3LW8A

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
GPLGSAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rhoa-binding protein
total genus 62
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw8A00
4X8HA 2LWIA 1WF3A 2CMKA 1YR9A 2RHDA 3PUXA 1W4BA 4BFUA 1RKBA 3GLIB 1L2TA 1N6LA 2CK3D 2RB4A 4AC9A 1W2HA 2YJTD 4MYTA 2ZI5A 2D2FA 4DLSA 4IEEA 3MGCA 1G9XA 4QGGA 5G3YA 1F3OA 1G4UR 3M4YA 3B9PA 3RS0A 4F92B 2WPDD 3ZS9A 1CR2A 4G1UC 3AVUA 1JPNA 3UG6A 1MKYA 2HXSA 1FQJA 2QNRA 3T35A 1E2HA 1P62B 2BMDA 2BMJA 2J87A 4NYJQ 4QJ4A 1L4YA 1LB1B 1KI6B 3GCGA 3LXRA 1KI3A 2ANCA 5FOXA 3IBGA 3UPUA 1IHUA 3K0EA 4NPHA 4B48A 4RJLA 4B75A 1DG1G 2O8BB 1ZRHA 3RYTC 1VMAA 2ONKA 1VG0B 1GRRA 1FTSA 3KX2A 2OV2A 3PCRB 3MFYA 3M1IA 3JZMA 2AHOA 1BKDR 2WOJA 4YMTA 4Q00A 621PA 1GNPA 2ZJZA 4FN5A 2YKGA 1U2RA 3GFTA 3U6KA 1VYTA 5FUYA 1CJKC 3QENA 3WMEA 1J8MF 2JLQA 2MMGA 4URVR 2BEKA 1LF0A 3MAAC 1IXZA 3QIAA 4G5OA 5GJCA 4QM7A 4JLMA 4O25A 3EZ6A 5L3QB 4ZIRB 1YHNA 4Q9JA 2BKEA 2JDIA 3UWKA 2P6RA 1X1SA 3HU3A 1ZUHA 2GF9A 2GRJA 4LJ7A 4URYR 4Q01A 4BECA 2RAPA 2QE7D 2TMKA 3TSOA 2ZQ5A 3WMFA 2CLSA 4JSYA 5CM9C 4DB2A 4A1FA 3PQCA 2X2FA 1TADA 1US8A 2GKSA 3FMIA 3SJAA 3KQNA 1V43A 1LTQA 1DAFA 1YKSA 2E87A 3PUVA 2JIZA 1OFIA 3E5HA 2CVHA 3EW9A 3VMFA 2JLYA 5KDLA 3R20A 4ERNA 4XD7D 1Q0UA 5HE8A 2ZSAA 1PV4A 3TVDA 2VLIA 2Z4RA 2YNMA 3VX3A 2PBRA 4PHGA 1KGDA 1X8JA 3LV8A 3SHFA 4F91B 1EK0A 1VCOA 2QENA 1TX4B 3SQWA 4PANA 3RRYA 2OFWA 4B6FA 2Q3HA 1P2TA 1F5NA 1GTVA 3RS4A 2BIFA 3TQCA 3THXB 1YZKA 3I3SR 1KDTA 5GADl 1Z2CA 5C46F 1ZD9A 4BLPA 1DAKA 2WSMA 4OQMA 2GXAA 3BS4A 3QPVA 4V0LA 5G3ZA 5EQTA 4DBLC 4X8OA 5CYOA 4B3FX 1JJVA 3K0FA 4CW7A 1D9XA 1E94E 1NVXQ 3BFKA 4W5JA 3LY5A 4Q03A 5FL7A 1LV7A 3REGA 1QZXA 2X77A 1Z22A 1P6XA 3EPHA 2XTNA 1JEEA 4LGMA 1DAIA 4FI3C 4C0LA 1KI1A 1KSJA 5TVKA 4C0JA 1Q21A 1RYHA 3NDPA 1E69A 5EE3A 1HH4A 3AGPA 4N1AA 3MMPA 2N42A 3SHWA 3TW8B 2XAUA 2FDCA 2CHQA 2B21A 4IJMA 4EDHA 1FUKA 1AS3A 2IC5A 1D5CA 5EXXA 2NO6A 3K0CA 2KBFA 2KE5A 4C0QC 3F5FA 2I1QA 4AYXA 1P75A 1G7CA 2Q6TA 4C7OA 1EFUA 2BCGY 3ZYCA 1GP2A 3GEHA 1M7GA 2C77A 3GJ3A 1GSIA 4C0AC 3ECCA 1IN5A 3RRMA 2W83A 4HAVA 1CS4C 4QFMA 1IXRC 4BFXA 3DM5A 4BRUA 2Z83A 3OZXA 1NBMA 4M1OA 3PV0A 2YYZA 4KCGA 2BBTA 5FTLA 2ZE7A 3QQ5A 1UDXA 2GETA 1VYUA 3Q8XB 4TMXA 2C8VA 2WZQA 4NYMR 2QT0A 4PPGA 3K9LA 1W36C 2ASEA 1R5NA 1VCIA 2FPMA 2DWQA 3OE7A 3CWZA 3QPUA 1ZUIA 3CF2A 2QAGC 1ODFA 3KJHA 3P1JA 4N3NA 1NLFA 4FIDA 4P32A 3I61A 3RS7A 1KZ7B 4EPWA 3K9GA 2NPIA 3EPLA 4OQNA 4QC2A 1MH1A 3B5JA 4BFWA 4Q9HA 1NY5A 3CR7A 3FHCB 3AF3A 4FMDB 1XEXA 2IYTA 4LPKA 5KDDA 2ZAOA 2FV8A 3QXSA 1XTJA 3U4QB 4TYPA 3RANA 5K8UA 3QG5A 2A3RA 3H0KA 1COWD 3U3JA 3QNUA 1GKUB 1Z5ZA 2CCKA 2XJ9A 1SXJC 3CNNA 1AA9A 3TNFA 3QSYA 2IYLD 1S9DA 2ZITA 3QOFA 4GT1A 4QJ5A 1ZMXA 2QU8A 3TQFA 4Z51A 3NTUA 4LHZA 3ZD6A 4TYWA 1MO4A 2F3TA 5ANRB 1PJRA 3M6AA 4AG5A 1JI0A 3A1UA 3THWA 2EWWA 3K9NA 2MMCA 1QHGA 4RFVA 2BM0A 1LY1A 3FMFA 2ZJBA 4URUR 2IS6A 2N1BA 3X1DA 4B43A 2ZUDA 4JLAA 2AKAB 2NQ2C 5TDHA 1N6KA 4PC7A 3BE4A 5D3QA 1US8B 4DLRA 3LFUA 4KLNA 3VKHA 3K70C 3H84A 1HT1E 5FOVA 4OI1A 5B58C 1E0AA 1CU1A 1GUAA 1XCMA 5EP2A 1P9WA 5H70A 1BS1A 1KMHA 2VH5R 4Q4JA 5LPNA 1XEFA 2QY9A 4HB3A 4JJKA 4DLWA 3AGQA 5JEEA 1G19A 2QGNA 4KFUA 3Q85A 2YOGA 1ZM9A 3A1VA 5IDVA 3WYFA 2XNDD 2QZ4A 3EASA 1HTWA 5JLJA 3CWQA 2Q9AA 4RKEA 3BFXA 4PAOA 3DOEA 2NZ8A 4Y0AA 4QBHA 3HU2A 1MV5A 4S35A 2XOKD 1N6OA 3HU1A 3B7GA 3S1AA 3ADDA 5FBLB 4H9GA 2GJKA 2RGNA 3KJGA 3TGPA 3IILA 4A2QA 4E09A 1SXJE 1VYVA 4QM6A 4IVPA 4PQYA 4PXAA 4CEHA 2CEAA 3WRYC 3PEYA 5TY0A 1U99A 2H17A 2VF7A 4GI7A 1SQ5A 4NZYA 2OLKA 3EXAA 3EC1A 1E2MA 1MO6A 4FD2A 3ZDQA 3ZZ0A 3THYB 5DHAA 2A9KA 2H16A 2OZEA 3W6OA 3W6PA 1EWRA 4Q7JB 5KNCA 4KU4A 4NP6A 4YC7A 1D8TA 3TUJC 3GLFE 1U9IC 1XMJA 2RHMA 3OEEA 3E2IA 3SZRA 4P4SB 4PQRA 1E9CA 4QGHA 1JR3D 2R6DA 2B8TA 