3LW5F

Improved model of plant photosystem i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 19
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2010-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 3lw5F00
4RKUF 2WSEF 3LW5F 4L6V6 2WSFF 4Y28F 4KT0F 2WSCF 5L8RF 1JB0F 4XK8F 2O01F
chains in the Genus database with same CATH superfamily
3AOEA 4GC5A 3FTFA 2L09A 2O25A 2XFTA 1C1KA 2JWSA 3QYEA 5E6JA 4M9ZA 4MH0E 4GHAA 1E94E 1QZEA 4JI8M 3EIEA 2I7NA 2QHOB 4LFAM 4KHPM 3FKEA 3KXEC 2A5YB 3PVSA 4QHTA 3GLFB 1TTEA 1X37A 3U6EA 3I51A 4KO8A 3AKZA 1EIJA 4AZFA 2BJWA 3LQRA 2F5SA 4MGHA 3HZJA 3W68A 5ITUA 1IN4A 3B7NA 3KS8A 4DR6M 2CFOA 4IJFA 3Q8GA 1I4WA 2YFQA 1XMOM 3IECA 3SAVA 3GLHA 1MN3A 2L7HA 1LTMA 4LCBA 1R2YA 1I94M 1T43A 3RGPA 5L8RF 1PJJA 4NC6A 2RGHA 1NV9A 3SAUA 3R9XB 1OJLA 2APLA 2MH8A 2J7NA 2VF7A 3HHYA 3VKHA 1G4AE 2Y0QA 1Q3CA 3FUWA 1OFHA 2DWZB 4ANRA 4DV2M 4KT0F 1PJIA 2Z8YM 3NWLA 1A5TA 5FTKA 4MGKE 4NRWA 4DUYM 1H6UA 2ZBKB 3FYCA 3MHVC 1NO1A 2JUJA 3L27A 3QAUA 1N36M 3A45A 1TH4A 4F1IA 2Z4RA 3E21A 4I4LA 2AHMA 2XEPA 1NJFA 5A2QS 2GQFA 2CHGA 1IBKM 3SC3A 2HHHM 1IY1A 2KRUA 1G3IA 1NY5A 1R2ZA 4A3VB 1N33M 2BNKA 1KSFX 3DA1A 1HQYE 1ZMVA 1QANA 5IZ7D 3K9PA 3C58A 1QQWA 1DO0A 3B7QA 1JQJC 2QP9X 4LRSA 3KW6A 2V6ZM 2QSFX 1NHWC 3FD9A 4DV1M 2JY7A 4LFBM 4JI3M 2JXNA 3FUUA 3J7BA 2OOBA 4LZJA 1G59A 4DR3M 1IXRC 1Z5CA 3J7AS 2J7OA 4B7HA 1S3SA 4GITA 4L6V6 4LF8M 2M60A 4GH9A 4IIWA 3WHKA 2DHYA 3U6DA 1OAIA 3KP0E 3THGA 4LF7M 3TWLA 4WP2A 1TDZA 3T38A 2YNMD 4DV4M 3U6MA 3GRVA 3HY5A 1ZAEA 2R0IA 5DFLA 2F5OA 2FH0A 3FYDA 2W82A 2Y20A 4L16A 2CUZA 1QUSA 3GPPA 2LVOC 2JY5A 2JY6B 1XNRM 7CATA 1JR3D 1SXJD 1PJQA 5E26A 4PCZA 2O01F 2C5RA 3VFDA 4OU7A 1VG5A 1HJPA 5ITRA 3SYKA 3U6PA 4MGZE 5FTLA 1HR0M 5DYIA 2L6OA 3FTEA 4D82A 1VEJA 4L15A 5DYGA 2EA0A 2R65A 4Z8XA 3GO8A 1IM2A 4HL4A 1D0LA 2H1RA 3RE8A 1WR1B 3U60A 2MR9A 3KVWA 3KOZE 2XGNA 2MJ5B 2HKJA 4LJ9A 3SATA 1FJGM 2KRKA 2OQ4A 2C9OA 4QHSA 3PFIA 3GLIA 4B7FA 3H4MA 3LCUA 2D7EA 1Z5AA 2DENA 1VEGA 3C3DA 3GRUA 3M7GA 3FRHA 2R44A 1QUTA 2OOAA 2ZTDA 3HX3A 2LVPC 4MM3B 1QDRA 5FTJA 