3LW8A

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
GPLGSAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rhoa-binding protein
total genus 62
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw8A00
1VG0B 5BXQC 2IUUA 1GIAA 1NY6A 2PJRA 5TMPA 3TW4A 3EAQA 2JJ1D 3K09A 4B33A 3H86A 3C7KA 3W9YA 4NHOA 5JS7A 4Q4LA 1TAGA 3EW9A 3THWA 5L8VA 3X1DA 4MKGA 2G0NA 4PQFA 4LJAA 4CT4B 2JDID 2V6JA 4PHTA 4U7DA 2Q9AA 3NWJA 1XCGB 2IS4A 3TRFA 1GNRA 4NYIR 1F60A 3T12A 4W9MC 1LF0A 4CZ2A 1D2EA 2D2FA 2XX3A 2NQ2C 1OHHD 1Y63A 1U98A 4IOMA 1TTTA 3EZ2A 2ERYA 3ZDQA 4RCZA 4E22A 2F43B 3W90A 1P2UA 1G6OA 4I81A 2JCSA 4IXNA 4DCUA 4A2QA 4GDFA 3LW8A 4EJSB 1U8AA 2OBLA 4DSTA 1Z0JA 4OQMA 5G40A 4B2IA 4FI3C 4Q48A 2DFTA 3RRYA 2W6JD 4JLAA 1QHSA 3L82B 2QSYA 2HT6A 1QVRA 4R98A 4AYWA 2OBNA 3SBDA 3B2EA 2MSEB 4L15A 2REOA 4JZKA 1SGWA 3TJZA 1OKKD 2QP9X 5J4VA 1DAEA 2DWPA 1DO0A 4UNRA 3I5XA 1JJVA 3GFPA 4LJ8A 2VO1A 1S4QA 2LWIA 2VYFA 4MRRA 1JPJA 4TYPA 1G7RA 2HLDA 1HUQA 5JZVA 1FQJA 2PT5A 3WYGA 1S1CA 5J4YA 1DE0A 1Z28A 1E2JA 1DAIA 4JVMA 4RD1A 2CVHA 4F4IA 4Q1DA 1I2MA 3HU1A 1KJZA 1UFQA 3KUDA 1AZSC 1IJEA 1YZQA 1U0HC 4CGZA 3TW8B 2O8BA 1FTNA 1H65A 2IC5A 2ATXA 2J41A 2CCKA 3RABA 4QJ5A 2IBMA 5DYGA 4BLTA 4A6XA 1Z07A 1OB5A 2DHRA 2NTYC 1D9ZA 1E9RA 5TARA 1PVOA 3BB1A 4B3FX 4XSHA 2ORWA 3THXA 4HEJA 4D0LB 1Z3IX 5CIWA 2ZM5A 5D3MA 3VR3A 4KBGA 3I3SR 2FPMA 1U9IA 2IF2A 2CMKA 4N3NA 2OEPA 1AQUA 1GDDA 2J0VA 4BLRA 2YZ2A 2VHJA 1E96A 4Q66C 2VBCA 4TTPA 2ZJ8A 2C5LA 2V7QD 3DHWC 3GFTA 2GF9A 2ZI6A 1KJYA 2P5TB 2QAGB 3I1FA 1XTKA 2ZI7A 3VAAA 5KSYA 4B35A 5LDDC 5KDLA 2XTNA 1FZQA 3LY5A 4O2LA 2PEYA 3QKSA 1XF9A 4PSAA 4QKQA 2ZRFA 5AWFC 4M1KA 1M2OB 2RAPA 2FSFA 2D74A 1DAKA 1W0JA 2C03A 3LBNA 1D2NA 1FUKA 1N0VC 1W36D 3SYLA 4C0QC 1US8A 4Q4JA 3K53A 4CT5A 1BO6A 3CNLA 5EE9A 3T5GA 3FMPB 2G88A 5JSZB 4B3DA 1NVXQ 4YC7A 4Q9IA 3T15A 2BCJQ 4WZBE 3AUXA 3Q5DA 4FWIB 5AR1A 3LO5A 5K8TA 4D4LA 2O8CB 2GNOA 1XPRA 2CNWA 3EG5A 2GBLC 4LWZA 4D6PA 4PXAA 4YMTA 4DDWA 3EZ6A 1SVIA 4M21A 4HI0E 2BKUA 5EUMA 1IHUA 1ZU4A 3LVRE 3FKQA 3QBVA 1N6IA 1E0AA 3LAWA 1LS6A 5CM8B 4TMXA 3T1OA 2R65A 1E79A 3CLVA 4RFSA 1R5OA 3PCRB 4NBSA 4HDQB 2DY1A 3NEJA 2ZJAA 1II8A 3FB4A 4LBZA 621PA 4P33A 1RJ9B 1G5TA 2GHIA 2WSSD 3GJXC 4PZZA 4AYTA 4A8JA 2MMGA 3D6TB 3L2OB 2OZEA 3B9PA 4QBHA 1JEDA 1OF1A 3I72A 4ASUD 4I1OA 2DCUA 5J4LA 1IBRA 1MO4A 1DAFA 3C4JA 3ONWA 1G7TA 5C2JB 1II0A 1GG2A 4LYAA 2FF7A 2FFBA 1VG8A 3CM0A 4M0LA 1P9NA 2Z4RA 5FI0B 4ZCIA 4WXRA 2F1JA 1S8FA 4E09A 1BIFA 4YMVA 4ZI2A 4LHWA 1G9XA 2DB3A 1GVNB 2ZRJA 1VYTA 3P26A 1KYIA 3CRW1 1CRPA 3UMRA 1JECA 2L0XA 1EFCA 1E1QA 1P4SA 2A78A 2C95A 4TMWA 3KB1A 4Q7LA 3LX5A 3RANA 1SVKA 2VHTA 2AXPA 2C96A 2WJGA 1NIJA 2VF7A 3ZH9B 1KK1A 4K46A 1E1RD 4V0OA 4DEXA 5K8UA 3FKSA 4PQRA 1KDPA 1F2TA 3A4LA 4DLYA 2RB4A 3QVUA 3UANA 2FFAA 4US0R 4KAXA 4PZYA 1E9CA 4DDUA 1KMQA 3WBKA 3EIEA 2IXEA 1JQJC 4HLDA 5JJKA 1RE0A 2GF0A 1G4AE 2QPTA 3B82A 4AG6A 2D4HA 1A1VA 1W4RA 2BKEA 4LX0A 2XAUA 3I8SA 2WMNB 1GTVA 2JGNA 2QEQA 2FMXA 5TXGA 3U61B 3GPLA 3B6EA 5FOTA 2V9PA 3AVXA 3EPJA 2JJ2D 1B0UA 4O2RA 4BFUA 2QORA 4OK3A 4X8MA 4V0NA 1G5PA 3NHAA 3DO6A 1XX6A 3M0EA 4WZAE 5JRJA 4I1UA 4G5RA 3IIJA 4US1R 4HUTA 4OK5A 4B47A 1ZC3A 1SXJB 4LOAA 4U00A 1P6XA 3BFVA 1AK2A 1Q20A 2HJVA 3B1VA 1J99A 3NDBB 1D2MA 4IRUB 4PFSA 2FA9A 4AI6A 1T3LA 1R0XA 2BMJA 3PQCA 4KFUA 1U81A 1ZD9A 4LV6A 4QC2A 4TMZA 3TQCA 5A4JA 2ANBA 4URVR 1OV4A 2QGZA 1SVOA 2ZRMA 2FN4A 1QHNA 1AS2A 4BLOA 2W2TA 4L4UA 3CPJB 2QM7A 4H1UA 2ZSFA 3IPYA 2J59A 1VHLA 1IM2A 1FL9A 3OEED 4YMSA 5FTJA 2ZI3A 5AK0A 2CHQA 4P4SA 4Q1EA 1ZAKA 2EW1A 1C4OA 3HPQA 4M53A 4C0BA 2GJ8A 2C2HA 3AVTA 1G3RA 1GKYA 5KU1A 1EK0A 1BYIA 1QDEA 2PBRA 2QTHA 2ZR7A 3FGNA 4G0NA 2KBEA 1PLLA 1WRBA 5HPYB 3BB4A 1I2DA 4HAVA 2ZJBA 3AGPA 2IHBA 2B7BA 3M4YA 4KFTA 1ESMA 4DRZA 1Q3HA 4D81A 4ZV4A 4HSEA 1RYFA 3KKNA 1XEXB 1XPOA 1OXSC 2BBOA 721PA 4N1AA 3K70B 4FIDA 5HKKA 3OEHD 3KL4A 3QKTA 2QN6A 4PX9A 4KFSA 3B78A 1ZP6A 3SC3A 2WKPA 3X1XA 4Q21A 5K8IA 1GM5A 3QJYA 5EXPA 3SFZA 2ZJYA 5DNYB 1GZSA 1MO6A 1G20E 2KWIA 2V6IA 4LBVA 4LJ5A 2J0UA 5IK2A 4GRAA 1AKEA 4V0ME 3DKPA 2ZRAA 5FOSA 5FUXA 3THWB 1OYYA 4ZI3A 4NMMA 2P0EA 4BEBA 3GLHE 4DDVA 2GXUA 2QY9A 2VL7A 4MKIA 3UIEA 4GFDA 3ZQJA 1XD8A 4QHYA 3SYNA 2ZRNA 4LJYA 2WZQA 2GXSA 1W4BA 3CRRA 4C0SA 3FOZA 4IVQA 2GJSA 4HZIA 1KI4A 4R9UC 4JKYA 4OI1A 4HAZA 3VR2A 1PJRA 3U3KA 3U7HB 5F9HA 1ZMXA 3SHWA 4BRWA 3A1VA 4KVGA 4LJ9A 2GXAA 3SNHA 3VKWA 2OFWA 4IVPA 1Z0DA 1N6HA 2D62A 3J81k 4XSGA 2PL3A 5DO9A 1J8YF 2XJ9A 2AN9A 1L4UA 4R2IA 5HKKD 3TSOA 4AY2A 3TSZA 4F91B 4PSVA 3RS4A 2XNSA 1KK3A 2IHYA 4TZ6A 4ACBA 1CR2A 1E0SA 4ON9A 3CBQA 2SHKA 1YZUA 2V54A 2ZQ5A 4RZ2A 5AJWA 2YWFA 1IY2A 2C9YA 4M1WA 2XZOA 4DVGA 4BASA 2VSXA 3I4LA 4B43A 5IK2D 4P3YA 1W36B 3HYRA 2ZRKA 2ZSAA 1NI3A 1T91A 5KUTA 4A2PA 5KYKA 2QMHA 4HLQB 2OLKA 4QGAA 4A36A 1XEWX 1XCMA 4V0MA 2ZYTX 1DG1G 3WMGA 5B58C 1KSGA 2O5VA 1F6BA 1FFHA 3EXAA 3X1ZA 1JPNA 4M1SA 1ZNWA 4ZCMA 1GSIA 5AUNB 3OFND 4DC9A 3GLHA 3GFOA 1UDXA 3UXMA 2QAJA 1M74A 1NN3A 2IWHA 4NYMQ 3QVVA 3TAHA 2O8BB 4X8LA 4EFNA 4S2EA 3F0TA 1XMJA 3H2YA 2QI9C 4XH9B 1UJ2A 