3LW5F

Improved model of plant photosystem i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
molecule tags Photosynthesis
total genus 19
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2010-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 3lw5F00
2WSCF 2WSFF 3LW5F 4L6V6 5L8RF 2WSEF 4RKUF 4Y28F 1JB0F 4KT0F 4XK8F 2O01F
chains in the Genus database with same CATH superfamily
3FUVA 2HL7A 2LVAA 4FCTA 1J7KA 1E32A 1N32M 2XZUA 2R0IA 2Q2EB 2XGNA 5A2QS 5ITRA 5LMNM 5JI3E 5F3WA 3FTDA 4D82A 1XMQM 3U6SA 1PJTA 1RU3A 1SXJB 2MR9A 2R62A 1DGGA 4DR6M 1TH2A 2EJSA 2KEBA 2CP8A 2N35A 2O25A 4K0KM 1GO5A 4LRTA 4F1IA 1HNZM 2UXDM 3SAWA 2JZ1A 3ZCBB 1WGNA 2F5QA 1IQPA 2JNHA 3I01M 1NY5A 2L4EA 2L7HA 3FUWA 3LQQA 4LRSA 4XBOA 2VF8A 4IBBA 4BB9A 4D80A 5ITUA 2V1UA 4AG6A 3UJNA 1IY0A 1QDRA 2V6ZM 3RGSA 1D0KA 1VEJA 3PNYA 1XNQM 3T15A 3B7NA 1YE9A 1NO1A 1L2BA 2EUCA 1PGYA 2R46A 2DZNB 1L2DA 1YUBA 4LF7M 2F5NA 3KS4A 4CJ6A 1XB2B 3MJ5A 2DZOB 3GQ4A 4JV5M 4FWGA 3B9PA 1V92A 3TWMA 4AI6A 3IHPA 1NNJA 3AOEA 3RGPA 3UZUA 4JI6M 2YNMD 4Q7JA 5ITQA 1XXHA 3GRRA 4LJ7A 2Y0QA 1PM5A 3RE8A 2QHOB 3I51A 1N36M 2QPAA 4XK8F 2J7OA 3VLFB 2RGHA 5BPVA 1W5TA 1QYRA 4NOOB 3EIHA 5FSWA 2M60A 3CTWB 4QHTA 1OTRA 3L28A 4FWDA 2CV0A 1Z59A 2C99A 2JA2A 4IJFA 3FUUA 1N33M 2B3TA 3HX3A 1SG9A 5FTKA 3L25A 2QZ4A 3HU1A 4LFCM 5EQTA 1X37A 2CHQA 5ITYA 1G3IA 2JUJA 4LJ8A 5KO3A 3FYDA 4JI5M 2ZANA 1LV7A 2XFTA 3SHFA 4B08A 3U61A 1KFVA 2DWZB 3GO8A 1T3TA 3L29A 2LVOC 1IXRC 3L2AA 5C1BA 2E5LM 2G8LA 5E6JA 3JR5A 2CEAA 2MGWA 2MH8A 3GLHA 5BR8M 4AQYM 1QDTA 3K8ZA 4GEWA 2VIIA 2O01F 4PDGA 1GKIA 2K6BA 4DV3M 3HHXA 3U60A 3I04M 3J81S 1HT1E 4AG5A 3HU2A 3ILKA 3FKEA 1GL7A 2K0BX 2KNVA 3C9PA 4LY6A 3ZQJA 2F5OA 1XNRM 1ZMUA 2WSCF 2WSFF 4LF9M 2FE8A 1XHBA 5EXTA 4DBGB 4MGIE 7CATA 1IN7A 3BBZA 1ZV1A 3DA1A 5IWAM 2VDBB 4X62M 2LVNC 5EP3A 2BNKA 4QHSA 2EO2A 3CF2A 1MN3A 2KXEA 2CRUA 5FTJA 2Y20A 4IBDA 3HHYA 2X8AA 3GLHE 3T6PA 3U6CA 2KDLA 1CUKA 2J7NA 3F92A 3K2LA 5EP4A 3W68A 1TH4A 4GRIA 2HAKA 3GPXA 3GLGA 3U61B 1UFZA 4Y28F 1NJFA 2LBCA 1Z5AA 4ANRA 4NXNM 3KVWA 3FTFA 2MROB 3K9OA 3U5ZA 