2P5SA 4PSVA 4YMUA 1K8RA 4JLOA 2CHVA 4EPRA 1OYYA 2X2EA 2IX3A 1W46A 2A78A 2LCFA 3QXXA 4Q1AA 2J0SA 4C7OB 1ZIPA 2FOLA 2G83A 1OXTA 4JL6A 5FTMA 2OFOA 2HCBA 1Z47A 1J8YF 3AKEA 5HCIA 5KU1A 2GA8A 4Q9IA 1KK3A 1YZQA 3DO6A 3Q5EA 2QP4A 1XTRA 4NTZA 1Z2AA 1N5JA 2RGGA 4KBFA 1RVDA 4NH0A 4CVNA 4R98A 5FPYA 1AKYA 3E1SA 3ZVLA 2QE7A 1HURA 1MABA 2WJHA 4V0KA 1E32A 5GJVC 5LDDC 1U0LA 2NPFA 2W2VA 2FU5C 2ZYTX 1KNQA 2KB0A 4TMKA 1XXHB 5J4KA 4XWAA 4IOLA 4CEIA 2OFXA 2V7QD 4PHHA 1LS1A 3IO5A 1SZPA 1CF4A 2G1KA 2QGZA 3UMRA 2HYDA 4GMXA 5L3VA 5CDFE 2EFEB 2ZS9A 3SI7A 1XEXB 2IWRA 5JBQA 3F0TA 1OIVA 4AG6A 1CP2A 4MQBA 1KK0A 4PPQA 5JSZA 5K8IA 3ASYA 4DLXA 4MDEA 2XTMA 2ZREA 4BFTA 1WMSA 2A5GA 4HYYA 5FOTA 3I8SA 3LD9A 3WMGA 4YXWD 4L15A 2QP3A 4LYJA 2QTFA 4BFVA 4FCVA 3CUEF 1XTIA 2CJWB 5DSZA 3QPWA 1XBTA 3EZFA 1XF9A 4RD1A 2PJRA 2O0JA 2XZPA 1H8EA 5E7MA 1Z3IX 5LB2A 4DDVA 2YC2C 5J47A 4P33A 2NOAA 4OK5A 4PAMA 1JQJC 2CLCX 4OI4A 1N6IA 2JCSA 2ZI6A 1W0KA 2ZRLA 1ANKA 1GG2A 4JT4A 2ZSBA 4KI0A 4PFSA 1PVOA 5F3WB 4C0BA 3QKRA 1TEXA 1VPLA 1F6BA 2ZYVX 2O52A 3FFBA 3SJCA 4D4JA 1G3IA 2BVNA 2VL7A 3B1YA 4HUTA 2ZS7A 3KUCA 5CIWA 4B71A 4YQFA 3KTAA 3EAQA 4Q4JB 2JJ2A 4WAUA 5BW8A 3HDTA 4C2UA 1W4RA 2KWIA 3KB2A 4G5RA 1TL7C 4B47A 1ZNZA 4IDNA 3B8HA 1E9EA 2EFHB 4ITRC 1ZNXA 2D06A 2EYQA 5C4MA 1GL6A 3T5GA 5FUVA 1N25A 4P4TA 2PT5A 2WVJA 3N2IA 3ASZA 4GP6A 2QTVB 1P4SA 4YMWA 1VG9B 2YC4C 2ZXUA 1E2FA 2ZVPX 3BJIC 2YOHA 3L82B 4LV6A 4BLRA 2RGBA 2JDID 3LLUA 3SYNA 2O8CA 3SJZA 1WRBA 1XB2A 5EJEA 2G1JA 3BERA 3JVUA 1N2CE 4JLKA 4HDQB 4GFDA 4IRUB 2JJ8A 3UKDA 3FVQA 4HAWA 2FPLA 2OAP1 3EIHA 1AKEA 1RZ3A 2UZ3A 4M9QA 5FTKA 2W2XA 3IEUA 4PX9A 2P67A 2JIZD 4ILEA 1D2EA 4IDHA 2R6CA 5DE3A 3GFOA 3MUFA 1Z6XA 5SZKB 1TF2A 1P2VA 1KI2A 1B0UA 4TQAA 1CTQA 1QVAA 1X8LA 3N5CA 4AKIA 2O8FA 3QXHA 4JL5A 2IT1A 1ZW6A 3D8BA 1J70A 3BXZA 4RCZA 5E7JA 2DB3A 2BHRA 5C2JB 4ZI3A 1ZD1A 2G3YA 4M8NE 2EU8A 2WJGA 4MYUA 3TAUA 3P20A 3SEAA 1VG8A 1BYUA 1Z0KA 3SE0A 4NDZA 5FPKA 1YVDA 3C15C 4US0R 4G5SA 5FTJA 1UEJA 1E4YA 4D2IA 3OHMA 2REXB 4HAZA 1NF3A 1VCMA 3I8XA 1AM4D 4M9XA 3TLXA 3CPEA 1SHKA 5FI0B 2ZRFA 5E95A 4V03A 4W7SA 3WY9A 5KSPA 2ZS8A 1C1YA 3V4RA 3PENA 3AV0B 2ORWA 5FL7D 3W9YA 2IXFA 3EIEA 4FMCB 1OXUA 1SVIA 2V4ZA 1HQCA 1PUIA 4ZCLA 3BOSA 2DHRA 3T15A 3ZVRA 2WJIA 4C2TA 2IW3A 1YJ5A 1UKYA 1KJWA 1ELOA 1I4LD 1SKQA 2AD5A 2WAXA 4FINA 3FDIA 4GOKA 4KO8A 4DLZA 1Q3HA 4CEIB 3A36A 1J90A 3KZ1E 1VCNA 3NC0C 2QQ0A 3TW4A 2REBA 2VEDA 2IWHA 2VHCA 4WZAE 4K46A 1W2GA 1NVVR 2C78A 2QMOA 3AUXA 1IN8A 1KYIA 1G6OA 5KPDA 2DFLA 4U7DA 4AKHA 5AUNB 4IDQA 5L3SA 2ZE8A 1X6VA 4DCVA 2XZOA 5H8WA 1Z6GA 4RD4A 3T1OA 1JBKA 4HATA 5JSZB 4K8OA 2G6BA 2VF8A 4IVRA 3T34A 4Z1MA 3OAAA 3VR3A 2ZI7A 3C8UA 1FZQA 5JRZA 3TMKA 1E1RA 3BFVA 1NBMD 2Q9BA 1S96A 1X3SA 1YR7A 2QROA 4N0EA 1XJCA 1E2KA 4E03A 4II7A 4BLSA 1A5TA 3X2SA 4KV9A 3K53A 4X8MA 1Z83A 4B2IA 2D74A 1BYIA 4RD0A 4D6PA 4BWYA 2BCJQ 1FFHA 1CJUC 1E1QA 1ZUNB 4I4LA 3OE7D 2P5TB 4B76A 2P65A 3U5ZB 1G5TA 5GVRA 2A2ZA 1G5RA 4Q66C 2R62A 1OV4A 1XU4A 1ZBDA 3MWYW 4ZO4A 2QG6A 4O3MA 4RD2A 4QKQA 3QKRB 5J4VA 2F7SA 4EIWA 2OO7A 2ZUBA 3ND9A 4Q48A 3C14C 1YZUA 5FOUA 4XH9B 1XTQA 5AJYA 1JJ7A 2Z4SA 3KTAB 3CH5A 1G8GA 5KOYA 4IDOA 1ZD8A 1AS2A 1DOAA 4JLJA 4RKFA 3MLEA 1UF9A 3B60A 1WA5A 5EZ6B 5P21A 2HJGA 1QHYA 3SJBA 1EESA 2VO1A 2VP6A 3W5JA 3SFZA 4EJSC 3QKSA 2F55A 5IHPA 2ZJYA 2YWFA 1F60A 3A6PC 3CRW1 5KSZA 1UKVY 2E1RA 2NO7A 2QAGA 3BRWD 1R8QA 2VP9A 3VKGA 2BWJA 2FGJA 2DCUA 2IYSA 1PZNA 4AK9A 1DARA 3SC3A 2O8CB 4P3YA 4PC1A 2V8OA 2WMNB 3C5HA 3RWOA 1XDBA 3LAWA 3U7EB 1DE0A 4MRNA 2EFCB 2RGXA 4BLQA 2O0KA 3AUYA 1Z29A 3BGWA 4IW3B 4BE7B 1N6RA 2XEXA 2ANBA 1JEDA 1R4AA 2GXUA 4NMMA 4HUQB 4M2LA 3CRQA 1G291 1G8FA 2AX4A 5EE5B 4RSGA 3CRRA 2N46A 1U94A 2OCYC 2GWHA 3TE6A 2B8WA 4FWTA 2CHGA 3R8FA 3U3OA 2GAOA 3P26A 1AN0A 2C9YA 3RDPA 5HZHA 1E2JA 1SXJA 2AKYA 