1Z5ZA 2ZE7A 3GJ0A 3THXB 2NIPA 4OL0A 4TLAA 2OM2A 2GK7A 5D3MB 2FFHA 3ADKA 4HAXA 4JIMA 4XVQA 1ZCAA 2OSBA 4QL3A 3HYTA 5DI3A 4RJLA 3VR1A 1MH1A 3UPUA 3ZYCA 4HB3A 3EC1A 3MAAC 4LHXA 4KBFA 1KKMA 1WMSA 4OQFA 1E98A 3REFA 1MABA 2WVJA 4AKGA 3I62A 3L0IB 2HJGA 3QBTA 4OK6A 3QKSB 4ZKDA 2EVWX 4JLKA 3TE6A 2XOKD 3LA6A 4MRPA 2QZ4A 3PVSA 2IXGA 3W6OA 1TQ2A 2ZAOA 4EIWA 3ECCA 1SHZA 1KI8A 4OHVA 5E95A 2AKYA 2BVNA 1QBKC 3A8TA 1VYVA 2QRNA 2X77A 1S1MA 5EP3A 5H1YA 4FMCB 4L16A 2CLSA 2OHFA 4NE2A 1FPMA 4R7ZA 2R6FA 5KPDA 2VSFA 1Z2AA 4LJ7A 2FGJA 1R0YA 1QHHA 4QOSA 3AVVA 4Q03A 4EAQA 1BOFA 1CR4A 2CE7A 4LHVA 1KI2A 1UEIA 4QBIA 2GTPA 1G16A 3GD7A 1IN6A 4RKEA 1G21E 5E7IA 3CPHA 3F8TA 4B71A 4LYJA 1A5TA 1U0LA 521PA 1TADA 2ZE8A 4RFSB 4IOKA 4G5OA 2ZEJA 2F55A 1II8B 2O0JA 1G8HA 1TNDA 2CL6X 4GOJA 2HF8A 2KSQA 1SQ5A 4XJXA 1OW3B 2ZRPA 1N0UA 4M9ZA 4OQXA 4PHFA 3F5FA 4C30A 4IHQA 5JCZA 4M1OA 3GP8A 1IN4A 5EP1A 2AX4A 2PLFA 3CZQA 3MWLA 4JS0A 3WYAA 1ODFA 1VYUA 3EA0A 2Z4SA 4FCVA 2HUPA 4HZUA 3MLEA 4D4MA 4Q9HA 1VG9B 3MGCA 3O8CA 3RSOA 3NEYA 4NONA 2JLWA 3VU9A 2H5EA 3IIKA 4DIDA 3LD9A 4LGMA 3VNUA 4JKIA 4LPSA 4PC7A 5KPJA 1LNZA 3U2QA 4IDNA 3AVYA 4CEJA 3SYKA 2VTKA 1OJLA 3CR8A 2WBLC 2NZ8A 4X8OA 4BLSA 3DDCA 4H9GA 2F7SA 1KDTA 1Z6AA 3ZZTA 3SJCA 4IFBA 4KLZA 3RVBA 1LV7A 2O0KA 3Q85A 2RMKA 4Q4HA 4WW0A 3IQWA 1WQ1R 4F38A 1KIMA 3LLMA 4BLQA 5FTNA 1F2TB 1G4UR 1PZNA 1ZC4A 1RW4A 2EYQA 3AUYA 4C3ZA 5DIFA 3QEJA 3HU3A 4M9XA 1P7CA 4QBFA 3A36A 4TWZA 1XNJA 3DZDA 3CRVA 2HCBA 1ZVQA 2PZFA 5BQ5A 4LPKA 1Z6YA 2V3CC 3C16C 3CH4B 1QG2A 2X19A 2IYVA 1IQPA 3SZRA 3QG1A 1E99A 1GOTA 3RAPR 4QFMA 4A4DA 3BBPA 2EYUA 1TL7C 5C4MA 3KJIA 1ZM4A 4LZZA 3VR6A 4P31A 3EWAA 1E32A 5CYPA 3ZD7A 3K8YA 1IN5A 2FZLA 3R9IA 3QF7A 1ZU5A 4GNKA 1NVVQ 4Q4AA 3ZVLA 2J7PD 4FN5A 5KO2A 1NN0A 1YZLA 4DB4A 3BB3A 1H8EA 1P61B 5CYOA 3CF6R 2D06A 3A37A 3EASA 1E2FA 1FMLA 3P27A 3QIAA 1ZUHA 4LV8B 4BFYA 5C18A 2F1IA 3QSYA 2PCLA 1UBGA 2YWGA 4Q00A 4NYIQ 4KYUA 2NMVA 2D7DA 3ASZA 3OE7A 2R6AA 4POAA 1TU4A 4E07A 1KO8A 3E70C 4HATA 1E4VA 1JR6A 1SXJD 1O3YA 4ZKEA 1QHIA 2P67A 4P4SB 3O8DA 3R7WA 5KSZA 2XNDA 2A3RA 3KKOA 4LRWA 4V02A 3WHKA 5JJLA 2WJYA 4II7A 3AVPA 4JLMA 4MRNA 1G19A 1FP7A 2IYYA 2OE2A 1E2EA 1X86B 3FWYA 1G7CA 3TR0A 2OCPA 4MYCA 1M6NA 2ZI4A 1GRNA 4TYWA 1J7KA 1Z0KA 2AR7A 1G17A 2HYDA 2O0HA 1DEKA 2YC4C 2ZETA 1D8TA 4LSGA 1JNYA 1TEVA 1OYWA 4M4SA 2R9VA 1HY3A 3I73A 1ANKA 1E6CA 4PR0A 4BFSA 5E7JA 2YNMA 4PTLA 4DB2A 1SULA 2OCBA 2V8OA 3O8RA 1E9AA 1S2MA 1IAQA 1KI1A 3CH5A 1NJFA 3GEEA 1P72A 1W46A 5JEEA 3PUZA 1IJFA 3A1TA 2GEUA 4QGGA 5E3HA 4TL8A 1AS3A 4N0EA 2FSIA 4EPVA 1DBSA 1YZTA 3H4MA 4G1UC 2ZSDA 2AD5A 2UVQA 2ZAMA 2VHQA 2W6ID 2XSZD 3B1ZA 2NGRA 2QBYA 1CJTC 3EC2A 4Q9KA 5FUYA 2BM1A 4C0AC 3TGPA 1E9DA 1IY1A 4PHGA 5SZKB 2JA1A 2NZJA 3QXSA 4DLUA 1KK0A 2J0UB 2VQSA 1U99A 4OHWA 1KSFX 1IN8A 4AK9A 2YVUA 1Z06A 1KI6A 5EXXA 3K70D 4DBLC 1ZCBA 2P6RA 3HPRA 2JIZD 3Q7PA 4XD7A 4IDOA 3T1VA 3T35A 1N6OA 2B7CA 4OJQA 5FBLB 4TLEA 1J90A 2DBYA 2ZITA 2ZXUA 1P62B 2ZU0C 1X1RA 3Q72A 2YINC 1D6JA 1ONBA 2FGKA 1AGRA 1DG3A 1W1WA 1JBKA 5AJZA 3BK7A 4P0TA 4NPHA 3TK1A 4KFRA 2ECKA 5F9FA 4RD6A 2GCNA 2Q9CA 1PLJA 4LK2A 4NU0A 2BBTA 4YONB 2OLJA 2OV2A 3FPAA 1HYQA 3HR8A 3I92A 1AM4D 5DSZA 5K8LA 1GUAA 5TVKA 5LBIA 1YVDA 1EFRA 4X8HA 1VCOA 3S1AA 2ZRCA 4B75A 1PUJA 3RRMA 3KFVA 1BYUA 3CF0A 3LQRA 1P5ZB 3REGA 1DOAA 1NBME 1GP2A 2VRWA 3PUYA 5FTKA 2W00A 3V9PA 2YOFA 3W5JA 1T6NA 2ONJA 4XOIA 1AA9A 1KGDA 4MRSA 1OT3A 5EXTA 3SFVA 5JHGB 3QPUA 4GOXA 4DLZA 3U6BA 3CF2A 4DSNA 2WAYA 1VMAA 3PUWA 5CK5A 5DHFA 4LHYA 3VNVA 4C7OA 4V0KA 2ZRIA 3GJ4A 1L2TA 4YDSA 4PPNA 5BYKA 1HH4A 1KOFA 1ZW6A 3QI2A 2IXFA 3T1TA 2O8FA 4B48A 4DJTA 3N70A 2B6HA 2G9NA 3V4RA 1WF3A 3WP0A 1NVUQ 2JLRA 2CL7X 2A2ZA 3ZS8A 3MJHA 4OYHA 3LRPA 3AQ4A 3L43A 3UATA 1Z0IA 3QKRA 2DPXA 3KQUA 3DPUA 4A2WA 4ARZA 4ESVA 2YWEA 2G83A 1T0HB 4EFLA 1NSFA 2HXYA 4V03A 3AKYA 2ZSBA 1ZNZA 2HLDD 1Z6TA 4LHZA 4W5JA 2FH5B 2FPLA 2FPKA 4MDEA 3MSXA 4IOLA 2ZPTX 3BERA 3CONA 4RD4A 4ZCLA 4RCYA 1SVLA 4Q7JB 4EJSC 5FOVA 3MG9A 1Q44A 4G5GA 5DI3B 4YMUA 5BN3A 1EFRD 4EUNA 2ZR0A 3C5HA 2GCOB 4HAWA 5G41A 4URXR 1CS4C 1OFIA 5J5CA 4QG7A 1YR6A 2WOJA 4YLGA 1OH7A 3LBIA 3PG5A 1XMSA 2EWVA 2CHGA 3FYHA 5KDOA 1MABB 3RWMB 3V4FA 1Z63A 1UEJA 1NBMA 4L8GA 3OIWA 3Q3JB 1RC8A 3U4QA 4WXPA 1BH2A 4W5WA 2DWQA 5J4KA 5FTMA 5DISB 2R6GA 2CXXA 1MRNA 5LD2C 1JALA 1W4AA 2P2LA 1E9FA 1XWIA 3RS5A 2X1VA 3BFXA 1XTRA 3QUSA 4KO8A 5ELXA 1X3SA 1E9BA 4MQBA 3ZZUA 4R2HA 4O3MA 1CU1A 2XITA 2GJ9A 4NDZA 2ORVA 1G3QA 3CX7A 3E1SA 3W3ZB 2A5YB 5FPYA 4IXMA 4AWXA 1R0WA 1ZM2A 1UBFA 1QHHB 2B8TA 4GP6A 4ABYA 5HCIA 4G5QA 3CKLA 4TN1A 3B1WA 5IRCD 3JVVA 4DCNA 5J40A 1W0JD 1SVWA 4FW9A 3RS3A 4BPBA 5HE9A 4Z54A 3TBKA 4B32A 5B57C 2WSMA 1XTQA 2GCPA 4A1FA 1NF3A 1TEXA 3DM9B 3KQKA 1Q1EA 3OIUA 4B6EA 1N5KA 2YJTD 1E2GA 3VQTA 4Q9JA 4KV9A 4GPTA 1VTKA 3GJ6A 1KI9A 1OXTA 1I4LD 2IT1A 2OFOA 3LXRA 2EFEB 4LCBA 4PPGA 4BZQA 2JLQA 2CNWD 2H8KA 2X2EA 2RGNC 4RY2A 1WDTA 5FH9A 1G41A 3U3JA 3M1IA 4BLPA 1S3GA 2WPDA 2YOGA 1W49A 2QAGC 3NC0C 4HB4A 2ZR9A 5GJVC 3EZ7A 1FP6A 3JZAA 4JJZA 4Q18A 5FBRB 4LYHA 4GOKA 1E79D 5L3QA 