3LW5F

Improved model of plant photosystem i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
154
structure length
154
Chain Sequence
b'DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 19
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2010-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 3lw5F00
2WSEF 3LW5F 4L6V6 2O01F 2WSFF 1JB0F 4RKUF 4KT0F 5L8RF 4XK8F 4Y28F 2WSCF
chains in the Genus database with same CATH superfamily
1G3IA 5FTNA 2UUBM 4JI3M 1IFYA 2KA6B 3TWLA 2XFSA 2ZBKB 3H4JA 5IWAM 3HY5A 1Z5CA 1XMOM 3T1YM 4OX9M 1FNNA 2R4EA 3GRRA 4RF0A 4JI0M 4JI7M 1SG9A 1NHWC 3C3DA 4FW9A 4FVMA 4JI2M 1NY6A 4I8OA 2XLJA 1IN5A 3QYEA 1VEGA 1ZAEA 4L4UA 4P17A 2OO9A 3BBZA 3ZC7B 3UZUA 4Z6YA 3U6OA 1NSFA 3RFWA 3GP1A 2ZTCA 3DOAA 2W82A 1DV0A 1IXRC 2LWXA 1HNZM 3F92A 4LF8M 3GLGE 3E46A 1VG5A 5EP3A 1ZMWA 3AV0A 3FRHA 4DR5M 4GH9A 1XXHE 1XB2B 4RNAA 3HHYA 2ZM6M 4DUZM 1GABA 3LVVA 2R44A 1SXJD 3DFZA 2CV2A 3KFUG 3JR5A 4OVZB 2EKKA 3B9PA 1E94E 2XH9A 2JZ1A 4G4NA 2GQFA 1PJQA 2LH0A 2R18A 4XGIA 5EP4A 2XSZD 1NV9A 2X8AA 1LTMA 3SYKA 1L2DA 1V34A 2KEBA 1N75A 5EXSA 5ITUA 1YUBA 1QUTA 3KXEC 3T38A 2P5TA 2DZLA 3FUVA 3E9SA 2O5RA 1JB0F 2ERCA 4OVZA 5FTKA 4GRIA 2HCBA 2WSCF 4NXNM 1T3TA 2QHOB 1PJIA 1XC8A 1LV7A 2L7IA 4IBJA 5H37D 3MJ5A 4QOZC 4GEWA 2UXBM 5KPTA 5EXXA 4DR4M 4YY3M 4AKGA 4MGKE 2CHVA 1MJGM 2HL7A 2XEPA 1MN3A 1PJTA 3KOZE 4IBKA 4NL4H 3U6CA 1EIJA 2KNVA 3GLHA 3ILKA 4G6ZA 4G4RA 1E9SA 3SYLA 2DAMA 3GRVA 2YR0A 1QAQA 1PJSA 4S12A 2R62A 1QQWA 1OAOC 4HLQA 4GHAA 4W5WA 4LZJA 3ZCBB 7CATA 3CF6E 1D0KA 3D8BA 1T6OA 2Z3XA 4AKIA 2QZ4A 4MGZE 3QYBA 5KPZA 1NY5A 3U6EA 2O25A 1YE9A 1IXSB 2M5ZA 1K3WA 3KSXA 2DNAA 3FKEA 2DZNB 1HJPA 1Q3BA 3B7NA 1VDLA 4L16A 4LF4M 1UM8A 3J7BA 2MH8A 1R7RA 4FWDA 4PT5A 4KO8A 3E21A 1N33M 4LJ6A 3SHFA 1MX0A 1F4IA 4LJ9A 4LRSA 1J5EM 5FSWA 2LVOC 2YNMD 1NV8A 1OQYA 1X37A 4TUWA 2LNHC 2R46A 2UUAM 4G4QA 4FWHA 2LVQD 3HHZA 4MB7A 4II7A 5DFLA 1OFIA 3M0EA 4DV4M 2DWZB 3DZDA 3W0LB 4IBCA 2XZFA 1G59A 2LXEA 1ZQ9A 2QSFX 3SMPA 4DUYM 1IBKM 1PJJA 2JY6B 1DGFA 1A5TA 3BOSA 3FTDA 1L2CA 4IBEA 1L2BA 1P3QQ 4LY6A 3PNVA 