3LW5F

Improved model of plant photosystem i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 19
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2010-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 3lw5F00
2WSEF 1JB0F 2WSCF 2WSFF 4KT0F 2O01F 4Y28F 3LW5F 4XK8F 5L8RF 4L6V6 4RKUF
chains in the Genus database with same CATH superfamily
3TWKA 3AOGA 4AG5A 3RFWA 4GKKM 2B3TA 3EIEA 1XXHE 2APLA 1IXSB 1PGYA 4L16A 3UGJA 5KPRA 2R45A 3TWMA 2LH0A 1E9SA 3VKHA 3FYCA 2DAKA 3KXEC 2CHGA 4RKUF 1IBKM 3BBZA 4NC6A 4JI3M 3LCUA 1VEKA 1PJQA 5ITQA 4MB7A 1SXJA 1PJTA 2R6FA 3HHXA 3W0LB 2G3QA 4CGYB 1NHGC 2Z4RA 4Q7JA 3ZC7B 2DWNA 4L15A 3KOXE 2N35A 1KSFX 2KNAA 3FYDA 1NJFA 2KNVA 1C7YA 1GABA 4GC9A 4B7FA 3GPPA 4AI6A 3NWLA 2CV0A 3HWSA 3CF0A 2KZSA 3HKPA 2EKKA 3L28A 2VQEM 1L2BA 3AOEC 3U61A 3SHFA 1I4WA 2KW0A 4DV0M 1J7KA 3I4VA 1G59A 5FTNA 1XNQM 3GLFA 1EIJA 1QDRA 4P17A 5H37D 3KW6A 2K0BX 3B74A 2YFQA 3IHPA 1DGHA 2DAIA 1XXHB 4FWHA 4GRIA 3MJ5A 1VQ1A 1W5SA 1TGUA 5EP3A 2CP8A 3IG5A 4YY3M 1R7RA 1TDHA 5IREB 2XSZA 3L27A 4LF4M 1V92A 4I4LA 2LVOC 1A5TA 3F92A 1Q02A 1UFZA 4CISA 5EP1A 2DWZB 2ZAMA 3FUTA 4F1IA 2V1CA 2X49A 3DA1A 1VDLA 1HNZM 3QWLA 3L25A 4GC5A 5FTKA 1GLNA 1E32A 4IBIA 3D8BA 3GLGE 3L2AA 2J7OA 4IJFA 2HHHM 3W68A 3GLIE 3K9PA 1PJJA 2QBYB 1AIPC 2CFOA 3GP1A 4IBDA 4EIWA 4G4NA 3KOYE 1OQYA 3LW5F 4LZZA 1G3IA 2ZBKB 4DR3M 1HQYE 2M5ZA 2XH9A 3HU3A 4IBGA 1N75A 3HGIA 1K3XA 4W5WA 3KS8A 1OAOC 1IQPA 1NVMA 1QZEA 2KRUA 1N32M 4OU7A 3B7NA 4JI2M 4LF6M 3A46A 2L6OA 4IBBA 1DO2A 2RKOA 3FTDA 3FUXA 3U6QA 1WGNA 1G8PA 3SC3A 1TR8A 4GH9A 3T6PA 2XFSA 2K47A 3FTCA 5DYGA 3GRYA 5FSWA 1VG5A 8CATA 1IM2A 3HJ8A 2DAMA 1YSYA 4II7A 4UN2B 2OOBA 4KHPM 5LMNM 1SXJC 5EXXA 1XMOM 4DV5M 2OQ4A 3GPXA 4GITA 2L4EA 3KVWA 4GIPA 1NY5A 2EO2A 5JI3E 4LF8M 3JR4A 2G5GX 3I04M 4BB9A 1NSFA 2Y0TA 3SARA 4LJ9A 1Q3CA 1BVSA 3U6MA 1DO0A 1KYIA 3U5ZA 4REZA 1IN5A 1N33M 4X66M 1T43A 1SXJD 1SXJE 2H1RA 3HJQA 4LFBM 2Z8YM 4B7HA 4M9ZA 4WW0A 2O5RA 4NOOB 1NO1A 1Z59A 1VEGA 2C96A 2AHMA 3EIHA 4A3VB 1T3TA 2L4FA 3K92A 3HHYA 3E21A 1UM8A 2QQ8A 2V6ZM 1YUBA 4FVMA 4FD2A 