4BECA 4DIEA 3KKMA 2CK3A 2PX0A 1RPZA 1DAHA 2PT7A 2FV8A 4JSTA 3AF3A 1WBBA 4ILEA 1VHTA 2WIBA 3VU9B 4C0HA 5GJCA 2P5SA 1OE0A 2QPAA 1KNXA 1VIAA 4B73A 1ZNXA 2BC9A 1YRBA 3TUZC 2WKQA 2AWOA 1YRAA 2AK2A 3UK6A 5CB8A 1BMFA 4TMVA 4A15A 4CEJB 2XZPA 1P3JA 2CJWA 4PZLA 3CUEF 3NBYC 4XWOA 3EPLA 3TQFA 3EZFA 1E2HA 4Q7MB 1NMZA 3P1JA 3FMOB 1G3IA 3WY9A 2RKOA 4Q4HB 5JCPA 1NVWQ 1M1YE 1Q1QA 3CB4A 1NLYA 4BFTA 1BS1A 3P4YA 2XXAA 1EFHA 4OHZA 4ERNA 3MWKA 3AVQA 3NC1C 3UMFA 3RRNA 3NDPA 2J7KA 2ZRDA 4DHEA 3K9LA 2WKRA 4Q5IA 4DDTA 3CW2A 2H57A 4NL4H 4FCWA 1XPUA 2TMKA 2J45A 1XP8A 2QT0A 1E1QD 2GZHA 2ZI5A 3MFYA 2MMCA 1XB2A 4HDCA 121PA 4TQ9A 1RZ3A 2BCGY 1E9EA 3GJ8A 1YHNA 4M2LA 3W34A 2GDJA 3QY0A 3FKSD 3EPHA 4LV5B 2FG5A 3FHCB 3IQXA 3BFKA 3SQWA 4DKXA 4EPRA 1W0KA 3IBGA 3SJAA 2IF0A 5FL3A 4Q4AB 4NYJR 2AFHE 1F2UA 5F98A 3WMEA 3KZ1E 2B92A 2FJUA 4PC6A 1UAAA 2GXQA 5JI2E 5AUOB 4L5BA 4GI7A 4IW3B 2ZSEA 1C1YA 1HV8A 3SR0A 4RZXA 3OIYA 1R6BX 2Y8EA 1TF5A 2C9CA 3KKQA 4PO9A 1KTVA 1MKYA 1Z2CA 2DWOA 2H16A 2BBSA 3KB2A 3C8UA 3IBYA 1L8QA 3QF4A 3ADBA 2ZJZA 2CEAA 2QE7A 5A5GA 1EGAA 2ZE5A 3SQXA 2DYKA 1BKDR 1DAMA 1H8HA 3NH9A 1QHYA 1HQYE 3NTUA 2BEJA 4A82A 3R7WB 3MCAA 1Z6GA 1ZM3A 2NPIA 2IYQA 3OESA 2DFKB 1MOZA 5FBWB 3B9QA 4ZO4A 3TIFA 4EPXA 3UG7A 3CX8A 5KTYA 4LY6A 1MO5A 3WRYC 4PSKA 1CJUC 5IF9A 3PEWA 2IYSA 1TQDA 4MKHA 3AKCA 4AD8A 1E2PA 3U5ZB 4D2IA 3BWDD 5JRZA 1R5BA 2WM9B 2OO7A 4AC9A 4BE7B 2VLIA 2FSGA 2RCNA 3FVQA 4ZDJA 4WIAA 1T4GA 1ZNYA 3IIMA 2GBLA 1ZIOA 2PH1A 1DADA 3E5HA 4LDJA 1EWRA 2QBYB 4D4KA 3SHFA 4DSOA 2XZLA 5CLQA 1HQCA 4Q1AA 2IYRA 3BXZA 3I5YA 4C0JA 1XRJA 2CLCX 3VHXA 3ZVRA 2ATVA 2ZI9A 4NCHA 3AVWA 1RVDA 2CCGA 2WIAA 1K5DA 4LJ6A 4RZUA 1TUEA 1Q1BA 2OUKA 3AP2A 3D7MA 2AWNA 1XXHE 1XZPA 4MITA 1KI6B 1OXVA 4OQLA 1X8JA 2AHOA 4JT2A 1JR3E 4B3XA 4IKEA 2Q9BA 4C9BA 2WMOB 3K0CC 4OQNA 5FFMA 1KJWA 1X8KA 2IA5A 2N42A 4I1VA 3THYA 4TTQA 1U90A 2IYLD 2UZIR 3ICEA 2UZ3A 4B6FA 3QG5A 4C0LA 4B3CA 4DUGA 2IYZA 4MGIR 3W6PA 4CYMA 1HT1E 2GWHA 4RKFA 3VX3A 3A1WA 1JJ7A 4MGKR 1YZNA 4AYXA 1CR1A 1TF7A 1SVSA 3GLFE 5F3WB 2MSCB 2ZVPX 2GJKA 1G8YA 2WV9A 1CR0A 4KVAA 3RC3A 4FWTA 1CJVC 3F3YA 2QG6A 3L8ZA 4HLUC 5C4GB 3NHBA 1ZJ6A 1E3MA 3FTQA 4PO1A 2GVDC 1YR7A 1CXZA 1TX4B 3L0OA 4NZYA 4ZIRA 4KYIB 3VMFA 4UNPA 3K70C 1YU9A 1Y3AA 2FWRA 1KSHA 3S1AB 3K9GA 4DSUA 3R9WA 3IHLA 1LY1A 5EE3A 3TMKA 4PAMA 4EQ6A 1VCMA 2RGNA 3A1UA 1J70A 3ND8A 2Q3HA 3MJRA 1SKYE 3AVOA 4XWAA 3FMFA 2HXSA 4B74A 1KO4A 1P2TA 2QAGA 2JLZA 2RH5A 3TAUA 3BH7A 2Q6TA 4BFZA 2PZGA 3M6AA 1ZM7A 4NTZA 4PC2A 2F9MA 2A5GA 3K0FA 3KFXA 2Z83A 3K0AA 2GEDA 3RDPA 4LI0A 1G291 1U8ZA 4JBYA 3NVAA 5CM9C 4C7OB 5H68A 5P21A 1WXQA 1XXHA 1NIPA 3IUYA 3VHLB 4K81B 2WOOA 5FUVA 2C99A 1N25A 1RRCA 1A82A 4MYUA 4GMXA 2HF9A 1CBUA 3BGWA 1JR3A 1NP6A 5FOWA 3CIOA 4TMKA 3EX7C 1GRQA 4URZR 3GCGA 1D5CA 2O8FB 4TSFA 1NSTA 3KUCA 2X2FA 4NP6A 2XB2A 2IEZA 1F3OA 1EX7A 4RZ3A 3SS8A 1G3MA 2FOLA 1W48A 5CDFE 3OAAA 5BW8A 5JEDA 3QKRB 2PEZA 1XZQA 1QG4A 3ZZ0A 3LX8A 2Q3FA 4AG5A 4ARZB 1US8B 3O8BA 3ZLJA 4Q4JB 3W3AA 3T61A 1NLFA 4P4UA 5IT5A 2KJQA 3AEZA 2AK3A 5L3SA 3GLFA 1GKUB 821PA 3WNBA 2C9OA 4M9QA 2WWWA 4RSGA 4B76A 4TLDA 2FDCA 2AKAB 1NKSA 2VP5A 2UKDA 2VP9A 3D3QA 1GL7A 2OXCA 4MH0R 3W6NA 4CIDA 1ZIPA 4EDHA 1G64A 5JECA 1OXUA 1V5WA 2E9SA 3P4XA 2ODEA 3D31A 4DLVA 1N5LA 3SN6A 5IHPA 1NNEA 1VIYA 4TQAA 2WWGA 2ODWA 1FTSA 5FPHA 2QENA 2QT1A 1ZD8A 4E03A 4B3GA 1TU3A 2WHXA 3QENA 3B13B 2VSOA 2I1QA 3U4QB 2VP6A 1EESA 3MMPA 5B64A 5CK4A 2OESA 2W0MA 2P6NA 4A6PA 1W2GA 1W36C 1F48A 2QU8A 3B8HA 5TY0A 4A8JB 3ICQB 3IO3A 2BMDA 3OF5A 3T34A 2BJWA 3DMDA 1XMIA 3C5CA 3AVUA 4TT3A 2OAP1 1GAJA 2QL6A 3BC1A 5IDVA 4Z1MA 1JR3D 3W5IA 2HYIC 5L3RA 4URUR 1G6HA 3SOPA 2G77B 1W44A 1CEEA 2ZANA 1CP2A 2ZYUX 1Z22A 2D3WA 2ZIAA 4A0HA 1UKZA 3NBZC 2R44A 5EXSA 3OAAD 2OCYC 1UDWA 1DTSA 5DN6A 1FMJA 4Q01A 2GZAA 5AJXA 5CDFA 5D3QA 2GAAA 1S9HA 1UKVY 1G8PA 2RGXA 4PC3A 4MYHA 5JS8A 4DEYA 2WAXA 2VIIA 1HE8B 4D26A 3TNFA 1U9IC 2XB4A 2C78A 4M22A 1KHTA 3LXXA 5DH9A 4H1VA 2ZUCA 4ITRC 4JLNA 2WJIA 3T1QA 2OT3B 3SU8A 1AZTA 3VR5A 5EE5B 2PLRA 3O47A 4RVCA 2YKGA 1NG9A 2RGBA 1EXMA 3LBHA 4LC0A 5HZHA 1HTWA 1MR3F 2EWWA 4TMTA 5L3QB 4UNSA 3U44A 1C9KA 2ZJOA 4DCVA 5KNBA 4JLDA 4A0GA 3HWSA 2QQ0A 4C2UA 1GFIA 3QPVA 3G5UA 3LDAA 5H8WA 1E0KA 1KNQA 1XEWY 4I1SA 2ZRGA 1GL6A 5G53C 3X1YA 1G5RA 3GEIA 4KU4A 3ZJYA 1YZKA 1T5LA 2HDNB 1IN7A 2J0QA 2YV5A 4BFVA 4DLWA 4Z1MD 2FZ4A 1WE2A 2WICA 5TDHA 2J3EA 2CJWB 1HT2E 3FE2A 1DAGA 3DOEA 2JJ1A 3MWYW 4YDHB 1KK2A 1AIPA 1YR9A 5FTLA 1W5TA 2WJVA 4JL6A 2QRZA 3NG1A 4B34A 3GLIE 6Q21A 2XXAB 1KO1A 4PAQA 5TV2A 3PITA 3X1WA 1L7VC 1XU4A 2P65A 3K1JA 4OBEA 3RS2A 5SZJA 2RGGA 3N5CA 4B2PA 2CHVA 1R5NA 2PX3A 1Q22A 2E87A 3ASYA 2JDIA 4URYR 3B1YA 2ODBA 2BIFA 2AFIE 2DR3A 3R8CA 2AXNA 3RS0A 2PCJA 2NO1A 1VG1A 4GMDA 2V55B 1LFDB 1TPZA 1P2VA 4Y0AA 3TVDA 3PENA 3WMFA 3RC8A 2OG2A 4CDGA 1RRPA 3LFUA 2WWFA 3BD9A 4QNMA 2IS1A 1J8MF 2QTFA 1P9RA 1OHHA 2FE4A 4F93B 4KSCA 4A92A 2WWYA 3GLGE 1FX0A 2H7VA 4FMDF 1JAHA 1N3BA 2G1JA 1HURA 1ZRHA 4Q1BA 2JLXA 1KAOA 3PV0A 3U7EB 3WRXC 3AKEA 4DLXA 1XEFA 1XMVA 1NLZA 1GITA 4WOPA 1M34E 1IXSB 2IW3A 3FFBA 