4WZBE 4XD7D 1X1RA 5E95A 1Z0AA 1GNPA 2CJWB 3T12A 2GBLA 1FX0A 2FSIA 2PZEA 4V0NA 1CR4A 2VYFA 1OB2A 2ONJA 4ZCLA 3H84A 5HCIA 4IDPA 2FFAA 2AK2A 4JLVA 5EE3A 4OI1A 5E7MA 3I62A 4PQYA 5C46F 2W2TA 1GVNB 1Z5ZA 3CNNA 3L82B 1U8YA 3DDCA 1JNYA 1GKIA 1KDRA 3PVSA 2A78A 3RS3A 2GESA 3TK1A 5KUTA 5DO9A 4JLBA 1FOEB 2OFWA 1MR3F 3QNUA 1NY6A 2GEDA 4ZKEA 3KUDA 2FZLA 4JLMA 5EUQB 2ORWA 3LWNA 3K0SA 1Z6XA 4A2WA 2IUSA 2ZRAA 1MO3A 2JJ1D 2XEXA 5TB5A 4NCKA 3QKRB 5GJCA 4NYIR 4PTLA 4P31A 1RPZA 2ZQ5A 4W5WA 3BD9A 1LF5A 5J40A 1JXMA 1W0JD 1JAIA 1KK2A 3QG1A 4BWYA 4UNQA 1EX6A 1RW4A 2BIFA 1X8JA 4WXPA 4ESHA 5F9HA 2XJ9A 2DFTA 1WQ1R 4JL8A 4UNRA 4HB4A 2HLDD 4LHVA 4EPTA 4DZZA 2G1KA 5HR5A 1CR2A 2CLDX 1K5GA 4ZIRA 5E4FA 2C96A 2GZDA 1G4AE 3PXGA 5FPKA 2YC4C 2RKOA 1XP8A 3KTAB 4KFSA 4RD2A 5KSPA 4D4KA 1E0JA 5EE0A 1R0ZA 2IT1A 1JR3E 2FOLA 2GF9A 1COWA 2X8AA 2JJ8A 3K9GA 4G5OA 5KO2A 1SVWA 2VP9A 2CDNA 5EE1A 3KQNA 2YOFA 3TSWA 4JLOA 3AGPA 1H8ED 2A7QA 3CZPA 4URUR 5FL7D 4XTCS 3VNUA 3ZZTA 4EFNA 4TQ9A 3QF4A 1G3UA 1E96A 1RRCA 2Q9BA 3KXIA 1B0UA 4MRNA 4O25A 5AK0A 2NG1A 1JJ7A 5JEEA 2FEOA 5AUQA 2NO1A 5BN3A 1EFRD 5JCPA 4BLSA 1IY0A 2VHTA 1U0HC 1JQJC 1XEFA 1H8HD 5D3MB 2H17A 1Z29A 4L4UA 421PA 1F48A 1KK1A 3UKDA 4DUGA 1J8MF 3SQWA 3BERA 2PEYA 4ZCMA 4IW3B 1AGRA 3LAWA 3AQ4A 4OYHA 1RKBA 1UBEA 4KU4A 1T3SA 1AQYA 1PLJA 4Q4HA 1TU3A 2ZS8A 4UNNA 3AM1A 2A30A 2HXSA 4AYXA 3X1XA 3E2IA 1NN0A 4TSFA 2YWEA 2BDTA 2WJYA 2PT5A 5DHAA 3PR1A 2QORA 3CPEA 4U00A 4DHEA 3SDZA 4LJ5A 2N42A 4KI0A 4NBSA 5TDHA 2O0KA 3NBXX 3TUIC 1UPTA 5CJ2A 4PHFA 1KSFX 3ICEA 1QHXA 2A5FA 1Z6YA 1G8FA 2EFCB 2QMUA 2NZ8A 2FU5C 2FFHA 1KSJA 1H65A 1M1YE 4MRRA 4MYHA 3R9XA 1Z0KA 2I1QA 4UQOA 2RHDA 2QT1A 2PLFA 2D74A 5CM9C 4YLGA 3KFVA 4BECA 2JJ2A 4Q5IA 1FQJA 1YKSA 4C0AC 3AF1A 1ELOA 1Q22A 2HYDA 2RGXA 5ANRB 4URVR 4AC9A 5J4LA 1XMSA 4F38A 5FH9A 3QBVA 4IOJA 3FVQA 5HE9A 4WVFA 1WCV1 4CRWB 4XWAA 1E0KA 5H68A 2IC5A 4NCNA 2PH1A 4US0R 3FKSA 2HDNB 3O8BA 1JI0A 1OFUX 1VYTA 1E2IA 3B60A 3SC3A 4MUBA 2F6RA 3U7HB 1NJFA 2YKGA 4MKGA 4KAXA 4D2IA 2OCBA 2FE4A 3OAAA 1WF3A 3WHLA 4BLPA 1JALA 4BE7B 4LWZA 2J7KA 1SXJB 4XIGS 3WMGA 4AG6A 1TF2A 5BYJA 1HV8A 1T3LA 2WSSD 3OEED 1S8FA 4IJMA 3SYNA 5L3VA 4GMXA 5EE5B 3RSLA 3BFXA 1E3MA 2W00A 2CVFA 1HYQA 1YZKA 1AQUA 1Z0FA 3FB4A 3VR3A 1IY1A 3GP8A 1ANKA 4L8GA 3TAUA 1BS1A 5EXPA 4NHOA 3CF2A 4A4DA 2IW3A 1NIJA 4A1FA 4DCTA 4X8MA 3UANA 1S96A 4DDTA 1LS6A 3A1UA 1IN7A 4TYWA 4RD3A 2FGJA 4P4TA 1QHNA 4QHTA 3H4MA 4Q19A 1P5ZB 2ZUDA 4GP6A 4B34A 5J4YA 3W8NA 4DRZA 5K8IA 3DOFA 2GILA 4B6EA 4JIMA 1II0A 2XNSA 3KXKA 2WTUA 1G3MA 1E1RD 4MA4A 2OBLA 3IKJA 4I1VA 2OO7A 3LY5A 3WXMA 1ZUHA 2YWGA 3Q8XB 3I32A 2H18A 3BH7A 3VHXA 3PITA 4G5RA 2HJGA 2EU8A 5EP1A 3QXXA 3CPJB 1FQKA 3P32A 3GLFE 6Q21A 2O8BB 2VO1A 4Z8YA 4DSNA 2Q6TA 3UMSA 2ZJ2A 1E99A 1TPZA 4F4IA 3U6KA 5CIQA 4W9MC 2VP6A 1XTSA 4YMVA 3NBFA 4Q18A 2WIBA 2BBTA 4NYJQ 5K8UA 1UJ2A 2QSYA 1SQ5A 2GWHA 2UKDA 1M6NA 3SOPA 2CE2X 3LD9A 121PA 2VA8A 3FHCB 5J47A 1QHYA 4JT2A 3IPXA 2KBFA 2CCKA 3KB1A 4LJ8A 5IK2A 2GK7A 2ZRJA 4RY2A 1ZIOA 2C2HA 4PC2A 1OYYA 2FEMA 4NYMR 3SJZA 1KSGA 1OFIA 2B7BA 2R44A 3AF0A 3I5XA 4A0RA 1AKEA 2GEUA 2PZGA 2QP9X 2F3RA 2GTPA 3FMIA 2KE5A 2J7PD 4Q48A 1C9KA 1GTVA 1I2DA 4C3ZA 2PZFA 1P73A 3PENA 2VTKA 5CB8A 4O0MA 2GJ9A 2JLZA 621PA 1S1MA 5CIWA 1NY5A 2ZUBA 2YOGA 2J9RA 2HT1A 4URYR 3I8SA 4JVLA 1I4DD 1F60A 3R9WA 2E9SA 2GCPA 3GLHB 4M9ZA 2QMHA 1XX6A 2VHCA 2DB3A 5GVRA 4QM6A 4JLKA 1Z0IA 3DVLA 2QI9C 1NVVR 4LY6A 3RSOA 4PSAA 2BM0A 3OE7D 4HZIA 4P4SB 3F0TA 3FOZA 3U2QA 3SEAA 4FMDB 4JL6A 3SS8A 4D4MA 3CB4A 3CONA 2EYQA 4HLQB 4WXRA 1DE0A 3T1VA 5DIFA 3JVVA 2GXUA 2YV5A 3AP3A 4AKHA 3MFYA 1UKYA 1UBCA 5AJZA 4M1OA 2C78A 1M7HA 1DAMA 3MD0A 2BV3A 5D3MA 2VEDA 3ZYCA 1E9CA 3MJHA 4LYJA 5BWMA 5DISB 5J5CA 4MQBA 5KTYA 3EPHA 1TUIA 3CNLA 1R8QA 4YDSA 4LJ9A 2AD1A 1N5LA 3EW9A 2VLIA 3KX2A 3S1AA 2AKYA 2V7QD 4Y0AA 5EJEA 5FTJA 3SNHA 3THWA 2J87A 3UK6A 2LWIA 3BORA 4EPRA 3WRYC 4AK9A 4DLTA 3G0HA 4I81A 4TT3D 1F2TA 4LYHA 5KNBA 3T1TA 3V00A 1HQYE 3JZAA 1GOTA 1OLOA 4GNKA 4DSOA 4TZ6A 4MGKR 4Q1CA 1KSHA 1OHHA 2ZYTX 5L3QB 5BW8A 5LDDC 1W36B 1GFIA 1KK3A 2C98A 3ADKA 1Z47A 5G3YA 1N6IA 1OKKA 4O3MA 1XRJA 1NG1A 1II8A 2P6UA 1XXHA 3U44B 4UXJA 4RVCA 4M1WA 3SBDA 2ZRLA 4TTQA 5BXQC 1S9DA 2IYWA 8OHMA 3CH4B 2OXRA 4QRHA 1E79A 3W34A 5HZKA 4JSTA 1S1CA 1NSTA 3AP2A 2WWXA 1QBKC 2MSCB 1Q3TA 3A1SA 3LFUA 4TL7A 4DDVA 1E1RA 1HE1C 1T3HA 3FM8C 3W5IA 4GPTA 4LV6A 2AX4A 4ARZB 3W6NA 2PJZA 5H1YA 5EXXA 1FZQA 2R6CA 3KXLA 2D7CA 5DHFA 1Z83A 2HUPA 1UF9A 3FEHA 2X77A 1OH5A 2OXCA 1NKSA 2XZOA 3OFNA 2GXSA 1T0HB 4QHSA 5JHGB 2F7SA 3UG7A 2ZI4A 4B6FA 1DVRA 2FGKA 2QGNA 3A1WA 4MUAA 2XB2A 1GRQA 1Z07A 1X86B 2OESA 1G6OA 3DKPA 5EE9A 4LHXA 2I1VB 4XVUA 1P3JA 2EWWA 2A5JA 2GCNA 1YZGA 3K0AB 1BKDR 5C18A 1NBME 3OF5A 1FX0B 3BFKA 1YZQA 2VIIA 3WYFA 4C2TA 4JLDA 2Z5FA 3QVVA 