1Q3BA 1D0KA 2K6BA 2X8AA 4FCWA 3A42A 1OIZA 1QVRA 2Z7JA 2HWJA 3J2PB 4FCVA 3L26A 2XF3A 3V76A 5KQDA 1FJGM 2JY8A 1IY2A 4D81A 2VF8A 4LJAA 2EUCA 1NV9A 4KT0F 3IECA 1QAQA 4LY6A 1XWIA 3VDUA 3RGPA 3GLHB 2LTUA 3SYKA 2DXIA 4JI5M 2WSFF 1IN8A 1H6UA 3LQRA 3U5ZB 2RGOA 1I94M 1ZAEA 2RGHA 5EP2A 3A98B 3GLFE 4AG6A 2KXEA 3D8LA 4MM3B 4NSRA 3KOWE 4IJEA 1QZMA 1F4IA 2CE7A 1IFYA 1ZQ9A 2R18A 1SXJB 3HHZA 1Z5AA 3BXWA 2DVWB 3WHLA 5ITRA 3SAUA 4Z8XA 1RU3A 3TPZA 3FRIA 3AOEA 1V33A 1IY1A 3PNVA 3FD9A 3NBXX 1XB2B 1NHWC 1NY6A 3LVWA 4BLCA 2VDBB 3PXGA 4L6V6 3OTOM 2LVAA 4B08A 4AKHA 1PJSA 1R4GA 1Y8GA 4GKJM 1L8QA 1NJGA 4LJ5A 2GNOA 3TWLA 1N78A 4G3OA 4LJ7A 4X65M 1DGBA 2LVPC 4FWGA 1OIPA 4IBKA 4L78A 4FW9A 3K2LA 2VIIA 3J7BA 4FCTA 4QNRA 3PVSA 4D80A 1L2CA 3FTFA 5E6JA 2KEBA 2LVQD 2JY7A 5C1BA 2UUBM 4B3TM 2ZANA 4LF7M 1MN3A 3LCVB 4HEOA 2OPFA 4HLQA 1PRBA 1ZMUA 2D7EA 4X64M 1DV0A 2EJSA 2VF7A 3SFZA 2JXNA 3MHVC 1ZMVA 3QYEA 1G4AE 4M0DA 1E9RA 3GLGA 1W5TA 4G4OA 4AZFA 4G6ZA 2ZTDA 3KOZE 3SAVA 2L7IA 4JI6M 4PDGA 3GQ4A 5EP4A 3K1JA 2OO9A 3U6LA 1L1TA 4TUWA 2YQZA 5FTMA 1V34A 3VLFB 1N34M 3GLHA 3U6PA 2OOAA 2P5TA 1IY0A 4LF9M 2JWSA 3ILKA 4MGYE 2KZUA 2D7GA 1HNWM 4DV4M 1HT1E 2WZJA 3MMPA 4I81A 2F5QA 2QENA 4CJ6A 5ITXA 3HU2A 3UK6A 1N77A 2C99A 3KDSE 1AUAA 4XGIA 2R62A 3U6CA 4AKGA 4GHAA 5C18A 4ITQA 7CATA 4IBCA 4PT5A 3SHGB 4PCZA 1KFVA 4JV5M 4QNMA 1WGLA 2HKJA 2R0IA 2R44A 3QYBA 3GRUA 3H4MA 4OW0A 4DR7M 1GKIA 2MGWA 4B3SM 1PM5A 4DV6M 3VDPA 1E94E 4AKIA 3HHWA 4NXNM 4S12A 4WP2A 3PNYA 3FTEA 1J09A 5ITUA 2Z3XA 1NNJA 3AL0C 4OVZB 1QYRA 1XXHA 1D0MA 2RRUA 3GPYA 3L29A 4MGIE 4DV1M 3GRRA 2LHGA 4DR6M 2Z4SA 4KO8A 1R2YA 3Q8GA 4MGHA 1JB0F 3H4JA 1TDZA 3AFHA 3HX3A 2DAGA 4IIWA 3LVVA 2LHCA 2G8LA 3DFZA 3PFIA 4LJ4A 2ZTCA 2O25A 3WHKA 1X37A 2HCBA 1IBLM 2V1UA 2HAKA 4B3MM 3THGA 4CIZA 4DV2M 3U61B 1TH3A 3FUVA 3TE6A 2E5LM 4GHLA 3RGSA 1L1ZA 1R5LA 2HL7A 3SATA 1Z5BA 3HY5A 3T1YM 4GEWA 4MGZE 4NL4H 4B3RM 1GL6A 3J27B 2KDLA 2CRUA 3M0EA 3T38A 4JYAM 1IN4A 2O01F 1XNRM 3U60B 4L4UA 3GLIB 1XHBA 4XBOA 4JI0M 2F5PA 5FLXS 2CWBA 2L7HA 2FOIC 2LBCA 1XC8A 1K82A 4DBGB 4LCBA 2KHHA 