1AS0A 2W6JA 4TQUS 2RGCA 1KO5A 4Y0VA 3K0EA 3IHWA 3SJZA 4DLTA 5FPKA 1M7BA 5G3ZA 4CW7A 4GT1A 4MGZR 5DHAA 2F9LA 4QGFA 2G1KA 5E7MA 1ETUA 1YE8A 2NO6A 3TR5A 1ELOA 2Q3MA 3JZMA 4D82A 1JXMA 1OKKA 2XEXA 4NCNA 4QRHA 3LWNA 3QF4B 3U3MA 1N6KA 1R4AA 1NVVR 3PIRA 2VP0A 1H8ED 1KSJA 5E4FA 1GNQA 1E2NA 3GLIA 3KQNA 4PPQA 1SZPA 4TTRA 4NKRA 4JL8A 2Z5FA 2IS6A 3OE7D 3A58B 1JI0A 1T0JB 5BYJA 3TVTA 5JJIA 2GILA 2H92A 3V00A 1E94E 3PJRA 3BE4A 1W2HA 3DM5A 5DI9A 5DLQC 1Z83A 2XNDD 3TH5A 1TUIA 1X8LA 3GJ5A 2H1LA 221PA 3SE0A 3DKVA 3PXGA 2A9KA 1JB1A 4MKFA 3GLGA 4V0LA 4AURA 3VFDA 3IO5A 1T3SA 4M1MA 4ESHA 4CEIA 2IX3A 3IPXA 3TUJC 1NN5A 3LV8A 4Q02A 1DPFA 3WHLA 4F7WA 2A5FA 1TF2A 2V7QA 1T3HA 2CDNA 5FOUA 1FNMA 3ND9A 1XTIA 1AJEA 2NG1A 2DFNA 3A6PC 2QMEA 2VA8A 4L9WA 1ZUNB 1HA3A 1ZUIA 2P6UA 1IOZA 1ZINA 1WB9A 2KBFA 4HDOB 5LB4A 2O8EA 1CLUA 2GRJA 5LD2B 5JBQA 1G8GA 2N46A 4LBWA 4F4JA 2ZS9A 1Z0AA 5HR5A 1MT0A 4A0FA 3KXIA 4WVFA 2QROA 4XVRA 4XTCS 1YJ5A 3THYB 3ADDA 5G3YA 1RIFA 1TQ4A 2WTUA 4BWYA 1U8YA 3SBEA 2QTVB 1OB2A 5C1BA 4DT1A 5B2ZA 4ZDKA 4IDQA 4CRWB 2OCAA 4C2TA 1Q21A 1YQTA 2IYXA 5KNDA 1S3SA 4UJ3A 3TSWA 1IONA 3CPEA 2FU5C 1II9A 3B7GA 2CVFA 1E69A 4XD7D 1GL9B 3BJIC 3NXSA 1OIXA 3KTAA 3WNCA 2YWHA 2EFGA 4JBXA 4KJZA 2XTZA 2ZUDA 5FL7A 1OH5A 5EE0A 5FOXA 4NCIA 2YHSA 4HYYA 1E9SA 4D0NA 3GLHB 1VECA 1XD2A 2IYWA 4JJKA 4MYTA 1A7JA 4ZIRB 4D25A 1FQKA 3RLFA 2R8RA 1GKIA 2H18A 3DL0A 2WSSA 4UXHA 3T5DA 4WBSA 4QGHA 4EQ6B 3EPKA 5KSPA 4ASUA 2ZRLA 5EUQB 2ZJ2A 2Q21A 5CJ2A 3L8YA 2RHDA 1DARA 2D2EA 3QNUA 1NRJB 2K5UA 2VF8A 3K0FB 1ZYUA 3K0AB 4HUQA 2I1VB 2Z6VA 1XXHB 421PA 2WJJA 4M1TA 4DXAA 1SVMA 2Q0HA 3GQBA 3KJGA 3KJEA 4UNNA 5H70A 2EFHB 2FEMA 2J9RA 1CJMA 3B60A 1UM8A 1WP9A 1YKSA 4QHTA 2ZS8A 3EZ9A 4JLBA 3U60B 4P32A 2ZUBA 4DZZA 1RKBA 2E1RA 2A5DA 4DCSA 3D8BA 4US2R 2WWXA 1CRQA 1QVAA 1AQYA 1X1SA 1GILA 2W0SA 1LTQA 2V4ZA 3OZXA 1GWNA 1E1RA 1MO3A 1U0JA 1RFLA 3AKDA 4LJ4A 4BZPA 5KDDA 4BEJA 2IWRA 5L3SB 5TB5A 1XJ0A 2REBA 1DS6A 3GLFB 4DLRA 3DEFA 1Z08A 2V1XA 5FL7D 3T06B 3KXKA 5AJYA 5FUWA 1P2SA 2VEDA 4JMPA 4KHZA 2EQBA 2ONKA 2QQEA 1EG7A 1UBEA 1R2QA 1B23P 3KDSE 5GVSA 4KLNA 1PUIA 5HE8A 1FNNA 1RYHA 2C77A 5BWMA 4A0RA 2IS2A 3Q9LA 1G7SA 2KE5A 4OHXA 2O52A 1KI7A 2J46A 3SI7A 4MDFA 1KDOA 2JJ2A 4OKSA 1XCPA 4Z8XA 4CEHA 5FPTA 1QRAA 1SKYB 4G01B 1DELA 1HEIA 2VP2A 3ETLA 4URWR 3A1SA 5LB2A 5UKDA 3UKDA 2BWJA 1JEEA 4TL6A 2BV3A 2I4IA 2JLVA 2B21A 2QMOA 2H17A 2VHUA 3VR4A 4KI0A 3WBJA 3THOA 3QXCA 5FBVB 2Z0MA 4NH0A 3SJBA 1NJGA 3MUFA 1NBMD 1T8TA 4RFVA 3IEUA 4TL9A 5KSOA 4HZUB 1EX6A 5F2EA 5FI1B 4DWJA 4D0GA 2FX3A 2O8DA 3HU2A 1ZD1A 1E0JA 3UMSA 4EKDA 5BN5A 3SDZA 1Q1ZA 4XTRA 4MRVA 4FD2A 1U94A 3OEEA 1E2QA 2GK6A 5JWOA 3CWZA 1OLOA 4RD3A 2YYZA 1V43A 2GKSA 4JLPA 2LKCA 4FINA 3GMTA 3BRWD 5FBQB 4TYYA 3RYTC 4W5HA 2BEKA 2OBMA 3R9XA 1NG1A 5AJVB 3VKHA 1A4RA 4OHYA 1N5JA 2C98A 4NYJQ 4C0KA 1OFUX 1UKEA 4J0QA 4R71A 1UADA 1EFUA 4PHHA 4IDPA 3U44B 3KXLA 3QEOA 2AL7A 4JT4A 4HAUA 2OXRA 1RRGA 2NO0A 4CF7A 4GP7A 2VH5R 1X6VA 2I3BA 4KODA 2NPFA 3OEHA 4PPFA 1P60A 2RGAA 1VDZA 4XIGS 1E2DA 3K0SA 3HR7A 2WPDD 3AP1A 1KI3A 3Q8XB 1E2IA 3H0KA 5HTKA 1N6NA 1UPTA 4ACAA 1P9WA 3I32A 1WA5A 3EA5A 3CRMA 4LBYA 5JFGA 2F1RA 4E5UA 2BM0A 1OFTA 2CK3D 2GEVA 4QJ4A 2QUZA 2ZE6A 3AH8A 1R8QA 4JLJA 1WCV1 3GEHA 5EZ6B 2Z43A 3IKJA 1M7GA 3I61A 1EWQA 4C4PA 3BAFA 1S96A 2WJHA 4PANA 1Z0FA 2F6RA 5JLJA 4YMWA 1IY0A 2JJ8A 2QSZA 3N2EA 3QXXA 1KMHA 3U3OA 1CJKC 1Q3TA 3EWSA 4MA4A 3VX4A 2W58A 4HB2A 1I4DD 3LH5A 4LUCA 1Q57A 4M9SA 5JHHB 2XGJA 4BUJA 1BMFD 4GBMA 4GSYA 5CIQA 1E4YA 1LF5A 3I8XA 1CIPA 1G3UA 1DVRA 3PUXA 4BQSA 4RD0A 2ERXA 3IGFA 1P75A 1ESNA 2NOAA 2FFQA 4BFWA 1W5SA 1KO7A 2IL1A 5FR2A 4RD2A 1COWA 4QM7A 3JVUA 3NBFA 1ZBDA 1DO2A 1XJCA 4KCGA 4IFEA 1FX0B 1Z8FA 3LNCA 1WBDA 1ZM9A 4JVLA 1E2LA 2J87A 2ZREA 3HP1A 4UNQA 1VKJA 2REXB 3KKPA 4Q47A 4LYFA 4O0MA 3AGQA 4HAYA 2ODNA 1OH6A 2GZDA 4XWKA 2GAOA 3PEVA 4N0DA 1M8PA 4W7SA 1FUUA 2GVZC 3P32A 4UXIA 4P4TA 4Q9LA 3IEVA 3UG6A 5J47A 2F43A 3LLUA 3B85A 4IEIA 2LKDA 2CLDX 3R8FA 1W0KD 2BHRA 1N6PA 2QA5A 3TUIC 3KQLA 3OHMA 2V1UA 1OSNA 1QF9A 4EJSA 2AD1A 1SXJC 4EFMA 2F3TA 1AKYA 4QNRA 2FNAA 2HEIA 3Q5EA 3RWOA 1KY2A 4AKEA 1KZGB 3GLIB 2J1LA 1UBCA 4EPYA 2A30A 2QPOA 3FHTA 5EE1A 4QBGB 5A0FA 3QXJA 2J5XA 1F5NA 2BBWA 3OFNA 4HLCA 1IXZA 2JAQA 5KHOC 1R0ZA 1O87A 2G3YA 3G82C 2QE7D 1JQLB 4MUAA 5B30A 2ZS7A 2ZRBA 1COWD 3EIQA 3KX2A 5CLLA 3DOFA 4Q1CA 1H8HD 1S0UA 3K9HA 3WP1B 2ZRHA 3ADCA 3E2IA 3A4NA 2GETA 1U2RA 1OIWA 3QPWA 1XTJA 1S9DA 5AUPB 1KZ7B 3H84A 3MWJA 3AF4A 3GLGB 1LW7A 4UXJA 1T9HA 3GJ3A 3LVQE 2PZEA 1G1MA 1NKTA 1EFTA 5DE3A 4ZDIA 4CEIB 4AKHA 1J2JA 4JVSB 5JWRA 1W4CA 2CCJA 5LPNA 5EQTA 4I99A 3RHFA 2ZYWX 2RGDA 2QNRA 4TL7A 4Z8YA 3CR7A 3BS4A 3RRZA 2B8WA 1NL3A 2IEYA 3FMIA 3QE0A 2O8EB 1OFHA 2XOKA 3VTKA 1JAIA 2OAQ1 4A9AA 2PMKA 4TYQA 1NY5A 5ANRB 3FDIA 1M7HA 1Z47A 4I4LA 3IILA 4B3BA 3UWKA 2HCJB 4FCTA 3ZIAA 1K6MA 1P73A 3IDQA 2OILA 4JYCA 5M04A 3U6KA 4QHSA 4KITB 4PQYA 5EZ5A 4DT1B 3K9NA 2IK8A 3A4MA 3DZ8A 4PAOA 3K09C 2ANCA 3RNLA 1Q12A 2JATA 5EP4A 1KDRA 3BH6A 3AM1A 1UKYA 1W7AA 2BJVA 4QJ3A 4JLOA 1XFAA 4DLSA 4BRUA 3WYFA 