4LFBM 2LHGA 2V1CA 1TH3A 3GLFA 3SAWA 2C99A 4L15A 1V92A 4IBGA 2BJVA 3U60B 3L25A 4UN2B 3W68A 2VQEM 3WHLA 2CHQA 3FE3A 1HR0M 2JP7A 1PRBA 3FRIA 1T43A 3RGPA 2DENA 5KQDA 3HKPA 2J7OA 2X49A 4JI4M 2KRKA 3THGA 3RGSA 3I04M 2D7GA 5EP1A 1OIZA 2B3TA 1PGYA 2MR9A 4MGHA 3U6SA 1AIPC 2EJSA 4JV5M 4PD2A 3VKHA 3J27B 2BJWA 4IJFA 4DR7M 4CHTB 4MGYE 1NO1A 2JUJA 4L6V6 5IREB 1GVNA 3A45A 4D81A 1GLNA 3FUWA 2UUCM 5EJCA 3L27A 5ITYA 4PCZA 2XZUA 2KNAA 4QHSA 1EFUB 4B7FA 3SHGB 1TH2A 2FFJA 5FTLA 3HHWA 1QANA 1IN4A 2Z4SA 3ZQJA 3FD9A 2QQ8A 3HZJA 2KXEA 4JI1M 1DO0A 2N35A 5KQ8A 4KLNA 4DR3M 1GL6A 2QBYB 4JI6M 2F4VM 1DGHB 2R6FA 4LJ7A 1IY0A 2LBCA 3U61B 5DNYA 3LCUA 1C1KA 3OTOM 3I4YA 3GRYA 2JY8A 3U6PA 1IN6A 4LJAA 1Z5BA 3T1HM 2H1RA 4AZFA 2DXIA 4DV7M 1QAMA 2DAGA 4HEOA 3MHVC 2G8LA 3W0FA 4D82A 2CWBA 2OOAA 4AQYM 3KOYE 2CFOA 1WGNA 2CP8A 4IBBA 3TL4X 2Y0QA 3CGWA 4MH0E 1RU3A 3C9PA 3TWMA 4REZA 2FH0A 3Q8XA 3GLFE 2L4FA 1TR8A 3UJNA 3JAMS 4RKUF 1JR3D 3W67A 3R8FA 4AI6A 3NBIA 3LCVB 1HT2E 1G8PA 5KO3A 3VK7A 2F5PA 1NHGC 2MROB 4B3MM 4DV6M 2FS1A 3J2PB 4NC6A 1H6UA 1HQYE 3QWLA 1IM2A 3GRUA 4NOOB 1ZMVA 4HL4A 4NSOB 4AG6A 1Q3CA 4M9ZA 3GLIB 5IZ7D 4X62M 3CF2A 2VF7A 3VFDA 1R2ZA 2QNJA 3KS4A 3SBJA 2Z4RA 1SXJB 5ITTA 2A5YB 3B74A 3KVWA 4AG5A 2HAKA 5JI2E 1GO5A 1E9RA 1CUKA 4FWGA 3M6AA 1SXJC 1TDHA 4GITA 3GPXA 3FTFA 2VDBB 5FTMA 5ITXA 3B7QA 2F5OA 2ZAMA 5L8RF 5C1BA 4WW0A 1QZMA 1IY2A 2M60A 1K3XA 3FYCA 1N77A 3HJQA 3UGJA 4BBAA 3KOXE 1KFVA 3A46A 4QNMA 4F2LA 1Y8GA 1Z5AA 2UXCM 1TF0B 4PDIA 2HHHM 4WP2A 4QOSA 1XWIA 2DAIA 1JQJC 3AOEC 1N34M 3LVWA 1OFHA 1NVMA 4DV2M 3KP0E 1Q39A 4LRTA 3MK6A 4X66M 1IN8A 2XSZA 1W5SA 1YSYA 2CE7A 4B7HA 3U5ZB 4L8RC 4I4LA 4WURA 3V76A 1NNUC 1XNRM 3KDSE 3Q8GA 4NSRA 3LQRA 4QNRA 3AOEA 1QAOA 2G3QA 4IIWA 5EXPA 2LVNC 1R2YA 3SAVA 3IG5A 3GLGB 3FYDA 3VDPA 3I51A 4LF7M 1IXZA 1HNWM 1XMQM 1IXSA 5FTJA 1I4WA 3AOGA 3U5ZA 4BLCA 3PVSA 1DGGA 4FCVA 4CGYB 1WR1B 2DWMA 3FTCA 2BWBA 1OIPA 5DYGA 5BPVA 3HHXA 3B89A 4EIWA 1XHBA 3TQSA 3U6LA 2CV1A 2K9DA 2RRUA 3GQ4A 3SAUA 1G71A 2C9OA 2FNAA 4MGIE 2YQZA 3JR4A 2Q2EB 1TTEA 1K82A 3TWKA 2WSEF 3FUUA 1Z6TA 3FTEA 4CJ6A 