3R8FA 3UJNA 3AJIB 2JZ0A 3GLFB 5DNYA 1DGGA 4R7GA 1JR3E 2CUZA 2K9DA 5KO3A 1JR3D 1QDTA 3KP0E 4R3DA 3VFDA 1ZMWA 4JI8M 4LJ8A 2C9OA 5JI2E 3Q8XA 2Y20A 4JN6A 5DFLA 1TH2A 4JI1M 4DR4M 1OFIA 2DHYA 2BWEA 4QOSA 2DWLA 1IBMM 1JQJC 2DZOB 4LFAM 1G71A 1VDDA 4LJ6A 1EE8A 1JR3A 3ZH9B 4LGYA 3E4RA 2A5YB 1Q39A 1ORYB 3FUUA 1DGFA 3QAUA 1WXQA 1HQCA 2FH0A 4NXMM 4QOZC 2MR9A 4QHSA 2LXEA 3AV0A 2JY6B 2R4JA 1OTRA 1HR0M 3M6AA 3GLIA 2YNMD 5DYIA 1GVNA 3JR5A 3FKEA 2UU9M 4X62M 3SAWA 1L2DA 2QSFX 4DV7M 3U6DA 2DI0A 4FWDA 3VK8A 1YLAA 2EA0A 3VK7A 2M60A 2Q2EB 2XSZD 4R71A 2FE8A 5EXTA 4JI4M 3K9OA 1D2NA 1ZV1A 4M0WA 3M7GA 3HZJA 2ZM6M 4LZJA 4G4RA 2F5SA 4OX9M 2I7NA 4B7GA 3C58A 4M9XA 3KP1E 4IBEA 4DUZM 2GQFA 3SASA 4JXJA 1MX0A 4M9SA 1WR1B 1YE9A 2QPAA 2F5OA 3FUWA 2XLJA 3SBJA 3KFUG 4LFCM 1WJ7A 4GMQA 3FE3A 2DAEA 4OVZA 1GO5A 3U6SA 4LF5M 4NSOB 2XZFA 5EJCA 2C9CA 5IZ7D 1P3QQ 4D82A 3U60A 2H5XA 2R46A 1MU5A 5KPTA 2F5NA 1T6OA 4QHTA 4P16A 3TQSA 5FTLA 3HJSA 4NRWA 1QAMA 4K0KM 4DUYM 4ZPXA 2CEAA 3DZDA 3HU1A 4NRVA 3VKGA 5FTJA 4CHTB 5KPZA 2UUCM 4YHHM 2EKFA 2XGNA 1QUTA 5A2QS 2C98A 1WHCA 1EFUB 2JY5A 2D7HA 2LNHC 2R4EA 4I8OA 1NV8A 3ZQJA 3UMMA 2ERCA 5F3WA 3A45A 1D0LA 2FFJA 5ITTA 2L09A 2FS1A 2QHOB 1OJLA 2MJ5B 1Z5CA 1OAIA 2JNHA 3B7ZA 3T15A 4L8RC 2F4VM 2UXBM 2QZ4A 3J80S 1GJTA 1LTMA 2FNAA 4MH0E 4Z6YA 2ZAOA 4WURA 3I4YA 4RF1A 2QBYA 4PD2A 3U6EA 4IBJA 4Y28F 4XK8F 2DENA 2KRKA 3E46A 3GRVA 1VEJA 1LV7A 2DZNB 2BNKA 5ITXE 4LRSA 2VQFM 2LWXA 2J7NA 2Y21A 3CGWA 4MGKE 3LMMA 1OKSA 1NNUC 3T1HM 3W67A 2WSEF 3BOSA 3GPUA 1CUKA 3GLHE 3E9SA 5EXPA 1DGHB 5EQTA 2CV1A 2BWBA 3I51A 1WIVA 3GQ3A 3LQQA 2BJWA 2DZLA 3CTWB 3C3EA 1IN7A 4IBFA 3SMPA 3C3DA 1PJIA 1J5EM 2UXDM 3KS4A 1GL7A 2DKLA 2DWMA 1C1KA 3R9XB 1OFHA 1S3SA 1N36M 3GO8A 3TL4X 3ZCBB 5KQ8A 4DV3M 2JA2A 4PDIA 1TF0B 1QQWA 5E26A 1Z6TA 2MH8A 1HJPA 3B89A 5EXSA 5IWAM 2C5RA 1K3WA 3K8ZA 4LGMA 2KNZA 3DOAA 3KSJA 3J81S 3GLGB 1XMQM 2MROB 2X4AA 5GKNA 1MJGM 3B9PA 4DR2M 4I5SA 3UZUA 2JZ1A 4F2LA 4G4QA 2CHQA 5L8RF 2CV2A 4KLNA 4JI7M 4KODA 3NBIA 2QNJA 1QAOA 1SG9A 4DR5M 1R6BX 4DR1M 1IXRC 1FNNA 4HL4A 2UXCM 2R65A 2W82A 