3AVOA 4BLRA 4TTPA 5JI2E 2W2VA 2XZPA 3X1ZA 2QNRA 3K9HA 1A82A 2VQSA 1CEEA 2WJGA 2BMEA 3BWDD 3GJ7A 3W5JA 1E2JA 2P2LA 1TADA 3LX5A 3CF0A 1NKTA 3H86A 4LBYA 4KITB 1CF4A 2ZRGA 1KJZA 4PQRA 1SVSA 4HATA 1P2VA 1Q0UA 2ZI6A 4M1TA 5DYIA 1RJ9A 3EIEA 2CLCX 3SUBA 4S35A 2ZRFA 1G3QA 3IHLA 2ZS9A 3K1JA 3RRZA 4ESVA 4MRVA 3PEUA 3CRVA 3UMFA 2IX3A 5DE3A 4QJ3A 1DAIA 2ECKA 3CRMA 3IO5A 4L15A 3P4XA 2FF7A 2WPDD 3K9LA 3MMPA 2ZSBA 1N6OA 4LYFA 5JRZA 1NN1A 4GZLA 2HF8A 1NLYA 2Q9CA 3LW8A 4HI0E 3V4FA 4UXIA 1RRFA 5AUOB 1TQ4A 2EFHB 1LV7A 1ZBDA 3R8FA 4MKHA 1DTSA 2OE2A 4PO8A 2VP5A 1X8KA 2ZUCA 4CVNA 3SJBA 3MG9A 1ZD8A 4LOAA 3REFA 2YJTD 1KZ7B 1JR3D 1LF0A 4B3DA 2D62A 4GZMA 5FL3A 4DSTA 1N6NA 4PANA 3EPKA 4QFVA 1UDWA 4ZIRB 1G41A 2GAAA 4KVGA 4TLCA 3IPYA 1LTQA 4M9SA 5A5GA 3IDQA 1NVXQ 1XMIA 4K46A 1A7JA 3BC1A 2H5EA 1FPMA 3EA0A 3K0CC 1G64A 2GEVA 5C1BA 1XD2B 1EK0A 3A36A 3D8BA 4AKEA 4HB3A 3TNFA 5DH9A 1OYWA 3LVRE 4HDOB 3EZ7A 2DWQA 3RRMA 2ZRMA 4AI6A 2JLXA 2Z83A 1XTJA 1Y63A 1R6BX 1HY3A 2ONKA 5FOUA 1WRBA 1RVDA 1UKVY 2FN4A 1YR7A 2YWFA 1KIMA 2P57A 3B9PA 3IGFA 1ZP6A 4XH9B 1TQ2A 3KUCA 3RRNA 4D4LA 3GLHA 5KDDA 3NWJA 1NP6A 2IYUA 2XSZD 1S3GA 1OH8A 4UNSA 5IDVA 1DO0A 4BZQA 4W7SA 1OH7A 1IAQA 2FPMA 2R65A 2XOKA 2YNMA 4R98A 4D82A 4KSBA 3V4RA 1G3RA 2OILA 2WOJA 2QRZA 3ND9A 1V5WA 1KI8A 1MKYA 5C4GB 5JI3E 3AEZA 2A2ZA 1L4UA 3GJ5A 1R5BA 4BASA 1P6XA 2NO7A 3QVUA 2LCFA 3U3KA 3FYHA 2O52A 3W6PA 4DT1A 4P0TA 2WWIA 2YYZA 3A37A 5CDFE 1E9SA 2JLRA 1J99A 4Q4HB 1QRAA 1IOZA 3CIOA 3B8HA 2NMVA 2R62A 4YXWD 4HDQB 2OV2A 3N5CA 2XTMA 1VCOA 4FIDA 1K8RA 4QHYA 3GLGE 3A4MA 1Q3HA 4ZKDA 3D6TB 2ATVA 2QM7A 1T91A 3C7KA 3EA5A 4YDHB 4B3BA 3O8CA 1VECA 3DM9B 3E1SA 1XCMA 5TY0A 4DJTA 5J4HA 1XMJA 4E07A 2O5VA 5JECA 2G3YA 2YINC 2GJAA 2QUZA 1E9FA 3WYAA 1CJMA 1QF9A 2CK3D 4IRUB 4HDCA 1ZYUA 2BEKA 2GHIA 1G9XA 3K9NA 4H1VA 1OIWA 4Q03A 2NPIA 1DOAA 3DM5A 4TMXA 2VRWA 2ZS7A 2O8FA 5DSZA 3U44A 1TEXA 5KYKA 1ZCBA 3OIUA 1KZGB 3IIMA 4IOKA 1G8GA 2VPPA 3DZ8A 1EWQA 1TX4B 3PEWA 2YZ2A 4WZ6A 3C15C 4R9UC 4E5UA 2WWHA 4IVPA 3EIHA 5CB6A 821PA 2FSHA 2ZSAA 1X6VA 3Q3JB 3U7GA 3BGWA 4KXFB 5FR2A 1LS1A 3DZDA 4PAQA 1JQLB 4A6PA 3UMRA 4URXR 5LB2A 4X8OA 4HZUA 3MSXA 1JB1A 4A2QA 1OW3B 5DNYB 3QKSA 3DWDA 5M04A 4TYNA 2WPDA 4I1SA 4RD1A 4QM7A 2F3TA 1DAFA 1KI6B 4IVQA 4TZ0A 4PQFA 3GLIE 3MDBC 2GETA 1VTKA 1AS2A 2IYXA 2P0EA 2DWOA 1ZVQA 3CKLA 3NC0C 1QHHB 3EZFA 4Q7LA 5FOTA 5KSOA 3IIKA 1UKZA 3L0OA 4CIDA 1FTSA 2B8TA 2Q3FA 3DMNA 3ZS8A 1UDXA 1KNQA 1OSNA 2J45A 5G53C 3KQLA 3VKHA 3ASZA 4F93B 4NP6A 2IXGA 2RGGA 4RKFA 4TLDA 1XJ0A 2OG2A 4G0NA 1MABB 2B8WA 3RWOA 3DOEA 4ACAA 4D26A 4B2LA 3K0CA 4M1KA 4X8LA 1OFHA 2YOHA 4MKIA 2WHXA 3UATA 1DBSA 2AXNA 3QPUA 3CR7A 4NONA 3M1IA 2R6GA 4Z1MD 4HAWA 1OIXA 4C0JA 4B32A 2GJKA 2MSDB 2Z6VA 1XPUA 3QG5A 4PC6A 2QAGC 1SKQA 4QOSA 5EXTA 3ZIAD 3MAAC 3OEHA 1GL6A 2G83A 2PJRA 4EPVA 2IEYA 4LUCA 4V0ME 5FTMA 5LD2C 4IKEA 4CZ2A 2P67A 4L9WA 2WKQA 3QXHA 4ZDWA 3WP1B 1DARA 3KZ1E 1DCQA 1U8ZA 3OZXA 4EIWA 4BLQA 2CRWA 1OXXK 2XSZA 4NPHA 2R6DA 1BOFA 2PLRA 4U7DA 1CJVC 2IYTA 2ZJZA 1Q1BA 3RS0A 1AK2A 2XZLA 2B6HA 2I4IA 5JSZB 4R2HA 4TLBA 5BQ5A 4Q9KA 3SYLA 3AV0B 2A5YB 4Z51A 4LV8B 5B58C 3VR6A 1EG7A 1M7BA 3SJAA 1MV5A 3AVXA 2CCJA 3I5YA 3T61A 4V03A 5JLJA 1CTQA 1TF5A 3IUYA 4HLUC 3ZQ6A 1Z06A 3HP1A 2A9KA 4R7ZA 2ZREA 1DG3A 5DN6A 2W6ID 4OK5A 4D6PA 2FFQA 2QE7A 1MOZA 3BRWD 3K53A 4ZCIA 5HZHA 4TN1A 2GCOB 2QL6A 4FINA 4ASUD 3B1YA 2CE7A 1RRGA 1JJVA 5CLLA 4ACBA 1E9AA 4PPGA 5JS8A 1WBBA 3KJGA 5FPTA 3TUJC 1EFUA 5DI9A 1XD2A 3AUYA 3ZD6A 5KNDA 3LBIA 1N3BA 1E1QA 2C9OA 3SFVA 1AN0A 4HUQB 4LYAA 3AGQA 5BN4A 3QEJA 4I1UA 3EPLA 3RANA 1L2TA 4BRUA 4FCVA 2ATXA 2ZE6A 4GRAA 4QJ5A 2GDJA 2BMFA 4RD0A 5B57C 1IBRA 4KFRA 3NHBA 4BFYA 3EWAA 1E9EA 2QG6A 2PMKA 1PZNA 3WBJA 1GKYA 4ZO4A 1IONA 4TYPA 1M8PA 4BEBA 2BBSA 3NG1A 2D4HA 4UKDA 4GOKA 2PBRA 5FOVA 3E5HA 3N2IA 1CJTC 5UKDA 3EIQA 1JAHA 1U0JA 1NMXA 2H1LA 5FOXA 1MRNA 5FUXA 3S1AB 2G9NA 3EZ6A 4PPFA 2Z43A 3U3RA 4TL9A 2DBYA 2ODBA 5FI1B 5JCZA 3THWB 1CRPA 3CBQA 1W4BA 2H7VA 5JJKA 2WOOA 1KKLA 1F2TB 1QDEA 1T8UA 4FMCF 4PC7A 1E2KA 1G7SA 2IYYA 1ESNA 2RGBA 1VIYA 3LXRA 4QBGB 4EUNA 4JLNA 4N1AA 5HTKA 1CXZA 2OUKA 2R6FA 3C41J 4AD8A 1LVGA 1II8B 4RKEA 1XXHB 2E1RA 2XAUA 4IDNA 4D4JA 1E2QA 3RS2A 4GI7A 3PEYA 1YJ5A 1BIFA 4XD7A 2VHUA 4KSCA 2QBYA 4PHTA 4L9SA 4A6XA 2EQBA 3H2YA 4M1SA 1RIFA 3KJHA 3ZD7A 1A5TA 4LPSA 2YWHA 1SHKA 3R7WA 3GJ6A 1KO4A 4Q4JA 3GQBA 4BUJA 3I61A 2QAGA 3RC8A 2AXPA 2OAP1 2B21A 2BCGY 1G8YA 3AB3A 1NL3A 5C4MA 1N5KA 2CEAA 3KKQA 4TL8A 4A0GA 1QHSA 3U7FB 3FHTA 3GJ0A 1FMJA 1FNMA 2D7DA 1GWNA 3LVQE 1GAJA 1G1MA 2VSXA 1TF7A 1U2RA 4LJ6A 5JEDA 3RABA 1G5TA 2ZU6A 1XB2A 1IHUA 1NBMD 1TNDA 4KO8A 4FWIB 3L0IB 4PSKA 2EFEB 4BFSA 1T0JB 3LA6A 3SN6A 3B2EA 2HCBA 1YZUA 4NCJA 2VP0A 1WA5A 5H70A 4BFXA 1P72A 3THYB 2OCYC 1UFQA 2QPAA 1N2CE 1RYFA 4DEYA 4C30A 2JJ1A 