1QHGA 3R20A 1N6RA 3KTAB 1A2BA 3HJNA 4NCKA 3KQHA 5JMTA 1T5IA 2QM8A 4TLBA 2XTMA 2J0SA 2X8AA 2CBZA 1OXXK 4IVRA 1QZXA 2ZTSA 1MRSA 4XVUA 4IJMA 5JSZA 4DUGD 1OH8A 1XDBA 1XD2B 2BMEA 1NMXA 1N5IA 3AB3A 3L0PA 3CO5A 5DYIA 3G0HA 2O8CA 3NKVA 2HT1A 1OPXA 2VPPA 2WWHA 3TLXA 2GCOA 4MGYR 4FXPA 1NMYA 4IDHA 4AKIA 5SZHB 5HCNA 4JYBA 3LQQA 3HDTA 1VPLA 3RS7A 5HZKA 4FMBB 4OI4A 1CULC 4LC1A 2RHMA 2DFLA 2ZYVX 4G5SA 4GZLA 1VCIA 1PLKA 3GJ7A 3ZS9A 4WA7A 5JWHA 3C14C 3AF1A 1XJQA 4HB0A 4HUQB 3QOFA 4U5XA 1VCNA 3NH6A 4NYMR 5JI3E 2NO9A 5FPSA 1LB1B 4QXAA 1RJ9A 1N2CE 2JEOA 4JSYA 4WAUA 2EFCB 1SHKA 1D9XA 5CB6A 3ZIAD 4TZ0A 4IOJA 4D4JA 1LVGA 1XD9A 1K5GA 3AF0A 2JLYA 5GJBA 1CF4A 3MD0A 2R6CA 3NBXX 5BN4A 1K8RA 1YR8A 3B5JA 3ZVMA 1XTSA 4PC1A 1SXJE 2VHCA 4JBWA 3AP3A 4JLVA 4GL2A 4YQFA 1KAGA 5GJWC 3EARA 3FHOA 1CTQA 2HV8A 4G3XA 4KXFB 4TLCA 2YOHA 3C15C 3VKGA 2QGNA 4WZ6A 4Z51A 2JASA 5GADl 4TSFD 4TYNA 3CWQA 2P3SA 5C46F 1Z29A 3WXMA 2W2VA 4UJ5A 8OHMA 1OIVA 1T8UA 2D7CA 2KI5A 2N1BA 4S35A 3RSLA 4OI0A 3MRSA 5KNCA 1W47A 3PEUA 3FFAA 4PO8A 1TMKA 2C04A 4Q1FA 3X2SA 4YXWA 1HE1C 5KOYA 1I4TD 3ZGXA 3N2IA 4B44A 1RRFA 5J4HA 2GA8A 3Q7QA 1AGPA 2R62A 2OFXA 3QQ5A 4CEHB 5CJPA 3PUVA 2VP4A 3PFIA 4OI2A 4FMDB 4DCTA 3C41J 3B1XA 1R8SA 3CX6A 2ASEA 3QKUA 2PJZA 2A5JA 1TQ6A 2QP3A 3PR1A 4JL5A 2J7PA 4F92B 2W2XA 3NIBA 4BGDA 3EIHA 5EP2A 1SKQA 3CNNA 4L9SA 4M1YA 1R7RA 3U3RA 3CZPA 1E2MA 2O8DB 2PMDA 3H1TA 4Q7KA 4MUBA 3UWOA 1MV5A 4U02A 4FMCF 2EU8A 1FOEB 4BZXA 1N6LA 1QHXA 2CE2X 1G18A 1SXJA 2KB0A 1JXOA 4TT3D 3BOSA 4UKDA 4B2LA 1YZGA 3L0SA 3W8RA 3ZVNA 1L4YA 2A7QA 1A2KC 2IYUA 2WWIA 3DVLA 3U7FB 2ZU6A 4O25A 1LS1A 4BFXA 3QXHA 2QP4A 3TKLA 2CL0X 2YC2C 5DN6D 2BDTA 2R6DA 2W83A 2NO7A 4F4CA 4IEEA 5SZIA 2G0TA 3BORA 2FEOA 4YXWD 1GRRA 5EJEA 1KKLA 1IXRC 3PEYA 1GNPA 3K0CA 3U7GA 2QMUA 4K8OA 3P20A 2EFDB 3OIVA 2IUTA 2C8VA 3BIFA 2MSDB 1UF9A 3AV0B 1FW6A 1AN0A 3ZQ6A 2BOVA 4GZMA 2F1HA 2GJAA 1PV4A 2BMFA 4A8JC 5GVRA 2G6BA 2GESA 2IUSA 3ZD6A 2ZJ5A 4D80A 2ORIA 5FR1A 3SEAA 1XBTA 2W6IA 2XSZA 1Q0UA 3DMNA 5AUQA 2XJ4A 2R2AA 1R10A 3LW7A 4KSBA 4HLUA 4NCJA 3CRQA 3BH0A 1CKEA 2RGEA 1XEXA 2FSHA 4JVNA 1Z6XA 4UQOA 4CVNA 2JLUA 4OJKA 4Q19A 3WNDA 1F2UB 5CITA 4AIIA 1KY3A 2JIZA 4QM6A 3W8NA 3KJHA 4ZDWA 2IYTA 2F3RA 2LCFA 1KMHB 2ZVQX 1N0WA 5DGXA 1G8FA 2ZROA 3AF2A 3CNOA 4ZPXA 4EPWA 5L3VA 1NN1A 2JLSA 4M8NE 4EPTA 1E2KA
chains in the Genus database with same CATH superfamily
1AKQA 1UC5B 3LLVA 4ISBA 1IE3A 2A1IA 4X7RA 1GIAA 1ZJYA 3IUEA 2WVHA 3EAQA 4Q82A 1TO6A 2D1FA 3S8EA 1UP4A 4OQ4A 3DDHA 1VA5A 1XF1A 3ANXA 4YRTA 4NFHA 5GM1A 1Z0ZA 3C7KA 3BCUA 1AO0A 2C7BA 2P2DA 2BISA 2K7ZA 3LXMA 2B94A 1QS0A 3JVEA 1LBEA 4Q4LA 1VKZA 2PFKA 5L8VA 3X1DA 1M1UA 4LJAA 4CT4B 4N6NA 1JU4A 4TTTS 2I78A 4DQ0A 2V6JA 1AKVA 1UBRS 3VR0A 2RH8A 1Z18A 1SG9A 4NZ9A 3NWJA 4MV6A 2PBFA 3R5TA 5KYUB 2HEGA 3OIFA 1CUDA 2QN2A 3E9CA 4NYIR 4ODIA 3BL6A 3T3NA 3K31A 1LF0A 1Y8AA 1L4MA 5KOHB 1XI2A 3LDFA 1PW5A 2PX2A 4EFDA 4GKKB 2QZJA 2NQ2C 4Z3DA 2I6TA 1BX0A 4JN6B 3S27A 2PHZA 2YV3A 1X94A 2PZAA 1OHHD 1Y63A 3KB8A 4G5HA 4IZOA 3RI3A 3EZ2A 3ZDQA 2F43B 1JIIA 3B2QA 8AT1A 3EXHC 4QQ8A 2W2MA 2D1TA 4R81A 5EIHA 5JXHA 3UUGA 4DCUA 2V7BA 3LUAA 4A2QA 2GYYA 3IJEB 1XTUA 1YQQA 2J5BA 3LT4A 3ND7A 3Q98A 1THMA 5BSFA 4BE4A 3IQIX 3FNIA 2H1CA 4Q48A 3RRYA 5JBIA 2C5GA 2EKBA 1U1FA 2ZULA 3L82B 5T8KA 3KUKA 2HT6A 2VYNA 1NULA 1NA5A 1QCYA 2PS1A 1QVRA 3PP8A 4MPPA 2G70A 5A4KA 2OBNA 1QK3A 2I6FA 3E9DA 1NOIA 1QG0A 2HMVA 2MSEB 4F1WA 1YDMA 1GPNA 2QP9X 3C6XA 3OKFA 4I14A 4FFOA 3ILYA 4UNRA 1T25A 1QR6A 1USIA 1W85A 4LJ8A 4IZIA 4KPUA 2VO1A 2LWIA 5FLEX 3V55A 2WWVD 3VO8A 4RMIA 3TOXA 4FNGA 5B12A 3ZY6A 4DJAA 1T9AA 3D0QA 2RKWA 1Z28A 2A1UB 3WWPA 1E2JA 3O31A 4GI2A 5KQGA 5IHPA 1KQFA 3P52A 4ND3A 2PGIA 4OGKA 4CM1A 1I2MA 3ZDFA 3FTCA 1IRXA 1UFQA 5FT9A 2WUDA 3WMWA 5BUQA 1T0PA 3LHFA 4L8VA 3LDGA 1H65A 2J41A 1O6BA 4L8WB 5C8YB 1IHDA 2EG5A 3O92A 3GRCA 4JI7B 2IBMA 1EHYA 1Z0UA 5K0EA 1HC7A 1BH6A 1SOUA 4LN1A 5DYGA 3ZWQA 1MNQA 3QU7A 3J7TA 3DOHA 1D9ZA 1PVOA 1CEYA 5EHIA 4MR9A 5DHRA 4B3FX 4YAIA 4D0LB 2XZTA 3QE9Y 1XK6A 1V7QA 3R7AA 3LKDA 2C8LA 1U9IA 2IF2A 1FX1A 2QRGA 3GT7A 1K06A 1UT5A 2CMKA 4O4JF 3FRJA 5HK8A 5JXWA 3C5WP 3K8OE 3PGJA 2PD3A 1F9AA 2YY5A 3C6ZA 2VWGA 2ZFUA 2ZJ8A 1ZL0A 3IAS1 5T41A 5CT4A 4GLFA 1G1AA 3H3JA 1Y5MA 4ZVTA 1PIWA 4ANFA 1C7QA 2JFUA 4OO3A 1Q19A 1ZGAA 4XYLA 1DXHA 5A1JA 1OC2A 3TZHA 4Q05A 2VYQA 4O2LA 1MA3A 1NRWA 3QKSA 2WAMA 4GPAA 1XF9A 4KACA 4PSAA 5AWFC 4M1KA 3FUWA 1UKAA 2G9UA 2D74A 4KK3A 3VI4B 4A5OA 3EBOA 3PA6A 1DQNA 3LBNA 1N0VC 1HNZB 3SYLA 4C0QC 5LXTB 4JEUA 1ULAA 1IIRA 2I2CA 2ID7A 4MV0A 3VVLA 3SIWA 2GEJA 4AKSA 1CDEA 2IYFA 3UFXB 3RODA 1UKBA 4P3KA 3FMPB 3QTLA 4DV7B 3WYDA 1NNLA 4JKOA 3KBBA 3T15A 3WGLA 4AN4A 4DN6A 2BCJQ 1Q0HA 2VDKB 4NK4A 3VPDA 1H2EA 3Q5DA 3HGMA 3LO5A 4GKAA 4D4LA 4DOMA 4A2CA 1XPRA 1QKKA 3EG5A 2FXVA 5F1KA 4IIYA 1QO9A 2I71A 3HXKA 4U8GA 2Z5VA 3IUMA 4R2XA 1PKEA 1GZDA 1E59A 2HSGA 3H5WA 3PD1A 4HI0E 4IICA 4ZRNA 5A9TA 5C8DA 3RUEA 1SCAA 1IHUA 3WYCA 2XNJA 1R6VA 3JWJA 3LVRE 4ENUA 5JTTA 5IVKA 1T4CB 2PYIA 4CF5A 2QTTA 3FOEC 1V1JA 2GBPA 2GN6A 2H4HA 3H75A 