2I7PA 2UUAM 1QANA 2L2DA 2XEPA 2YR0A 3C9PA 5BPVA 3AKZA 1IXSA 1TH4A 2LVNC 2JUJA 2XZUA 2DHRA 2J5YA 2XFTA 3CF6E 3B7QA 4RNAA 4ANRA 3KSXA 1G41A 2WSCF 2Y0QA 5BR8M 3IG8A 4LG2A 3SMSA 4BBAA 1IN6A 3W0FA 2QP9X 2CHVA 2JP7A 3JAMS 4RF0A 3J7AS 5ITYA 3U6OA 4LRTA 3SYLA 1GJSA 3GQ5A 1QUSA 2DNAA 1R2ZA 3FRHA 1TTEA 2NQ8C 3I01M 3CF2A 4AQYM 3RE8A 5IT9S 5LMUM 3MK6A 2KA6B 2QCUA 1HNXM 1HT2E 1IXZA 2BJVA 4AW4A
chains in the Genus database with same CATH topology
2WSEF 1JB0F 2WSCF 2WSFF 4KT0F 2O01F 4Y28F 3LW5F 4XK8F 5L8RF 4L6V6 4RKUF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE F;  1JB0 F;  2WSC F;  2WSF F;  4KT0 F;  2O01 F;  4Y28 F;  3LW5 F;  4XK8 F;  5L8R F;  4L6V 6;  4RKU F; 
#chains in the Genus database with same CATH topology
 3TWK A;  3AOG A;  4AG5 A;  3RFW A;  4GKK M;  2B3T A;  3EIE A;  1XXH E;  2APL A;  1IXS B;  1PGY A;  4L16 A;  3UGJ A;  5KPR A;  2R45 A;  3TWM A;  2LH0 A;  1E9S A;  3VKH A;  3FYC A;  2DAK A;  3KXE C;  2CHG A;  4RKU F;  1IBK M;  3BBZ A;  4NC6 A;  4JI3 M;  3LCU A;  1VEK A;  1PJQ A;  5ITQ A;  4MB7 A;  1SXJ A;  1PJT A;  2R6F A;  3HHX A;  3W0L B;  2G3Q A;  4CGY B;  1NHG C;  2Z4R A;  4Q7J A;  3ZC7 B;  2DWN A;  4L15 A;  3KOX E;  2N35 A;  1KSF X;  2KNA A;  3FYD A;  1NJF A;  2KNV A;  1C7Y A;  1GAB A;  4GC9 A;  4B7F A;  3GPP A;  4AI6 A;  3NWL A;  2CV0 A;  3HWS A;  3CF0 A;  2KZS A;  3HKP A;  2EKK A;  3L28 A;  2VQE M;  1L2B A;  3AOE C;  3U61 A;  3SHF A;  1I4W A;  2KW0 A;  4DV0 M;  1J7K A;  3I4V A;  1G59 A;  5FTN A;  1XNQ M;  3GLF A;  1EIJ A;  1QDR A;  4P17 A;  5H37 D;  3KW6 A;  2K0B X;  3B74 A;  2YFQ A;  3IHP A;  1DGH A;  2DAI A;  1XXH B;  4FWH A;  4GRI A;  3MJ5 A;  1VQ1 A;  1W5S A;  1TGU A;  5EP3 A;  2CP8 A;  3IG5 A;  4YY3 M;  1R7R A;  1TDH A;  5IRE B;  2XSZ A;  3L27 A;  4LF4 M;  1V92 A;  4I4L A;  2LVO C;  1A5T A;  3F92 A;  1Q02 A;  1UFZ A;  4CIS A;  5EP1 A;  2DWZ B;  2ZAM A;  3FUT A;  4F1I A;  2V1C A;  2X49 A;  3DA1 A;  1VDL A;  1HNZ M;  3QWL A;  3L25 A;  4GC5 A;  5FTK A;  1GLN A;  1E32 A;  4IBI A;  3D8B A;  3GLG E;  3L2A A;  2J7O A;  4IJF A;  2HHH