2Z4RA 3RVBA 5JMTA 2IYZA 1V43A 2CL7X 3W3AA 1KI6A 2EWVA 1F5NA 4XSHA 1SULA 4JT4A 4DLRA 2OLJA 4HLUA 2VL7A 3RYTC 1QHHA 1E4VA 2WBLC 1W0JA 1YQTA 1AIPA 1BO6A 1YRAA 1ZC3A 1TL7C 1ZNWA 2F9LA 4KCGA 1IJFA 3C5HA 4CEIA 4M4SA 2HLDA 4DIEA 2IHBA 2JGNA 2N1BA 2QSZA 4LV5B 2PL3A 3GJXC 4KFUA 4RCYA 3GD7A 1MABA 1X3SA 4AIIA 3VU9A 5CYPA 4M0LA 1R5NA 4JZKA 1ZNZA 2NIPA 3NDPA 5EP2A 1N25A 2V54A 3B9QA 2C9CA 1HQCA 1RJ9B 2IXFA 4OBEA 4JBYA 3CRRA 3B1WA 3U3OA 4A92A 3A4LA 1XU4A 2K5UA 3N70A 5GJVC 2OM2A 2IEZA 3A6PC 4DLVA 1Z0JA 2CXXA 3QIAA 2DHRA 3B6EA 2ORVA 1TUEA 3C16C 3CH5A 4LJ4A 3QQ5A 1T6NA 2N46A 1X1SA 4Q47A 3A58B 4DLZA 4CW7A 1Z22A 1H8EA 2BM1A 4Q1FA 4JVMA 5FL7A 2CHGA 3UWOA 4M22A 3WMFA 1EESA 1KGDA 4LHYA 1ZRHA 2BJVA 2WWFA 1EFTA 1NG9A 4B2PA 4O2RA 1W2GA 3AKEA 2ODNA 4C0SA 2X1VA 3F5FA 3GPLA 1KO8A 4LGMA 2V3CC 1WDTA 4MGZR 2I3BA 1EFRA 3QKTA 1KJYA 5G3ZA 3THOA 1R8SA 1ZW6A 1YR6A 2QMOA 2WAYA 4E03A 5KU1A 2PX0A 5JSZA 1H8HA 3AKCA 3LQQA 3HYRA 1W2HA 3AKDA 4CEJB 2O0JA 3E70C 2C03A 4US2R 4BZXA 4LC1A 4EJSC 3AH8A 1S2MA 1CBUA 4HAUA 1QHIA 1UBFA 4JLAA 4FCWA 4TMTA 5JBQA 3W9YA 3MGCA 4LC0A 2XNDD 4OQLA 3BH6A 4PPQA 1N6LA 2BWJA 4I4LA 1CKEA 1YZNA 1ZIPA 2ZRBA 4DLWA 1JBKA 3L8ZA 3RWMB 4DSUA 1E2GA 2EFGA 5IF9A 1XEXB 2GCOA 2GKSA 4OQXA 3CWZA 4GOJA 4HB0A 2Z4SA 4D0NA 5DLQC 1GILA 3EWSA 1NVUQ 1BMFD 4TMWA 2XB4A 3ZZUA 1FNNA 2ZEJA 5J4KA 5TARA 1SVKA 3RC3A 3NEJA 1SGWA 3KKPA 2RB4A 3QY0A 2IXEA 2ZAMA 5FI0B 1G7CA 3HU3A 3Q5EA 2CCGA 4HLCA 4HUQA 5KHOC 1FTNA 2QPOA 1U9IC 4XVQA 3ASYA 4PAOA 2ZM5A 2JDID 1KK0A 3PUWA 3EZ9A 1RE0A 4DT1B 3CF6R 4QGHA 1P4SA 4IEEA 4JMPA 3U7EB 2FH5B 3WP0A 1N6RA 3THXB 2MMGA 2O8CA 4LCBA 2FFBA 5FOWA 1G19A 2SHKA 3B82A 3HPRA 4EAQA 2BKUA 1N5JA 2AD5A 2OSBA 4IDHA 2WIAA 4JJZA 3NVAA 1IN8A 4ITRC 1NN3A 3AVYA 1KY3A 2B7CA 1D8TA 3Q5DA 3LDAA 4CEHA 2DFKB 5JJIA 4DCSA 1S3SA 1KI9A 5CLQA 1OV4A 2WSSA 3OEEA 2OBNA 2ZVPX 1GNQA 1NLZA 3P27A 1D2MA 1CS4C 1U98A 1MH1A 1VKJA 2X2EA 3IQWA 4K8OA 3IHWA 3JZMA 5JWOA 1GSIA 1W0KD 1NNEA 4MRPA 3K0FA 3B1XA 3T34A 4Q4LA 3PV0A 1QVAA 1W4CA 2PCLA 3NDBB 2BHRA 2FPLA 2LKCA 4JS0A 4P3YA 1IN4A 1ZM7A 1KO5A 2W6JD 3RLFA 1VHTA 3F3YA 4BFUA 4NKRA 2O8FB 5A0FA 1WMSA 4UXHA 3TMKA 5HKKD 4M1YA 2GRJA 2CMKA 3F8TA 4B3CA 4G1UC 3TGPA 4OHYA 1F3OA 1BH2A 2OCPA 3K70D 3TW4A 2O8DA 1E4YA 4OQNA 3ZVNA 1W4AA 4HB2A 1Z63A 3CNOA 4DC9A 4PAMA 1G7TA 5CYOA 2FJUA 3AP1A 1R10A 3VX3A 3HU1A 5D3QA 1PUJA 4HZUB 1N0WA 1U81A 3K70C 1UKEA 2PX3A 3EG5A 2P6RA 4NZYA 3QKSB 1KNXA 1W4RA 2PEZA 1HE8B 1R2QA 3QE0A 3ZVMA 2YHSA 3KQKA 2C99A 1UAAA 3SR0A 4ZDKA 2BBWA 4RZUA 3CRQA 4HAZA 1TU4A 4MITA 4OQFA 3RHFA 1KJWA 1IY2A 2FPKA 3THYA 3HDTA 1Q1EA 3TJZA 3LNCA 4NYJR 1Z8FA 5DI3A 3TR0A 4RZXA 2IS6A 2OHFA 3QBTA 5TMPA 2ANBA 4XWOA 1J90A 4DB2A 3CR8A 4BFZA 4WOPA 4CT5A 1R7RA 4WW0A 2FA9A 4RSGA 2CHVA 2IYSA 4B43A 1ZCAA 2RGNC 3ETLA 4RJLA 2ZI7A 4B47A 1EFHA 1A4RA 1RZ3A 4RFSB 2J7PA 3NEYA 1W36D 1ZM4A 4RFVA 2DPXA 3AF3A 4QXAA 4R2IA 4QBFA 2IS2A 1DO2A 2GK6A 1IXSB 2NO0A 1XEWX 2QY9A 2NPFA 2WAXA 4LBVA 1B23P 3TSOA 1E9BA 1QG4A 3PJRA 5JJLA 2FMXA 2AKAB 2PCJA 3B5JA 4JLPA 3P26A 2GZAA 2VHQA 1U9IA 5EP3A 3OE7A 2RGCA 5CDFA 4DLXA 1T9HA 3SHFA 5TXGA 1O3YA 2C8VA 2G1JA 4IFEA 2O8EA 3KFXA 3ECCA 3N2EA 3SHWA 1D5CA 3AVQA 2EFDB 5DYGA 4A9AA 1XEWY 3ZLJA 1OJLA 5LB4A 2FWRA 2ZR9A 3IQXA 3VHLB 3GLGA 2XGJA 1Z6GA 5EXSA 3O8DA 4EPWA 2OFXA 2J5XA 2C9YA 1FP6A 4US1R 4Q1DA 2CNWD 4PZYA 3DPUA 1ZM3A 4XJXA 2WWGA 4CEJA 4JSYA 2O0HA 3PQCA 4PPNA 4FCTA 4FN5A 2MSEB 3CZQA 4D0LB 2DR3A 1NF3A 4YC7A 3TSZA 5FOSA 3JVUA 4A36A 1P2UA 1Z6AA 4KFTA 4LK2A 4F4JA 4KVAA 2V7QA 4IXNA 5GADl 3PEVA 2HXYA 2HCJB 4I99A 1XWIA 5GJBA 2XX3A 2QQEA 1E6CA 4TT3A 1W1WA 1WP9A 2VHJA 5B30A 1BYUA 1N6PA 3QXSA 4FI3C 4OHXA 4TL6A 1XEXA 2ZVQX 3TH5A 5AJXA 3GFOA 1SKYE 3OIVA 3A1VA 3AKYA 1SXJE 2REBA 3Q7PA 4TYQA 4Q1BA 3CWQA 2OZEA 1SVLA 1SVMA 1FFHA 3BE4A 2TMKA 3EASA 1MT0A 2GBLC 3RS5A 1GDDA 4E09A 3ADCA 5EQTA 1G16A 721PA 1R0YA 4GFDA 4GDFA 4AYTA 2HT6A 3T35A 1MRSA 3SZRA 2J59A 4F7WA 5HKKA 1OXUA 3VMFA 4OHWA 2CBZA 4DDUA 1YR9A 3AVVA 4ZDIA 5TV2A 4IVRA 4OK3A 1K5DA 3O47A 3EC1A 3ZVLA 4TMVA 2X2FA 2WZQA 4H1UA 1VHLA 1G4UR 2G0TA 2ZETA 2ZJBA 1NN5A 1DG1G 2XXAA 2VBCA 4HYYA 2IYLD 1L7VC 2OWAA 4CT4B 1J70A 1T4GA 3CPHA 3FGNA 4NYIQ 3THXA 4ON9A 4LJAA 2W58A 1IM2A 2JEOA 4CYMA 4IOLA 2XJ4A 3DKVA 3CX6A 4C7OA 2JIZD 4DWJA 2Q3MA 3VR4A 3GEEA 3NBZC 5FBWB 2BBOA 2IYQA 3EZ2A 2CL0X 4UJ3A 4IFBA 2J1LA 1XJQA 5JHHB 3FKQA 2J0VA 4B44A 4XTRA 4QG7A 4OI2A 1WE2A 3TKLA 3C8UA 3ZS9A 3HPQA 1EXMA 4M53A 2QBYB 2JLQA 3ONWA 4H9GA 1VYUA 1EWRA 2PMDA 5ELXA 4POAA 2ODEA 521PA 4FD2A 3GLFB 4AKIA 4KYIB 4TMKA 3R7WB 4Q4JB 2EW1A 3CX8A 4LHWA 2QAGB 4PSVA 2ERYA 3U5ZB 1COWD 1OPXA 1Q21A 2OT3B 2QRNA 3CX7A 1YU9A 4Q66C 5LD2B 1ZMXA 3EARA 4JLJA 2IF0A 4Q00A 4LJ7A 1N6HA 1DPFA 4PC1A 2V55B 4OHZA 5E3HA 4A8JC 4QNRA 1KMHB 2V8OA 4MGYR 4URWR 2V6JA 2J0QA 4S2EA 4D0GA 3IEVA 4BFVA 1ZU5A 