3B13B 1SKYB 1KTVA 1D2MA 1EFTA 1T8UA 2R44A 4WIAA 4DSOA 4LPSA 5A4JA 2HDNB 1RRGA 5KNBA 3QXCA 421PA 2IL1A 4R7ZA 4F93B 1E2PA 4YXWA 1DPFA 3RRZA 1MO5A 1OXVA 2IYRA 1UAAA 1P2UA 2QPOA 1WQ1R 3SQXA 3B78A 2JAQA 4ABYA 1TNDA 4AD8A 1M34E 3GLFA 1SULA 2BBSA 4GOJA 1QHSA 1IONA 2QMUA 3ZS8A 1NLYA 3FB4A 2XXAA 4QHSA 4AKEA 1FOEB 4QNMA 3RC3A 3D31A 2Z43A 2XNSA 4CEJA 4EAQA 5DO9A 3G82C 3K9HA 2ZEJA 1GM5A 3X1YA 4TLEA 2PX0A 2QQEA 1NL3A 2KBEA 1MO3A 3KUDA 1T6NA 1Y63A 1BMFA 3U3RA 5B57C 1G3RA 3PJRA 1T5IA 3Q3JB 1OKKA 3AP1A 3OEED 5TV2A 1Z63A 4D82A 1D9ZA 1T0HB 4KITB 1KO1A 2RGDA 4OJKA 1TTTA 5JS7A 2VSFA 4I81A 5AR1A 2IUUA 4ACAA 2GXQA 2KJQA 5L3SB 4A6XA 4RZ2A 5FUWA 1NMZA 2YWGA 3B9QA 2NTYC 4IHQA 4JMPA 521PA 4BZQA 4D4KA 3CZPA 2Z0MA 2IS1A 2FEOA 3A8TA 3IHWA 1M74A 1WXQA 1XX6A 721PA 2BBWA 1T9HA 1EFRD 2LKDA 2OT3B 3KXIA 3H2YA 4H1UA 1U8YA 1XWIA 4P31A 2JLZA 3T1QA 5CDFA 3NEJA 1KDOA 1TF7A 4HDOB 1U8ZA 5DH9A 2ZRAA 4C3ZA 2X8AA 4AI6A 4QBIA 2DY1A 2D2EA 5DI3A 1Q1ZA 3CBQA 4AWXA 1U9IA 2FMXA 1DS6A 1KDRA 3F8TA 4RZUA 5TXGA 2CCJA 3R7WA 4OHXA 1C4OA 1NSTA 2CDNA 4TL7A 5FTNA 4A92A 1E2QA 3FWYA 3G0HA 3AKDA 4JVSB 1FNMA 1YZTA 1T91A 3KXKA 4RZXA 4DCTA 2XTZA 4MYHA 1PLLA 4DCSA 2VP5A 3NBFA 4NKRA 1CJTC 4IFEA 4XTRA 3I62A 2HYIC 1RC8A 4IEIA 4Q7MB 1Z0IA 3ND8A 4Z8YA 3ADKA 3OEHA 3U7HB 1E79A 4RD6A 3PUYA 1NVUQ 2GAAA 6Q21A 4PC6A 4ZDKA 3X1XA 5F9HA 1XEWX 1E2GA 4Q1CA 1DADA 5GVSA 1LVGA 2QMEA 2AFIE 2ODBA 4B74A 4TT3A 5KUTA 4TQUS 4EFMA 2OCPA 4YDSA 4F4CA 1M7BA 5HKKA 4HAYA 1ZM4A 2FE4A 2OSBA 4L5BA 4MGZR 2VRWA 4TZ0A 1Z28A 1W36B 5F98A 3QKSB 4JSTA 5CLLA 4A0GA 4TSFA 4WZ6A 2WM9B 2ZVQX 1D6JA 5JRJA 2ATVA 1A4RA 2QN6A 4JZKA 4LHWA 1GRQA 1H8HA 1SHZA 3QEJA 4Q1BA 5EP3A 3KQHA 3N2EA 3FTQA 1U81A 1H8ED 4ASUA 2ZM5A 1G20E 4P4UA 4W5WA 2F6RA 4TWZA 5D3MB 4IKEA 1ZYUA 1W0KD 1EFHA 2PH1A 3EARA 3A1WA 2Y8EA 2F1RA 2W0SA 2W58A 3U2QA 3NKVA 1OLOA 2BEJA 5DIFA 3EA0A 1T8TA 4KFRA 2C2HA 4LY6A 5FR2A 2RH5A 4A0RA 3GLIE 4V02A 1AZTA 1T3HA 2WKRA 5KSYA 3FYHA 1DTSA 1YRAA 3EA5A 5CB6A 5E4FA 2JJ2D 3PUWA 4A15A 2R8RA 5AK0A 1SXJB 2FFHA 3AVWA 4OBEA 4UNQA 5IK2A 4TLBA 4LHXA 3ZVNA 2WWXA 1UFQA 2WWYA 5JJLA 2C03A 3RWMB 3CPHA 4Q02A 3SYKA 3H86A 2REOA 4L9WA 3UK6A 1TAGA 2A5DA 5HTKA 2ZI9A 5JI2E 3GLFB 2ZANA 1XNJA 4A0HA 5CM8B 4QHYA 3GJXC 3DKPA 3TK1A 3TUZC 1KO8A 2XXAB 3ZQ6A 4YMSA 1RRCA 2KI5A 4OHWA 1QHHA 1UADA 3K70B 4CEJB 1IQPA 1TQ2A 2JA1A 2F9MA 4QL3A 3CB4A 4Q1FA 5CJ2A 3ZQJA 3GLGE 1NNEA 3UG7A 1GOTA 2G77B 4GP7A 3IIKA 2BMEA 1SVOA 1N0VC 1GKIA 4AYTA 2C99A 3CRMA 3LA6A 4JBYA 4WOPA 1G4AE 3LQRA 4ZKEA 4EUNA 3EWAA 3KFXA 2BDTA 4FWIB 1P9RA 5JJIA 2ATXA 3V4FA 3HP1A 2QM8A 4K81B 1XMVA 2ECKA 1UM8A 4OHZA 1OH7A 3FGNA 1GDDA 3IPXA 3ZGXA 1OH6A 4LUCA 5FL3A 2B7CA 5AWFC 3KKQA 1KAOA 3E70C 1RE0A 4NBSA 1HYQA 1E0JA 3IIMA 3B6EA 4TYQA 2QUZA 3C41J 2J41A 3VR2A 3GQBA 4M9SA 1NKSA 4KJZA 2O8EA 4B3GA 1KK1A 3KKPA 2FWRA 2NO0A 2CL7X 3HWSA 1TUIA 1G3QA 4NYJR 3VHXA 2ZE6A 3C4JA 4MRRA 4DDTA 3GD7A 2J0UA 3B1WA 2C5LA 2YHSA 4M4SA 4XSGA 1G3MA 1UBEA 3B1VA 5DI3B 3TR5A 4LBZA 1W4CA 2J5XA 1G5PA 2VHQA 3BH0A 4BASA 5H1YA 4G5GA 2CXXA 3R7WB 4KLZA 4M1SA 2FN4A 4LJ5A 3Q7PA 1CEEA 3WHKA 1N0UA 1EX7A 5FPSA 3SOPA 4C9BA 1XJQA 2G0TA 5KDOA 4Q19A 3MWLA 1R8SA 2NMVA 1QF9A 2FX3A 3I1FA 1R5OA 3T5DA 2IYWA 1UBFA 2CL0X 3WNCA 2CBZA 3OAAD 2WICA 4Z1MD 1FL9A 2GJSA 2GBLC 4WVFA 1LF5A 5AJXA 1E1RD 1KI7A 4CIDA 1QHXA 3CZQA 4PC3A 3ADCA 2FPKA 1CRQA 1KY2A 2YVUA 4KVGA 4TMZA 2FFBA 4B6EA 4KYUA 1CR1A 1XZQA 4Z54A 2NZJA 3K0FB 1VHLA 1YZNA 2H1LA 1AQYA 4KFTA 2QPTA 4UQOA 4US1R 5IRCD 5M04A 1ZAKA 1CJMA 2VHTA 4ZDJA 4RFSA 3UWOA 4W5HA 1W48A 2ZRIA 5G53C 4BZPA 1E1QD 2UKDA 1XD9A 2H92A 4GOXA 2OEPA 2RCNA 4L8GA 3O8RA 4Q7KA 2AD1A 1NN5A 1ZM7A 3CRVA 3OIYA 2WAYA 3V9PA 3BWDD 5KTYA 3LX8A 4ZDWA 1CXZA 4Q47A 1GILA 1ONBA 3GEEA 2ZAMA 4LJYA 3TVTA 2CE7A 3PITA 2BV3A 3TJZA 5B64A 3LRPA 1AGRA 4IXNA 4MA4A 4LHYA 1E9FA 3A58B 1NJFA 