1PM5A 3C3EA 1G4AE 3NWLA 4JI8M 4G3OA 2VQFM 5ITXE 4JI5M 2CRUA 3U6QA 1Q02A 1VEKA 4Y28F 1UFZA 1QYRA 1OTRA 2CUZA 3QAUA 2KZSA 4FCTA 2J5YA 2RGOA 3T6PA 3U60A 2C5RA 4K0KM 3TE6A 2DKLA 1QDTA 2E5LM 1WJ7A 2JXNA 3HU1A 3BXWA 2UU9M 2JY7A 4D80A 3SFZA 4JYAM 5A2QS 3CTWB 4B7GA 4LG2A 1QUSA 2R65A 2AHMA 1QDRA 1QVRA 2EO2A 4QHTA 3HX3A 3KW6A 4IBFA 5E6JA 3A98B 3FUXA 3SASA 3GO8A 2C96A 4M9SA 5ITQA 2D7HA 2XFTA 3GQ3A 4LF9M 3L2AA 4Z8XA 1DO2A 4B3SM 3MMPA 5C18A 3VK8A 2QP9X 2DHYA 2KW0A 3HJ8A 5DYIA 2EUCA 4DR2M 2GNOA 1GJSA 2X4AA 2L7HA 4AW4A 2NQ8C 2C9CA 1FJGM 2CEAA 4JXJA 1J09A 2I7PA 3HU2A 4OU7A 3HWSA 5LMUM 3A42A 2O01F 4GC5A 2DWNA 5EQTA 1TH4A 1OAIA 2DZOB 3SC3A 2ZTDA 2QBYA 1DGHA 1OJLA 3E4RA 2JWSA 3U61A 1WGLA 2C98A 2D7EA 4FCWA 3J7AS 3RE8A 5LMNM 1J7KA 4R71A 4ITQA 1G41A 2QENA 3AKZA 2I7NA 2JZ0A 4JN6A 2WSFF 3J80S 1WXQA 1GL7A 3ZH9B 2DI0A 2FE8A 3GQ5A 1QZEA 1R4GA 2R45A 2XGNA 4BB9A 4GKJM 2Y21A 2Z8YM 3L28A 4B3TM 2BNKA 3PXGA 2DAEA 8CATA 1TDZA 2BWEA 4OW0A 5F3WA 3KSJA 1OKSA 2ZAOA 1IBMM 2KRUA 5JI3E 4LFCM 2H5XA 2DAKA 2KDLA 2QPAA 4X65M 4B3RM 1N78A 4DV3M 2F5SA 1E32A 4GHLA 2KNZA 4LJ8A 1V33A 2L09A 1VQ1A 3U6DA 2EA0A 2CHGA 3B7ZA 2RKOA 4IBDA 1L1TA 3D8LA 1ZMUA 1AUAA 5EXTA 1D2NA 3DA1A 3GLHB 4NXMM 3K8ZA 3GLIA 2FOIC 1I94M 1R6BX 2OOBA 1MU5A 1NJGA 2HWJA 4PDGA 1IN7A 3KS8A 3I01M 4XBOA 1IY1A 1VEJA 1SXJA 2L4EA 4FD2A 3K2LA 1YLAA 3VLFB 4LFAM 3H4MA 3SARA 2LTUA 4I5SA 4DV1M 4MM3B 2F5NA 2HKJA 4LGYA 1HNXM 4LF5M 2J7NA 2ZANA 2Y0TA 3U6MA 2CV0A 1S3SA 1EE8A 3R9XB 1JR3A 1WIVA 1Z59A 3VKGA 4ZPXA 2RGHA 4F1IA 2EKFA 2R4JA 3IG8A 4LF6M 4DR1M 2MJ5B 2DHRA 4Q7JA 2V6ZM 1GJTA 2LHCA 1N32M 4M0DA 4ANRA 1NNJA 2Z7JA 2DWLA 3PFIA 4IBIA 2Y20A 3HU3A 4LJ4A 1XXHB 3AJIB 4GMQA 4R7GA 1NJFA 3K92A 2UXDM 4IJEA 3VDUA 4I81A 4M9XA 1IBLM 3K9PA 3KP1E 4DR6M 3T15A 1WHCA 3SMSA 4GC9A 3LQQA 2DVWB 3EIEA 1D0MA 3C58A 3IHPA 2F5QA 5BR8M 4DBGB 3AFHA 2K6BA 3GLGA 1ZV1A 3UMMA 5E26A 4GKKM 3LMMA 3CF0A 2L6OA 3L29A 4LCBA 3FUTA 3KOWE 3LW5F 1KSFX 5GKNA 4CIZA 3GLFB 2MGWA 1D0LA 4LJ5A 4X64M 4CISA 1XXHA 1TGUA 2K0BX 5KPRA 2OQ4A 3I4VA 4M0WA 3K9OA 4KODA 2YFQA 3AL0C 4R3DA 3HJSA 4LGMA 3TPZA 2OPFA 