3NBYC 1US8B 3U3MA 1SZPA 2V1UA 5GJWC 1AGPA 4G5QA 3RAPR 2QU8A 1HH4A 1SHZA 4KYUA 1P62B 3K8YA 4J0QA 4QGFA 2ZJYA 4E22A 2RH5A 3BFVA 1OXVA 3NIBA 2ZI9A 4A0FA 1YHNA 3LH5A 3GMTA 2KSQA 3P20A 4P4UA 3V9PA 4DUGD 3GLHE 2V1XA 4IDQA 4XWKA 1JR6A 3PUZA 3WY9A 2REOA 3QEOA 4CEIB 1EGAA 4DCNA 5FTLA 3C14C 1JR3A 1AM4D 1FP7A 2NO9A 3GFPA 1GRNA 1G3IA 1LFDB 2BMDA 4GP7A 4FXPA 5G40A 1Q57A 3VNVA 2FV8A 2ZANA 4TSFD 3VU9B 5KOYA 2L0XA 3SE0A 3VKWA 4C0HA 3MJRA 5SZHB 1XPRA 2C95A 5L3SA 5F98A 1G7RA 1VYVA 2AHOA 1OH6A 1GKUB 4QJ4A 1G18A 4WAUA 5FBVB 3EPJA 2NO6A 4QL3A 1WB9A 2KI5A 1VCNA 3ZJYA 1P2SA 4C2UA 4NU0A 3QOFA 2V4ZA 4G5GA 4PFSA 4BLOA 1XDBA 2G88A 2C5LA 1TEVA 4PZZA 4RFSA 5AUPB 2H8KA 2W83A 2PT7A 1QHGA 4QGGA 1TMKA 4LRWA 1GL9B 2OCAA 2JJ2D 4M21A 1KI4A 1MO4A 5E7JA 2VP2A 4FMCB 2A3RA 3SI7A 1CP2A 1YZLA 3R20A 3UXMA 5K8TA 2WJIA 2VP4A 1G5RA 2RMKA 2GNOA 3VQTA 3EC2A 2C77A 3AUXA 3G82C 3WMEA 1PLKA 3FKSD 1R5OA 3QXCA 4JL5A 2IBMA 5CK5A 3TRFA 4URZR 4PX9A 4B33A 4AKGA 1NSFA 3LBNA 4PXAA 1EX7A 1JECA 2Q9AA 1VIAA 5L3RA 2NOAA 1Z3IX 2J3EA 3OAAD 4Q7MB 4DVGA 4ZI2A 3U4QB 2ZYUX 2JA1A 3U3JA 2R8RA 1Z08A 3P4YA 1DAKA 3QXJA 3SBEA 4Q9JA 4B74A 3DEFA 4B75A 4BZPA 2HF9A 2R9VA 2BMJA 4BRWA 1LW7A 3KB2A 3BH0A 4JJKA 3PFIA 1DELA 4YXWA 2JIZA 3HYTA 3GJ8A 4BQSA 2QPTA 2ZRKA 4KLNA 3WNBA 2ZSDA 5JWRA 4FWTA 1AZSC 3FFAA 1E0SA 2J41A 4IDOA 4OI4A 4Q4AB 1HUQA 4OHVA 4QNMA 3IBYA 3T5DA 3FMFA 3IIJA 4LSGA 3U60B 1F2UB 1VCIA 4RZ3A 1Z2AA 3LLMA 3ADDA 3BBPA 3JUEA 1FUKA 1E2EA 3H0KA 1G8PA 1ZD1A 1XTIA 2CK3A 4Q7KA 2AFIE 3GFTA 2QQ0A 1KI1A 5BN5A 3K0EA 5H8WA 4I1OA 1U99A 2AK3A 4Q21A 1P7CA 1IJEA 1TAGA 4WIAA 4WA7A 1II9A 3D7MA 3HR8A 4C0QC 5FUWA 3J81k 3ADBA 4A8JA 2VF7A 3L0SA 5FPSA 3GJ3A 4F91B 4B71A 3MWJA 1GIAA 2J0UA 2O8CB 1XBTA 1ZUIA 1L8QA 1P60A 1DEKA 3C4JA 4DCVA 2ZR7A 4MRSA 1XFAA 3RRYA 2JCSA 5KNCA 2RGAA 2VSOA 1XTQA 2ZE8A 4R71A 2W2XA 2VF8A 4CEHB 4G5SA 2D3WA 4JBWA 1S0UA 2BVNA 3KKNA 2FZ4A 1EFCA 2GA8A 4B3GA 1ESMA 3I8XA 3KDSE 3RDPA 5LBIA 4ABYA 4C9BA 4DIDA 2IHYA 4DLUA 5CITA 3K0FB 2P5SA 3L0PA 3AF4A 4NYMQ 1CRQA 1HT2E 3FHOA 1KAOA 4LDJA 1R0XA 1N0UA 1WXQA 2R6AA 2ZSEA 3NKVA 5IK2D 4GMDA 5IHPA 4BEJA 4MYCA 1KAGA 4GSYA 1T5IA 4M9XA 4AWXA 4RD6A 3TQFA 1CR1A 4OKSA 3VKGA 2JASA 2NZJA 1PLLA 3TAHA 3OIYA 2GVZC 1HTWA 2QEQA 2OBMA 3M6AA 1K6MA 2D2FA 1GL7A 2C04A 3Q9LA 1NI3A 1P9WA 3FTQA 4V0LA 4JYBA 2ZIAA 3GLFA 1ETUA 3X2SA 2O8DB 4DLSA 3PIRA 2F1JA 2VSFA 1NVVQ 4NTZA 1P9NA 1Z6TA 1M34E 4Z1MA 5J4VA 2QZ4A 5SZKB 5L8VA 5JWHA 3LW7A 3LBHA 4LPKA 4D81A 1PUIA 1WBDA 4YMUA 2GXAA 1YE8A 4IXMA 3I73A 4MKFA 1Q1ZA 3ZIAA 4L16A 5P21A 1ODFA 1ZNYA 2IUTA 1JXOA 1VG8A 2KBEA 1KMHA 2QMEA 3TE6A 3LXXA 2AFHE 3AVPA 4TQAA 3VFDA 2F43B 4NE2A 2JLWA 1US8A 3FMPB 1OF1A 4AY2A 2ZPTX 2YC2C 3LJUX 3QUSA 4OQMA 3LRPA 4KHZA 1VCMA 1KI3A 2WJVA 1OE0A 4Q1EA 2RGDA 3TVDA 2OAQ1 1X8LA 4YQFA 4BPBA 4EJSB 5EZ5A 5AWFC 1W5SA 3VTKA 3NTUA 5DI3B 1IN6A 1KI7A 1VG9B 2P5TB 3FDIA 3UWKA 3K09C 3MUFA 4V0OA 1KDTA 1E2MA 2WKPA 4M1MA 1XCGB 1AA9A 3Q7QA 1S4QA 4NCIA 4DDWA 1Q1QA 1ZINA 1SKYB 2GF0A 2H92A 3TBKA 1D2NA 1U90A 3IBGA 2BJWA 2Q21A 4MH0R 1E9RA 1E2FA 1G291 3T5GA 4MYTA 4CDGA 2W0MA 2W6IA 4ILEA 4AURA 1XCPA 1E0AA 4IEIA 2ZJ5A 1T5LA 1M2OB 2OEPA 3BS4A 3CO5A 1OHHD 4FW9A 4G01B 5CM8B 1U8AA 1J2JA 2ZROA 3D31A 2F1RA 4RZ2A 2D06A 1DS6A 4ASUA 3C5CA 3PCRB 1OKKD 1TTTA 4MDFA 1D9ZA 2W0SA 4BFWA 4A15A 4F4CA 4PO9A 2JLVA 2ZE7A 3FFBA 3UIEA 4Q9HA 4MDEA 1UEIA 1PJRA 5KPDA 2FSGA 3FMOB 4QBHA 4JVNA 3GEHA 1GG2A 1G6HA 2CJWA 1E79D 1HURA 1M7GA 3NC1C 1E94E 2IWRA 2O8EB 2ERXA 4HLDA 1HT1E 3BJIC 3BIFA 1W48A 1G8HA 2Y8EA 2GAOA 2ZJAA 3MWYW 2GZHA 4Q1AA 1XD9A 3GLGB 4LJYA 1NRJB 2BEJA 5FFMA 1KY2A 1XMVA 1CJUC 1NLFA 2ZI5A 3KL4A 1N6KA 2HYIC 3U61B 4Q7JB 1A2KC 2NQ2C 2ZJ8A 3OFND 2IS4A 2QP3A 2UZ3A 2ZRPA 3I1FA 4EFLA 3TUZC 3I92A 3U4QA 2RCNA 1VG0B 3UG6A 1SXJD 2DCUA 2QP4A 3FWYA 3TR5A 2B0OE 1UBGA 1Y3AA 5GVSA 4JYCA 1CU1A 1ZM2A 2ZRCA 1XZQA 1YVDA 1ZNXA 3QKRA 1SXJC 2WICA 1G20E 2ZYWX 4WZAE 4Z8XA 1ZC4A 221PA 3WHKA 3WBKA 5EZ6B 2RGEA 3DO6A 1J7KA 3TQCA 2FX3A 1PVOA 1S9HA 2QM8A 1AS0A 4Q4AA 3R8CA 4TWZA 4IHQA 1IXZA 4O2LA 3T1OA 3LX8A 1UM8A 4D25A 4JKYA 1F2UA 1SVOA 2G77B 1VDZA 1U94A 3B1VA 4A2PA 1GM5A 3I3SR 4GOXA 2DWPA 3Q72A 4DXAA 3OESA 4W5HA 3CW2A 5AJYA 5AUNB 5FR1A 4U02A 4NL4H 4XSGA 1GNRA 2GXQA 3KTAA 2WMNB 3K70B 3ZGXA 2B92A 1C4OA 1HEIA 3Q85A 3TW8B 2G6BA 2IA5A 5F9FA 1VPLA 3GLIB 1KDOA 3PG5A 3SYKA 3KQUA 2OLKA 2XXAB 1GRRA 4Q9IA 4BLTA 3IO3A 4C4PA 2AN9A 3D3QA 3OHMA 4JBXA 4ERNA 4TTRA 4W5JA 4C7OB 2UZIR 1NVWQ 3IILA 1RFLA 3NH6A 4XOIA 1D9XA 1NBMA 3A8TA 1C1YA 1KHTA 4B2IA 2NTYC 4AYWA 2WKRA 4KBGA 2EVWX 4Y0VA 3WNCA 3GJ4A 3ZDQA 3M4YA 2JLYA 4ZPXA 1W44A 4LBZA 4TYYA 1D6JA 1KTVA 3K09A 1GZSA 1TQDA 1YRBA 1OIVA 4OK6A 2ZRIA 1R0WA 2IF2A 3B7GA 2DFNA 5SZJA 2FDCA 3MLEA 3W3ZB 3KQHA 2QA5A 4KLZA 5IT5A 4NDZA 3BB4A 4EDHA 3BAFA 2JATA 2RAPA 2F1HA 5FPHA 1N5IA 4B76A 5B64A 1E2HA 