1N5LA 1S1MA 3SS8A 1RJ9A 2IYQA 4BUJA 2H18A 4EFLA 2ZETA 3OIUA 1KHTA 2FGKA 2H8KA 4UKDA 4DXAA 2OLJA 4B2PA 1P73A 3DMDA 5EE1A 1W36D 1EFRA 3Q5DA 3AKYA 3L2OB 2J0QA 3VR6A 2WWFA 1FMJA 3C5CA 4XJXA 5JZVA 1DO2A 3IQWA 3WNBA 3FMPB 3PG5A 3LVQE 5JWRA 4ZCMA 4L4UA 3GJ7A 1WBBA 2ZE5A 1L7VC 3GP8A 2ZYWX 1H65A 4Q1EA 1S9HA 2WWIA 5EXSA 4WXRA 3GJ5A 4A0FA 3PFIA 4TYYA 4I1OA 2EQBA 3CIOA 3NWJA 4BFZA 3IO3A 4B44A 4CRWB 5ELXA 4A36A 3TSZA 1W49A 4LYHA 2OBNA 3BH6A 4Q21A 3LX5A 2OBLA 5JHGB 1NY6A 4HSEA 3WHLA 1SXJD 2F1JA 5FR1A 3AP3A 3AEZA 3FFAA 1A7JA 4EJSA 1S1CA 2OILA 2FA9A 1Z6TA 3C7KA 1Q20A 1RIFA 2GZHA 4ZKDA 2ODWA 2FZ4A 2ZSFA 4N0DA 2PEZA 2PMDA 4XSHA 4RY2A 2EYUA 2IXEA 3L0PA 1OXXK 1E2IA 1GRNA 4JLVA 1N6PA 5CYPA 3REFA 3TRFA 3UXMA 4D80A 3KQUA 3OFNA 1W5TA 1GNRA 5TB5A 1C9KA 4L16A 3WXMA 5JECA 3L0IB 1YE8A 4LWZA 3DL0A 3PXGA 1IJFA 2PCJA 3HYTA 4Q4HA 3MD0A 2EFDB 1NN1A 5E3HA 3EZ9A 1Q1BA 2GDJA 3THWB 1U0JA 1EWQA 2ZR0A 2GJ9A 2RGAA 4A2WA 4OQLA 4PPNA 3K70D 4CT4B 2J0UB 3BB3A 1XD8A 4EKDA 2JLRA 3WP1B 2QEQA 4ESVA 4TTPA 3NBYC 4NCHA 2IA5A 2IYVA 3T1TA 1DBSA 4MGIR 1DAHA 2EW1A 1BMFD 2OXRA 1KJZA 1OFUX 1NIPA 3KKMA 4LSGA 2WTUA 2QPAA 4IOJA 2A5FA 1E6CA 1KMHB 2B7BA 1OKKD 2XX3A 2W0MA 3NHAA 4KODA 4NU0A 4MRVA 4PZYA 1ZU4A 3VX4A 2D3WA 2OBMA 4KAXA 4TTRA 1J99A 1K6MA 4X8LA 3FMOB 1FMLA 3NIBA 4NE2A 2YOFA 1J7KA 3P27A 3AB3A 1T3SA 1T3LA 4XWOA 3CF0A 3W34A 1S2MA 1OF1A 4KXFB 4ZCIA 2QRZA 4US2R 1VECA 2A5JA 1QBKC 1SVSA 1SGWA 2VQSA 3S1AB 3EPJA 2YWHA 2ZRBA 4IDPA 3U44A 1XP8A 1P72A 2WMOB 4UNNA 2GESA 1ETUA 1OE0A 5LB4A 3IIJA 5LD2B 2OAQ1 3IPYA 1KMQA 1UJ2A 4CEHB 1GWNA 2QAJA 4TLDA 4MYCA 4DSNA 2OG2A 5CK4A 4BRWA 4NCNA 2RGCA 4CT5A 2ZUCA 3EX7C 3ETLA 2VP2A 4PHTA 3BH7A 4R2HA 1BO6A 1XD2A 2RGEA 2C95A 1KO4A 2F3RA 3Q72A 1OIWA 2IF0A 1NJGA 1ZM3A 1M7HA 3W3AA 4HAUA 2ERYA 2V6IA 4U00A 3U3MA 3W3ZB 5G40A 1JALA 3B2EA 4HLDA 4F7WA 5HPYB 3VR4A 4A9AA 3OEHD 1E79D 2ODEA 4L9SA 4QGFA 4BLTA 1NP6A 4HLUC 4E07A 2ZYUX 4LYAA 5B30A 1NMXA 1OXSC 5AJZA 4TYNA 1SVLA 3GEIA 4TT3D 2V54A 5TMPA 2IS2A 4B2LA 1E98A 4ARZA 3QBVA 4JKIA 3SFVA 3SYLA 5HKKD 1DAMA 2GCOA 3T06B 3KFVA 4XVQA 2VHJA 4LBVA 5J5CA 3D6TB 3GJ8A 2C04A 1SVKA 4HB4A 5CJPA 5FOSA 1ZP6A 4AIIA 2C98A 5C18A 4TSFD 1VTKA 3GLIA 3DVLA 2VSOA 4QNRA 1H8HD 1G41A 1MABB 1JNYA 4JKYA 4ASUD 2F9LA 1I4TD 5L3RA 4PO8A 1TQ6A 2ERXA 1RYFA 4IVQA 4KVAA 4DUGA 2BC9A 1VG1A 2HV8A 5JEDA 1A2BA 1XEWY 1UPTA 2DBYA 1JAIA 1G64A 2Q3FA 2WSSA 2AR7A 4A2PA 4PC2A 5BQ5A 3EIQA 3IKJA 3JVVA 4TN1A 1OH8A 3H4MA 4C0KA 2O0HA 1YR8A 2EWVA 1G7TA 2OHFA 4PQFA 2PMKA 1HUQA 4HEJA 3LBHA 4RVCA 2GHIA 3MSXA 5IK2D 4O2RA 4EJSB 3ZZTA 1FQKA 2QSZA 4A6PA 4F4JA 3KL4A 2Q21A 2GVZC 2CLDX 3GLGA 3RNLA 2O8BA 1KDPA 4RZ3A 821PA 2MSDB 1T5LA 2WKPA 3CX8A 4RD3A 5FPTA 3A1SA 4TMWA 1GL9B 4GNKA 2K5UA 1EFCA 2DWPA 3GJ4A 3NBZC 4HB0A 2J7KA 4EPTA 1XFAA 4Q4HB 3TH5A 4AY2A 1W0JA 2AWOA 1OFHA 2NO1A 3W8NA 2HLDA 2IYUA 3I73A 221PA 3NXSA 4ON9A 4ACBA 2GCNA 2SHKA 2P2LA 3UATA 3ICEA 2BJVA 3NH9A 4FW9A 4LV5B 2EVWX 4PR0A 3UANA 4ZIRA 1RPZA 1BH2A 4OK6A 4KSBA 2IEZA 5CITA 2D7DA 4R71A 1XMSA 1W5SA 5K8LA 1J2JA 4LK2A 4LRWA 4XVUA 4G0NA 4S2EA 3B1ZA 4IOMA 3LXXA 4MUAA 4Q5IA 3CX7A 2GEDA 1NSFA 5FBQB 3K09C 1XPUA 4GRAA 2AXNA 4DEXA 3TR0A 4A8JC 3GLHE 1P2SA 4C30A 4JVMA 3IDQA 3RVBA 2XZLA 4DSTA 2HCJB 3PEVA 2AK2A 2XJ4A 3I92A 1MOZA 4UJ3A 4GDFA 2OXCA 1R0XA 3DPUA 4OJQA 4UNRA 3AVXA 2GILA 2GK7A 4DLYA 3HJNA 4B3XA 1NN3A 1S8FA 1MRSA 2GJAA 1SVMA 2W6IA 5SZJA 2ONJA 1JQLB 5GJWC 1AQUA 1U90A 1T4GA 2H5EA 3T12A 3UMSA 4HZUA 1ZINA 2JLSA 2JLWA 4GPTA 3BBPA 1EG7A 1QVRA 3BB4A 1NMYA 1CRPA 1II0A 3I5XA 3RRNA 1WCV1 4JVLA 2VPPA 1G6HA 5BN4A 2HT6A 2WIBA 3SDZA 2IEYA 2R6FA 2ZRMA 3R9IA 1XD2B 4NYMQ 4QOSA 1E2EA 4GMDA 3RAPR 4DT1A 4AURA 2CNWA 3LDAA 2O8FB 2VBCA 2YZ2A 4B34A 2QA5A 2GEUA 4WW0A 3QKTA 3I72A 2CE2X 2JGNA 3W6NA 2PJZA 3AVQA 2FG5A 5DHFA 5F9FA 4ZPXA 3LNCA 1S3SA 3V00A 4ARZB 3CH4B 