1T43A 4IBKA 2F4VM 1BVSA 4R3DA 3GLHB 1E94E 1SXJA 2D7GA 3J7BA 4DV0M 4JI7M 2DXIA 3EIEA 5C18A 2HKJA 1IY2A 4NSRA 1QUSA 4I5SA 4G4RA 4LG2A 4REZA 3SYKA 4MH0E 1JR3A 3DZDA 3IG5A 2J5YA 4NRWA 1QAQA 3M6AA 3AL0C 1GLNA 3RFWA 3KDSE 3HZJA 1LTMA 2XFSA 2ZBKB 3FUTA 4FD2A 1VEKA 2Z3XA 1WIVA 5FTLA 4DR1M 1N78A 1VEGA 3R9XB 1L1ZA 2RKOA 1K3WA 1MJGM 2KW0A 4AZFA 3GLGB 3VK8A 2ZAOA 1HQCA 3FRHA 3HY5A 1VDLA 1G8PA 2C9CA 2DAGA 3H4MA 3VDPA 3U6LA 1JR3E 2WSEF 3KOWE 3LCVB 3TWLA 3KXEC 2O5RA 5L8RF 5JI2E 3U5ZB 1I4WA 3VKHA 3KP1E 2ZTCA 4EIWA 2LTUA 1IBLM 2YQZA 3D8BA 1PJSA 2XH9A 3B74A 3K9PA 3SATA 3ZC7B 4CISA 4TUWA 3SHGB 4QOZC 4DUZM 4BLCA 4DV5M 1PRBA 2ZM6M 4B7FA 1DV0A 2DAEA 5EXSA 1QANA 3M7GA 1FJGM 4JI2M 1IXZA 1IFYA 3C58A 4B7HA 5LMUM 1J09A 3J80S 1D2NA 2D7HA 4GMQA 2W82A 3FYCA 1UM8A 5ITXE 2RGOA 2DKLA 3AFHA 1E9SA 4LCBA 2GQFA 2VQFM 2R44A 4WP2A 1EIJA 4FCVA 4NSOB 4M0DA 3K92A 4DV1M 4LF4M 4IBGA 4PCZA 1DO2A 4MM3B 2FOIC 1TR8A 1JQJC 3C3DA 2XSZD 3HJSA 2LVPC 5IREB 3FD9A 2CV1A 3U6DA 1G4AE 1C7YA 3FTEA 1N75A 4M9XA 1NHWC 3TL4X 5EXXA 1JB0F 2DVWB 3SYLA 3J2PB 2LHCA 1HNWM 3WHKA 1G41A 2LH0A 1OAOC 2QCUA 3HWSA 3KOXE 2HCBA 2Z4RA 3U6EA 2WZJA 2QSFX 4I8OA 4GKKM 3H4JA 3I4YA 2UXBM 4PD2A 5KPZA 3KOZE 3GPPA 2L09A 4KLNA 2G3QA 3B7QA 2X4AA 2QNJA 3KOYE 1IBKM 4G6ZA 1WJ7A 2MJ5B 4MB7A 1H6UA 5GKNA 4G4NA 4DR5M 4GIPA 4JI4M 1TDHA 1R6BX 2OPFA 1GJSA 3L26A 3SC3A 1IXSA 3QWLA 1TTEA 4BBAA 4GITA 4JN6A 3KFUG 2M5ZA 4IIWA 2VF7A 4OW0A 3CF6E 3KW6A 1R2YA 4G4OA 2L2DA 2OOAA 4L8RC 4DR4M 2H5XA 1HQYE 5EP2A 5IT9S 1GL6A 1WHCA 3LQRA 2UUAM 4LZJA 4QOSA 1PJJA 2F5SA 2BWEA 5ITTA 4JI1M 8CATA 2DWNA 2KNZA 3HJ8A 4AKGA 1NY6A 1NNUC 2FH0A 1Q3BA 4PT5A 4Z8XA 3UGJA 4DUYM 3GQ3A 4MGYE 3KSXA 1DO0A 3B89A 4WURA 2OO9A 2VQEM 3KP0E 5EXPA 1YLAA 2FNAA 2JY8A 1E9RA 2C9OA 3SFZA 2R6FA 3SAVA 1L8QA 4CHTB 4R71A 1YSYA 2H1RA 3M0EA 2UUBM 4LJAA 2Y21A 3QAUA 4MGKE 1G59A 1AUAA 1VG5A 1V34A 2KRKA 2KHHA 4IBEA 2EA0A 1IXSB 3LMMA 2CUZA 2K9DA 3PFIA 3U6OA 2EKKA 1DGFA 4IBFA 4PDIA 2C98A 4B3SM 3AOEC 2LNHC 4GC9A 3U6QA 1DGHB 3K1JA 4JI3M 3E9SA 4GKJM 4LZZA 3BOSA 2OQ4A 5EJCA 1OJLA 4FW9A 5FTNA 2JXNA 1T6OA 2V1CA 