1G66A 5JUWA 3H3XA 5H9VA 4BL5A 2PWAA 3PCRB 4NBSA 1VGRA 1FUEA 1JWLA 3EEIA 3NEJA 2QAIA 4REMA 3FB4A 2EBFX 4DLAA 1JIXA 3SP1A 4V1CA 2H4ZA 2A58A 4P33A 2NO5A 1RJ9B 3QI7A 4RENA 4LVUA 4PZZA 5CB4B 3CNBA 4UM9B 5A4AA 4DV3B 4J6EA 4FGZA 3SKYA 3DEJA 2MSKA 3L2OB 5HJEA 2OZEA 1BE0A 3UOWA 5JYBA 4CR7A 4EAAA 3I72A 4ASUD 3K1AB 4UU8A 2PH7A 1O77A 3RVNA 3T7SA 3ONWA 1V8PA 1G7TA 4MO2A 1II0A 1MQ9A 2FF7A 2FFBA 1VG8A 3CM0A 2QVXX 3ES9A 3MAGA 2XDWA 4LRQA 4M0LA 3ZI0A 4AO6A 3AG5A 3WOVA 5JDIC 4QO7A 1KP9A 3V7WA 5HZGA 3ITDA 3WLSA 4YMVA 1K89A 4LHWA 3NRCA 4MQLA 1P0QA 1OTXA 1XMQB 1NPYA 5G02A 1GVNB 1VE5A 2OENG 2QZZA 1VYTA 1WULS 2ZRJA 3ITNA 2YY6A 4CDMA 2FMUA 3KO8A 3EVEA 1NFQA 3DG9A 4OHRA 3JYLA 2C59A 4NOKA 3L1HA 4HYEA 3BDIA 1H2AS 1PQWA 3M70A 2C95A 3W7VA 2Q07A 1ZJZA 3BSFA 4AJIA 4EATA 1ABFA 2Z4TA 3PSHA 1A4UA 2VHTA 1W6UA 1XROA 2EZUA 2XDYA 3H7AA 3I09A 4L9AA 4UEOA 3BMQB 1LLQA 1QH8A 3FNGA 4FJ1A 3ZH9B 4V0OA 5JZ9A 2EF0A 4YPFA 1J0AA 4AY4A 3FKSA 2R87A 4DEXA 1FYVA 4YH1A 4FHDA 4MJ7A 5MGBA 1G8JA 1U3DA 2RB4A 4RF5A 3E7DA 4ZT2A 2FFAA 3DFZA 4PZYA 1ENOA 3QQPA 4JQSA 3WBKA 1JQJC 3GB9A 3FGZA 1A9PA 5F5XA 1NC3A 2QPTA 3P2IA 1OWPA 1PJ2A 2YW9A 2XT9A 1TT5A 3WK6A 1A1VA 2XODA 1SWVA 4AICA 1BHJA 1CB0A 5LYJF 1TYCA 5CGQB 2PZJA 1Y81A 1JFTA 1MX5A 2FMXA 1GG9A 1N2CB 4WN3A 3ENQA 2WRZA 4UE6A 5LNK6 2V9PA 4GOMD 2JJ2D 3MLAA 2WM3A 3K2IA 5DTIA 2QORA 1Z5WA 4KO3S 4M9CA 4OK3A 1Q83A 1RIIA 1UAYA 2ZSUA 1ZISA 2XUOA 3RVDA 4YRGA 1V25A 2SCUB 4K9KA 4I1UA 1G60A 2LIPA 1LC0A 3IIJA 4US1R 3KR1A 1NKVA 2RAFA 3LY7A 4PZEA 1RWXA 1H3NA 2VLBA 5JQWA 3VR4D 2ZUEA 5HBRA 4U00A 1U2DC 1P6XA 4MS1B 3BFVA 4COKA 1DJLA 1VL2A 2HJVA 3B1VA 4R1UA 4Z1OA 4IRUB 3NDBB 2BRUA 4RWZA 4ZVVA 1L5FA 5HRUA 3SHTA 4IQ4A 1JQEA 4G0ZA 1T3LA 3WRWA 4QWMA 4UMEA 1DBVO 2P3QA 2H1VA 3TX6A 2P4UA 2ANBA 4Q7QA 3DO8A 1NUUA 3PX2A 5B6IA 2ZRMA 3T7EA 1J8DA 2ZT7A 3CPJB 3JQAB 3SF8B 2A35A 3U62A 2QNIA 4WVLA 3VPXA 4DSAA 1LQTA 3R1IA 3AHHA 3OEED 3AZPA 1LWNA 5FTJA 4B7CA 4D8VA 2ZI3A 4NSNA 1SO8A 2CHQA 3RFUA 4Q1EA 3WB2A 3GU3A 3TLAA 4CM6A 3IP7A 5ALDA 5DXAA 5FFNA 3BF8A 4A8TA 1U1IA 1RACA 1VGQA 1OX5A 3UJ7A 2GJ8A 5I9TA 1LPNA 3Q41A 3UA4A 3AVTA 5KINB 1MPTA 1TFRA 1V8BA 4N5NA 2BZGA 2IDZA 5KU1A 5BSEA 2ZR7A 1UBNA 3FGNA 3ER6A 1RLTA 4G0NA 1WRBA 2H51A 4D9KA 4FYJA 5HPYB 2JNWA 1XZNA 5IXYA 1F0KA 3LUHA 1ODLA 4FBMA 2ZJBA 4QREA 2XGMA 4KYVA 3RAFC 5K3FB 3FSGD 2DFDA 4ZV4A 2B7BA 4E1VA 5BY2A 1ESMA 3RV4A 2QJFA 4C6RA 4D81A 4DF3A 2GD6A 2JZOA 1ZICA 1T0IA 1ZGGA 4KXWA 4P98A 1T5HX 4ZT7A 1XDUA 3W4KA 4EHNA 1XPOA 3BJEA 4IIXA 1FDVA 4HH1A 4RWEA 2BBOA 1BW9A 2EP7A 4OXNA 2BM8A 2WHQA 4MLPA 4CF4A 2WB4A 1OLSB 5B3JC 5HKKA 4ND8A 4O4JA 3W9UA 2WUEA 1ZP6A 2C5SA 3CV3A 2ADFA 2Q50A 1YRWA 1LX7A 3EXEA 5DOZA 2BFAA 4MP6A 4D7AA 1WW3A 1ZOIA 3O90A 4JU8A 2XUAA 1SUPA 3SFZA 3TXXA 1GZSA 4RF2A 4P4LA 1EJ2A 2V6IA 2GZ1A 2OO5C 3GJQA 3OCZA 4OV6B 3CGWA 3P2YA 5CURA 4EYGA 1SCBA 1JH9A 3DKPA 1L3IA 3N87A 3O75A 4J1TA 5IARA 2CBGA 1SKMA 2VJNA 3THWB 2ZIVB 3TD9A 4NMMA 3L4BA 1VOTA 3LUFA 1N2SA 2LDBA 3NHWA 3T3EA 5B3LA 5JCXA 1JEYA 1YIDA 5JSYA 2QPLA 2QY9A 3DZJA 4MKIA 3UIEA 2IEIA 4KSYA 1NW4A 4LNAA 4QQNA 1JAZA 4QHYA 4ZYXA 1DC6A 1BX3A 4HMPA 3EZXA 1QYXA 2HREA 3VVMA 3CRRA 5F1YA 1DEXA 2YMLA 4C0SA 5BW5A 4LAFA 1TE2A 1RWNA 1IMOA 1ZRNA 2FUKA 3BXPA 4E88A 5DBGA 1KI4A 2JAXA 2KX7A 3B9RA 4JKYA 1HTTA 1S2LA 2VCEA 3O8NA 2XDQB 4AZ0A 3CLSD 1PJRA 4EECA 1ZMXA 1FUYB 2GXAA 2DUMA 2WF5A 5I7HA 4KDEA 3SNHA 4LNUA 3U0BA 2ZBFA 3DFFA 2B9EA 3K9QO 3P9IA 4IVPA 1Z0DA 3JQQA 3NUQA 1N6HA 4FGSA 5FAKA 1ECGA 5M7EA 4YIHA 4FC7A 5DO9A 1B0AA 1EFVB 4NPCA 1O95A 3USZA 1L4UA 1YBFA 3L18A 2A0KA 1C7RA 2E6KA 3V1NA 1DCTA 1C7ZA 1QE0A 2EJBA 4PSVA 2VT7A 4GG1A 4RORA 1OX4A 1KK3A 1TTPB 2XB9A 5AMXA 3MJTA 2IZ5A 4C08A 1EM8A 1R12A 2QL9A 1QM5A 4PGFA 5A9RA 1FQWA 2BFCB 2V54A 3DEAA 2ZBDA 2PKXA 5AJWA 4M76B 1C41A 4XM0A 4MW7A 3O4VA 4M1WA 1L5MA 3C7AA 1I6MA 3CWCA 3OX3A 3E22B 1O9GA 1PBNA 1PR5A 5F7JA 1L8AA 1QR2A 4BASA 2VSXA 3I4LA 2XZOA 2LW7A 4K3UA 4BVJA 4UAUA 2JJYA 3HYRA 1QRUA 2XEDA 2ZRKA 3D02A 4O2BF 4QQKA 2AR0A 2OP1A 4G1VA 1Z74A 3WKBA 5KYKA 2VKTA 5T4EA 4I50F 2RE8A 1VRCA 3UGTA 1U0TA 1XCMA 2ZWVA 2QLJA 1KZ1A 3PHCA 2MCFA 3IVAA 1CUSA 5DYYA 4CCSA 2EEPA 4F2WA 5B58C 2CUNA 2ZBVA 3N39C 1Q0ZA 3ZNNA 1JPNA 3I53A 4ARCA 2B61A 4REQA 3KQOA 1YA4A 4ZCMA 1Q91A 3H4VA 2XT6A 3WQQA 3E7PA 1UDXA 4BV8A 4AY6A 4ZZ2A 1NUPA 3DNFA 1BGWA 5AI6A 4R01A 3TAHA 3ZXSA 4DBZA 1M0EA 3RFVA 2BEUA 3S2ZA 2O8BB 1YCGA 3FETA 1N33B 1QTRA 3OC6A 3TG2A 3C5VA 3HJUA 5E6UA 1WSDA 4TV9F 3MCTA 2EATA 1V4NA 2IX9A 1MORA 3GJ0A 3TRDA 4HNVA 2Y0PA 4OL0A 1W88B 4E6PA 2OM2A 4MWOA 1M6EX 2ZYIA 4OGLA 2AN4A 4OUDB 5HQJA 3ADKA 3HH8A 1N0HA 4HAXA 4JIMA 4XVQA 3UJ9A 2G9VA 3KAQA 3UWSA 3WS7A 4CNBA 3PPWA 5IBCA 3T3OA 1J56A 3HYTA 5EIOA 3OPMA 1CVIA 1DQSA 5DI3A 4EHJA 3VR1A 1XCJA 2K4MA 3ZYCA 4HB3A 2A1TS 4XUDA 1O96B 4LQDA 1HDRA 2WW8A 5CUQA 4C1NA 3ZHYA 4F4HA 1MU0A 1O6CA 3PL1A 4WPGA 1WMSA 2D8MA 3OSUA 4R1NA 1Z4NA 2H06A 3MS4A 3I62A 3L0IB 5LYJA 3VC1A 3B7WA 4OK6A 3MVEA 2DTDA 4JLKA 2P6OA 1JV2B 1WCIB 4U6QA 2ZLBA 4F2DA 5EC8A 5EIFA 2BUCA 2ZB2A 2EF1A 2IZ1A 1Z4OA 3W6OA 3W6UA 1VIMA 4AUEA 4CM4A 3EF0A 3IURA 1QBKC 3MJFA 