3C3EA 4X66M 1J5EM 4Z6YA 1AIPC 2CEAA 3RFWA 5ITXE 4LRTA 1VDLA 4NRVA 4RF1A 3GLGA 4G4QA 4DV0M 2CV2A 5FTNA 3HHWA 2QQ8A 3A42A 2UUCM 1PRBA 1XXHE 1PJSA 3D8BA 2DWNA 2K47A 4NOOB 3U6LA 3K92A 3SHGB 3K1JA 3GPXA 1GL6A 4IBFA 1E32A 1IY0A 2HCBA 2F5PA 4GMQA 1PJTA 3FUXA 1IN6A 2VIIA 3U6QA 4IBJA 1Z5BA 2V1CA 1DGGA 2XSZA 2ZAOA 1YE9A 2R18A 3I01M 2X4AA 1WJ7A 2EJSA 2ZAMA 1K3WA 2F5NA 2XLJA 4GKJM 2B3TA 2KNAA 2KZSA 3L28A 4HLQA 1GLNA 2KEBA 5ITYA 3I04M 1XHBA 1IBMM 4FD2A 2L4FA 4KLNA 4LJ6A 3UJNA 1JR3E 1DGBA 1SXJE 1Z59A 2BWEA 2DZLA 3VK7A 1ZMUA 1R7RA 3HKPA 4PDGA 4LF9M 2OO9A 3CF0A 3AOGA 1MU5A 2Z7JA 4LF6M 3M0EA 4XK8F 3U61A 3HGIA 3FTCA 4AKGA 1W5SA 2LVQD 2RGOA 2DAMA 1P3QQ 5KQDA 1VEKA 1XXHB 3I4VA 3DOAA 3GRRA 4AKHA 4IBBA 4PD2A 4X65M 2UXCM 3U5ZB 4CJ6A 2N35A 2YQZA 1YUBA 5ITQA 1TGUA 2P5TA 3L25A 3HU3A 1D0MA 5IREB 1TH3A 4LF5M 4L8RC 2ZTCA 2CHQA 1NNJA 1D0KA 2H5XA 2HAKA 4JYAM 4I81A 3HJSA 4P16A 2FOIC 4D80A 2UXDM 4FWDA 3TPZA 3IHPA 3J81S 2FS1A 2L7IA 4S12A 3ZH9B 1NHGC 4JI6M 1GL7A 5C18A 4TUWA 3RGSA 5F3WA 4OVZB 2UUAM 4L78A 1SXJB 5DNYA 1QZMA 2Q2EB 1OQYA 1UFZA 4AI6A 1Z6TA 4MB7A 1L2CA 4X62M 1XNQM 4XGIA 4CISA 1DGHB 4HEOA 4GC9A 3U6SA 2BWBA 3FTDA 4JI1M 1IXSB 4R3DA 2C98A 2LNHC 3EIHA 3U6CA 4PDIA 1SG9A 3QWLA 2CRUA 3KOXE 4QOSA 1D2NA 3FE3A 2F4VM 4DBGB 4YY3M 3TWKA 3SBJA 5BR8M 3SYLA 1TH2A 1WHCA 1GVNA 3GLHE 5IT9S 3GQ4A 2QENA 4B7GA 3VK8A 4QNRA 2EKFA 3K8ZA 3LVVA 1NNUC 3KP1E 5EP3A 4NXNM 2KZUA 5JI3E 3Q8XA 2UU9M 2QBYA 1V33A 1NVMA 3AV0A 1RU3A 2NQ8C 4EIWA 4DR2M 2G5GX 4DV5M 5EP4A 1HQCA 1J7KA 1HNXM 3HU1A 3LCVB 2VQEM 1IY2A 1J09A 1VDDA 2QCUA 1SXJC 1MX0A 3C9PA 4W5WA 2VDBB 2YR0A 4G4NA 2R4JA 2J5YA 5EJCA 4DR7M 4IBDA 1FNNA 1QDTA 2LVNC 3L29A 4FWGA 5KPZA 2DWLA 1OIZA 2C9CA 2K0BX 1NY6A 4OW0A 3PNYA 4FCWA 4NXMM 1Q3BA 1YLAA 1TF0B 3GLFA 4LJ7A 2V1UA 3D8LA 5KPRA 2WSEF 4LJ4A 2GNOA 2JZ0A 4Y28F 4P17A 4R7GA 3SFZA 3MK6A 3GLHB 4M0WA 1L8QA 2X8AA 4RKUF 2KNVA 4DR1M 1OAOC 2KDLA 2UUBM 3NBIA 3DZDA 2L2DA 2R62A 4IBKA 4R71A 1E9SA 1IFYA 4AG6A 3AOEC 3K9OA 3V76A 2ERCA 2DVWB 1V92A 2EO2A 3E46A 3U6OA 2RKOA 4B3TM 4B3RM 2QZ4A 1PM5A 2CV0A 3W0FA 5H37D 2LXEA 