3AJIB 5KPRA 1QAOA 3LVWA 2DAIA 3T38A 4LF5M 2DAMA 4AKHA 1VDDA 5EP1A 1TH3A 3E4RA 3TPZA 4M9ZA 1HJPA 4DV2M 3W0FA 4UN2B 2LXEA 1V33A 4DV6M 1ZAEA 2HWJA 3GP1A 1NJGA 2NQ8C 1TF0B 4FVMA 2Z7JA 3W0LB 3GLIA 2DAKA 3AV0A 1XMOM 1HR0M 1IN5A 3A42A 2QP9X 4DR3M 2XEPA 1DGBA 1KSFX 3GRVA 4L6V6 1QZEA 1KYIA 1Z5BA 2KZSA 2JWSA 3C3EA 2QBYB 4LF8M 3MMPA 1NHGC 4LGYA 1QVRA 2KZUA 3TWKA 1Q39A 4L4UA 3NBXX 2CE7A 4HLQA 4L16A 5ITXA 1PJIA 2XZFA 4AW4A 1A5TA 2KRUA 3GRUA 2FS1A 3QYEA 4P17A 1K82A 4B3MM 3FTCA 4IBJA 3GLIE 3VDUA 2UU9M 1Q02A 1QUTA 4IJEA 3ZH9B 3NWLA 3T1YM 3I4VA 4IBCA 1P3QQ 1HT2E 4WW0A 2P5TA 4L78A 3MHVC 3Q8XA 1IN8A 2JZ0A 3PNVA 3GLIB 2LVQD 2KNAA 2CHGA 2FFJA 3GPUA 1IM2A 2EKFA 2JY5A 4NC6A 3SARA 1IN4A 3BXWA 4JI0M 3PVSA 4LF6M 1NV8A 1XWIA 4QNRA 3D8LA 1Z5CA 5E26A 4YHHM 1OIPA 3E21A 4RF1A 3U6MA 2OOBA 4I4LA 1GABA 4LFAM 2DHRA 5FLXS 4MGHA 1QZMA 3HKPA 3FRIA 3SMPA 3FUXA 4P16A 1J5EM 1SXJC 4A3VB 1TGUA 4GC5A 4LFBM 1Q3CA 4KHPM 4LJ9A 1GJTA 4LGMA 3GQ5A 2Z8YM 3QYBA 3R8FA 1L1TA 1D0MA 4KO8A 2DHYA 3UK6A 3SBJA 4FCWA 2XSZA 4RNAA 4R7GA 5KQDA 3LVVA 1ZMWA 4OX9M 3LW5F 2R65A 3GRYA 3IG8A 2ZTDA 3GPYA 1I94M 2DWLA 5DNYA 2QQ8A 1MX0A 4RF0A 3A98B 3V76A 1L2CA 3VKGA 5DYIA 3A46A 2R45A 2F5PA 1G71A 1NV9A 2CFOA 1R4GA 4JXJA 3UMMA 4B3TM 3L27A 4X66M 2L7IA 2G5GX 1N34M 5DFLA 1WXQA 1DGHA 4W5WA 2C5RA 1ORYB 4X65M 3E46A 1QAMA 4RKUF 2APLA 2ERCA 4OVZA 3MK6A 3WHLA 3JAMS 1IY1A 1TDZA 4DR7M 2L4FA 2UUCM 3GLFA 2YR0A 4JYAM 2K47A 2YFQA 4X64M 2AHMA 5DYGA 3TE6A 4MGZE 4YY3M 4JI8M 5KPTA 3FE3A 1XXHE 2L6OA 1EFUB 3CF0A 4CIZA 3JR4A 3U6PA 1FNNA 3B7ZA 2DNAA 4XGIA 5KQ8A 2ZAMA 4B7GA 1HNXM 4NRVA 3THGA 2DENA 2CHVA 3DFZA 3GLFE 3W67A 3PXGA 3J7AS 1XXHB 3SMSA 1OIZA 3Q8GA 3HHZA 2XF3A 4KT0F 2QBYA 3NBIA 4F2LA 4GHAA 1OFHA 1N77A 4B3RM 3HJQA 4OU7A 1EE8A 1ZMVA 3IECA 3DOAA 4GHLA 3LCUA 4AKIA 3KSJA 4OVZB 1VQ1A 2R4JA 1PJQA 3GLFB 4FWHA 2Y0TA 3J27B 4ZPXA 4Z6YA 2JY7A 3OTOM 2R18A 4ITQA 1GVNA 3SASA 1OKSA 2JP7A 4DV7M 4G3OA 3CGWA 4GH9A 4CGYB 1IBMM 3HU3A 3TQSA 2QENA 3A45A 2I7PA 2LWXA 4QNMA 2HHHM 2R4EA 2RRUA 4HEOA 2DI0A 2A5YB 1SXJD 4L15A 2LHGA 4HL4A 2XLJA 4NXMM 4KODA 1NSFA 1OFIA 