M;  3W68 A;  3GLI E;  3K9P A;  1PJJ A;  2QBY B;  1AIP C;  2CFO A;  3GP1 A;  4IBD A;  4EIW A;  4G4N A;  3KOY E;  1OQY A;  3LW5 F;  4LZZ A;  1G3I A;  2ZBK B;  4DR3 M;  1HQY E;  2M5Z A;  2XH9 A;  3HU3 A;  4IBG A;  1N75 A;  3HGI A;  1K3X A;  4W5W A;  3KS8 A;  1OAO C;  1IQP A;  1NVM A;  1QZE A;  2KRU A;  1N32 M;  4OU7 A;  3B7N A;  4JI2 M;  4LF6 M;  3A46 A;  2L6O A;  4IBB A;  1DO2 A;  2RKO A;  3FTD A;  3FUX A;  3U6Q A;  1WGN A;  1G8P A;  3SC3 A;  1TR8 A;  4GH9 A;  3T6P A;  2XFS A;  2K47 A;  3FTC A;  5DYG A;  3GRY A;  5FSW A;  1VG5 A;  8CAT A;  1IM2 A;  3HJ8 A;  2DAM A;  1YSY A;  4II7 A;  4UN2 B;  2OOB A;  4KHP M;  5LMN M;  1SXJ C;  5EXX A;  1XMO M;  4DV5 M;  2OQ4 A;  3GPX A;  4GIT A;  2L4E A;  3KVW A;  4GIP A;  1NY5 A;  2EO2 A;  5JI3 E;  4LF8 M;  3JR4 A;  2G5G X;  3I04 M;  4BB9 A;  1NSF A;  2Y0T A;  3SAR A;  4LJ9 A;  1Q3C A;  1BVS A;  3U6M A;  1DO0 A;  1KYI A;  3U5Z A;  4REZ A;  1IN5 A;  1N33 M;  4X66 M;  1T43 A;  1SXJ D;  1SXJ E;  2H1R A;  3HJQ A;  4LFB M;  2Z8Y M;  4B7H A;  4M9Z A;  4WW0 A;  2O5R A;  4NOO B;  1NO1 A;  1Z59 A;  1VEG A;  2C96 A;  2AHM A;  3EIH A;  4A3V B;  1T3T A;  2L4F A;  3K92 A;  3HHY A;  3E21 A;  1UM8 A;  2QQ8 A;  2V6Z M;  1YUB A;  4FVM A;  4FD2 A;  1Q3B A;  1D0K A;  2K6B A;  2X8A A;  4FCW A;  3A42 A;  1OIZ A;  1QVR A;  2Z7J A;  2HWJ A;  3J2P B;  4FCV A;  3L26 A;  2XF3 A;  3V76 A;  5KQD A;  1FJG M;  2JY8 A;  1IY2 A;  4D81 A;  2VF8 A;  4LJA A;  2EUC A;  1NV9 A;  4KT0 F;  3IEC A;  1QAQ A;  4LY6 A;  1XWI A;  3VDU A;  3RGP A;  3GLH B;  2LTU A;  3SYK A;  2DXI A;  4JI5 M;  2WSF F;  1IN8 A;  1H6U A;  3LQR A;  3U5Z B;  2RGO A;  1I94 M;  1ZAE A;  2RGH A;  5EP2 A;  3A98 B;  3GLF E;  4AG6 A;  2KXE A;  3D8L A;  4MM3 B;  4NSR A;  3KOW E;  4IJE A;  1QZM A;  1F4I A;  2CE7 A;  1IFY A;  1ZQ9 A;  2R18 A;  1SXJ B;  3HHZ A;  1Z5A A;  3BXW A;  2DVW B;  3WHL A;  5ITR A;  3SAU A;  4Z8X A;  1RU3 A;  3TPZ A;  3FRI A;  3AOE A;  1V33 A;  1IY1 A;  3PNV A;  3FD9 A;  3NBX X;  1XB2 B;  1NHW C;  1NY6 A;  3LVW A;  4BLC A;  2VDB B;  3PXG A;  4L6V 6;  3OTO M;  