3W0LB 3OTOM 3J2PB 2ZM6M 3M6AA 1TDHA 3KSJA 4XBOA 2M5ZA 2Y21A 2FNAA 2OPFA 1OKSA 4FW9A 4IBCA 3MMPA 4Q7JA 4JI7M 1IN7A 1WXQA 2G8LA 4GKKM 3ILKA 2XF3A 4I5SA 4BB9A 2LBCA 1EE8A 1OIPA 2XSZD 2DWMA 4M9XA 1YSYA 2WSFF 2VF8A 1Q02A 3KDSE 4IBIA 4LJ5A 4AW4A 3GP1A 1N78A 2XH9A 3LQQA 4K0KM 2FFJA 4LJAA 4LG2A 2CE7A 2LVAA 1E9RA 2DAKA 2WSCF 4CIZA 2X49A 4FVMA 5FTMA 2LHGA 1HT2E 2C99A 1GKIA 2O5RA 3BXWA 3HHZA 4OX9M 2JP7A 2DAEA 2LTUA 5BPVA 4JXJA 3B9PA 4NSRA 4QNMA 4CHTB 4ZPXA 2KA6B 1R4GA 2DZNB 2DZOB 3TQSA 1ZV1A 4GIPA 5FSWA 4KODA 1GABA 2D7HA 2Z3XA 2BJVA 4I8OA 4IBGA 5EXXA 3GLIE 4NSOB 2E5LM 3SARA 4LY6A 1XWIA 4REZA 4DR4M 4DV7M 1AUAA 3KFUG 5C1BA 3SHFA 3T15A 3VDPA 3DFZA 1DV0A 1TR8A 2DI0A 3KS4A 3VLFB 4M0DA 3ZC7B 1IBLM 1WGNA 2DNAA 3KOYE 2CWBA 3SAWA 3I4YA 3ZQJA 2F5QA 2JZ1A 3PNVA 3GLGE 2K9DA 3JR5A 2CP8A 4LZZA 2DAIA 2WZJA 3BBZA 2KXEA 2LHCA 3AL0C 1EFUB 4MGIE 2DKLA 1HNWM 3U60B 4JN6A 3MJ5A 1L2DA 5FLXS 5EQTA 1VQ1A 4GEWA 3JR4A 4M9SA 2R4EA 2VQFM 3NBXX 3ZCBB 1OFIA 3GLIB 2L4EA 4CGYB 3T1YM 2MGWA 4G3OA 4IBEA 1QVRA 2RRUA 2XFSA 3IG5A 2HWJA 5EP1A 3R8FA 2R45A 3TL4X 1G41A 3B74A 1R5LA 4FWHA 4FCTA 2DXIA 4GRIA 3LVWA 4RNAA 2R6FA 1WGLA 4FCVA 1IN8A 3T6PA 1GO5A 3GLGB 4G6ZA 4AKIA 1HT1E 4WW0A 1ORYB 5GKNA 5LMUM 4L4UA 3T1HM 3HJQA 1DGFA 2LWXA 3KSXA 4LF4M 3SMPA 1KYIA 5ITTA 4X64M 3CGWA 3UZUA 3CF6E 3SMSA 1K82A 1L1TA 1K3XA 8CATA 4ITQA 3B7ZA 3L2AA 1LV7A 4II7A 5KO3A 2I7PA 1T3TA 1WIVA 3GRYA 3HWSA 3VKGA 2KNZA 2JNHA 4F2LA 4B3SM 3CF2A 4B3MM 1T6OA 4YHHM 1XB2B 3FRIA 3LMMA 4B08A 1NJGA 1N34M 2ZANA 3K2LA 1C7YA 4JI5M 4JV5M 1XMQM 1JB0F 4WURA 4JI0M 3UGJA 2CV1A 3J80S 1F4IA 4GHLA 1L1ZA 3H4JA 3U61B 2MROB 4DV6M 1UM8A 5ITXA 3PXGA 1XC8A 1HNZM 4QOZC 3BOSA 3UMMA 3GPUA 4LJ8A 3AFHA 5JI2E 2Y0TA 1NV8A 3E9SA 3HHXA 1MJGM 2JY8A 1ZMWA 2QNJA 1R6BX 3FUTA 4PT5A 3A98B 3WHLA 1XXHA 2K6BA 4UN2B 5EXSA 4NL4H 4BLCA 3LW5F 1N75A 2C96A 5KQ8A 3HU2A 3CTWB 3QYBA 3TE6A 3GPYA 3U5ZA 4MGYE 3FUVA 3TWMA 1N32M 4LGYA 1ZQ9A 4AQYM 3E4RA 3HJ8A 3A46A 2FE8A 1W5TA 2HL7A 1Y8GA 4JI4M 1IQPA 3IG8A 3KOWE 2XZUA 1GJSA 1QAQA 5LMNM 1QAMA 1KFVA 2CHVA 2QPAA 4DR5M 3JAMS 4JI2M 4LFCM 