3VK7A 2JY6B 2BJWA 4DV4M 2CV2A 1K3XA 1MU5A 1WR1B 1C1KA 3VFDA 1JR3D 5H37D 1R2ZA 2CWBA 1WGLA 3KS8A 2GNOA 2Z4SA 4M9SA 4DR2M 1Y8GA 3AOGA 3AKZA 4LJ4A 2X49A 2DWMA 1OAIA 2BWBA 5FTMA 3U60B 3T1HM 3HHWA 4IBIA 2D7EA 4D81A 4M0WA 1XC8A 1AIPC 2I7NA 4I81A 4LJ5A 1OQYA 3HGIA 1S3SA 1R7RA 3GLGE 2BJVA 1NVMA 1F4IA 2KA6B 1D0LA 1IN6A 1ZQ9A 4NL4H 4LJ6A 5IZ7D 1QQWA 2UXCM 4II7A 4S12A 1R5LA 1SXJE 4G4QA 2DZLA 2C96A 1Z6TA 1W5SA 3SAUA
chains in the Genus database with same CATH topology
2WSCF 2WSFF 3LW5F 4L6V6 5L8RF 2WSEF 4RKUF 4Y28F 1JB0F 4KT0F 4XK8F 2O01F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSC F;  2WSF F;  3LW5 F;  4L6V 6;  5L8R F;  2WSE F;  4RKU F;  4Y28 F;  1JB0 F;  4KT0 F;  4XK8 F;  2O01 F; 
#chains in the Genus database with same CATH topology
 3FUV A;  2HL7 A;  2LVA A;  4FCT A;  1J7K A;  1E32 A;  1N32 M;  2XZU A;  2R0I A;  2Q2E B;  2XGN A;  5A2Q S;  5ITR A;  5LMN M;  5JI3 E;  5F3W A;  3FTD A;  4D82 A;  1XMQ M;  3U6S A;  1PJT A;  1RU3 A;  1SXJ B;  2MR9 A;  2R62 A;  1DGG A;  4DR6 M;  1TH2 A;  2EJS A;  2KEB A;  2CP8 A;  2N35 A;  2O25 A;  4K0K M;  1GO5 A;  4LRT A;  4F1I A;  1HNZ M;  2UXD M;  3SAW A;  2JZ1 A;  3ZCB B;  1WGN A;  2F5Q A;  1IQP A;  2JNH A;  3I01 M;  1NY5 A;  2L4E A;  2L7H A;  3FUW A;  3LQQ A;  4LRS A;  4XBO A;  2VF8 A;  4IBB A;  4BB9 A;  4D80 A;  5ITU A;  2V1U A;  4AG6 A;  3UJN A;  1IY0 A;  1QDR A;  2V6Z M;  3RGS A;  1D0K A;  1VEJ A;  3PNY A;  1XNQ M;  3T15 A;  3B7N A;  1YE9 A;  1NO1 A;  1L2B A;  2EUC A;  1PGY A;  2R46 A;  2DZN B;  1L2D A;  1YUB A;  4LF7 M;  2F5N A;  3KS4 A;  4CJ6 A;  1XB2 B;  3MJ5 A;  2DZO B;  3GQ4 A;  4JV5 M;  4FWG A;  3B9P A;  1V92 A;  3TWM A;  4AI6 A;  3IHP A;  1NNJ A;  3AOE A;  3RGP A;  3UZU A;  4JI6 M;  2YNM D;  4Q7J A;  5ITQ A;  1XXH A;  3GRR A;  4LJ7 A;  2Y0Q A;  1PM5 A;  3RE8 A;  2QHO B;  3I51 A;  1N36 M;  2QPA A;  4XK8 F;  2J7O A;  3VLF B;  2RGH A;  5BPV A;  1W5T A;  1QYR A;  4NOO B;  3EIH A;  5FSW A;  2M60 A;  3CTW B;  4QHT A;  1OTR A;  3L28 A;  4FWD A;  2CV0 A;  1Z59 A;  2C99 A;  2JA2 A;  4IJF A;  3FUU A;  1N33 M;  