2LVA A;  4B08 A;  4AKH A;  1PJS A;  1R4G A;  1Y8G A;  4GKJ M;  1L8Q A;  1NJG A;  4LJ5 A;  2GNO A;  3TWL A;  1N78 A;  4G3O A;  4LJ7 A;  4X65 M;  1DGB A;  2LVP C;  4FWG A;  1OIP A;  4IBK A;  4L78 A;  4FW9 A;  3K2L A;  2VII A;  3J7B A;  4FCT A;  4QNR A;  3PVS A;  4D80 A;  1L2C A;  3FTF A;  5E6J A;  2KEB A;  2LVQ D;  2JY7 A;  5C1B A;  2UUB M;  4B3T M;  2ZAN A;  4LF7 M;  1MN3 A;  3LCV B;  4HEO A;  2OPF A;  4HLQ A;  1PRB A;  1ZMU A;  2D7E A;  4X64 M;  1DV0 A;  2EJS A;  2VF7 A;  3SFZ A;  2JXN A;  3MHV C;  1ZMV A;  3QYE A;  1G4A E;  4M0D A;  1E9R A;  3GLG A;  1W5T A;  4G4O A;  4AZF A;  4G6Z A;  2ZTD A;  3KOZ E;  3SAV A;  2L7I A;  4JI6 M;  4PDG A;  3GQ4 A;  5EP4 A;  3K1J A;  2OO9 A;  3U6L A;  1L1T A;  4TUW A;  2YQZ A;  5FTM A;  1V34 A;  3VLF B;  1N34 M;  3GLH A;  3U6P A;  2OOA A;  2P5T A;  1IY0 A;  4LF9 M;  2JWS A;  3ILK A;  4MGY E;  2KZU A;  2D7G A;  1HNW M;  4DV4 M;  1HT1 E;  2WZJ A;  3MMP A;  4I81 A;  2F5Q A;  2QEN A;  4CJ6 A;  5ITX A;  3HU2 A;  3UK6 A;  1N77 A;  2C99 A;  3KDS E;  1AUA A;  4XGI A;  2R62 A;  3U6C A;  4AKG A;  4GHA A;  5C18 A;  4ITQ A;  7CAT A;  4IBC A;  4PT5 A;  3SHG B;  4PCZ A;  1KFV A;  4JV5 M;  4QNM A;  1WGL A;  2HKJ A;  2R0I A;  2R44 A;  3QYB A;  3GRU A;  3H4M A;  4OW0 A;  4DR7 M;  1GKI A;  2MGW A;  4B3S M;  1PM5 A;  4DV6 M;  3VDP A;  1E94 E;  4AKI A;  3HHW A;  4NXN M;  4S12 A;  4WP2 A;  3PNY A;  3FTE A;  1J09 A;  5ITU A;  2Z3X A;  1NNJ A;  3AL0 C;  4OVZ B;  1QYR A;  1XXH A;  1D0M A;  2RRU A;  3GPY A;  3L29 A;  4MGI E;  4DV1 M;  3GRR A;  2LHG A;  4DR6 M;  2Z4S A;  4KO8 A;  1R2Y A;  3Q8G A;  4MGH A;  1JB0 F;  3H4J A;  1TDZ A;  3AFH A;  3HX3 A;  2DAG A;  4IIW A;  3LVV A;  2LHC A;  2G8L A;  3DFZ A;  3PFI A;  4LJ4 A;  2ZTC A;  2O25 A;  3WHK A;  1X37 A;  2HCB A;  1IBL M;  2V1U A;  2HAK A;  4B3M M;  3THG A;  4CIZ A;  4DV2 M;  3U61 B;  1TH3 A;  3FUV A;  3TE6 A;  2E5L M;  4GHL A;  3RGS A;  1L1Z A;  1R5L A;  2HL7 A;  3SAT A;  1Z5B A;  3HY5 A;  3T1Y M;  4GEW A;  4MGZ E;  4NL4 H;  4B3R M;  1GL6 A;  3J27 B;  2KDL A;  2CRU A;  3M0E A;  