4OVZA 2EUCA 2UXBM 2Z4SA 3J27B 1JR3A 1SXJA 2R46A 1G8PA 3UK6A 1PGYA 2DHRA 5EXPA 2LH0A 1V34A 5IWAM 1QYRA 2KW0A 4DV3M 3GLFE 1DGHA 1IN5A 5EXTA 1QAOA 1N77A 3W67A 1IXZA 3SASA 4LGMA 1NSFA 2KHHA 1IXSA 5EP2A 3L26A 1G71A 1BVSA 1GJTA 2D7GA 3F92A 3GQ3A 1DO2A 1OTRA 4D81A 4DUZM 2DAGA 3B89A 3VDUA 2G3QA 4G4OA 2QBYB 4IJEA 1Q39A 4G4RA 3AJIB 1CUKA 5KPTA 3GQ5A 4AG5A 1L2BA 4BBAA 4RF0A 2EKKA 2JA2A 2XZFA
chains in the Genus database with same CATH topology
4RKUF 2WSEF 3LW5F 4L6V6 2WSFF 4Y28F 4KT0F 2WSCF 5L8RF 1JB0F 4XK8F 2O01F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKU F;  2WSE F;  3LW5 F;  4L6V 6;  2WSF F;  4Y28 F;  4KT0 F;  2WSC F;  5L8R F;  1JB0 F;  4XK8 F;  2O01 F; 
#chains in the Genus database with same CATH topology
 3AOE A;  4GC5 A;  3FTF A;  2L09 A;  2O25 A;  2XFT A;  1C1K A;  2JWS A;  3QYE A;  5E6J A;  4M9Z A;  4MH0 E;  4GHA A;  1E94 E;  1QZE A;  4JI8 M;  3EIE A;  2I7N A;  2QHO B;  4LFA M;  4KHP M;  3FKE A;  3KXE C;  2A5Y B;  3PVS A;  4QHT A;  3GLF B;  1TTE A;  1X37 A;  3U6E A;  3I51 A;  4KO8 A;  3AKZ A;  1EIJ A;  4AZF A;  2BJW A;  3LQR A;  2F5S A;  4MGH A;  3HZJ A;  3W68 A;  5ITU A;  1IN4 A;  3B7N A;  3KS8 A;  4DR6 M;  2CFO A;  4IJF A;  3Q8G A;  1I4W A;  2YFQ A;  1XMO M;  3IEC A;  3SAV A;  3GLH A;  1MN3 A;  2L7H A;  1LTM A;  4LCB A;  1R2Y A;  1I94 M;  1T43 A;  3RGP A;  5L8R F;  1PJJ A;  4NC6 A;  2RGH A;  1NV9 A;  3SAU A;  3R9X B;  1OJL A;  2APL A;  2MH8 A;  2J7N A;  2VF7 A;  3HHY A;  3VKH A;  1G4A E;  2Y0Q A;  1Q3C A;  3FUW A;  1OFH A;  2DWZ B;  4ANR A;  4DV2 M;  4KT0 F;  1PJI A;  2Z8Y M;  3NWL A;  1A5T A;  5FTK A;  4MGK E;  4NRW A;  4DUY M;  1H6U A;  2ZBK B;  3FYC A;  3MHV C;  1NO1 A;  2JUJ A;  3L27 A;  3QAU A;  1N36 M;  3A45 A;  1TH4 A;  4F1I A;  2Z4R A;  3E21 A;  4I4L A;  2AHM A;  2XEP A;  1NJF A;  5A2Q S;  2GQF A;  2CHG A;  1IBK M;  3SC3 A;  2HHH M;  1IY1 A;  2KRU A;  1G3I A;  1NY5 A;  1R2Z A;  4A3V B;  1N33 M;  2BNK A;  1KSF X;  3DA1 A;  1HQY E;  1ZMV A;  1QAN A;  5IZ7 D;  3K9P A;  3C58 A;  1QQW A;  1DO0 A;  3B7Q A;  1JQJ C;  2QP9 X;  