2B3T A;  3HX3 A;  1SG9 A;  5FTK A;  3L25 A;  2QZ4 A;  3HU1 A;  4LFC M;  5EQT A;  1X37 A;  2CHQ A;  5ITY A;  1G3I A;  2JUJ A;  4LJ8 A;  5KO3 A;  3FYD A;  4JI5 M;  2ZAN A;  1LV7 A;  2XFT A;  3SHF A;  4B08 A;  3U61 A;  1KFV A;  2DWZ B;  3GO8 A;  1T3T A;  3L29 A;  2LVO C;  1IXR C;  3L2A A;  5C1B A;  2E5L M;  2G8L A;  5E6J A;  3JR5 A;  2CEA A;  2MGW A;  2MH8 A;  3GLH A;  5BR8 M;  4AQY M;  1QDT A;  3K8Z A;  4GEW A;  2VII A;  2O01 F;  4PDG A;  1GKI A;  2K6B A;  4DV3 M;  3HHX A;  3U60 A;  3I04 M;  3J81 S;  1HT1 E;  4AG5 A;  3HU2 A;  3ILK A;  3FKE A;  1GL7 A;  2K0B X;  2KNV A;  3C9P A;  4LY6 A;  3ZQJ A;  2F5O A;  1XNR M;  1ZMU A;  2WSC F;  2WSF F;  4LF9 M;  2FE8 A;  1XHB A;  5EXT A;  4DBG B;  4MGI E;  7CAT A;  1IN7 A;  3BBZ A;  1ZV1 A;  3DA1 A;  5IWA M;  2VDB B;  4X62 M;  2LVN C;  5EP3 A;  2BNK A;  4QHS A;  2EO2 A;  3CF2 A;  1MN3 A;  2KXE A;  2CRU A;  5FTJ A;  2Y20 A;  4IBD A;  3HHY A;  2X8A A;  3GLH E;  3T6P A;  3U6C A;  2KDL A;  1CUK A;  2J7N A;  3F92 A;  3K2L A;  5EP4 A;  3W68 A;  1TH4 A;  4GRI A;  2HAK A;  3GPX A;  3GLG A;  3U61 B;  1UFZ A;  4Y28 F;  1NJF A;  2LBC A;  1Z5A A;  4ANR A;  4NXN M;  3KVW A;  3FTF A;  2MRO B;  3K9O A;  3U5Z A;  1T43 A;  4IBK A;  2F4V M;  1BVS A;  4R3D A;  3GLH B;  1E94 E;  1SXJ A;  2D7G A;  3J7B A;  4DV0 M;  4JI7 M;  2DXI A;  3EIE A;  5C18 A;  2HKJ A;  1IY2 A;  4NSR A;  1QUS A;  4I5S A;  4G4R A;  4LG2 A;  4REZ A;  3SYK A;  4MH0 E;  1JR3 A;  3DZD A;  3IG5 A;  2J5Y A;  4NRW A;  1QAQ A;  3M6A A;  3AL0 C;  1GLN A;  3RFW A;  3KDS E;  3HZJ A;  1LTM A;  2XFS A;  2ZBK B;  3FUT A;  4FD2 A;  1VEK A;  2Z3X A;  1WIV A;  5FTL A;  4DR1 M;  1N78 A;  1VEG A;  3R9X B;  1L1Z A;  2RKO A;  1K3W A;  1MJG M;  2KW0 A;  4AZF A;  3GLG B;  3VK8 A;  2ZAO A;  1HQC A;  3FRH A;  3HY5 A;  1VDL A;  1G8P A;  2C9C A;  2DAG A;  3H4M A;  3VDP A;  3U6L A;  1JR3 E;  2WSE F;  3KOW E;  3LCV B;  3TWL A;  3KXE C;  2O5R A;  5L8R F;  5JI2 E;  3U5Z B;  1I4W A;  3VKH A;  3KP1 E;  2ZTC A;  4EIW A;  2LTU A;  1IBL M;  2YQZ A;  3D8B A;  1PJS A;  2XH9 A;  3B74 A;  3K9P A;  