3T38 A;  4JYA M;  1IN4 A;  2O01 F;  1XNR M;  3U60 B;  4L4U A;  3GLI B;  1XHB A;  4XBO A;  4JI0 M;  2F5P A;  5FLX S;  2CWB A;  2L7H A;  2FOI C;  2LBC A;  1XC8 A;  1K82 A;  4DBG B;  4LCB A;  2KHH A;  3R8F A;  3UJN A;  3AJI B;  2JZ0 A;  3GLF B;  5DNY A;  1DGG A;  4R7G A;  1JR3 E;  2CUZ A;  2K9D A;  5KO3 A;  1JR3 D;  1QDT A;  3KP0 E;  4R3D A;  3VFD A;  1ZMW A;  4JI8 M;  4LJ8 A;  2C9O A;  5JI2 E;  3Q8X A;  2Y20 A;  4JN6 A;  5DFL A;  1TH2 A;  4JI1 M;  4DR4 M;  1OFI A;  2DHY A;  2BWE A;  4QOS A;  2DWL A;  1IBM M;  1JQJ C;  2DZO B;  4LFA M;  1G71 A;  1VDD A;  4LJ6 A;  1EE8 A;  1JR3 A;  3ZH9 B;  4LGY A;  3E4R A;  2A5Y B;  1Q39 A;  1ORY B;  3FUU A;  1DGF A;  3QAU A;  1WXQ A;  1HQC A;  2FH0 A;  4NXM M;  4QOZ C;  2MR9 A;  4QHS A;  2LXE A;  3AV0 A;  2JY6 B;  2R4J A;  1OTR A;  1HR0 M;  3M6A A;  3GLI A;  2YNM D;  5DYI A;  1GVN A;  3JR5 A;  3FKE A;  2UU9 M;  4X62 M;  3SAW A;  1L2D A;  2QSF X;  4DV7 M;  3U6D A;  2DI0 A;  4FWD A;  3VK8 A;  1YLA A;  2EA0 A;  3VK7 A;  2M60 A;  2Q2E B;  2XSZ D;  4R71 A;  2FE8 A;  5EXT A;  4JI4 M;  3K9O A;  1D2N A;  1ZV1 A;  4M0W A;  3M7G A;  3HZJ A;  2ZM6 M;  4LZJ A;  4G4R A;  2F5S A;  4OX9 M;  2I7N A;  4B7G A;  3C58 A;  4M9X A;  3KP1 E;  4IBE A;  4DUZ M;  2GQF A;  3SAS A;  4JXJ A;  1MX0 A;  4M9S A;  1WR1 B;  1YE9 A;  2QPA A;  2F5O A;  3FUW A;  2XLJ A;  3SBJ A;  3KFU G;  4LFC M;  1WJ7 A;  4GMQ A;  3FE3 A;  2DAE A;  4OVZ A;  1GO5 A;  3U6S A;  4LF5 M;  4NSO B;  2XZF A;  5EJC A;  2C9C A;  5IZ7 D;  1P3Q Q;  4D82 A;  3U60 A;  2H5X A;  2R46 A;  1MU5 A;  5KPT A;  2F5N A;  1T6O A;  4QHT A;  4P16 A;  3TQS A;  5FTL A;  3HJS A;  4NRW A;  1QAM A;  4K0K M;  4DUY M;  4ZPX A;  2CEA A;  3DZD A;  3HU1 A;  4NRV A;  3VKG A;  5FTJ A;  4CHT B;  5KPZ A;  2UUC M;  4YHH M;  2EKF A;  2XGN A;  1QUT A;  5A2Q S;  2C98 A;  1WHC A;  1EFU B;  2JY5 A;  2D7H A;  2LNH C;  2R4E A;  4I8O A;  1NV8 A;  3ZQJ A;  3UMM A;  2ERC A;  5F3W A;  3A45 A;  1D0L A;  2FFJ A;  5ITT A;  2L09 A;  2FS1 A;  2QHO B;  1OJL A;  2MJ5 B;  1Z5C A;  1OAI A;  2JNH A;  3B7Z A;  3T15 A;  4L8R