4LRS A;  3KW6 A;  2V6Z M;  2QSF X;  1NHW C;  3FD9 A;  4DV1 M;  2JY7 A;  4LFB M;  4JI3 M;  2JXN A;  3FUU A;  3J7B A;  2OOB A;  4LZJ A;  1G59 A;  4DR3 M;  1IXR C;  1Z5C A;  3J7A S;  2J7O A;  4B7H A;  1S3S A;  4GIT A;  4L6V 6;  4LF8 M;  2M60 A;  4GH9 A;  4IIW A;  3WHK A;  2DHY A;  3U6D A;  1OAI A;  3KP0 E;  3THG A;  4LF7 M;  3TWL A;  4WP2 A;  1TDZ A;  3T38 A;  2YNM D;  4DV4 M;  3U6M A;  3GRV A;  3HY5 A;  1ZAE A;  2R0I A;  5DFL A;  2F5O A;  2FH0 A;  3FYD A;  2W82 A;  2Y20 A;  4L16 A;  2CUZ A;  1QUS A;  3GPP A;  2LVO C;  2JY5 A;  2JY6 B;  1XNR M;  7CAT A;  1JR3 D;  1SXJ D;  1PJQ A;  5E26 A;  4PCZ A;  2O01 F;  2C5R A;  3VFD A;  4OU7 A;  1VG5 A;  1HJP A;  5ITR A;  3SYK A;  3U6P A;  4MGZ E;  5FTL A;  1HR0 M;  5DYI A;  2L6O A;  3FTE A;  4D82 A;  1VEJ A;  4L15 A;  5DYG A;  2EA0 A;  2R65 A;  4Z8X A;  3GO8 A;  1IM2 A;  4HL4 A;  1D0L A;  2H1R A;  3RE8 A;  1WR1 B;  3U60 A;  2MR9 A;  3KVW A;  3KOZ E;  2XGN A;  2MJ5 B;  2HKJ A;  4LJ9 A;  3SAT A;  1FJG M;  2KRK A;  2OQ4 A;  2C9O A;  4QHS A;  3PFI A;  3GLI A;  4B7F A;  3H4M A;  3LCU A;  2D7E A;  1Z5A A;  2DEN A;  1VEG A;  3C3D A;  3GRU A;  3M7G A;  3FRH A;  2R44 A;  1QUT A;  2OOA A;  2ZTD A;  3HX3 A;  2LVP C;  4MM3 B;  1QDR A;  5FTJ A;  3C3E A;  4X66 M;  1J5E M;  4Z6Y A;  1AIP C;  2CEA A;  3RFW A;  5ITX E;  4LRT A;  1VDL A;  4NRV A;  4RF1 A;  3GLG A;  4G4Q A;  4DV0 M;  2CV2 A;  5FTN A;  3HHW A;  2QQ8 A;  3A42 A;  2UUC M;  1PRB A;  1XXH E;  1PJS A;  3D8B A;  2DWN A;  2K47 A;  4NOO B;  3U6L A;  3K92 A;  3SHG B;  3K1J A;  3GPX A;  1GL6 A;  4IBF A;  1E32 A;  1IY0 A;  2HCB A;  2F5P A;  4GMQ A;  1PJT A;  3FUX A;  1IN6 A;  2VII A;  3U6Q A;  4IBJ A;  1Z5B A;  2V1C A;  1DGG A;  2XSZ A;  2ZAO A;  1YE9 A;  2R18 A;  3I01 M;  2X4A A;  1WJ7 A;  2EJS A;  2ZAM A;  1K3W A;  2F5N A;  2XLJ A;  4GKJ M;  2B3T A;  2KNA A;  2KZS A;  3L28 A;  4HLQ A;  1GLN A;  2KEB A;  5ITY A;  3I04 M;  1XHB A;  1IBM M;  4FD2 A;  2L4F A;  4KLN A;  4LJ6 A;  3UJN A;  1JR3 E;  1DGB A;  1SXJ E;  1Z59 A;  2BWE A;  2DZL A;  3VK7 A;  1ZMU A;  1R7R A;  3HKP