3SAT A;  3ZC7 B;  4CIS A;  4TUW A;  3SHG B;  4QOZ C;  4DUZ M;  4BLC A;  4DV5 M;  1PRB A;  2ZM6 M;  4B7F A;  1DV0 A;  2DAE A;  5EXS A;  1QAN A;  3M7G A;  1FJG M;  4JI2 M;  1IXZ A;  1IFY A;  3C58 A;  4B7H A;  5LMU M;  1J09 A;  3J80 S;  1D2N A;  2D7H A;  4GMQ A;  2W82 A;  3FYC A;  1UM8 A;  5ITX E;  2RGO A;  2DKL A;  3AFH A;  1E9S A;  4LCB A;  2GQF A;  2VQF M;  2R44 A;  4WP2 A;  1EIJ A;  4FCV A;  4NSO B;  4M0D A;  3K92 A;  4DV1 M;  4LF4 M;  4IBG A;  4PCZ A;  1DO2 A;  4MM3 B;  2FOI C;  1TR8 A;  1JQJ C;  3C3D A;  2XSZ D;  3HJS A;  2LVP C;  5IRE B;  3FD9 A;  2CV1 A;  3U6D A;  1G4A E;  1C7Y A;  3FTE A;  1N75 A;  4M9X A;  1NHW C;  3TL4 X;  5EXX A;  1JB0 F;  2DVW B;  3SYL A;  3J2P B;  2LHC A;  1HNW M;  3WHK A;  1G41 A;  2LH0 A;  1OAO C;  2QCU A;  3HWS A;  3KOX E;  2HCB A;  2Z4R A;  3U6E A;  2WZJ A;  2QSF X;  4I8O A;  4GKK M;  3H4J A;  3I4Y A;  2UXB M;  4PD2 A;  5KPZ A;  3KOZ E;  3GPP A;  2L09 A;  4KLN A;  2G3Q A;  3B7Q A;  2X4A A;  2QNJ A;  3KOY E;  1IBK M;  4G6Z A;  1WJ7 A;  2MJ5 B;  4MB7 A;  1H6U A;  5GKN A;  4G4N A;  4DR5 M;  4GIP A;  4JI4 M;  1TDH A;  1R6B X;  2OPF A;  1GJS A;  3L26 A;  3SC3 A;  1IXS A;  3QWL A;  1TTE A;  4BBA A;  4GIT A;  4JN6 A;  3KFU G;  2M5Z A;  4IIW A;  2VF7 A;  4OW0 A;  3CF6 E;  3KW6 A;  1R2Y A;  4G4O A;  2L2D A;  2OOA A;  4L8R C;  4DR4 M;  2H5X A;  1HQY E;  5EP2 A;  5IT9 S;  1GL6 A;  1WHC A;  3LQR A;  2UUA M;  4LZJ A;  4QOS A;  1PJJ A;  2F5S A;  2BWE A;  5ITT A;  4JI1 M;  8CAT A;  2DWN A;  2KNZ A;  3HJ8 A;  4AKG A;  1NY6 A;  1NNU C;  2FH0 A;  1Q3B A;  4PT5 A;  4Z8X A;  3UGJ A;  4DUY M;  3GQ3 A;  4MGY E;  3KSX A;  1DO0 A;  3B89 A;  4WUR A;  2OO9 A;  2VQE M;  3KP0 E;  5EXP A;  1YLA A;  2FNA A;  2JY8 A;  1E9R A;  2C9O A;  3SFZ A;  2R6F A;  3SAV A;  1L8Q A;  4CHT B;  4R71 A;  1YSY A;  2H1R A;  3M0E A;  2UUB M;  4LJA A;  2Y21 A;  3QAU A;  4MGK E;  1G59 A;  1AUA A;  1VG5 A;  1V34 A;  2KRK A;  2KHH A;  4IBE A;  2EA0 A;  1IXS B;  3LMM A;  2CUZ A;  2K9D A;  3PFI A;  3U6O A;  2EKK A;  1DGF A;  4IBF A;  4PDI A;  2C98 A;  4B3S M;  3AOE C;  