2F1IA 4NCHA 4JVSB 4OI0A 3CUEF 4V02A 1RYHA 5FPYA 4ZV4A 3VAAA 1ZD9A 3TLXA 1NJGA 4C0LA 3ZVRA 2ZRNA 4NH0A 4RCZA 3CM0A 3PUYA 5EP4A 2IK8A 3B1ZA 3L2OB 5A4JA 1QZXA 3RS7A 5LPNA 3O8RA 3TVTA 3BK7A 4K81B 4PZLA 4B35A 2AR7A 3LLUA 3HU2A 5K8LA 3BB3A 4D80A 2J0SA 4HUTA 4YMWA 1DAGA 2XOKD 3VR5A 1RRPA 2QN6A 4OJQA 3SQXA 2UVQA 5TVKA 3BOSA 4N0DA 1E2PA 3KJIA 3R9IA 3DL0A 4MYUA 3LO5A 1KO1A 2F43A 4IOMA 3KKOA 4B73A 3CLVA 1FMLA 2WM9B 1J8YF 4C0KA 2XTNA 4LI0A 1GUAA 1W47A 1Z28A 4X8HA 4JKIA 2QTFA 4EQ6B 1U0LA 1AKYA 1W46A 2IQJA 2A5GA 4QGAA 2J46A 2ZXUA 4FMBB 1Z0DA 1P75A 5EUMA 5AR1A 1DADA 3A1TA 4EJSA 2ZSFA 1DAEA 1P2TA 1CJKC 5HCNA 1ZU4A 1I2MA 2CVHA 4A0HA 5HPYB 2V9PA 2GJ8A 1XTKA 2HEIA 5L3SB 3LQRA 2DFLA 4ZDJA 4EPYA 1Q12A 1G21E 4RD4A 1SVIA 5F2EA 1XNJA 1SXJA 3MCAA 3B85A 1VG1A 2DYKA 4PHGA 1W7AA 1Q20A 2XNDA 3RS4A 4CF7A 1AJEA 4FMDF 4YONB 5KDOA 5KSYA 2ZYVX 4UNPA 1CR0A 4HAYA 3TIFA 3GEIA 5JZVA 2CLSA 2DY1A 2HV8A 1A2BA 1E9DA 2GJSA 3ZZ0A 2EYUA 1UADA 1E2NA 4Q02A 1BMFA 1KOFA 1BYIA 1W36C 1KYIA 3AVWA 2P65A 2VH5R 4LZZA 4TLAA 1KI2A 2WVJA 1IQPA 2IL1A 1KMQA 4KBFA 3T15A 3QPWA 2KJQA 5CJPA 2ZRDA 3L8YA 4BGDA 4EKDA 2Q3HA 3AF2A 2BKEA 2QENA 1LNZA 2MMCA 4WBSA 5FUYA 3EAQA 2KB0A 3ZQJA 1E2DA 1XXHE 4QC2A 1YR8A 2BOVA 5FBQB 1AS3A 2JDIA 4XVRA 4DKXA 1XD8A 2QTHA 1FL9A 4YMSA 4DEXA 4TMZA 2IUUA 3T9KA 2O8BA 1E2LA 2AWNA 2ZRHA 3DHWC 1ZAKA 2KWIA 2QAJA 3MWLA 3QSYA 4A82A 4N0EA 2YVUA 5FBLB 1E98A 1F6BA 2ZITA 5DGXA 1JEEA
chains in the Genus database with same CATH superfamily
1U2QA 2WVHA 5MGBA 1IZYA 1TM7E 3DWLG 5H7XA 5TQ2A 4HQ6A 2Q0HA 4UUNA 2P4SA 5BN5B 1RLUA 2GYVA 3CVQA 1GITA 2WJJA 4L8FA 4TUMA 1EVKA 2H16A 2VYND 1I94B 1GPKA 1X7HA 1OBOA 2FFRA 3B1FA 4DM7A 3D64A 2FZGA 5B12A 2AS0A 5ALKA 4CCSA 4ENVA 2YRFA 4MRMA 2AMFA 3ID6C 3ZV7A 1UDCA 2JANA 2W42A 3D81A 4PEVA 1Q16A 2O7QA 3EJ6A 4QFMA 4OFZA 3NYWA 5ENOD 1QVRA 3QK7A 2ZDHA 1ML4A 2AJTA 2JZNA 4KQ2A 2LXHC 4C89A 2CV0A 3VA7A 4ZYZA 3STYA 4LWPA 4EHFA 5FBRB 5JAOA 4YA6A 2WMOB 3HI6A 2PJUA 1V2GA 1Z26A 3DLCA 3ZWWA 1SIUA 5D1NA 4F56A 1MLDA 2CHQA 1JJAA 2H85A 3AFIA 3FNFA 4HEJA 3RYHA 5BSGA 1DAHA 3Q3GE 4YV2A 3KLMX 4E2WA 2FUIA 3ASNE 1UCFA 3OJCA 3UWDA 1O87A 2ZZMA 2ZTSA 3VR2A 3MRSA 3W9SA 2EKPA 4UU0A 3BZUA 4N5CA 5HDBB 3VH3A 5IH3A 5IARA 2ZT6A 4AJJA 1SA4A 4YAJA 3VI4B 1ZI9A 4J7CA 2VYFA 4BVFA 5LM3A 1JLSA 2X6IA 3IOYA 5L45A 2AMJA 3FM9A 1GVNB 1L5VA 2NXWA 4BWVA 2GTHA 3O84A 2FZLA 2FFWA 4IXDA 3HA2A 1NC1A 1P5FA 5FWXB 3N71A 1B0ZA 4PTLA 5B53A 1JXMA 1J22A 4RHCA 1GQSA 4UNQA 4WCFC 2C3OA 4HB4A 3IBTA 1X70A 4TWAA 3KZCA 1L4EA 4WXYB 4XKJA 5HZGA 2SKDA 5CFOA 1M1ZA 1PQWA 3L7YA 1XQVA 3AGPA 3TPFA 3OJEA 5KQSA 4EG0A 2GRRB 1BZYA 1DJNA 1QJ4A 1EDZA 5FRDA 1AN9A 4ENWA 1VLHA 4DI4A 2H17A 4XQ9A 1PU2A 2CLMB 2WILA 4OYHA 2OENG 1RKBA 3O91A 1QZZA 4E0BA 4KU4A 1IQ0A 4KGVA 3FMGA 2YFKA 3TLKA 5HJ5A 4EFDA 3ZBQA 3P2EA 4NFLA 4KDRA 1H65A 4MRRA 4HNUA 3DTTA 4OHUA 3HYLA 1JW9B 2QG4A 3FCEA 1GQ2A 2I6QA 1Z5UA 5A71A 1XJWA 1QP8A 4Q5IA 4C0AC 3C3RA 2JABA 5J4LA 3JTMA 1E8WA 1WM5A 1KQOA 1JG1A 2PH1A 2HPAA 1EWYA 2H4FA 3SHVA 4XA8A 2P75A 4LWZA 4XUCA 1N33B 1H2ZA 1QGZA 5EHXA 2CVFA 1FP1D 4GZ5A 1BS1A 4I9UA 4MVJE 4DDTA 3TFWA 1WEHA 5FFFA 5J4YA 3HUTA 1LI4A 4I7EA 4LZPA 2YRWA 3RSEG 1N9GA 3WXMA 5LQCA 4WLVA 1MX6A 2OO3A 4B4DA 1KAMA 3SFYA 2QKYA 2J3IA 3LK7A 4MS4B 3EE6A 4YASA 2G5PA 3WL5A 2CE2X 2PKQO 2PYDA 1JFRA 4YJ2A 2CJPA 3TLJA 4JR0A 1UZUA 2IS6A 4LJ8A 1QP4A 3DE2X 3K4HA 5AKXA 1B0PA 4NYMR 2OKGA 1C29B 4H0CA 3EUWA 4J91A 2GTPA 2VTKA 1A8PA 1AXEA 2XA2A 5K7SA 5EN4A 4BLUA 5C0OE 1WV0A 3PD7A 2GCPA 5GVRA 3KSRA 3C8HA 1U0FA 3AX6A 1N3YA 3SEAA 1A98A 2Q2NA 2ZFUA 1IB0A 1HC7A 2BONA 4ZVTA 4FC7A 1P0QA 1XWWA 5HDQA 3N05A 3DEYX 1ZRMA 2H0RA 4NX2A 4IHJA 1SG9A 3PZ4A 1DPGA 3B7WA 5EJEA 1ESZA 1CY0A 3THWA 1FYEA 3F6CA 1KE2A 3G0HA 1ZCFA 3BICA 3HLTA 3JZAA 3AEKB 2NPOA 3ROXA 3ZWAA 3HXBA 5IKXA 1VE1A 4OXNA 3Q9NC 2I2OA 2R8ZA 2FN8A 1CUIA 1U2DC 4F53A 3EGWA 3GRKA 4RK4A 3D8TA 4ITVA 1ADCA 3UJAA 4IG4A 2Q3JA 2JEKA 3X2QE 2WF6A 1UF9A 4B4OA 4W1PA 1F17A 1T0HB 2ES4A 3QFSA 2AI3A 4KFCA 4FYIA 2PY6A 3ZVYA 3PC4A 2QG9A 4CEMA 3RS8A 1HYBA 2Z4TA 3ENNA 1OFVA 1WILA 2CLFB 4RTJA 4MUMA 5NULA 3CIAA 4FLBA 3GJ7A 3PTZA 3WIUA 3AJAA 4X97A 4HATA 4D8TA 3RRZA 3KQOA 2X58A 4BEPA 5TQVA 4CKYA 3FUEA 5DE3A 1HF3A 3RFUA 4YEDA 1TCAA 1PTKA 3VPBA 3V4FA 1T9KA 3SE7A 3FI9A 4RVOA 2WKSA 2FSVA 4P4NA 1B73A 3M5CA 1EDOA 4IQ8A 4B3DA 4QWWA 5FL3A 3IR5A 2HRDA 4JZYA 2FQ1A 1N8SA 2PVSA 3NASA 3IDQA 3UAVA 2VWPA 3BC1A 1FTQA 2C61A 2NAFA 4D4HA 2SKCA 3LHKA 3EZ7A 4XI9A 2B5WA 4MR9A 2FN4A 3NTLA 4MQEA 5JQGA 3RRNA 3DUFA 2HJSA 4NDAA 1QVWA 2YCBA 2ETXA 4A49A 2R6JA 2D7JA 4BASA 4OUDA 1J97A 3A9UA 1XLTC 4KOEC 2P2ZA 3GA0A 2NMVA 4KJXA 3KR0A 4QYTA 1PFYA 4L7QA 3EA5A 2JIMA 1N2IA 3JQ7B 5TY0A 2O5VA 3K6SB 2GJAA 2Z8ZA 2OFPA 4DV2B 3I5UA 2CK3D 4IRUB 4GTRA 1KMIY 1QIFA 1EA7A 1OIWA 1IK6A 3GLTA 5BQOA 2QIZA 3KNVA 3CE9A 