2APLA 1BVSA 2R0IA 4AKHA 3GPPA 4RF1A 1HQCA 1GKIA 3GPUA 2KHHA 1ORYB 3EIHA 3GLIE 4P16A 1XNQM 3M7GA 4DV0M 2VF8A 3IECA 2LVAA 4B08A 4YHHM 1L8QA 2K47A 2KZUA 3L26A 4DV5M 1L1ZA 1SXJE 1VDDA 2WZJA 3PNYA 4NRVA 3UK6A 3WHKA 5ITRA 1N36M 3NBXX 5FLXS 4XK8F 3SATA 3K1JA 3GPYA 2LVPC 1DGBA 3HGIA 4NRWA 2V1UA 1IQPA 4A3VB 4KT0F 2XF3A 1C7YA 3GLHE 1HT1E 1JR3E 2L2DA 2QCUA 2VIIA 4L78A 3J81S 2JNHA 5IT9S 1W5TA 5EP2A 1R5LA 4LZZA 4KHPM 2JA2A 2JY5A 2G5GX 1KYIA 4G4OA 4GIPA
chains in the Genus database with same CATH topology
2WSEF 3LW5F 4L6V6 2O01F 2WSFF 1JB0F 4RKUF 4KT0F 5L8RF 4XK8F 4Y28F 2WSCF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE F;  3LW5 F;  4L6V 6;  2O01 F;  2WSF F;  1JB0 F;  4RKU F;  4KT0 F;  5L8R F;  4XK8 F;  4Y28 F;  2WSC F; 
#chains in the Genus database with same CATH topology
 1G3I A;  5FTN A;  2UUB M;  4JI3 M;  1IFY A;  2KA6 B;  3TWL A;  2XFS A;  2ZBK B;  3H4J A;  5IWA M;  3HY5 A;  1Z5C A;  1XMO M;  3T1Y M;  4OX9 M;  1FNN A;  2R4E A;  3GRR A;  4RF0 A;  4JI0 M;  4JI7 M;  1SG9 A;  1NHW C;  3C3D A;  4FW9 A;  4FVM A;  4JI2 M;  1NY6 A;  4I8O A;  2XLJ A;  1IN5 A;  3QYE A;  1VEG A;  1ZAE A;  4L4U A;  4P17 A;  2OO9 A;  3BBZ A;  3ZC7 B;  3UZU A;  4Z6Y A;  3U6O A;  1NSF A;  3RFW A;  3GP1 A;  2ZTC A;  3DOA A;  2W82 A;  1DV0 A;  1IXR C;  2LWX A;  1HNZ M;  3F92 A;  4LF8 M;  3GLG E;  3E46 A;  1VG5 A;  5EP3 A;  1ZMW A;  3AV0 A;  3FRH A;  4DR5 M;  4GH9 A;  1XXH E;  1XB2 B;  4RNA A;  3HHY A;  2ZM6 M;  4DUZ M;  1GAB A;  3LVV A;  2R44 A;  1SXJ D;  3DFZ A;  2CV2 A;  3KFU G;  3JR5 A;  4OVZ B;  2EKK A;  3B9P A;  1E94 E;  2XH9 A;  2JZ1 A;  4G4N A;  2GQF A;  1PJQ A;  2LH0 A;  2R18 A;  4XGI A;  5EP4 A;  2XSZ D;  1NV9 A;  2X8A A;  1LTM A;  3SYK A;  1L2D A;  1V34 A;  2KEB A;  1N75 A;  5EXS A;  5ITU A;  1YUB A;  1QUT A;  3KXE C;  3T38 A;  2P5T A;  2DZL A;  3FUV A;  3E9S A;  2O5R A;  1JB0 F;  2ERC A;  4OVZ A;  5FTK A;  4GRI A;  2HCB A;  2WSC F;  4NXN M;  1T3T A;  2QHO B;  1PJI A;  1XC8 A;  1LV7 A;  2L7I A;  4IBJ A;  5H37 D;  3MJ5 A;  4QOZ C;  4GEW A;  2UXB M;  5KPT A;  5EXX A;  4DR4 M;  