2LNH C;  4GC9 A;  3U6Q A;  1DGH B;  3K1J A;  4JI3 M;  3E9S A;  4GKJ M;  4LZZ A;  3BOS A;  2OQ4 A;  5EJC A;  1OJL A;  4FW9 A;  5FTN A;  2JXN A;  1T6O A;  2V1C A;  3AJI B;  5KPR A;  1QAO A;  3LVW A;  2DAI A;  3T38 A;  4LF5 M;  2DAM A;  4AKH A;  1VDD A;  5EP1 A;  1TH3 A;  3E4R A;  3TPZ A;  4M9Z A;  1HJP A;  4DV2 M;  3W0F A;  4UN2 B;  2LXE A;  1V33 A;  4DV6 M;  1ZAE A;  2HWJ A;  3GP1 A;  1NJG A;  2NQ8 C;  1TF0 B;  4FVM A;  2Z7J A;  3W0L B;  3GLI A;  2DAK A;  3AV0 A;  1XMO M;  1HR0 M;  1IN5 A;  3A42 A;  2QP9 X;  4DR3 M;  2XEP A;  1DGB A;  1KSF X;  3GRV A;  4L6V 6;  1QZE A;  1KYI A;  1Z5B A;  2KZS A;  2JWS A;  3C3E A;  2QBY B;  4LF8 M;  3MMP A;  1NHG C;  4LGY A;  1QVR A;  2KZU A;  3TWK A;  1Q39 A;  4L4U A;  3NBX X;  2CE7 A;  4HLQ A;  4L16 A;  5ITX A;  1PJI A;  2XZF A;  4AW4 A;  1A5T A;  2KRU A;  3GRU A;  2FS1 A;  3QYE A;  4P17 A;  1K82 A;  4B3M M;  3FTC A;  4IBJ A;  3GLI E;  3VDU A;  2UU9 M;  1Q02 A;  1QUT A;  4IJE A;  3ZH9 B;  3NWL A;  3T1Y M;  3I4V A;  4IBC A;  1P3Q Q;  1HT2 E;  4WW0 A;  2P5T A;  4L78 A;  3MHV C;  3Q8X A;  1IN8 A;  2JZ0 A;  3PNV A;  3GLI B;  2LVQ D;  2KNA A;  2CHG A;  2FFJ A;  3GPU A;  1IM2 A;  2EKF A;  2JY5 A;  4NC6 A;  3SAR A;  1IN4 A;  3BXW A;  4JI0 M;  3PVS A;  4LF6 M;  1NV8 A;  1XWI A;  4QNR A;  3D8L A;  1Z5C A;  5E26 A;  4YHH M;  1OIP A;  3E21 A;  4RF1 A;  3U6M A;  2OOB A;  4I4L A;  1GAB A;  4LFA M;  2DHR A;  5FLX S;  4MGH A;  1QZM A;  3HKP A;  3FRI A;  3SMP A;  3FUX A;  4P16 A;  1J5E M;  1SXJ C;  4A3V B;  1TGU A;  4GC5 A;  4LFB M;  1Q3C A;  4KHP M;  4LJ9 A;  1GJT A;  4LGM A;  3GQ5 A;  2Z8Y M;  3QYB A;  3R8F A;  1L1T A;  1D0M A;  4KO8 A;  2DHY A;  3UK6 A;  3SBJ A;  4FCW A;  2XSZ A;  4RNA A;  4R7G A;  5KQD A;  3LVV A;  1ZMW A;  4OX9 M;  3LW5 F;  2R65 A;  3GRY A;  3IG8 A;  2ZTD A;  3GPY A;  1I94 M;  2DWL A;  5DNY A;  2QQ8 A;  1MX0 A;  4RF0 A;  3A98 B;  3V76 A;  1L2C A;  3VKG A;  5DYI A;  3A46 A;  2R45 A;  2F5P A;  1G71 A;  1NV9 A;  2CFO A;  1R4G A;  4JXJ A;  3UMM A;  4B3T M;  3L27 A;  4X66 M;  2L7I A;  2G5G X;  1N34 M;  5DFL A;  