3RWBA 3BIOA 4HR7A 2FSHA 2YXPX 4WZAB 2MWMA 5TMDA 3QKSA 5KU7A 3UGKA 3J81A 4TZ0A 1QORA 4JOSA 3VKHA 4UBLA 4RKFA 4G63A 3RWOA 4K9MA 3B53X 3KJFA 2HZ7A 3PE4A 3CR7A 1ADYA 5KIAA 4HAWA 4C0JA 4MCHA 3TDNA 5SYMA 4PFKA 4IWXA 4A1OA 3H5RA 4X20A 4IKEA 4L9WA 2BKGA 1DARA 1U8ZA 4UAUA 1VMEA 5B7PA 1A9SA 2H1CA 4EB6B 4QVIA 4EW1A 4NIMA 2A5YB 2VNFA 2VA9A 5AM2A 1DC6A 1E90A 4V03A 5DGDA 3DOUA 1ZSYA 4MO9A 2M2IA 3W1WA 2FFQA 1UBMS 4RACA 1SZAA 1TM3E 2ORED 4F3KA 4R1UA 1SVUA 4WECA 1F8UA 2J3JA 3OPQA 4HUQB 1ZSNA 1O9HA 4G2NA 3RANA 3N9IA 2RFLA 3O92A 1H5NA 4NDNE 2BBSA 4DQKA 4UKDA 3GGPA 4MUGA 3E5HA 3BXGA 3X1JA 1D4ZA 1PW5A 1TECE 4JJAA 2G9NA 3V46A 4L0MA 1QGUB 3O6VA 2DF8A 3NDJA 3RAFC 4LG6A 4Y2XA 2FEZA 5JDIA 2C5HA 2NV2B 4E1AA 3OPVA 2FKNA 3BCHA 1II8B 2PD4A 2OPHA 2R00A 2CVQA 4O4LB 2YWHA 5CX4A 1O1YA 4QOEA 4Z4EA 3LKDA 4K40A 2WE8A 1Y34E 3RABA 3BTOA 1XB2A 3NHMA 4IHAA 2OCYC 1WB4A 4KPUB 1WY6A 3S29A 2WHYA 2EWVA 4MX8A 3L7JA 2O2SA 1ODCA 3HIZA 1BI8B 1L9XA 2E6RA 3V7NA 4ZQGA 2GZ3A 2Y3IA 1AF4A 1MABA 1Q11A 4HAIA 1AKUA 2JJMA 1W5EA 3B1WA 5GZ1A 3H9CA 2CXXA 4IO0A 3VR5D 4DLZA 1ZXLA 2PDAA 3QUBA 4YGYA 3DWEX 1SCNE 1WDTA 3DJFA 1ZG3A 2JL1A 3G7UA 4LNAA 2PX0A 5KU1A 1TNYA 2KU3A 3NR2A 5LP6A 3E70C 2POQX 4YACA 5BQ3A 3IMCA 1UBFA 4Q9DA 5A5DA 1JA9A 2QL9A 2BWJA 1XQYA 3K72B 4DVJA 1TZJA 4EL5A 2SBTA 3ADOA 5BMVB 1SVNA 4GOJA 3EWSA 4TMWA 3Q98A 3PF8A 3E9RA 3H8SA 4P5DA 3AW8A 1XUOA 4S0ZA 3H5TA 1WHTB 3OJFA 4HFNA 3AHFA 3Q5MA 1NXSA 5J9FA 7ADHA 2VJOA 2FFBA 2IBSA 4D9GA 4EAQA 3HO6A 5C7OO 2DP4E 1NN3A 3JVEA 4F8JA 2B9VA 5ED4A 4K8OA 4HT3B 3JZMA 4NH4A 1LK7A 3FH5A 2GBFA 4I46A 1U6JA 2DTEA 3P2YA 4N5HX 2ZXEA 1NMSA 3ZYLA 2ZWAA 3F8TA 1KQPA 1MNQA 2WPVA 3CNOA 3CBGA 5JAHA 3HU1A 5LQSA 1NXPA 2LR0A 3U5PA 4AIRA 5CB4F 1JIUA 4J6IA 3KQKA 3OT1B 3WZLA 4AJWA 1B15A 2NADA 2VHWA 2DQZA 2I3ZA 1VB5A 4X41A 4ZTZB 4RG6A 3ZY4A 4XDZA 4H6VA 4GYOA 4J6EA 5K01A 3R76A 3K5IA 1OBCA 3CR8A 2K7FA 3AG2E 4H7XA 4MR8A 2HLPA 4DWOA 4MWBA 3EGDB 3NEYA 2IS2A 5BSVA 3QA3E 4OU4A 4DEVA 4LBVA 1B23P 5JJLA 4GMFA 2V5QC 5CDFA 4GX2A 1T9HA 5TXGA 1NZDA 5HQ3A 2Q1UA 3Q75A 3STWA 1WG8A 1IHDA 1Z6GA 2GO1A 4GAAA 2V59A 3DPUA 4XJXA 4YAFA 4LNGA 5BRNA 2PD3A 3JVUA 4A16A 4E2ZA 4KFTA 2J85A 3MJEA 1RMTA 3A9TA 1BYUA 1H2YA 4N7RA 4I1PA 3AKYA 3OCXA 3FH0A 5EQTA 1R0YA 3OQHA 1TIKA 4OHWA 2ZSIA 3VNSA 1WDWB 4IVRA 4TM7A 4UWHA 3TW8A 5JY6A 1L7VC 3LX4A 3PRZA 3U4GA 4K6KA 2OQRA 5SVXA 1Y1QA 5KYUB 1XQ1A 4GTVA 4G8CA 2J1LA 4BMCA 4GA1A 4UUPA 2XMGA 3GAMA 4UPEA 3PDHA 1YVPA 1YQWA 3TLAA 2QUIA 1Q21A 2POCA 4Q66C 2CNDA 3EARA 3VSCA 2EG9A 5DU2A 2AG1A 2SICE 2ETAA 5I7WA 3U3MA 5CD1A 5GJWC 2QU8A 4UOZA 1DLIA 3F6SA 3GVXA 3CYFA 3LH5A 3VNBA 2FMFA 4PYRA 5CRUA 1JR6A 4LF8B 3DV0A 2G36A 2E4YA 3F5DA 1U7OA 1JI3A 5GV8A 3OQMA 4MVJP 1SCIA 3VU9B 3SE0A 5SZHB 2C95A 4HK4A 4AUEA 1UP6A 2E89A 4KMOA 2KI5A 1RSZA 3CUKA 1B6TA 2G88A 1TEVA 1V37A 2HFKA 1N5MA 2ISCA 4JDUA 4M21A 4Q9NA 4GOLD 2J0EA 3PL1A 3SXUA 5CT9A 3AUXA 3WMEA 1NVGA 1C81A 3FFXA 2OCIA 4OYLA 4DWWA 5JJBA 3TTSA 1M9NA 4YXWA 3URZA 1D2GA 2FWMX 2YZ7A 4BN0A 1AZSC 4FFWA 1E1LA 1N0HA 3EFEA 4NBLA 1TQ8A 2YW2A 3H0KA 1AQIA 3K0EA 3X43A 5AI5A 4J0UA 2AOVA 4HH4A 3HTXA 2BLLA 2X9GA 4QQ8A 4NACA 3H1AA 2XYQA 3W5CA 3NHKA 3GJ3A 2XCTB 3RTEA 1HDYA 2BTOA 4HDMA 1I24A 3M5DA 4BERA 3BA6A 1RACA 2I8AA 3NOGD 3MEQA 3NKVA 5CECB 2ZISA 1XZIA 2H8GA 5ALPA 3DSTA 3QFFA 4FKMA 4HSGA 5LLTA 2C04A 1PG5A 4WKPA 2FI1A 2PTHA 1JB9A 3IKLA 4KE8A 3WLHA 3CXRA 4L7TA 4KYOB 1ZNYA 2QMEA 1RDFA 3AK4A 1OF1A 2L82A 5K1ZA 3L0ZA 5J2TA 4HWOA 1KWGA 3N0XA 4D9CA 1TD9A 1B8PA 5CDSA 1W85A 2H92A 3VZPA 1JHZA 4RDCA 1LNSA 2FWIA 3BS4A 1SFRA 2EERA 4AECA 1DS6A 3RVPA 3UTCA 4AJHA 4X85A 1WHSB 1ODKA 4IHJF 5HUJA 1KEPA 1PZHA 4DAOA 1EDEA 3FYDA 3ZY3A 3U80A 4EYGA 2G07A 1V7PC 1HDOA 5ER9A 4LISA 4H0NA 3WTCA 3JQDA 1APBA 2RCNA 4UATA 3UJHA 1Y3AA 4JYCA 2ODQA 1VGQA 5TQJA 2R3SA 4R1LA 4LX8A 4KO2S 3E3AA 2FMTA 1H1LB 3UHJA 4LMRA 2QYJA 2J07A 1U4SA 3W79A 4FLMA 4C0WA 3TDKA 1WPXA 4R40A 2FR8A 3A4IA 3VNRA 4D98A 2HJRA 4YROA 2VP7A 3L1UA 1OX5A 2RDMA 6LDHA 2BE7A 1JZQA 2RKBA 4L7VA 3RKSA 5FORA 2X22A 1AKVA 3CZCA 3L84A 3OIFA 4Z9YA 4C2AA 5D86A 1A3CA 3OOHA 4J03A 4XYEA 2XZTA 4JI6B 3ZCVA 4F3TA 3W7AA 1JFVA 3E34A 3BAFA 4Y2PA 3ESKA 2RAPA 2H5JA 1GNTA 2Q7DA 2ASVA 2REQA 3LUBA 3GH3A 4BCBA 1Z5GA 2IZ6A 2XGOA 4BVGA 1LU9A 4PZLA 2V8BA 3EQ2A 2X7XA 3O9VA 4GB0A 1NASA 1D04A 3UT5B 2IOYA 4CMHA 2W11A 1KO1A 1P18A 5CFPA 4NAVA 5JQGF 2I1JA 1KFJB 3JRNA 3Q40A 5D8DA 1Q12A 1JR2A 4CGVA 3UZUA 3VTYA 4JT9A 5AK4A 5EJIA 4A3TA 3OJXA 4C3VA 1GCGA 3NZSA 3L7BA 4MJLA 4KP7A 1FFWA 3U56A 3KD7A 1MX2A 4FIZA 4IIXA 4EKDA 2UYCA 5K4AA 4EFKA 1X7ZA 1V95A 1FX1A 3E9EA 1N2SA 5CBOA 1N94A 4HGOA 1S01A 4YK7A 3EIUA 4DL9A 3HLYA 3EYWA 4QTTB 3APDA 2E4XA 2WSIA 4RKWA 2GN9A 4H59A 4EKYA 1X1BA 1TN6A 2JD0A 3HEBA 4BO6A 3PQ8A 1N0VC 3QF7A 3KJEA 1AMOA 2F9MA 4EUSA 4EG1A 3T7AA 1UEJA 2PXXA 1O4VA 5A4FS 