4YY3 M;  4AKG A;  4MGK E;  2CHV A;  1MJG M;  2HL7 A;  2XEP A;  1MN3 A;  1PJT A;  3KOZ E;  4IBK A;  4NL4 H;  3U6C A;  1EIJ A;  2KNV A;  3GLH A;  3ILK A;  4G6Z A;  4G4R A;  1E9S A;  3SYL A;  2DAM A;  3GRV A;  2YR0 A;  1QAQ A;  1PJS A;  4S12 A;  2R62 A;  1QQW A;  1OAO C;  4HLQ A;  4GHA A;  4W5W A;  4LZJ A;  3ZCB B;  7CAT A;  3CF6 E;  1D0K A;  3D8B A;  1T6O A;  2Z3X A;  4AKI A;  2QZ4 A;  4MGZ E;  3QYB A;  5KPZ A;  1NY5 A;  3U6E A;  2O25 A;  1YE9 A;  1IXS B;  2M5Z A;  1K3W A;  3KSX A;  2DNA A;  3FKE A;  2DZN B;  1HJP A;  1Q3B A;  3B7N A;  1VDL A;  4L16 A;  4LF4 M;  1UM8 A;  3J7B A;  2MH8 A;  1R7R A;  4FWD A;  4PT5 A;  4KO8 A;  3E21 A;  1N33 M;  4LJ6 A;  3SHF A;  1MX0 A;  1F4I A;  4LJ9 A;  4LRS A;  1J5E M;  5FSW A;  2LVO C;  2YNM D;  1NV8 A;  1OQY A;  1X37 A;  4TUW A;  2LNH C;  2R46 A;  2UUA M;  4G4Q A;  4FWH A;  2LVQ D;  3HHZ A;  4MB7 A;  4II7 A;  5DFL A;  1OFI A;  3M0E A;  4DV4 M;  2DWZ B;  3DZD A;  3W0L B;  4IBC A;  2XZF A;  1G59 A;  2LXE A;  1ZQ9 A;  2QSF X;  3SMP A;  4DUY M;  1IBK M;  1PJJ A;  2JY6 B;  1DGF A;  1A5T A;  3BOS A;  3FTD A;  1L2C A;  4IBE A;  1L2B A;  1P3Q Q;  4LY6 A;  3PNV A;  4LFB M;  2LHG A;  2V1C A;  1TH3 A;  3GLF A;  3SAW A;  2C99 A;  4L15 A;  1V92 A;  4IBG A;  2BJV A;  3U60 B;  3L25 A;  4UN2 B;  3W68 A;  2VQE M;  3WHL A;  2CHQ A;  3FE3 A;  1HR0 M;  2JP7 A;  1PRB A;  3FRI A;  1T43 A;  3RGP A;  2DEN A;  5KQD A;  3HKP A;  2J7O A;  2X49 A;  4JI4 M;  2KRK A;  3THG A;  3RGS A;  3I04 M;  2D7G A;  5EP1 A;  1OIZ A;  2B3T A;  1PGY A;  2MR9 A;  4MGH A;  3U6S A;  1AIP C;  2EJS A;  4JV5 M;  4PD2 A;  3VKH A;  3J27 B;  2BJW A;  4IJF A;  4DR7 M;  4CHT B;  4MGY E;  1NO1 A;  2JUJ A;  4L6V 6;  5IRE B;  1GVN A;  3A45 A;  4D81 A;  1GLN A;  3FUW A;  2UUC M;  5EJC A;  3L27 A;  5ITY A;  4PCZ A;  2XZU A;  2KNA A;  4QHS A;  1EFU B;  4B7F A;  3SHG B;  1TH2 A;  2FFJ A;  5FTL A;  3HHW A;  1QAN A;  1IN4 A;  2Z4S A;  3ZQJ A;  3FD9 A;  2QQ8 A;  3HZJ A;  2KXE A;  4JI1 M;  1DO0 A;  2N35 A;  5KQ8 A;  4KLN A;  4DR3 M;  1GL6 A;  2QBY B;  4JI6 M;  2F4V M;  1DGH B;  2R6F