4JUDX 4IIEA 5DHTA 1AU9A 2QRNA 4C6TB 4ZK2A 3L84A 1BQ4A 3SZLA 2JVIA 3OP1A 4PG5A 4NE2A 4W8GA 3ZBQA 1KQ3A 2XA2A 1EVKA 1D09A 4YV1A 2PKEA 1V9SA 2R6FA 5CVVA 1JU3A 4U63A 1JTFA 1Z2AA 5BWLA 1NE2A 5KPDA 1QP4A 4BY9E 2V7XA 2HRCA 4NDNE 4Q03A 4K86A 2IU4A 3V1UA 1RS0A 2CYBA 2GRAA 2HH9A 4DNOA 2CUKA 4NJEA 4DQLA 4OM8A 3WIVA 1ZPDA 3V97A 2W98A 1RSZA 4IHAA 3H9BA 2QWXA 3EEQA 2J3HA 4RKEA 2W70A 4RULA 1JQBA 1XZAA 4KNYA 3KWJA 2NXEA 1K8YB 3CPHA 3KYBA 4B71A 4LYJA 2IPOA 3PQ6A 1MJGA 2IPMA 3VH2A 3TLMA 2HMYB 1GZHB 4D9MA 1R16A 1OD6A 1XNHA 1XP5A 2ZEJA 4G5OA 3ERCA 2O0JA 3GHHA 2HF8A 2KSQA 3QX9A 2FPGA 1QE5A 4PLPA 3KRTA 5ECDA 1JMYA 2HJSA 1SQ5A 1TEHA 1UOEA 4PNEA 5BN1A 5C9ZA 2JG3A 1G2IA 1N0UA 4PHFA 3B5EA 1D0SA 1J8FA 3O83A 2XWSA 3L7LA 1WSAA 2ODPA 4I8DA 4S2UA 3NOXA 4C30A 1J25A 2B8JA 3MHTA 4CR6A 2B78A 1LNQA 3PX7A 3AU8A 3K15A 4RADA 2IY7A 1NWCA 3MWLA 3Q11A 2ZIXB 4FUQA 1VYUA 2YN4A 4CL8A 2Z4SA 4FCVA 2C7QA 1YBMA 2D5BA 1ZITA 3URMA 1Z39A 2BFEA 1WPQA 4RU1A 1FJ2A 2ZIGA 2G67A 3UWMA 2J4FA 3MD9A 3NCTA 4G89A 3DJFA 1KKUA 3NEYA 3UMJA 2B1IA 3NYWA 4JI2B 5IKOA 5LU8A 5ES3A 2JLWA 2OV6A 4UD2A 1BDJA 5CFPA 3V3KA 4CIAA 2DRIA 3VNUA 4N5HX 3R6TA 4QSMA 2W6NA 3CCBA 3K30A 1JE1A 1W4LA 3GZ4A 5BWBA 3GPDG 3OT1A 1LPOA 5GINE 3UQYS 3N75A 3ROFA 2OFFA 3SYKA 1OJLA 2WBLC 3CEHA 4RFLA 4X8OA 3SJ7A 1KDTA 1Z6AA 3MQFA 3Q8MA 3SJCA 3PNMA 4KLZA 2CZCA 1DQYA 3WNQA 1LV7A 4F2HA 3KKLA 5ARDA 3Q85A 2NV2B 2R8PA 3M9XA 4WW0A 3S8YA 1WZCA 1XYGA 5AKZA 2XOXA 2BI8A 3AINA 5AKEA 5DM0A 2YASA 3L1KA 4MHOA 1PQPA 3DJYA 5LFAA 4C3ZA 3OQNA 5DTMA 4M9XA 1CYDA 1Y89A 3FWHA 1DIAA 3DZDA 4P53A 1JMVA 1M54A 3CRVA 1M6VB 3DYVA 3X2EA 5ICFA 4R5MA 3I1YA 2QVZX 3B1KA 4DA7A 5A1TA 3O4FA 2BF7A 4XEUA 3AFHA 3CH4B 1G9TA 1WXDA 4IDDA 3JCZA 2JGLA 3SZRA 5I51A 2W48A 1U2PA 3LUPA 4FEYA 1PP4A 4H3HB 1GOTA 4X7BA 1NDHA 3KQVA 3RAPR 1KHHA 4JJAA 4QFMA 4IIUA 2H1SA 1AHPA 1SCKA 2WWTA 4PTYA 2ZYAA 1U7PA 2P9QA 3KJIA 1ZM4A 4DVJA 1G6Q1 1PTJC 3N05A 5FV7A 1V2GA 3NALA 5KBYA 4JEIA 1E32A 3RKUA 3L4JA 3ZD7A 2R4UA 3O8OB 5CPFA 1UZUA 2W8ZA 3O4GA 4IDBA 4LZWA 2FZLA 2PLNA 1T2CA 1ZU5A 3MWGA 1NVVQ 3DF7A 4GNKA 3RUAA 5BQOA 4B0PA 2PYDA 3E15A 2C7PA 3GVHA 3FFXA 4N0PA 1AHIA 1WWKA 1H8EA 3UNXA 4FOTA 2PD6A 2WU0A 4N7MA 1VJRA 1NOKA 1UZNA 2VF5X 4BCBA 4CQMD 4F5YA 3LRTA 1E2FA 3KZMA 2CXTA 3A4IA 4P08A 1YNOA 4IGFA 4LV8B 4M0EA 1DCKA 4MS4B 4RNDB 4N3AA 4UHBA 4OB8A 2LR0A 3VOAA 1ZK1A 5EXEA 3KHUA 5HMMA 4F4DA 5LOVF 1C3XA 1L8LA 3ENKA 3RHZA 2RD2A 3KV3O 3O2NA 3OE7A 1H22A 4DYVA 5FOQA 5HKOA 4BBJA 3G5LA 1X15A 3CHYA 4N01A 4JI3B 1AKTA 3H65A 4I5DA 1OX6A 3LPNA 1QHFA 2Y0EA 4YACA 2Z56A 4BGUA 5AOAA 3OZIA 4O2BA 4MO9A 5HIIA 5GWXA 3R7WA 5KSZA 4FM9A 2A3RA 5CXSA 4JI1B 3VYRB 4I50A 4V02A 1T2EA 4RUKA 1X9IA 1LLFA 1Y1SA 2FFJA 4II7A 3WXBA 3AVPA 4JLMA 2EW2A 3DUWA 5EWJA 2IYYA 2QN7A 3B1FA 3TR0A 5GP1A 5DBOA 4MYCA 5FI5A 3GRRA 2CC2A 3FF4A 5G1PA 4IFTA 4PFKA 4QEKA 3ROZA 1D8TA 4LSGA 4NBWA 3F1KA 1OYWA 4M4SA 3I73A 3IEIA 4L85A 4PR0A 1WY7A 4M6WB 4BFSA 1W75A 2Q41A 3LQKA 2NN3C 6GPBA 3P9NA 5AI4A 4R1TA 4RTPA 4DB2A 2OCBA 2V8OA 3O8RA 4S0ZA 3GG2A 1P0IA 4FYMA 4IH1A 4TV9A 4U0KA 1P72A 1W46A 4TV8A 5BMVF 3SYRA 3NGLA 4CHGA 3PUZA 1IJFA 2IKSA 4EY5A 2JCBA 5E3HA 3SX2A 4YO7A 2XYVA 4N48A 1M1ZA 2ECQA 1AS3A 3AIKA 3S1LA 3PX3A 4N0EA 4HYQA 3P9RA 4AL4A 2ZSDA 2UVQA 4PCAA 4INPA 2QBYA 3SXUA 4CFYA 3QYFA 4QO8A 1CJTC 1LGYA 5BV8A 3FNFA 3P2KA 4HN2A 1E9DA 2IHKA 5DV9A 3KZXA 1H4QA 2JA1A 2VHEA 5DMHA 3T52A 1P1IA 2ZW9A 3WWEA 1Q2UA 1KP3A 3EVZA 3OEYA 4O3FA 2WG2A 3H1GA 1V6AA 3HDGA 4ZVNA 4NDAA 1JFRA 2NU7A 4FGKA 5HJ5A 4YECA 5AM3A 3VDRA 2JIZD 4RQTA 1SHTX 4IV8A 4XD7A 2BFWA 4J43A 4JJIA 4YAOA 1EJBA 3L8EA 4JOCA 1UK7A 1Z16A 3GJRA 3I5MA 2GD2A 3JD2A 2GM3A 4RHYA 3VMMA 3GN2A 4U7DA 1SA0A 1M72A 2G1AA 3CEAA 2JFBA 4JJ4A 2ZXUA 2ZU0C 4JC5A 4WBXC 4D4HA 1J49A 1XDSA 1V9LA 2NQTA 2YINC 1D6JA 1Z37A 2HBRA 3CZ4A 5IM4A 1W1WA 5CFQA 5HS4A 5AJZA 2NXNA 4I1PA 3DMYA 4QLOA 3TK1A 5IDWA 4KFRA 4RD6A 3KALA 1PLJA 3C87A 1FP4B 3Q9UA 4LK2A 2OLJA 2OGWA 1X7DA 2WKSA 2I7XA 2I91A 1SBHA 2PX8A 3HR8A 4BZWA 2ZGVA 4UUMA 4WDRA 3N0XA 4BNZA 5DSZA 2VDUE 2X1MA 2ADOA 2O20A 1IB6A 4A1OA 4C4SA 1UOPA 4H6WA 5AIBA 3DXYA 1Y34E 1WW8A 1C3LA 3A27A 3DE5X 4X8HA 1QGYA 3NV9A 4MZXA 1P2DA 3A31A 5IYZF 3RRMA 4EHHA 4BQFA 2ORED 5SY6A 3RGGA 4DTCA 5HW0A 1NBME 2EG9A 2V45A 1DWUA 4ILKA 4V24A 2RAVA 4E2ZA 1JHRA 1QYRA 1SELA 2VRWA 2ZTUA 5T64A 3RK0A 3V9PA 3W5JA 3M4JA 3EXG1 3DAGA 4R3WA 2IYNA 5BSHA 2O23A 5C32A 1OT3A 5EXTA 4C07A 4FGLA 4Q6WA 4G4JA 3E9EA 2OUIA 3DKRA 1X80A 3QPUA 4B6QA 5A7FA 3OJXA 4PYMA 4DSNA 2WAYA 4EI8A 1ECFA 2H5JA 3VNVA 5IKEA 4V0KA 3S68A 4OXIA 2VYND 1UANA 1LI4A 3BL5A 4KAJA 3QI2A 2IXFA 3HB1A 4G1BA 4HXEB 1GT91 1FFGA 2ODTX 2X7HA 3R23A 2VK2A 2VN8A 2WTEA 3EK2A 4L02A 1HYHA 2B6HA 3OPNA 4U2GA 4MIYA 3ZKWB 3KYDB 4NE9A 1H2HA 2JLRA 3IESA 2FUG6 4BP9A 3M34A 5G0VA 3ZS8A 4OYHA 3RT9A 3AQ4A 4KIGA 5CT8A 3L43A 1Z0IA 3QKRA 5G1NA 3I42A 4A2WA 1J7JA 4ZTZB 5JARA 1D8AA 1QLJA 2HM7A 3E5MA 1JH8A 1BE8A 3ORSA 2HXYA 4W82A 5MFZA 4J2HA 1G8AA 2B25A 4KRGA 3KKEA 4RJKA 1RYNA 2FPKA 1C2YA 2PWPA 4QYSA 4IOLA 1PJQA 3IVRA 4J07A 1B4DA 1NVMB 3BERA 3CONA 1LK0A 1QO7A 1UXOA 2I4NA 3S2UA 