4LG1A 1Q6ZA 4U7PB 3WDKA 1OB5A 3NTXA 2P6NA 5LBUA 1CLUA 1XYYA 4RDIA 3GX1A 4OL0A 5BP7A 2ORIA 3WLKX 3UEOA 1CUSA 2ZI3A 3Q15C 1CZKA 2VC2B 4RTQA 5BSRA 4HDRB 2IOLA 3EF0A 5HQ8A 1JGTA 3HWSA 5IG2A 5K0EA 6REQA 1ORIA 4CMBA 3HFGA 1DWOA 4KQHA 1R4AA 3PS9A 3O4JA 2GVDC 4QKQA 2J4DA 2DQSA 1TJFA 3PTLA 4KVOA 3T1QA 2B1GA 1JDUA 2HIGA 2VSNA 4QPDA 5AITA 2QTNA 4Z54A 1FRFS 3I9OA 4MZDA 3WNQA 4TWIA 4LXYA 3FCSB 1H0RA 1I51A 2WMDA 2UYQA 2ZAOA 3JCKC 5IN4A 4ETWA 1UL1X 3OZTA 3AVTA 1W94A 4FYMA 1SQ0A 1GQRA 1Y7LA 1HT0A 2C84A 5E1OA 4PS8A 3PT9A 4U0UA 2EJBA 1NA3A 4WDRA 4A8PA 3MTEA 4V0NA 1CR4A 3T3OA 4ZCLA 3Q1KA 4I7BA 2G40A 3Q5GA 4DMMA 5LP1A 3DAOA 3P0FA 3P9YA 2Y1KA 4QWMA 1GKIA 3PVSA 3LQ1A 5KUTA 3QNUA 3WB2A 1KU0A 4FZVA 3DT6A 4B87A 3K0SA 2QX4A 4CG1A 1IDOA 1WEMA 2V6GA 2J3KA 1ZD4A 4RA9A 4P9NA 2JZCA 4M0FA 1VFYA 2MSWA 3DT8A 5EJ2A 4U96D 3QU4A 2G1KA 13PKA 4BQPA 1CR2A 4ZIRA 1C3OA 4ME6A 5J23A 3NM4A 1RWVA 2C7BA 4YLYA 1JR3E 3F4LA 2J32A 5K09A 1EWVA 2YOFA 1SCUA 3MS7A 3PRKE 3HJAA 5EMKA 4EFNA 4D42A 4PG4A 2PX6A 4E88A 2WF9A 1B0UA 2GFHA 3WWDA 1E7YA 4GOND 1NBIA 4MIEA 3IRUA 3IMEA 3C1OA 1N4AA 3AHDA 1QH1A 2PM8A 3V34A 2OZLA 2V0GA 2VXYA 4MARA 4D97A 2HH9A 5AN8A 4OLBA 4ARCA 1GA4A 3GNQA 1AHNA 5LNK1 3H6GA 4MW4A 1ZGAA 3CPEA 1DJPA 3ICEA 1PV1A 2NZ8A 1WX1A 2M6RA 3ORSA 3RSZA 2D74A 2H0AA 2ECIA 4MB6A 3U4HA 2W48A 2OP1A 4F38A 3C24A 5HE9A 9MHTA 3OLQA 2LBPA 4US0R 3O8BA 5LCWB 2C9MA 4C4OA 3TWSA 2OCGA 3NQPA 4GKVA 3I4RB 4GMXA 1DRUA 5BT8A 2RFAA 1HYQA 2I6TA 2VSOE 1Y1LA 5ENQD 5HHTA 2VJEB 4TRMA 4MVCA 1YMPA 5EJGA 5ICMA 1RZVA 2QN1A 4P4TA 2C0MA 4HXFB 2DFPA 3KOXA 4RSHA 4E4TA 1OI3A 4ZRMA 2YJ6A 5CR9A 5JCJA 1P19A 2BGNA 1OI4A 1A72A 2YWGA 2H18A 2VDNB 3BH7A 3A9CA 2WD7A 3CPJB 4CM9D 3ER8A 2JBAA 1WTCA 3DDZX 1EBFA 1VDMA 4Q18A 2E5FA 1NRWA 2GWHA 3KV3O 3M1LA 4C4SA 4LS3A 4PX5A 4U39A 4B4KA 3OQBA 2Z8YA 4QDKA 1W19A 5T4BA 3HDJA 3TZ6A 2CCKA 2O1SA 2GK7A 1TKBA 4CQMD 4LUNU 3AKZA 3FHLA 1SCAA 2F3QA 2PZFA 1RADA 1P73A 3H16A 2B4RO 621PA 1SD5A 5CT8A 2RHWA 4L9RA 3F7OA 4ILHB 4UVGA 1GEGA 3G2QA 2D0OB 1OLSB 4D4MA 2AVPA 4DLKA 3HBLA 5F9MA 1N2XA 2YV5A 3IODA 4I50B 4GQAA 1VKZA 3OH8A 1E3DA 2FK7A 2VZ9A 3JAWA 3CNLA 3IHPA 1ZHFA 2VLIA 3S1AA 3TX6A 1GGJA 2V7QD 2ECPA 3KEAA 3SF4A 4CMIB 1NUQA 5E6UB 2AX3A 4TZ6A 1KSHA 4A03A 1T1RA 1RQ7A 3ADKA 5G3YA 3JQBA 4KO3S 4C6TA 2O3TA 2EF0A 1TYBE 2MCFA 4C6HA 5KNLA 2WWXA 4CLEA 4G84A 3W6NA 2WW8A 2XCIA 1XXLA 3F3SA 4G1MB 1THMA 5JHGB 2ZI4A 3LZ6A 1UJJA 4LF6B 1P3JA 2HRQA 4RHUA 1YZGA 3IOMA 3ABME 4AJPA 3ICPA 4MWCA 5JXWA 4JJFA 3MYYA 4KZKA 2P2LA 5ILOA 1K92A 3HDGA 2ZI6A 3SNXA 1VBFA 1OFGA 1Y8MA 4YO8A 3UHAA 2X3UA 2QX7A 4D57A 2DJIA 5AW1A 4UARA 1Z6UA 4FULA 3N9MA 3CEAA 5B78A 3EH1A 2JIDA 4P3OA 1IOLA 4A27A 4PANA 1G41A 1LWNA 1LTQA 3WIOA 5A5GA 3BL5A 4F1WA 1Z4MA 1GZVA 3ZCTA 2BGRA 3IAFA 3DNMA 3RAJA 3OPYA 4DRXB 3R6LA 3L3BA 1ZITA 3OCVA 3NWJA 3D0KA 1S3GA 1HQDA 1Y4DE 1YL5A 2BHTA 3GWZA 5LQKA 2J9XB 3GUHA 2YIDA 3R3HA 4I4TB 3CIOA 3KSZO 4HHEA 3KHSA 4WZBA 1CHNA 1TW3A 3A4MA 1JEQB 1U2EA 2Z9CA 3COYA 3HGQA 3E1SA 4DJTA 1CNFA 2ZXFA 4JR2A 2FUCA 1TT7A 2OBYA 4U6QA 1QF9A 2GHIA 2PLWA 5EWMA 1ZUWA 3CNQS 4GKAA 4BQIA 2UZ1B 4MSXA 3HVEA 1HXHA 5KYKA 3IIMA 1YHZA 5CUQA 2ZSAA 1X6VA 4HWRA 4YTEA 4AZ3B 4GYWA 4ZAGA 4QDOA 5FR2A 1LS1A 4URXR 1JQLB 4Y6LA 3MSXA 3EBOA 1YJQA 5DNYB 1N4SA 3DWDA 2A8YA 3O48A 1QQTA 3BA1A 1QO7A 1QQEA 3ISJA 4BGEA 3K5HA 2X38A 1VXOA 2FVXA 5ALWA 2M1ZA 3CT4A 3LDGA 4JH0A 1Z2EA 3P0EA 3TWTA 1BX3A 2VGEA 1DBPA 5JPDA 2I4OA 3RYIA 1XAGA 4X8LA 4MKIA 3VVLA 3OZFA 2PVCA 4OXKA 3SQDA 5T8KC 2PJRA 2RSLA 1ONOA 4A1SA 2I2CA 2WF5A 2YHAA 4F6RD 2HQRA 4HBZA 4WRRA 2XSZA 3FJ1A 4PZAA 3RS0A 1J23A 1YAJA 4I6GA 1HE5A 1V0JA 3JSAA 2QTLA 1UWKA 5BSFA 4G65A 1Z06A 2A9KA 3GJSA 3LPCA 1M1YA 1WAO1 3BRWD 3K53A 4ASUD 3A3OA 1U2SA 3RKUA 4XE5A 1QC5A 2NVBA 5HM6A 4GMGA 4U3JA 2WIDA 2AC7A 4GL4A 2XTAA 2RH9B 1MGPA 2D1TA 3IP8A 4G4SO 5I48A 3EHNA 4PINA 4YIHA 1QDLB 2NXEA 1IONA 1M8PA 4RC9A 2UDPA 4KWIA 3B7RL 1DEAA 1D1QA 4LFCB 5FI1B 1CRPA 1I3KA 2NZUG 2WOOA 4FMCF 1NQOA 2IYYA 4N1AA 3FD8A 3LCMA 4L73A 4JWKA 1QZ3A 3BD8A 5L7TA 1BIFA 2BFDB 3R7WA 5CVEA 2QAGA 2AXPA 5C4MA 1G8JA 3MTBA 1RRMA 2VSXA 3OP4A 1G5TA 5BV7A 4CF4A 5AK6A 4PYKA 5C31A 1NKVA 5IJ0A 3AF6A 1UFQA 4B6QA 4JXZA 3BIXA 4N76A 1Q7GA 4C30A 1ZH8A 1KI6A 4R41A 4ND8B 3D6HA 4ECEA 4EG5A 4HRAA 1W0JA 5A05A 4TZKA 3VU0A 2JGNA 3ZDZB 3NI2A 2FQXA 5CT4A 5LR6A 2V54A 3N70A 4ROSA 2BH2A 2OM2A 5JSKA 2ORVA 4M0CA 1H8EA 1UK9A 5LFAA 4LHYA 4J1TC 4J7UA 4O2RA 1ULUA 1V1MA 4MPRA 1ENPA 3PJFA 3KVOA 3CG4A 5ITZA 3FTEA 3EXFA 5JSZA 3OX4A 1H2WA 4BZXA 1PJ4A 1QB7A 1EIWA 1P5JA 1FE8A 5AVVA 1YMVA 3FZQA 1XOIA 4I4LA 3VU8A 2GAIA 1XEXB 5SVIB 2Z4SA 2C5SA 3MLAA 2P1DA 3QY0A 2BAGA 1XCLA 5KYYA 5KHOC 1WV1A 2WUFA 4EUFA 3BK2A 3KDAA 3KWMA 1BHO1 4HO1X 1LPOA 2Z30A 2E4WA 4HWGA 3EZGA 1T0PA 2ZTVA 1MA3A 2BKUA 1O54A 1WSBA 2RH4A 4ITRC 3B6ZA 1XFDA 1TLLA 