A;  4LJ7 A;  1IY0 A;  2LBC A;  3U61 B;  5DNY A;  3LCU A;  1C1K A;  3OTO M;  3I4Y A;  3GRY A;  2JY8 A;  3U6P A;  1IN6 A;  4LJA A;  1Z5B A;  3T1H M;  2H1R A;  4AZF A;  2DXI A;  4DV7 M;  1QAM A;  2DAG A;  4HEO A;  3MHV C;  2G8L A;  3W0F A;  4D82 A;  2CWB A;  2OOA A;  4AQY M;  3KOY E;  2CFO A;  1WGN A;  2CP8 A;  4IBB A;  3TL4 X;  2Y0Q A;  3CGW A;  4MH0 E;  1RU3 A;  3C9P A;  3TWM A;  4REZ A;  2FH0 A;  3Q8X A;  3GLF E;  2L4F A;  1TR8 A;  3UJN A;  3JAM S;  4RKU F;  1JR3 D;  3W67 A;  3R8F A;  4AI6 A;  3NBI A;  3LCV B;  1HT2 E;  1G8P A;  5KO3 A;  3VK7 A;  2F5P A;  1NHG C;  2MRO B;  4B3M M;  4DV6 M;  2FS1 A;  3J2P B;  4NC6 A;  1H6U A;  1HQY E;  3QWL A;  1IM2 A;  3GRU A;  4NOO B;  1ZMV A;  4HL4 A;  4NSO B;  4AG6 A;  1Q3C A;  4M9Z A;  3GLI B;  5IZ7 D;  4X62 M;  3CF2 A;  2VF7 A;  3VFD A;  1R2Z A;  2QNJ A;  3KS4 A;  3SBJ A;  2Z4R A;  1SXJ B;  5ITT A;  2A5Y B;  3B74 A;  3KVW A;  4AG5 A;  2HAK A;  5JI2 E;  1GO5 A;  1E9R A;  1CUK A;  4FWG A;  3M6A A;  1SXJ C;  1TDH A;  4GIT A;  3GPX A;  3FTF A;  2VDB B;  5FTM A;  5ITX A;  3B7Q A;  2F5O A;  2ZAM A;  5L8R F;  5C1B A;  4WW0 A;  1QZM A;  1IY2 A;  2M60 A;  1K3X A;  3FYC A;  1N77 A;  3HJQ A;  3UGJ A;  4BBA A;  3KOX E;  1KFV A;  3A46 A;  4QNM A;  4F2L A;  1Y8G A;  1Z5A A;  2UXC M;  1TF0 B;  4PDI A;  2HHH M;  4WP2 A;  4QOS A;  1XWI A;  2DAI A;  1JQJ C;  3AOE C;  1N34 M;  3LVW A;  1OFH A;  1NVM A;  4DV2 M;  3KP0 E;  1Q39 A;  4LRT A;  3MK6 A;  4X66 M;  1IN8 A;  2XSZ A;  1W5S A;  1YSY A;  2CE7 A;  4B7H A;  3U5Z B;  4L8R C;  4I4L A;  4WUR A;  3V76 A;  1NNU C;  1XNR M;  3KDS E;  3Q8G A;  4NSR A;  3LQR A;  4QNR A;  3AOE A;  1QAO A;  2G3Q A;  4IIW A;  5EXP A;  2LVN C;  1R2Y A;  3SAV A;  3IG5 A;  3GLG B;  3FYD A;  3VDP A;  3I51 A;  4LF7 M;  1IXZ A;  1HNW M;  1XMQ M;  1IXS A;  5FTJ A;  1I4W A;  3AOG A;  3U5Z A;  4BLC A;  3PVS A;  1DGG A;  4FCV A;  4CGY B;  1WR1 B;  2DWM A;  3FTC A;  2BWB A;  1OIP A;  5DYG A;  5BPV A;  3HHX A;  3B89 A;  4EIW A;  1XHB A;  3TQS A;  3U6L A;  2CV1 A;  2K9D A;  2RRU A;  3GQ4 A;  3SAU A;  1G71 A;  2C9O A;  2FNA