A;  4PDG A;  4LF9 M;  2OO9 A;  3CF0 A;  3AOG A;  1MU5 A;  2Z7J A;  4LF6 M;  3M0E A;  4XK8 F;  3U61 A;  3HGI A;  3FTC A;  4AKG A;  1W5S A;  2LVQ D;  2RGO A;  2DAM A;  1P3Q Q;  5KQD A;  1VEK A;  1XXH B;  3I4V A;  3DOA A;  3GRR A;  4AKH A;  4IBB A;  4PD2 A;  4X65 M;  2UXC M;  3U5Z B;  4CJ6 A;  2N35 A;  2YQZ A;  1YUB A;  5ITQ A;  1TGU A;  2P5T A;  3L25 A;  3HU3 A;  1D0M A;  5IRE B;  1TH3 A;  4LF5 M;  4L8R C;  2ZTC A;  2CHQ A;  1NNJ A;  1D0K A;  2H5X A;  2HAK A;  4JYA M;  4I81 A;  3HJS A;  4P16 A;  2FOI C;  4D80 A;  2UXD M;  4FWD A;  3TPZ A;  3IHP A;  3J81 S;  2FS1 A;  2L7I A;  4S12 A;  3ZH9 B;  1NHG C;  4JI6 M;  1GL7 A;  5C18 A;  4TUW A;  3RGS A;  5F3W A;  4OVZ B;  2UUA M;  4L78 A;  1SXJ B;  5DNY A;  1QZM A;  2Q2E B;  1OQY A;  1UFZ A;  4AI6 A;  1Z6T A;  4MB7 A;  1L2C A;  4X62 M;  1XNQ M;  4XGI A;  4CIS A;  1DGH B;  4HEO A;  4GC9 A;  3U6S A;  2BWB A;  3FTD A;  4JI1 M;  1IXS B;  4R3D A;  2C98 A;  2LNH C;  3EIH A;  3U6C A;  4PDI A;  1SG9 A;  3QWL A;  2CRU A;  3KOX E;  4QOS A;  1D2N A;  3FE3 A;  2F4V M;  4DBG B;  4YY3 M;  3TWK A;  3SBJ A;  5BR8 M;  3SYL A;  1TH2 A;  1WHC A;  1GVN A;  3GLH E;  5IT9 S;  3GQ4 A;  2QEN A;  4B7G A;  3VK8 A;  4QNR A;  2EKF A;  3K8Z A;  3LVV A;  1NNU C;  3KP1 E;  5EP3 A;  4NXN M;  2KZU A;  5JI3 E;  3Q8X A;  2UU9 M;  2QBY A;  1V33 A;  1NVM A;  3AV0 A;  1RU3 A;  2NQ8 C;  4EIW A;  4DR2 M;  2G5G X;  4DV5 M;  5EP4 A;  1HQC A;  1J7K A;  1HNX M;  3HU1 A;  3LCV B;  2VQE M;  1IY2 A;  1J09 A;  1VDD A;  2QCU A;  1SXJ C;  1MX0 A;  3C9P A;  4W5W A;  2VDB B;  2YR0 A;  4G4N A;  2R4J A;  2J5Y A;  5EJC A;  4DR7 M;  4IBD A;  1FNN A;  1QDT A;  2LVN C;  3L29 A;  4FWG A;  5KPZ A;  2DWL A;  1OIZ A;  2C9C A;  2K0B X;  1NY6 A;  4OW0 A;  3PNY A;  4FCW A;  4NXM M;  1Q3B A;  1YLA A;  1TF0 B;  3GLF A;  4LJ7 A;  2V1U A;  3D8L A;  5KPR A;  2WSE F;  4LJ4 A;  2GNO A;  2JZ0 A;  4Y28 F;  4P17 A;  4R7G A;  3SFZ A;  3MK6 A;  3GLH B;  4M0W A;  1L8Q A;  2X8A A;  4RKU F;  2KNV A;  4DR1 M;  1OAO C;  2KDL A;  2UUB M;  3NBI A;  3DZD A;  2L2D A;  2R62 A;  4IBK A;  