4DCSA 3E9MA 3KSMA 5F76A 2ZVPX 4H0FA 2D00A 2G06A 5JWOA 2CKDA 4Q4LA 1OAKA 1ZEMA 2GBGA 4DRYA 5L4SA 2OV8A 2IH2A 2LVBA 1TC1A 3TMKA 3K0HA 1TCUA 4UI9B 4WKCA 3COWA 2O59A 4HZUB 1M1NB 1M0EA 1KRWA 3GOQA 1JHUA 1Z8DA 2DLCX 3C3JA 4RZUA 1DBRA 1RHUA 3O2NA 4MPJA 3I05A 1NQVA 2FSSA 1JF8A 1NP3A 4F6CA 4EZEA 1Z8FA 3LC1O 5DI3A 1QOZA 1LWOA 2OHFA 3QBTA 4TKVA 1PC2A 1JHRA 4IV5A 3VV2A 4JR1A 4DB2A 1D6NA 1OT5A 3KZOA 2PSHA 3GJRA 3VYSB 3RJ5A 3HUUA 2J7PA 5F78A 1W36D 4RFVA 3AF3A 2RH8A 4H16A 3L9XA 2WAXA 1E8NA 5M7EA 1ZS9A 5TEVA 2B1RA 4PVDA 4EHMA 3B5JA 5I6DA 4DQLA 1OCCE 4Z0TA 2NU8B 2EP7A 2WG2A 1VPVA 4G0XA 4NOKA 5DYGA 2FWRA 4A4CA 4CL2A 2C94A 2C9YA 5JO0A 4BKRA 3GRAA 5HMLA 3U1TA 4S3OC 2OG1A 5KWEA 4OQQA 3ZU3A 3TSZA 1SWVA 2G7MC 1P2UA 3I01A 4BNYA 4ZYVA 2H7XA 4F3VA 3NOVA 1E6CA 2VHJA 3GFOA 5CB4A 3JS5A 3H75A 5AOBA 4EW6A 1ZOIA 1IY9A 1M2GA 2GBLC 3QU5A 1B89A 4FEEA 3FU5A 5CLIA 4B3HA 1U1CA 3A4TA 2VDPB 4P3PA 3NTVA 5ALGA 3R9AB 4H1UA 1EEXB 5LUAA 2WAMA 4YX9A 4EF4A 3M2PA 3OTGA 4WAFA 4DWJA 2ILRA 4PM4A 4C9BB 4EKIA 5K0LA 4TS1A 1Q7CA 2H54A 3S2GA 2LDRA 2DPYA 1SU4A 3AINA 4UBOA 1I2ZA 1RTTA 2OBXA 1EXMA 3QPAA 2QBYB 4H9GA 5ELXA 2Q2OA 521PA 4CG2A 1C9NA 3OCZA 3IKOB 3JWIA 1DCMA 3KEZA 3KS2A 2ZU6B 1GV0A 4GSKA 1CEXA 3ERCA 2ET6A 3QLEA 4S2EA 2GASA 3ENWA 4P1ZA 1G2IA 2NXCA 1Y5NA 1H0KA 1T13A 3H04A 3R3SA 4J6FA 1H4SA 3OJWA 5KOHA 4WKBA 3RYCA 2F62A 2HFJA 3PQEA 2R47A 3RVNA 1CY1A 3AEUB 1TNOA 4BESA 5G40A 1PD1A 2L0XA 4X3OA 4K7JA 1IEXA 3AHJA 2XEHA 4OGWA 3FRIA 2FN3A 4UUQA 3WICA 1Y82A 4QGGA 4R68A 1HL7A 1GL9B 2JJ2D 3P9QA 3GBVA 3QQPA 2ICAA 1PJCA 3R20A 1UK8A 5LC1A 4QXQA 3EG9B 1WMAA 2W6NA 3DFMA 3K2EA 5KJFA 1HFAA 5AJTA 4L0QA 4NSNA 5L3RA 1Z56C 4BNDA 1Z3IX 1KFBB 3QYFA 1HNXB 2VJMB 3BWBA 4B75A 5DM1A 1QDUA 4WEOA 3TPZA 3VR3D 3E22A 3BMOB 3FUFA 4G36A 4K5QA 2HBZA 4QNMA 3KD2A 3URKA 1ZD3A 1THZA 4Q7KA 3VC7A 1XQWA 4XM2A 4KQEA 2DFDA 4WA7A 3LUFA 4D02A 1ECPA 4I8XA 5BY2A 1AT1A 3HUDA 3FPBA 5KWJA 3W5VA 1XNGA 2ONDA 2XKJE 2B4YA 4RQBA 2ZVJA 3PNSA 2XBLA 3UC9A 2L69A 4UHDA 5IK2D 1G98A 4BHTA 3MFQA 1BVHA 3OIYA 2COKA 2I6UA 2IPNA 1NXOA 3EEBA 2ADOA 2O8DB 1BJTA 4HNGA 1Y9DA 1W88A 3TKYA 1UAGA 5I9MA 1FNDA 3RK4A 4K0KB 3UKJA 2IUTA 4XPZA 3GVHA 4NE2A 2I29A 3AERB 2EILE 1Z74A 4AY2A 3IP5A 3QUSA 3PCXA 3D2CA 2I2BA 4YQFA 1RWNA 1C80A 4J8YA 4M7WA 5IYZF 3A0UA 1QONA 3LX6A 4TQGA 3I2KA 4IDCA 4JEMA 3MPUA 4MH0R 3T5GA 5TMEA 4MYTA 2W6IA 4IEIA 3NTQA 1QE0A 3GL6A 1Q0HA 2ZJ7A 5CM8B 1O57A 2BR5A 3FFBA 1MMFB 5I51A 4JVNA 3IHYA 4NABA 1M7GA 2I7VA 2IWRA 2NQ8A 4DV5B 3EPPA 1J1ZA 2UVDA 3KE9A 1X7YB 5CGZA 3LS8A 3VPCA 1BNCA 2Y2UA 4WWPA 1V7ZA 4HI9A 3QDNA 1OLUB 3L7CA 1UBGA 2P3LA 1IWOA 1X1AA 2WICA 2RGEA 4D3FA 3B1VA 3J80A 5DOZA 4F1SA 1J39A 2D59A 3ZGXA 3RFXA 1QX3A 3E3OA 4MV6A 4TKUB 3KQUA 3PG5A 4KUEA 1Y8QA 5JD5A 5F1OA 2W6QA 3NH6A 1C1YA 3LDUA 4EMUA 1GG9A 1JHXA 1U02A 3ZDQA 2WTEA 1P8JA 3TFOA 3QTLA 2ZTLA 4CMAA 3BILA 4ROTA 3GMSA 3ZXIA 2ZPUA 2GAFA 4BMNA 2NXNA 4BLWA 3LNTA 4NH0A 2IK8A 4OG2A 4YLEA 1TO1E 3BK7A 2PUGA 2AR7A 3DVAA 4B31A 4WN9A 3MJWA 1FJ2A 3L8HA 4YMWA 5E0OA 3FWZA 1P31A 1UANA 1WKCA 2G7ZA 2O2HA 4CM6A 1GZHB 1ZU4A 2K2QB 5EMLA 2FFJA 3VKFA 2YQ4A 4Q94A 3ZOZA 1USKA 4ZDJA 3WGGA 2VQ2A 3J5PA 2DYKA 4PHGA 3UB3A 4Z99A 2ZIXA 4F6LA 1XZHA 1EHYA 5ALZA 1QQ5A 2NZ2A 5K5EA 1PK8A 1KI2A 4LY3A 2WVJA 1IQPA 4KBFA 5DSTA 4ZEXA 3OEWA 2ZRDA 3AF2A 5CAEA 4CMEA 1XXHE 2ZQYA 2YV1A 1U1DA 1G63A 5IJXA 3JQ1A 2M63A 1QFXA 1J21A 4EP1A 2HCRA 2AJDA 4DCOA 4TTVA 4YPVA 5F4BA 4NJEA 4EGJA 5HSGA 1GQOA 2BSXA 5KPJA 2VDOB 3CLRC 4HVAA 2QT0A 5DGIA 3N8DA 1AO3A 1QFSA 3APFA 4RCVA 3MWEA 1GD1O 3RVMA 3V31A 3MIIA 2JFYA 5BN3B 3PNMA 1E7UA 4OV6B 4R2LA 4BKPA 3KYBA 2JLUA 2BFWA 2PUVA 3W9BA 4D9EA 4EL0A 1FUUA 4GKBA 1GT6A 2Z6QA 4IQGA 5SICE 1OPRA 2VAVA 4EUEA 3QY9A 3KD3A 2XPIA 2YSMA 4DMKA 1PY1A 3L46A 2P2NA 1RPJA 2B82A 2EINE 1OR8A 3BZBA 5D5PA 1RXVA 4F8YA 2UXDB 2C5EA 2R03A 1PFWA 3O1JC 1FDRA 3QKUA 2WEKA 5A1TA 3FDHA 2QROA 4K9KA 4GR4A 1C30B 1XTRA 4EF6A 1UOQA 1GU1A 5FHRA 1OXTA 3B7UX 1YS7A 3FUJA 2CNWA 1EGQA 2AVDA 2IS1A 2H57A 3REGA 2HRRA 3CE6A 3FUWA 1XJCA 1K0UA 1Z2CA 5FWYA 2V97A 4YRNA 3DR3A 1M74A 3A9VA 1QTIA 2B37A 4DXHA 2IV7A 3NP9A 5EL0A 1W5AA 1BXRB 5BWOA 4OYYA 3HKCA 1YB5A 1QF7A 4AX4A 4LK3A 4PRKA 1WZCA 2P6PA 5LKAA 5EGSA 2IUSA 5M34A 3RO3A 16PKA 5EJ7A 3WGVA 5CXQA 4EG6A 2BFEA 3P5BA 3QKRB 2MJLA 1LF5A 4HYEA 3KYDB 3SM3A 1KH2A 1L6IA 2WQHA 5AI8A 5B7QA 1E3WB 4IH1A 2KBXA 2C96A 1VP9A 5A7HA 4M8SA 3PXGA 4ZYUA 3BXHA 2QN8A 4F11A 1LA2A 3FNIA 3GEBA 1BOOA 3I3OA 1BEEA 1RRCA 1N1EA 2Q9BA 5G1NA 1IPEA 1MA0A 4UTZA 3JU3A 2J9GA 4XX5A 1CQIA 4WNGA 3IS3A 421PA 3W9UA 3S5UA 3QWFA 1OA1A 4DUGA 4IW3B 1PDOA 1RPNA 4ISCA 4EMSA 2CB0A 1WCIB 4R8VA 3WQBA 1ORHA 3A6FA 4ZVQA 4ADSG 2H1IA 1FUEA 4WBNB 1SOVA 2W2KB 4MW0A 1DO8A 4UUBA 2R4TA 5ITZF 1I3CA 2BMWA 3AYZB 5DHRA 3H9QA 5J2UB 4DV3B 2BP7B 2XUFA 1HGXA 3IPRA 4HNSA 4M87A 3PEFA 4XEUA