A;  4MGI E;  2YQZ A;  3JR4 A;  2Q2E B;  1TTE A;  1K82 A;  3TWK A;  2WSE F;  3FUU A;  1Z6T A;  3FTE A;  4CJ6 A;  1PM5 A;  3C3E A;  1G4A E;  3NWL A;  4JI8 M;  4G3O A;  2VQF M;  5ITX E;  4JI5 M;  2CRU A;  3U6Q A;  1Q02 A;  1VEK A;  4Y28 F;  1UFZ A;  1QYR A;  1OTR A;  2CUZ A;  3QAU A;  2KZS A;  4FCT A;  2J5Y A;  2RGO A;  3T6P A;  3U60 A;  2C5R A;  4K0K M;  3TE6 A;  2DKL A;  1QDT A;  2E5L M;  1WJ7 A;  2JXN A;  3HU1 A;  3BXW A;  2UU9 M;  2JY7 A;  4D80 A;  3SFZ A;  4JYA M;  5A2Q S;  3CTW B;  4B7G A;  4LG2 A;  1QUS A;  2R65 A;  2AHM A;  1QDR A;  1QVR A;  2EO2 A;  4QHT A;  3HX3 A;  3KW6 A;  4IBF A;  5E6J A;  3A98 B;  3FUX A;  3SAS A;  3GO8 A;  2C96 A;  4M9S A;  5ITQ A;  2D7H A;  2XFT A;  3GQ3 A;  4LF9 M;  3L2A A;  4Z8X A;  1DO2 A;  4B3S M;  3MMP A;  5C18 A;  3VK8 A;  2QP9 X;  2DHY A;  2KW0 A;  3HJ8 A;  5DYI A;  2EUC A;  4DR2 M;  2GNO A;  1GJS A;  2X4A A;  2L7H A;  4AW4 A;  2NQ8 C;  2C9C A;  1FJG M;  2CEA A;  4JXJ A;  1J09 A;  2I7P A;  3HU2 A;  4OU7 A;  3HWS A;  5LMU M;  3A42 A;  2O01 F;  4GC5 A;  2DWN A;  5EQT A;  1TH4 A;  1OAI A;  2DZO B;  3SC3 A;  2ZTD A;  2QBY A;  1DGH A;  1OJL A;  3E4R A;  2JWS A;  3U61 A;  1WGL A;  2C98 A;  2D7E A;  4FCW A;  3J7A S;  3RE8 A;  5LMN M;  1J7K A;  4R71 A;  4ITQ A;  1G41 A;  2QEN A;  3AKZ A;  2I7N A;  2JZ0 A;  4JN6 A;  2WSF F;  3J80 S;  1WXQ A;  1GL7 A;  3ZH9 B;  2DI0 A;  2FE8 A;  3GQ5 A;  1QZE A;  1R4G A;  2R45 A;  2XGN A;  4BB9 A;  4GKJ M;  2Y21 A;  2Z8Y M;  3L28 A;  4B3T M;  2BNK A;  3PXG A;  2DAE A;  8CAT A;  1TDZ A;  2BWE A;  4OW0 A;  5F3W A;  3KSJ A;  1OKS A;  2ZAO A;  1IBM M;  2KRU A;  5JI3 E;  4LFC M;  2H5X A;  2DAK A;  2KDL A;  2QPA A;  4X65 M;  4B3R M;  1N78 A;  4DV3 M;  2F5S A;  1E32 A;  4GHL A;  2KNZ A;  4LJ8 A;  1V33 A;  2L09 A;  1VQ1 A;  3U6D A;  2EA0 A;  2CHG A;  3B7Z A;  2RKO A;  4IBD A;  1L1T A;  3D8L A;  1ZMU A;  1AUA A;  5EXT A;  1D2N A;  3DA1 A;  3GLH B;  4NXM M;  3K8Z A;  3GLI A;  2FOI C;  1I94 M;  1R6B X;  2OOB A;  1MU5 A;  1NJG A;  2HWJ A;  4PDG A;  1IN7 A;  3KS8 A;  3I01 M;  4XBO A;  1IY1 A;  1VEJ A;  