1R7RA 1CR4A 5KYKA 3OIVA 1GAJA 4QBGB 3VFDA 1UKZA 4YLGA 4DIDA 3R9WA 2D4HA 2A7QA 2KSQA 2BMFA 2IHBA 4FMDF 2J7PA 2AN9A 2V6JA 4LC1A 3KKOA 4C0HA 3O8CA 3CLVA 5FBRB 3LWNA 3LO5A 4M9ZA 3K1JA 1ZVQA 1XPRA 2WJVA 3VAAA 1NVWQ 3QF7A 3DM9B 4OHVA 2D62A 1W47A 4PZZA 3VHLB 4DDUA 3VNVA 1IAQA 1X86B 3RS3A 5EZ5A 3WP0A 3DEFA 5AUQA 4LCBA 3U60B 1II8A 2R65A 1IM2A 3AVTA 2PZFA 3KJIA 4MGKR 2FEMA 4PZLA 5EP4A 3DZ8A 1WBDA 2V55B 2JATA 4GSYA 4OL0A 1DELA 5FBWB 3B85A 3KDSE 4DLVA 2FSHA 4RCYA 4DKXA 5J40A 4OI0A 2BBOA 2XSZA 3QEOA 5CB8A 2AXPA 5IT5A 2XGJA 2PZGA 2NIPA 2QL6A 1FPMA 2GBLA 2GJ8A 1KK2A 2UVQA 4LX0A 3TAHA 3U61B 3BD9A 3CNOA 3CKLA 4URWR 1X1RA 1L4UA 4UJ5A 2W2TA 1I4DD 1KO7A 3EPKA 2WWHA 4JYBA 3K0SA 1CULC 1QHNA 1I2MA 2H57A 3MWJA 3GLGB 3WBJA 3A4NA 1ESNA 3U4QA 1WE2A 5IF9A 2ZSDA 1E2DA 1G18A 1OB5A 2ZJ2A 3GPLA 4TMVA 5H68A 1Q3TA 3TUIC 1K5GA 2ZJ8A 3QE0A 4B3DA 3NBXX 1ZNYA 1N6HA 1ZC4A 3L0SA 3UIEA 4I99A 1FNNA 1OJLA 4LJAA 2XB2A 2QT1A 1E96A 4DHEA 4UXHA 4B3CA 1CR0A 4LZZA 1FX0A 3IHLA 1TF5A 1OW3B 2QBYA 5EUQB 2ORVA 3DHWC 5JS8A 3C16C 1PLJA 2ZSEA 1TU4A 2UZIR 1FP7A 3O47A 4QRHA 4DCNA 2PT7A 3AF2A 1O3YA 1E9SA 1QG2A 3AF0A 5HZKA 2PEYA 1G17A 3TSWA 2OCBA 3PEUA 4HLQB 1P5ZB 1BOFA 1GIAA 2YWEA 2ZI4A 2ZRJA 1VDZA 4WXPA 4CDGA 3NEYA 4Q9KA 4B35A 2MSEB 1N5IA 4EPVA 3WNDA 3I32A 3MJRA 5SZHB 3EZ7A 3AQ4A 4NONA 2OCAA 4E22A 5C1BA 5BYKA 3ZD7A 1RW4A 3IBYA 1TQ4A 2FSFA 4OQFA 3LW7A 3OFND 3ONWA 2HT1A 2QAGB 4M21A 2ZI3A 3QXJA 3RSLA 2J9RA 3BIFA 4WA7A 3HR7A 1N3BA 1Z6AA 2G0NA 1CBUA 1W44A 3F3YA 4KBGA 1E9DA 2PLRA 2AWNA 2DPXA 4HZUB 2JLUA 2NGRA 4BQSA 1Q44A 4LDJA 1N6NA 2YV5A 3SR0A 1E99A 4E5UA 5JCZA 4WBSA 5DYIA 1SKYE 5A5GA 3MG9A 1Z0DA 4V0ME 1XMIA 2IK8A 2C96A 3A37A 1NKTA 3D7MA 3OIWA 2QRNA 4JJZA 2WWGA 3O8DA 1TUEA 4TLCA 5FOWA 4URXR 2V9PA 4DT1B 4J0QA 1E2LA 1QRAA 2DR3A 3THYA 1TQDA 5GJBA 3MRSA 1OSNA 2VA8A 4OYHA 2HJVA 2FJUA 2RKOA 4YMVA 3QKUA 1LNZA 2DFNA 4HI0E 1E3MA 1OHHA 3MJHA 1IN4A 4V0OA 1LFDB 3NH6A 4P4SA 3EC2A 121PA 5HE9A 3FKQA 5J4YA 3SBDA 3L8YA 4DCUA 3RABA 1G7RA 2Q9CA 4AKGA 1YQTA 3QI2A 1X8KA 3T61A 2VP4A 5EP1A 4DSUA 3NDBB 4M0LA 4NYIR 5BN5A 1T0JB 3N70A 4YDHB 4LI0A 4POAA 5CK5A 1M1YE 5FUXA 1HY3A 1U0HC 2PL3A 2W6JA 1UKEA 2ZR7A 2J45A 4KFSA 3R9XA 1II8B 2JJ1A 4TTQA 2G9NA 3K0AA 4KSCA 4LV8B 1KSFX 1Z0FA 3KXLA 4QHTA 1E0SA 2V3CC 2B92A 3LBNA 1RRFA 3OESA 1Y3AA 1VHTA 3B1XA 2QM7A 3VNUA 1IOZA 1XXHA 1NIJA 1OIXA 2GK6A 4URZR 1HQYE 1YU9A 3CM0A 4BZXA 3GJ0A 4DLUA 5AJVB 3L43A 5B2ZA 3DMNA 4G3XA 4GL2A 4DLTA 2GTPA 4QXAA 3MWKA 5KHOC 3W90A 4CYMA 4MRSA 4A82A 5EUMA 4D0NA 2B6HA 4LJ4A 1G8HA 2QTHA 5CLQA 1Z6YA 5JI3E 1S0UA 1YRBA 4Q18A 4EQ6A 4PAQA 2I1VB 3FPAA 3KJEA 2CVFA 5BN3A 2NO9A 3CPJB 3FHOA 5JMTA 1KNXA 5BXQC 2WWWA 3EWSA 2O8DA 1R6BX 2ZRKA 1TMKA 3P32A 1NRJB 1NLZA 4HZIA 3QJYA 3LLMA 3BAFA 4DC9A 3LW8A 4LJ6A 1QG4A 4IFBA 1FX0B 4PSAA 3TBKA 4DUGD 1JR3E 3L8ZA 2QBYB 2CJWA 4U02A 2WSSD 1RFLA 4HLUA 3BC1A 2CL6X 1XZPA 4JLBA 1Z0JA 2V1XA 4OHYA 3RSOA 3AP2A 3QG1A 3AF1A 3Q7QA 1KZGB 3X1ZA 4NHOA 1JR6A 1R10A 1N0WA 4FMBB 1IY1A 5DN6A 1E2NA 3R8CA 4Q9LA 4D0LB 1B23P 3VR5A 3WYAA 1MRNA 3LBIA 2A30A 1GVNB 1KOFA 3W5IA 3ZIAA 2I4IA 1GITA 5G41A 2YINC 1SVWA 1LW7A 5AJWA 3OF5A 1AGPA 5FFMA 1HE8B 5HCNA 4EPYA 2OM2A 3RLFA 1W1WA 4DZZA 1XRJA 2CK3A 1ZCAA 3DOFA 3LVRE 1TEVA 4PPFA 2WHXA 4MKHA 2F1IA 2LKCA 1W0JD 3QVUA 2VTKA 1D2NA 3AF4A 4YONB 4JL8A 2HLDD 2P6UA 5DI9A 1Z0AA 4GBMA 5SZIA 5JFGA 2OE2A 2WPDA 3GLHA 3P4XA 2ZRNA 4F4IA 1R0WA 4HAXA 4AYWA 4R2IA 1W7AA 2BJWA 4HDCA 4M1KA 5EXPA 2P0EA 4Z8XA 4DWJA 3PEWA 1FUUA 5LBIA 4LOAA 4IOKA 3QVVA 2BOVA 4DIEA 4JLDA 1MR3F 1NI3A 3G5UA 4FMCF 3QUSA 4BEJA 4M1WA 1P9NA 4Q4LA 1K5DA 1RRPA 2IF2A 2PLFA 4Q4AA 3QY0A 4MKFA 5J4LA 3U7GA 3DZDA 3FKSD 4WZBE 3GMTA 1DO0A 4XIGS 1UBGA 4XWKA 1AZSC 1PUJA 4BLOA 1DAGA 1OFTA 1XCPA 4QGAA 1NVVQ 2DFKB 4HB2A 4DJTA 5EXTA 2R6GA 2Z5FA 1G21E 1HT2E 4JLNA 2GF0A 3PR1A 4G5QA 1ESMA 