4R71 A;  1E9S A;  1IFY A;  4AG6 A;  3AOE C;  3K9O A;  3V76 A;  2ERC A;  2DVW B;  1V92 A;  2EO2 A;  3E46 A;  3U6O A;  2RKO A;  4B3T M;  4B3R M;  2QZ4 A;  1PM5 A;  2CV0 A;  3W0F A;  5H37 D;  2LXE A;  3W0L B;  3OTO M;  3J2P B;  2ZM6 M;  3M6A A;  1TDH A;  3KSJ A;  4XBO A;  2M5Z A;  2Y21 A;  2FNA A;  2OPF A;  1OKS A;  4FW9 A;  4IBC A;  3MMP A;  4Q7J A;  4JI7 M;  1IN7 A;  1WXQ A;  2G8L A;  4GKK M;  3ILK A;  2XF3 A;  4I5S A;  4BB9 A;  2LBC A;  1EE8 A;  1OIP A;  2XSZ D;  2DWM A;  4M9X A;  1YSY A;  2WSF F;  2VF8 A;  1Q02 A;  3KDS E;  4IBI A;  4LJ5 A;  4AW4 A;  3GP1 A;  1N78 A;  2XH9 A;  3LQQ A;  4K0K M;  2FFJ A;  4LJA A;  4LG2 A;  2CE7 A;  2LVA A;  1E9R A;  2DAK A;  2WSC F;  4CIZ A;  2X49 A;  4FVM A;  5FTM A;  2LHG A;  1HT2 E;  2C99 A;  1GKI A;  2O5R A;  3BXW A;  3HHZ A;  4OX9 M;  2JP7 A;  2DAE A;  2LTU A;  5BPV A;  4JXJ A;  3B9P A;  4NSR A;  4QNM A;  4CHT B;  4ZPX A;  2KA6 B;  1R4G A;  2DZN B;  2DZO B;  3TQS A;  1ZV1 A;  4GIP A;  5FSW A;  4KOD A;  1GAB A;  2D7H A;  2Z3X A;  2BJV A;  4I8O A;  4IBG A;  5EXX A;  3GLI E;  4NSO B;  2E5L M;  3SAR A;  4LY6 A;  1XWI A;  4REZ A;  4DR4 M;  4DV7 M;  1AUA A;  3KFU G;  5C1B A;  3SHF A;  3T15 A;  3VDP A;  3DFZ A;  1DV0 A;  1TR8 A;  2DI0 A;  3KS4 A;  3VLF B;  4M0D A;  3ZC7 B;  1IBL M;  1WGN A;  2DNA A;  3KOY E;  2CWB A;  3SAW A;  3I4Y A;  3ZQJ A;  2F5Q A;  2JZ1 A;  3PNV A;  3GLG E;  2K9D A;  3JR5 A;  2CP8 A;  4LZZ A;  2DAI A;  2WZJ A;  3BBZ A;  2KXE A;  2LHC A;  3AL0 C;  1EFU B;  4MGI E;  2DKL A;  1HNW M;  3U60 B;  4JN6 A;  3MJ5 A;  1L2D A;  5FLX S;  5EQT A;  1VQ1 A;  4GEW A;  3JR4 A;  4M9S A;  2R4E A;  2VQF M;  3NBX X;  3ZCB B;  1OFI A;  3GLI B;  2L4E A;  4CGY B;  3T1Y M;  2MGW A;  4G3O A;  4IBE A;  1QVR A;  2RRU A;  2XFS A;  3IG5 A;  2HWJ A;  5EP1 A;  3R8F A;  2R45 A;  3TL4 X;  1G41 A;  3B74 A;  1R5L A;  4FWH A;  4FCT A;  2DXI A;  4GRI A;  3LVW A;  4RNA A;  2R6F A;  1WGL A;  4FCV A;  1IN8 A;  3T6P A;  1GO5 A;  3GLG B;  4G6Z A;  4AKI A;  1HT1 E;  4WW0 A;  1ORY B;  5GKN A;  5LMU M;  4L4U A;  3T1H M;  3HJQ A;  1DGF