1WXQ A;  1DGH A;  4W5W A;  2C5R A;  1ORY B;  4X65 M;  3E46 A;  1QAM A;  4RKU F;  2APL A;  2ERC A;  4OVZ A;  3MK6 A;  3WHL A;  3JAM S;  1IY1 A;  1TDZ A;  4DR7 M;  2L4F A;  2UUC M;  3GLF A;  2YR0 A;  4JYA M;  2K47 A;  2YFQ A;  4X64 M;  2AHM A;  5DYG A;  3TE6 A;  4MGZ E;  4YY3 M;  4JI8 M;  5KPT A;  3FE3 A;  1XXH E;  2L6O A;  1EFU B;  3CF0 A;  4CIZ A;  3JR4 A;  3U6P A;  1FNN A;  3B7Z A;  2DNA A;  4XGI A;  5KQ8 A;  2ZAM A;  4B7G A;  1HNX M;  4NRV A;  3THG A;  2DEN A;  2CHV A;  3DFZ A;  3GLF E;  3W67 A;  3PXG A;  3J7A S;  1XXH B;  3SMS A;  1OIZ A;  3Q8G A;  3HHZ A;  2XF3 A;  4KT0 F;  2QBY A;  3NBI A;  4F2L A;  4GHA A;  1OFH A;  1N77 A;  4B3R M;  3HJQ A;  4OU7 A;  1EE8 A;  1ZMV A;  3IEC A;  3DOA A;  4GHL A;  3LCU A;  4AKI A;  3KSJ A;  4OVZ B;  1VQ1 A;  2R4J A;  1PJQ A;  3GLF B;  4FWH A;  2Y0T A;  3J27 B;  4ZPX A;  4Z6Y A;  2JY7 A;  3OTO M;  2R18 A;  4ITQ A;  1GVN A;  3SAS A;  1OKS A;  2JP7 A;  4DV7 M;  4G3O A;  3CGW A;  4GH9 A;  4CGY B;  1IBM M;  3HU3 A;  3TQS A;  2QEN A;  3A45 A;  2I7P A;  2LWX A;  4QNM A;  2HHH M;  2R4E A;  2RRU A;  4HEO A;  2DI0 A;  2A5Y B;  1SXJ D;  4L15 A;  2LHG A;  4HL4 A;  2XLJ A;  4NXM M;  4KOD A;  1NSF A;  1OFI A;  3VK7 A;  2JY6 B;  2BJW A;  4DV4 M;  2CV2 A;  1K3X A;  1MU5 A;  1WR1 B;  1C1K A;  3VFD A;  1JR3 D;  5H37 D;  1R2Z A;  2CWB A;  1WGL A;  3KS8 A;  2GNO A;  2Z4S A;  4M9S A;  4DR2 M;  1Y8G A;  3AOG A;  3AKZ A;  4LJ4 A;  2X49 A;  2DWM A;  1OAI A;  2BWB A;  5FTM A;  3U60 B;  3T1H M;  3HHW A;  4IBI A;  2D7E A;  4D81 A;  4M0W A;  1XC8 A;  1AIP C;  2I7N A;  4I81 A;  4LJ5 A;  1OQY A;  3HGI A;  1S3S A;  1R7R A;  3GLG E;  2BJV A;  1NVM A;  1F4I A;  2KA6 B;  1D0L A;  1IN6 A;  1ZQ9 A;  4NL4 H;  4LJ6 A;  5IZ7 D;  1QQW A;  2UXC M;  4II7 A;  4S12 A;  1R5L A;  1SXJ E;  4G4Q A;  2DZL A;  2C96 A;  1Z6T A;  1W5S A;  3SAU A; 
#chains in the Genus database with same CATH homology
 2WSC F;  2WSF F;  3LW5 F;  4L6V 6;  5L8R F;  2WSE F;  4RKU F;  4Y28 F;  1JB0 F;  4KT0 F;  4XK8 F;  2O01 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...