2W6ID 3HPQA 1A1VA 4D26A 1UDWA 4BPBA 4JIMA 4D81A 1S4QA 4PTLA 5C4GB 1IN6A 4M1YA 1P60A 2R2AA 1QHHB 3AVPA 4C4PA 4F38A 1JECA 3AVYA 5FH9A 2ZRDA 1G7SA 3RHFA 2Q0HA 1E4VA 1GFIA 4B32A 5E7IA 4OKSA 1O87A 3DDCA 4UNPA 3K0AB 5DGXA 3CNLA 3K09A 3ZZUA 2FFAA 1OPXA 2ZR9A 1U98A 1KAGA 4JLPA 2J1LA 3RS2A 4A8JA 3I5YA 2VYFA 5TARA 2CNWD 2IUSA 4DB4A 1G8PA 1YR6A 3I4LA 3LQQA 3PIRA 4TMTA 1L8QA 4Q7LA 3KB1A 4I1UA 1Q1EA 3CO5A 2Q3MA 2VP0A 4XD7A 1NG9A 2ZRGA 3K8YA 3J81k 3FE2A 2QP9X 4FCTA 2FFQA 1R0ZA 2H7VA 4JVNA 3TIFA 2WV9A 3IGFA 4DVGA 3CF6R 3IQXA 1JXOA 4FXPA 3AVOA 2J7PD 5JWHA 4JBWA 2O8EB 4MITA 3IEVA 3NG1A 3GJ6A 4UXJA 1E9RA 2PZEA 3AKCA 4EQ6B 3K0CC 3ADBA 2WKQA 1GL7A 3B82A 1JB1A 2E9SA 1KKLA 2O8DB 2JASA 4KYIB 4LYFA 3ZLJA 1ZIOA 5JWOA 1KKMA 3CONA 4MKGA 2ZPTX 2JLVA 3PUZA 5KPJA 4W9MC 5F2EA 2GVDC 3RS5A 2WOOA 4DRZA 4LBYA 1F2TA 4JS0A 4ZV4A 2HF8A 4A4DA 4XOIA 3AH8A 4XVRA 2GZAA 4CGZA 3UMFA 1WB9A 2DYKA 1U8AA 1OYWA 2XSZD 3WRXC 1G8YA 2P3SA 4PO1A 5J4HA 2VIIA 2IXGA 3JZAA 2QI9C 4ESHA 3VU9A 4BEBA 1FP6A 2DFTA 3BORA 2JLXA 1Q12A 1DG3A 1P3JA 5L8VA 2ORIA 5DISB 1V5WA 1Z06A 1NN0A 2BKUA 4TL9A 4D4MA 4JBXA 1NG1A 4NCJA 4GZMA 1IN7A 2F43A 1IY2A 4PHFA 1PLKA 1GZSA 1AS0A 2GZDA 3P4YA 4NCKA 1OB2A 1AJEA 4TL6A 4RFSB 4TL8A 1KI4A 4V0NA 3LH5A 4QJ3A 3H1TA 2IYZA 4JT2A 5EE0A 3U3KA 2FZLA 1FTNA 2AK3A 4DDWA 2HXYA 2WBLC 2EFGA 3QF4A 3GLHB 2ZRCA 1F2UA 2C9CA 4M22A 4MGYR 1AIPA 4LC0A 4LBWA 3TKLA 2GXSA 3SNHA 1E0KA 2W00A 4G01B 3WBKA 5DYGA 3VTKA 4Q1DA 1LS6A 3T1VA 3ICQB 2QSYA 1MT0A 4D25A 2I3BA 3WYGA 4HUQA 1ZU5A 2GCPA 3EG5A 1NBME 1GNQA 3A1TA 4IXMA 4B3BA 2WIAA 4MH0R 1RJ9B 4NL4H 4CZ2A 2XB4A 4Q4AB 4O2LA 3MCAA 3HR8A 2ZIAA 1TU3A 1KO5A 5KSOA 3Q9LA 1QHIA 1FW6A 2P6NA 2ZU6A 1BIFA 3VR1A 4ZDIA 1UEIA 2FSIA 4TQ9A 2HEIA 2ZJ5A 1I2DA 2J3EA 1IJEA 4QG7A 1CKEA 3NHBA 2ODNA 2HF9A 1XXHE 4V0MA 1COWA 3CR8A 4P0TA 3SN6A 8OHMA 4KHZA 1E9BA 2J46A 2CCGA 4PO9A 3CX6A 4H1VA 1E9AA 4BGDA 2ZJAA 4UXIA 2A5YB 1Q22A 2WJJA 5DNYB 4LHVA 3BK7A 3NVAA 4M53A 4CF7A 3HPRA 3ZVMA 2QORA 2BM1A 4LJ9A 4Y0VA 2AL7A 5HR5A 1IY0A 1M2OB 3SBEA 4QBFA 2J59A 5UKDA 2L0XA 4MKIA 2IUTA 5AUPB 1G3UA 2D7CA 2PX3A 1KJYA 3FHTA 2FF7A 1KI6A 2FNAA 2RGNC 4A8JB 1HEIA 1JPJA 5LD2C 5FBVB 3U7FB 2ZTSA 3CW2A 4NCIA 4M1TA 1VKJA 4MUBA 3W8RA 1ZCBA 3KKNA 5FPHA 1Z08A 5K8TA 4XTCS 3THOA 4BFYA 5KO2A 1OT3A 4DEYA 1OHHD 1P61B 3DKVA 3PVSA 1M6NA 1Z07A 1HE1C 1YZLA 2MSCB 1ZM2A 1ZC3A 1W4AA 1IXSB 2ZU0C 1Z8FA 2XNDA 1G1MA 1XJ0A 3ZH9B 3M0EA 4OQXA 4ZI2A 1DEKA 1IBRA 1KY3A 5JJKA 1ZNWA 2VSXA 3KQLA 5L3QA 2XOKA 2GEVA 2W6JD 4TZ6A 5KNDA 4D0GA 2ZRPA 3EZ2A 2X19A 3ZJYA 1KSGA 1EX6A 1S3GA 2JJ1D 1WDTA 3BB1A 1JAHA 3FOZA 5JHHB 2OUKA 1F2TB 2X1VA 2JEOA 2G88A 3AVVA 3AM1A 1KI8A 2FH5B 1F48A 2HUPA 3L0OA 3RC8A 2ZRHA 5BWMA 4B73A 4BFSA 2OESA 3FKSA 1DAEA 1KSHA 1GKYA 2O5VA 5DLQC 4FCWA 2AFHE 3VU9B 2R6AA 3VQTA 1R2QA 3O8BA 5BYJA 2R9VA 1JR3A 1M8PA 3A4LA 2RMKA 3NC1C 1R0YA 1VIAA 4D4LA 1Q1QA 1WP9A 3U44B 3D3QA 4PSKA 2V1UA 3X1WA 1G16A 2IHYA 5JCPA 3KQKA 4EFNA 2F43B 4M1MA 3THXA 1II9A 1XTSA 1YZGA 4U5XA 1CJVC 3GFPA 4JYCA 4HLCA 5AUOB 2VHUA 1VIYA 1A2KC 1Q57A 1QDEA 2C9OA 2ZROA 1A82A 1XTKA 5FI1B 3SU8A 2DWOA 1HA3A 3QF4B 1CLUA 2WJYA 1XPOA 1F2UB 1P7CA 1R5BA 2IYXA 2XITA 2Z6VA 3VKWA 4MRPA 4MDFA 4I1SA 1CIPA 2ZJOA 2QMHA 4C0SA 4NYIQ 2GNOA 1N5KA 1ZJ6A 2NG1A 3HYRA 4GZLA 5D3MA 4LJ8A 4O0MA 3U6BA 2V7QA 1DVRA 2FSGA 1HV8A 1KIMA 1OH5A 1UBCA 4TLAA 5DN6D 1JXMA 4I1VA 4OI2A 4R9UC 3IUYA 4UNSA 4B33A 4OK3A 5CIQA 2IS4A 1XCGB 3ZIAD 2IYYA 2GCOB 2J0VA 1TPZA 1AK2A 5EE9A 2IBMA 1EGAA 1KI9A 5A0FA 1EXMA 3A4MA 4EPXA 2F1HA 2PCLA 3QBTA
chains in the Genus database with same CATH superfamily