C;  2F4V M;  2UXB M;  2QZ4 A;  3J80 S;  1GJT A;  1LTM A;  2FNA A;  4MH0 E;  4Z6Y A;  2ZAO A;  4WUR A;  3I4Y A;  4RF1 A;  2QBY A;  4PD2 A;  3U6E A;  4IBJ A;  4Y28 F;  4XK8 F;  2DEN A;  2KRK A;  3E46 A;  3GRV A;  1VEJ A;  1LV7 A;  2DZN B;  2BNK A;  5ITX E;  4LRS A;  2VQF M;  2LWX A;  2J7N A;  2Y21 A;  3CGW A;  4MGK E;  3LMM A;  1OKS A;  1NNU C;  3T1H M;  3W67 A;  2WSE F;  3BOS A;  3GPU A;  1CUK A;  3GLH E;  3E9S A;  5EXP A;  1DGH B;  5EQT A;  2CV1 A;  2BWB A;  3I51 A;  1WIV A;  3GQ3 A;  3LQQ A;  2BJW A;  2DZL A;  3CTW B;  3C3E A;  1IN7 A;  4IBF A;  3SMP A;  3C3D A;  1PJI A;  1J5E M;  2UXD M;  3KS4 A;  1GL7 A;  2DKL A;  2DWM A;  1C1K A;  3R9X B;  1OFH A;  1S3S A;  1N36 M;  3GO8 A;  3TL4 X;  3ZCB B;  5KQ8 A;  4DV3 M;  2JA2 A;  4PDI A;  1TF0 B;  1QQW A;  5E26 A;  1Z6T A;  2MH8 A;  1HJP A;  3B89 A;  5EXS A;  5IWA M;  2C5R A;  1K3W A;  3K8Z A;  4LGM A;  2KNZ A;  3DOA A;  3KSJ A;  3J81 S;  3GLG B;  1XMQ M;  2MRO B;  2X4A A;  5GKN A;  1MJG M;  3B9P A;  4DR2 M;  4I5S A;  3UZU A;  2JZ1 A;  4F2L A;  4G4Q A;  2CHQ A;  5L8R F;  2CV2 A;  4KLN A;  4JI7 M;  4KOD A;  3NBI A;  2QNJ A;  1QAO A;  1SG9 A;  4DR5 M;  1R6B X;  4DR1 M;  1IXR C;  1FNN A;  4HL4 A;  2UXC M;  2R65 A;  2W82 A;  2I7P A;  2UUA M;  1QAN A;  2L2D A;  2XEP A;  2YR0 A;  3C9P A;  5BPV A;  3AKZ A;  1IXS A;  1TH4 A;  2LVN C;  2JUJ A;  2XZU A;  2DHR A;  2J5Y A;  2XFT A;  3CF6 E;  3B7Q A;  4RNA A;  4ANR A;  3KSX A;  1G41 A;  2WSC F;  2Y0Q A;  5BR8 M;  3IG8 A;  4LG2 A;  3SMS A;  4BBA A;  1IN6 A;  3W0F A;  2QP9 X;  2CHV A;  2JP7 A;  3JAM S;  4RF0 A;  3J7A S;  5ITY A;  3U6O A;  4LRT A;  3SYL A;  1GJS A;  3GQ5 A;  1QUS A;  2DNA A;  1R2Z A;  3FRH A;  1TTE A;  2NQ8 C;  3I01 M;  3CF2 A;  4AQY M;  3RE8 A;  5IT9 S;  5LMU M;  3MK6 A;  2KA6 B;  2QCU A;  1HNX M;  1HT2 E;  1IXZ A;  2BJV A;  4AW4 A; 
#chains in the Genus database with same CATH homology
 2WSE F;  1JB0 F;  2WSC F;  2WSF F;  4KT0 F;  2O01 F;  4Y28 F;  3LW5 F;  4XK8 F;  5L8R F;  4L6V 6;  4RKU F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...