1SXJ A;  2L4E A;  4FD2 A;  3K2L A;  1YLA A;  3VLF B;  4LFA M;  3H4M A;  3SAR A;  2LTU A;  4I5S A;  4DV1 M;  4MM3 B;  2F5N A;  2HKJ A;  4LGY A;  1HNX M;  4LF5 M;  2J7N A;  2ZAN A;  2Y0T A;  3U6M A;  2CV0 A;  1S3S A;  1EE8 A;  3R9X B;  1JR3 A;  1WIV A;  1Z59 A;  3VKG A;  4ZPX A;  2RGH A;  4F1I A;  2EKF A;  2R4J A;  3IG8 A;  4LF6 M;  4DR1 M;  2MJ5 B;  2DHR A;  4Q7J A;  2V6Z M;  1GJT A;  2LHC A;  1N32 M;  4M0D A;  4ANR A;  1NNJ A;  2Z7J A;  2DWL A;  3PFI A;  4IBI A;  2Y20 A;  3HU3 A;  4LJ4 A;  1XXH B;  3AJI B;  4GMQ A;  4R7G A;  1NJF A;  3K92 A;  2UXD M;  4IJE A;  3VDU A;  4I81 A;  4M9X A;  1IBL M;  3K9P A;  3KP1 E;  4DR6 M;  3T15 A;  1WHC A;  3SMS A;  4GC9 A;  3LQQ A;  2DVW B;  3EIE A;  1D0M A;  3C58 A;  3IHP A;  2F5Q A;  5BR8 M;  4DBG B;  3AFH A;  2K6B A;  3GLG A;  1ZV1 A;  3UMM A;  5E26 A;  4GKK M;  3LMM A;  3CF0 A;  2L6O A;  3L29 A;  4LCB A;  3FUT A;  3KOW E;  3LW5 F;  1KSF X;  5GKN A;  4CIZ A;  3GLF B;  2MGW A;  1D0L A;  4LJ5 A;  4X64 M;  4CIS A;  1XXH A;  1TGU A;  2K0B X;  5KPR A;  2OQ4 A;  3I4V A;  4M0W A;  3K9O A;  4KOD A;  2YFQ A;  3AL0 C;  4R3D A;  3HJS A;  4LGM A;  3TPZ A;  2OPF A;  2APL A;  1BVS A;  2R0I A;  4AKH A;  3GPP A;  4RF1 A;  1HQC A;  1GKI A;  3GPU A;  2KHH A;  1ORY B;  3EIH A;  3GLI E;  4P16 A;  1XNQ M;  3M7G A;  4DV0 M;  2VF8 A;  3IEC A;  2LVA A;  4B08 A;  4YHH M;  1L8Q A;  2K47 A;  2KZU A;  3L26 A;  4DV5 M;  1L1Z A;  1SXJ E;  1VDD A;  2WZJ A;  3PNY A;  4NRV A;  3UK6 A;  3WHK A;  5ITR A;  1N36 M;  3NBX X;  5FLX S;  4XK8 F;  3SAT A;  3K1J A;  3GPY A;  2LVP C;  1DGB A;  3HGI A;  4NRW A;  2V1U A;  1IQP A;  4A3V B;  4KT0 F;  2XF3 A;  1C7Y A;  3GLH E;  1HT1 E;  1JR3 E;  2L2D A;  2QCU A;  2VII A;  4L78 A;  3J81 S;  2JNH A;  5IT9 S;  1W5T A;  5EP2 A;  1R5L A;  4LZZ A;  4KHP M;  2JA2 A;  2JY5 A;  2G5G X;  1KYI A;  4G4O A;  4GIP A; 
#chains in the Genus database with same CATH homology
 2WSE F;  3LW5 F;  4L6V 6;  2O01 F;  2WSF F;  1JB0 F;  4RKU F;  4KT0 F;  5L8R F;  4XK8 F;  4Y28 F;  2WSC F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...