3GZJA 1MB4A 2LWIA 1PQWA 2C5AA 4GKJB 2ZUFA 3DLPX 1L2TA 2CK3D 2RB4A 5IU6A 3KYDA 2X1MA 1Y8QB 1E5DA 1W2HA 5K0JA 1KR2A 4LW8A 1TK2A 3OMWA 3NYIA 5FWXB 2WUGA 2W42A 4NC9A 2H4JA 2WQZA 4DZRA 4OX9Y 3LPDA 4OBXA 3HFJA 4RPHA 3IQDB 3IBTA 4F92B 5F73A 2WPDD 3OJXA 4JN6B 3PQ8A 1CR2A 5FNVB 3A1EA 2E3JA 2FB9A 3U0BA 5IBRA 1FQJA 4R8VA 2BFPA 2XQJA 4B7ZA 3L7LA 4L7QA 2XUFA 3BWEA 4BP8A 2BMJA 5HW0A 1GU0A 1UJ6A 5FRDA 2X86A 5M34A 3QPAA 1SNYA 2A67A 2YVLA 5CA1F 3IE2A 4GF5A 4QGBA 5KYXA 1T15A 3NHLA 3MN1A 3B12A 5TEVA 1BCSA 1RADA 3BFJA 1KI3A 4LJSA 4QDOA 2QN9A 4JH0A 4B9EA 1IHUA 1TT5A 1AY0A 1WPGA 4NG4A 5DYNA 4RJLA 3UWSA 2BGLA 3NKLA 2QZ9A 4F5EA 1WZUA 3ZWOA 2O8BB 2GAFA 1VMAA 1VG0B 4EYGA 3AR5A 2XEDA 3KVVA 3M1IA 4JI7B 2VDRB 2WJWA 2AHOA 4YMTA 4PW0A 1DKMA 1GNPA 2YKGA 4MA0A 4HQOA 3F1LA 3U6KA 3HN6A 1D03A 4LTDA 1FNSA 3GMDA 3H4VA 3HGQA 1YWGO 3QENA 3RUHA 3KQPA 5TQJA 4DIFA 3IA7A 1CZUA 4GG1A 2OAEA 5H0IA 5K3DA 3V8MA 1Q5PA 1AMUA 4X0EA 3DAYA 3EZ6A 1HE5A 5A3QA 4LDNA 2FJ0A 3EIUA 1OXMA 1FS5A 3L6EA 5KWSA 3KJZA 1PGQA 1WCWA 2R5WA 4URYR 4ZZ1A 4Q01A 3GLRA 2GM5A 1GCUA 1ZRMA 2VJLA 2YJ4A 3BVPA 4BECA 4F2DA 2ZQ5A 4JSYA 1NJSA 4MAMA 4NK5A 4UDXX 1GPLA 1ACLA 4GQIA 1SC1A 5IS2A 2OECA 1TADA 2GKSA 2QJOA 2FKNA 3E0QA 3FMIA 1V43A 3SJAA 1YKSA 4K6MA 3K72B 2Y0PA 1EVEA 4TMYA 4EEZA 2CVHA 3IQIX 4W7HA 4QPJC 3RUPA 3R20A 3UJPA 4XD7D 2M6SA 2XKBA 4ERNA 2DHQA 2XQGA 4F72A 2ZSAA 5FBHA 4XB2A 1PV4A 1CB7A 3CJRA 2YNMA 2P7IA 1IOLA 4MK4A 1KGDA 3SHFA 4F91B 2V45A 4JGBA 1VMKA 5KJ6A 5EINA 3MUNA 3QOWA 1FCJA 1BWQA 2FMKA 5LFAA 1DTWB 4TWIA 2B30A 4MRMA 4ZCSA 1P2TA 5EJGA 4OP2A 4RQBA 4D9KA 5JCOA 4DQKA 1VJ0A 5KVCA 5GADl 4BE4A 3P9CA 1YCFA 3C97A 4F7DA 3EGDB 1JFFA 1Z34A 1WABA 2A0WA 1YA8A 1PQPA 3SYMA 2R8ZA 2VSQA 4EKEA 4DPMA 1DT5A 3C6BA 5FT9A 1JJVA 1TZKA 3WOHA 1WSDA 4WEOA 1D9XA 1NVXQ 2CJYA 2BD0A 2QG9A 1QIKA 3BFKA 4CW7A 5FL7A 4DIKA 4JODA 4OHRA 2UYGA 4F9FA 1IFXA 4UM8B 1T10A 2X77A 3ZHTA 3COSA 3LUAA 3OOWA 3DDOA 1E6MA 3ZH2A 1ZOSA 3RAEC 1DAIA 5JZBA 3Q6NA 1PJ3A 2DT5A 2D1FA 2GKGA 3R24A 3WQQA 3SJ7A 3TX2A 1RYHA 3EZYA 1BTOA 1L5OA 3N2NA 1HH4A 5EE3A 5EWMA 5EQDA 3MMPA 1RRMA 3F6RA 1SZJG 3D2LA 1O6GA 5DV9A 3OO1A 1AS3A 2OD7A 3W5HA 1Q83A 1PCXA 1ZQ1A 3I9LA 1ISIA 1GXSA 5BMVA 4C0QC 1ORRA 3OEYA 3FKJA 3H13A 4KLCA 1OA1A 3DZJA 3BHJA 1PKEA 4GOND 5CVVA 1ADYA 2WSIA 1C1XA 5AVYA 1R3UA 1Z5WA 4C7OA 2BCGY 3ZYCA 4BS9A 1GP2A 2J48A 3V3KA 4C0AC 2C77A 3Q98A 1GSIA 3EFHA 4JELA 3G8AA 2QJFA 3K6KA 4TRJA 3RRMA 2A8YA 2YJ6A 4HAVA 5EWLA 5BQ3A 2JGDB 5AKKA 4BRUA 4I50A 1E89A 4U8GA 3AJDA 2ACKA 2YYZA 1KVRA 1LLCA 2C5HA 4KCGA 4RABA 5C3UA 2C5EA 2ZE7A 4Y8VA 3GFBA 1XTPA 2BMAA 3PSAA 4RZQA 1JHVA 4YRCA 3T3PB 1VYUA 3T5BA 4HEA6 4HNHA 3ZCPA 4NARA 3WRXA 1ZX1A 3J80A 3WYDA 4UC0A 2BSXA 2QT0A 4PPGA 2OBXA 3K9LA 4PGAA 1CUCA 3OCXA 2P68A 1A4UA 1S01A 2X2PA 3HI6A 3BKWA 3N8HA 4R3NA 4TV9A 3H5VA 3SF8B 5JPDA 3C24A 4BB9A 1ZUIA 4IWYA 3G2NA 5A02A 2QSJA 4O1HA 1CIJA 3I61A 3RS7A 1V6AA 4CG0A 1WB5A 1DG9A 1ADFA 4OQNA 4XPIB 4HPJB 4YASA 5JH7F 4BFWA 2I2CA 4JSRA 4AUMA 4EELA 4CEIB 2WG2A 5B1YA 5D85A 3OQIB 5ABPA 4OB8A 3CR7A 3PX7A 5D00A 2VJCA 3FHCB 1W4ZA 1NPDA 4RAQA 1VLVA 1XEXA 2IYTA 4LPKA 4LYEA 1BX0A 4HQLA 4JXJA 3KETA 3W0LB 3W4JA 2ZAOA 5T4EA 1DCTA 1CZHA 1XTJA 3I45A 4TS9A 4TYPA 2XXJA 3RANA 1NVDA 4CTKA 4D8VA 4IO0A 5BPHA 2Q5JA 2PUBA 2BGRA 4WOBA 2ZUVA 3JQ7A 3I2KA 5IWCA 2DXIA 5LQCA 4ND8A 1LDMA 3ZDXB 1ML4A 1Z5ZA 3GPDG 3CNNA 2OOSA 1E3JA 4NDNE 1S02A 2VYNA 4HYTA 3TNFA 3M1AA 1UFVA 2IYLD 1S9DA 3GP3A 3K16A 4GT1A 1UT5A 1ZVVA 4CT0A 3BE8A 3TQFA 4Z51A 2AEFA 3NTUA 4Q3DA 3DVSX 1KEPA 3FPSA 1MO4A 1HKHA 1X7XA 5BRAA 1PJRA 3FUWA 3M6AA 4H3VA 2D0DA 3VR5H 2IYNA 3HG7A 1IB0A 3HDJA 4CKXA 1YB1A 1O7JA 1R9MA 1WR8A 3K9NA 5AI6A 1YD7A 5IKXA 5IT9A 4JA0A 4OLFA 4KR9A 3W04A 1O57A 1SCBA 3P9IA 3BMQA 4JLAA 2AKAB 5EHIA 5FULA 1BRTA 1N6KA 3EIWA 2Y1WA 3BE4A 2QNIA 3TW0A 3VKHA 5JROA 4Z86A 1G1AA 3KEOA 3NOOA 4WQMA 3OIGA 3QUTA 4NK4A 3I4FA 3IQEA 1XTZA 1XZHA 2PQ0A 3QFCA 1XCMA 4BMYA 1P9WA 3NOXA 1OVGA 3AOEC 4Q4JA 5JO9A 1U0GA 4JJKA 3UA4A 2AW5A 3DWFA 4RNCA 4E3ZA 1CY4A 4YFYA 3FI9A 1E8MA 4KNYA 2VYQA 2Q7XA 3DUFA 2YIMA 1V3QE 