4D9GA 4RCYA 5CA0B 2PSEA 4DY6A 3WE7A 1QRRA 2H9IA 5F78A 3GO4A 1FVXA 1Q44A 3GMDA 4QGBA 2ZR0A 3C5HA 5I8PA 1CS4C 2OLEA 1OFIA 3FMGA 3FRIA 2WOJA 1OH7A 1HORA 3LBIA 3PG5A 2PO7A 1JKFA 2DPYA 3REQA 2GTHA 2CHGA 2QG9A 3P7MA 3V4FA 2CN1A 5ALKA 1NBMA 1RRMA 3GDGA 4LOHA 4L8GA 1H2WA 1JPVA 3OIWA 3ESBA 1RC8A 3U4QA 2CHUA 2YJGA 3G49A 4W5WA 4YAFA 4OHMA 5FTMA 1V3QE 3SZMA 5DYNA 2CXXA 4RJJA 1DXOA 5KB3A 1JALA 3H9CA 1PSDA 3CEPB 4PV7A 5CTJA 1J6UA 3W1VA 2X1VA 4KO8A 1B6SA 1XTRA 2YWRA 3QLTA 2W22A 1RM3A 4OJMX 4R2HA 3P0HA 3UAVA 4O3MA 3ZW7A 3W3ZB 1PJAA 3IXQA 1G3QA 2JIDA 2VDWB 3DGFC 4IKPA 3VYTB 4AWXA 4B40A 1QHHB 2B8TA 3FCSB 3UGQA 5LLDA 4G5QA 1W30A 1RYEA 4TXHA 4TN1A 1JHXA 1YDWA 5GONB 1RJDA 3OPVA 3ZCUA 5D5HA 5IBRA 1GGJA 1FSGA 4DCNA 3V3TA 4DABA 1T2AA 3V2IA 4OXKA 3RIHA 5LOVA 5HE9A 3TBKA 4ZZ0A 3HJTA 1JWBB 1LRJA 2WSMA 4B7ZA 3ZNQA 2W7TA 2CXSA 2QJRA 5E38A 1ZN7A 5FF9A 3MRTA 3SZGA 5JAHA 1ULSA 3D59A 1AQ6A 5HUHA 4HQLA 3SVTA 3LA8A 3VQTA 2C1XA 3CVYA 3DO5A 1WEKA 4DPKA 4UM5A 3DHEA 1OXTA 2OFOA 4PPGA 1NBOA 2AOUB 4DDTA 1FDWA 4BZQA 1L7BA 5K4AA 4C2BA 5ITSA 1JS1X 2FMTA 2RGNC 1GGHA 1WDTA 3ZY4A 2EBHX 1G41A 1I7PA 4DUZB 3BMOA 2YOGA 2W8BA 2QAGC 4QSHA 5CA0F 1YI1A 1UMCB 5D5PA 2IJGX 5I7WA 3JZAA 4Q18A 4Q93A 4GOKA 5G2OA 4WECA 1DOHA 3GUYA 5GPBA 3CVXA 3I6IA 1Y4DE 2JBAA 1F8GA 1RXSA 3H1AA 2VG8A 5AIAA 4JI6B 1TI7A 2DFPA 2RJNA 4YJHB 3OA0A 3JX9A 1ONSA 2FCAA 3EXFA 4ILEA 2Z1DA 4EABA 1T5DX 1P2BA 2WIBA 3PDCA 5BMVA 3KD3A 2H4YA 3UTDA 5AKGA 4YRQA 2VPQA 1VIAA 3DBHA 3OCUA 4HCJA 2EZTA 3DVSX 2R7MA 4J90A 3IBSA 3BILA 4L95C 4PG7A 4PTZA 1YRBA 5T3UA 2WKQA 2Z2ZA 5CT6A 1PJ3A 1VQ1A 4U2BA 3X44A 1FDSA 1PNTA 2Z30A 2VRCA 1P3JA 3EXHA 1PJBA 2Z04A 4M0KA 4QUHA 4HGNA 3NBYC 1RJWA 4RC9A 4LIPD 4L7QA 4XWOA 3FOFC 1JHQA 2QRPA 3EZFA 1V47A 1LDYA 1T26A 1NMZA 4E31A 2XIQA 1QXSA 1UBSB 3V48A 4DMUB 4QDTA 3REOA 3ZWNA 1Q1QA 3HCBA 3SDSA 1I3NA 1NLYA 4YUWA 1N4DA 3KVNA 3VH4A 4IDGA 3VUEA 2ZAGA 5IS2A 4PEVA 2BGLA 3NC1C 3NDPA 4WV3A 1GQRA 1KORA 3CW2A 4NL4H 4QOJA 4FCWA 4MAAA 2TMKA 9MHTA 4F97A 3KSBC 2GZHA 4ZTUB 2ZI5A 3BUSA 1M8KA 3QELB 2XTJA 3LKZA 2VF4X 4CTKA 1XB2A 3QU4A 4HDCA 4M8IA 4DMKA 121PA 3H3FA 3K2BA 4NC9A 4E6EA 5DM70 1RZ3A 2G82A 2BCGY 4V2IA 3D3EA 4X84A 1RYBA 5C1DA 2WHYA 5IVHA 4K9LA 4Y1FA 3FKSD 2C3UA 3PDIA 2IH4A 4LV5B 4GH5A 5A71A 4B3HA 1I9CA 3VM6A 4JYPA 2FZ5A 2EWMA 4BNDA 1UOQA 5I7UA 3SQWA 4NEHB 4EPRA 1W0KA 5HFNA 1WXIA 3NBAA 3LCVB 2RHHA 4HXFB 3GI1A 4Z0TA 5E1OA 1U9YA 2OZVA 3IPRA 3MGKA 4Q4AB 3SJAA 3WK5A 3HRHA 1F2UA 1I1OA 3W79A 3X1JA 1WSBA 4E2YA 3ZV5A 5JI2E 4Y9SA 5AUOB 4L5BA 4GI7A 3OOJA 1M3SA 2ZSEA 1C4WA 4EX6A 4INJA 4PYKA 1FCJA 1CF2O 3PGVA 1TYZA 3OIYA 4PY2A 1R6BX 3R3YA 1TF5A 5AICA 2ZTVA 4RPHA 3X1MA 3TMAA 3GFQA 2JFQA 2DWOA 3C1OA 2BBSA 4NULA 3KB2A 4H1HA 5A04A 3IBYA 5LKAA 3R4VA 4OHBA 3HCNA 3KJQA 3JY6A 4N3GA 1F8XA 4MJLA 1A9OA 1YO6A 4P5PA 3PDJA 3SSAA 1RXEA 1LZLA 4CL0A 4OQDA 3CN9A 4GGOA 5GV7A 4X66B 3ED1A 4CIWA 3WLAA 4W99A 4B7AA 3ROGA 2NPIA 2HU7A 1E5LA 1EK5A 4WOJA 4ZT3A 3EMKA 5FBWB 2TS1A 4M8LA 4RSHA 4J1QA 3TIFA 3HZOA 3G0IA 1A9SA 3CJQA 2RI0A 3CX8A 3L1UA 4IJ5A 5TPZD 4LY6A 5DW0A 4YFVA 1MOPA 1CJUC 2Z8XA 4PSKA 3I76A 1RDFA 5EMNA 2X8JB 3ILVA 2E4UA 1SXHA 2FYTA 5FADA 4NLLA 3WA7A 2KS6A 3RKRA 5IEJA 5JRZA 1R5BA 1Z13A 3GLTA 2OO7A 3I0NA 3ND6A 2VAWA 3PNPA 4HRAA 2ZCVA 2FZKA 4LW8A 4YT2A 4UU0A 2FSGA 2R3SA 1NW7A 3FCCA 1W5BA 3O38A 1U28C 2RONA 2EKDA 4NV0A 4RXTA 2HLHA 3MUEA 1YR2A 5KQLA 4ZDJA 4QYTA 4BX0A 1XDZA 1U7DA 2ZCUA 1KYXA 3IIMA 2PH1A 3DE2X 1LVUA 3AB7A 3JWEA 3SHFA 3V1MA 3TNDA 2XZLA 1SK9A 4FIZA 4BNNA 2CF5A 1XZ8A 5CX1A 2PVCA 2QQFA 3BSWA 4NCHA 4RJIA 2FW1A 2CCGA 1K5DA 1KU6A 3MOSA 4LJ6A 2OUKA 2GN8A 2AWNA 2P9TA 1JHDA 3BGIA 3PUIA 1UZLA 1N0IA 4OQLA 4PLGA 2DH5A 2OK7A 4MUMA 1T2UA 2XADA 4JT2A 2C2GA 5HA5A 2AFVA 3T54A 4ARIA 3TW6A 2Q9BA 3BWEA 3DP7A 3PNYA 1O5OA 2BFPA 2V96A 3KLPX 4OQNA 4XQGA 5H80A 4DLPA 2AZXA 1KJWA 2PGXA 1DRKA 5JSKA 1VHQA 4JI0B 4HFNA 1FTYA 1WXWA 2PLWA 4JSRA 3ICEA 4FONA 2Q3LA 4NOJA 3VTFA 4BN5A 4DUGA 4ZOQI 2LZ0A 3WIOA 1HZZC 3W6PA 4CYMA 1GL3A 1HT1E 3R0QA 1XZLA 3B89A 3MRVA 3ZBPA 4EY3A 4L22A 1JJ7A 3MSCA 5FWXB 1QK4A 4YJ3F 1JYSA 3F6PA 1BMTA 4UDXX 3N59A 1L5KA 1GQYA 2PGOA 2HY7A 2V6BA 2ZUUA 3GLFE 1EFPB 2GUGA 1SU6A 3BFJA 4MWTA 4B8ZA 6CHYA 3ZWVA 4YRCA 3RAEC 1EUZA 1VXRA 3FPSA 3M2TA 4Q3LA 4HLUC 5C4GB 1ZJ6A 1E3MA 3FTQA 1VBFA 2BZSA 2GVDC 4R8LA 4YJ2F 3K8ZA 4NZYA 1KBOA 3ZGVA 3IV9A 4KGDA 3VMFA 3K70C 1CDOA 1RPNA 3GL9A 3MINA 4MW2A 2LVBA 4FDUA 3RO7A 3S1AB 4XSVA 1MAWA 4JBIA 3IQHX 3PPIA 1QQ7A 4GOND 3RSCA 5EJMA 4HBZA 3TKYA 4NCAA 3NV7A 3VSBA 3W7AA 3ND8A 4DQDA 5CA1A 2PE5A 1XWWA 5KVSA 3AVOA 2OG1A 3I6QA 4OHUA 2VWQA 3FY4A 4ALNA 1GZ4A 2RH5A 3HQ4O 3TAUA 5J2TF 3ULKA 3BH7A 2PZGA 3M6AA 1SXPA 4TLLB 1ZM7A 1ZAYA 2PKRA 2A5GA 3ESAA 3K0FA 1JKJA 1HRDA 2HIGA 2Z83A 2GEDA 4G9BA 2QY6A 5H4GA 1U8ZA 1VBKA 3NVAA 5SY9A 4EVSA 2P4SA 4C7OB 1RHKA 5EJ7A 3U09A 3VHLB 2W42A 5FUVA 2UXBB 2AR9A 1MIHA 4MYUA 1N2HA 5CD9A 1CBUA 3OU2A 5LQKA 5FOWA 2HRRA 3TRHA 5AK5A 2O8FB 1GRQA 4URZR 5ER9A 4XARA 1HDZA 5BV1A 4G2NA 1NSTA 1E8MA 2G06A 1T13A 1XRSB 3ZE0B 2XB2A 1EDDA 3ZX4A 1NXXA 1QJCA 4DR4B 3JYOA 2FOLA 5LR6A 1RKXA