A;  2LWX A;  3KSX A;  4LF4 M;  3SMP A;  1KYI A;  5ITT A;  4X64 M;  3CGW A;  3UZU A;  3CF6 E;  3SMS A;  1K82 A;  1L1T A;  1K3X A;  8CAT A;  4ITQ A;  3B7Z A;  3L2A A;  1LV7 A;  4II7 A;  5KO3 A;  2I7P A;  1T3T A;  1WIV A;  3GRY A;  3HWS A;  3VKG A;  2KNZ A;  2JNH A;  4F2L A;  4B3S M;  3CF2 A;  4B3M M;  1T6O A;  4YHH M;  1XB2 B;  3FRI A;  3LMM A;  4B08 A;  1NJG A;  1N34 M;  2ZAN A;  3K2L A;  1C7Y A;  4JI5 M;  4JV5 M;  1XMQ M;  1JB0 F;  4WUR A;  4JI0 M;  3UGJ A;  2CV1 A;  3J80 S;  1F4I A;  4GHL A;  1L1Z A;  3H4J A;  3U61 B;  2MRO B;  4DV6 M;  1UM8 A;  5ITX A;  3PXG A;  1XC8 A;  1HNZ M;  4QOZ C;  3BOS A;  3UMM A;  3GPU A;  4LJ8 A;  3AFH A;  5JI2 E;  2Y0T A;  1NV8 A;  3E9S A;  3HHX A;  1MJG M;  2JY8 A;  1ZMW A;  2QNJ A;  1R6B X;  3FUT A;  4PT5 A;  3A98 B;  3WHL A;  1XXH A;  2K6B A;  4UN2 B;  5EXS A;  4NL4 H;  4BLC A;  3LW5 F;  1N75 A;  2C96 A;  5KQ8 A;  3HU2 A;  3CTW B;  3QYB A;  3TE6 A;  3GPY A;  3U5Z A;  4MGY E;  3FUV A;  3TWM A;  1N32 M;  4LGY A;  1ZQ9 A;  4AQY M;  3E4R A;  3HJ8 A;  3A46 A;  2FE8 A;  1W5T A;  2HL7 A;  1Y8G A;  4JI4 M;  1IQP A;  3IG8 A;  3KOW E;  2XZU A;  1GJS A;  1QAQ A;  5LMN M;  1QAM A;  1KFV A;  2CHV A;  2QPA A;  4DR5 M;  3JAM S;  4JI2 M;  4LFC M;  4OVZ A;  2EUC A;  2UXB M;  2Z4S A;  3J27 B;  1JR3 A;  1SXJ A;  2R46 A;  1G8P A;  3UK6 A;  1PGY A;  2DHR A;  5EXP A;  2LH0 A;  1V34 A;  5IWA M;  1QYR A;  2KW0 A;  4DV3 M;  3GLF E;  1DGH A;  1IN5 A;  5EXT A;  1QAO A;  1N77 A;  3W67 A;  1IXZ A;  3SAS A;  4LGM A;  1NSF A;  2KHH A;  1IXS A;  5EP2 A;  3L26 A;  1G71 A;  1BVS A;  1GJT A;  2D7G A;  3F92 A;  3GQ3 A;  1DO2 A;  1OTR A;  4D81 A;  4DUZ M;  2DAG A;  3B89 A;  3VDU A;  2G3Q A;  4G4O A;  2QBY B;  4IJE A;  1Q39 A;  4G4R A;  3AJI B;  1CUK A;  5KPT A;  3GQ5 A;  4AG5 A;  1L2B A;  4BBA A;  4RF0 A;  2EKK A;  2JA2 A;  2XZF A; 
#chains in the Genus database with same CATH homology
 4RKU F;  2WSE F;  3LW5 F;  4L6V 6;  2WSF F;  4Y28 F;  4KT0 F;  2WSC F;  5L8R F;  1JB0 F;  4XK8 F;  2O01 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...