3UA3A 1F17A 3WWEA 2J6BA 3OFSA 5I48A 2XNDD 3CWQA 3DBHB 3N5KA 2JCGA 3OQ6A 4RKEA 3UAVA 3QPBA 2FXIA 3DOEA 2NZ8A 4KB5A 1V8DA 4PAOA 4Y0AA 3X1MA 5BORA 2JHGA 5K6TA 4B7CA 5K6RA 4K3UA 5LXTA 2Q6OA 1B7GO 4KR2A 1N6OA 3S1AA 4ND7A 4EG0A 2C31A 4UCFA 1U5CA 1NVAA 1Y7HA 1J2YA 5BQOA 1E92A 3N2GB 3P7MA 3OP4A 1LLFA 1KAEA 5HM6A 1BVRA 1H5UA 1P1JA 2WTMA 4PBTA 3KCQA 3B7PA 2MR5A 4CEHA 1ISJA 3WRYC 3MIIA 1FC0A 2V7VA 1NJ1A 5FLEX 2GAIA 4LK3A 1UMDA 3QNWA 1SQ5A 5JVDB 3DE3X 1ZR4A 3EXAA 1E2MA 1MO6A 2NADA 3U26A 4AMUA 4WJKB 2XGMA 1U7HA 4G89A 4U7PB 1YS7A 2FWIA 3IKTA 2H16A 3OLVA 4Y1RA 3W6OA 2Q5EA 3FYUC 4UHEA 5BW5A 1FFSA 1EWRA 1QV6A 3WGMA 4BQNA 5B6PA 2QKYA 4Q7JB 5KNCA 2QYHA 1D8TA 4AICA 2POCA 4YAWA 3ERCA 2H1IA 1NYLA 2WSLA 4GGPA 1NBHA 1IBMB 5M5BA 4TVOA 1N3LA 1VQ1A 4P4SB 3NOQA 4PSVA 1MV8A 1K8RA 4BVGA 3NX4A 5A9SB 5GONA 4PWYA 5IJ0A 2J0SA 2LCFA 2GCEA 1VXRA 1MVNA 4DQXA 1NBOA 2ID9A 3I2YX 1DWOA 3ETJA 3WXBA 3U61B 5FTMA 1QAMA 3AKEA 3S2GA 2XRZA 3E1GA 2X0NA 2BTQB 2JKZA 4FKZA 2XE8A 3T9CA 2R8EA 1QTIA 4QYIB 2YICA 3CSUA 4RSMA 4KBFA 2RGGA 4NH0A 1RVDA 2KLHA 2XMCA 3I2FA 4U9IS 4CVNA 4BVAA 1SCJA 1GQFA 3NXKA 3PDWA 3KLNA 1U2GC 3ZVLA 1HDYA 4S1WA 1VHQA 2H51A 5SY9A 4V0KA 5LDDC 1TXGA 3IE1A 1Z5PA 2NPFA 2HIHA 4RK5A 2BE9A 2FU5C 2XI4A 1XTTA 4R1MA 3ZXSA 5LQKA 3LKDA 1RKQA 2Z8ZA 4TMKA 1H6AA 1E3LA 2VQ6A 3COYA 4MXDA 1WBJB 2OHIA 3EYWA 3CGGA 4XWAA 3CU5A 3UCEA 4DV4B 3S2EA 2OFXA 2V7QD 5D87A 1JKJB 1O94C 3OE5A 4XYBA 5IABA 1DV1A 2EX0A 4PHHA 4YCNA 4UBOA 4RHYA 1X38A 4TKMA 2QK4A 5JZSA 4QDKA 2Q1WA 1C7JA 3WL6A 1ZDMA 5CDFE 2PWAA 3CO0S 2VDJA 5DX8A 1AN9A 5JBQA 1NMQA 2OBFA 3C6ZA 3IMKA 2VJKA 3UYLA 4R2WA 1HKUA 3TCXB 1WDMA 1H6DA 1CUBA 5K4HA 4DR1B 4OA8A 3G8DA 3OZUA 2FSVA 4ZVMA 3SZ3A 4AIRA 3TWOA 2E5LB 4U4AA 3LCCA 2QL5A 1GG8A 1KS2A 1XV5A 4IIHA 5EKSA 5K8IA 4I6EA 3PDHA 1GSHA 2QY6A 3ROFA 4MDEA 1XQVA 2CL5A 2FQQA 4BFTA 1M8GA 4CCWA 4J76A 4YXWD 3KALA 4KJXA 4LYJA 5KYVA 2YV1A 1X1AA 2IZ7A 3GFRA 1KY5A 4FCVA 4BFVA 1XTIA 1R8XA 1TZMA 2CJWB 2D4AA 2X42A 4IF4A 4OA5A 4OM7A 3ROPA 1XBTA 3T5CA 2PJRA 5AM1A 2Z1MA 2O0JA 2XZPA 2IEBA 4G0MA 4W9NC 2PJUA 4HXGA 3STXA 4ATNA 4EYQA 3L7DA 4DDVA 5L40A 1MEJA 2FRDA 3NV7A 1IEQA 4D57A 2QHXA 1N6IA 2JCSA 1W0KA 1ANKA 1GG2A 1JG4A 4JT4A 2WINI 4NAUA 3NDJA 1DPGA 2MINB 4KI0A 1I1QB 1PVOA 3KZOA 1A7KA 5F3WB 4B5LA 4C0BA 1VPLA 3SJCA 5KWEA 3WS7A 1WW3A 3FA2A 1QGZA 4W5NA 3MF4A 3KUCA 3WGGA 5CIWA 4EW3A 2AW3A 5FWNA 2WJZB 3GT3A 3D3NA 4PIMA 4WAUA 3HDTA 1LDEA 2KWIA 1ODSA 2P2CA 2PZ8A 2XA9A 4P34A 3N86A 1Z15A 3LCUA 3FRIA 1L4MA 4OD0A 3KQWA 2QLTA 1TQHA 1ZNXA 5ALLA 3HWX1 2H9AA 1GL6A 4CI9A 3AMVA 5FUVA 3HLYA 3V7FA 4PN3A 2VPWA 3ZK8A 4B3JA 2FUNB 4GQAA 1A8QA 3PFFA 2QTVB 3DHYA 4GP6A 4YMWA 3FGOA 5IJXA 4F5ZA 3MZ0A 3IMFA 2ZXUA 1SC6A 1YV9A 4OSPA 1ZK0A 1AVTA 2JDID 4FQ7A 4CF5A 2O8CA 2NUPB 2VZEA 3HNOA 1JIIA 1XB2A 3F7MA 4Q3EA 3IOEA 2OG1A 1N9GB 3BERA 1NLUA 1N2CE 1QC5B 3VM6A 4GFDA 4IRUB 3T0GA 2WR8A 2JJ8A 5EAIA 4JP8A 3FVQA 2FPLA 2O4CA 4B81A 1WU8A 2GGSA 3LUGA 4KBYA 3IR7A 4M9QA 4S12A 1K6XA 1YF3A 3NGXA 3ML1A 4INJA 4CNQA 4ZVNA 1D2EA 2AUTA 1F8GA 2V8BA 5SZKB 2QMYA 1TF2A 2J9XB 2VDUE 2JS7A 4TQAA 5FNVF 3UAZA 3QXHA 3VV3A 2PS3A 3DKIA 3D8BA 3L6UA 4L02A 2PQ6A 4F97A 2BHRA 3EH2A 5C2JB 3ELWA 2NXEA 4M8NE 2WJGA 1HDGO 2FOXA 2FR8C 3ZDCA 4OU5A 5ALHA 4LRTB 3P20A 3SEAA 4FBMA 3TB6A 1I5OA 1FU4A 3G9XA 4BNDA 2HR1A 1C1DA 3SE0A 5FPKA 3RSZA 3K2EA 4YY3B 1TC1A 4OXIA 1MLDA 3OU2A 1UEJA 3SWWA 4LJLA 3AYZB 3HXOA 4MLDA 4HD8A 1VCMA 3RTBA 4QUBA 1H42A 5BSKA 5TQ2B 5HKAA 2FSSA 3Q7RA 1SHKA 4LWQA 1CJCA 2PFKA 4QLBA 3B9RA 3OX3A 3QVWA 5E95A 3PQ6A 4N9QA 4FMPA 4YRJA 2QF7A 2Z6UA 2YWXA 3WK9A 1OXUA 2V4ZA 3ZCTA 1HQCA 2ZTUA 3CCCA 1PUIA 1RTTA 4NI5A 1C4KA 4Z4IA 1G8JA 1ORTA 1NJ6A 4BRSA 3ZVRA 3TN7A 5EVJA 1BN7A 1UKYA 2WAXA 4NBUA 4ASUA 3EFEA 1C7FA 3FDIA 1DX9A 4HUJA 3U4GA 3ZCSA 1Q3HA 2ECPA 3EQZA 3WYBA 3A32A 1BW9B 4AO6A 5HIIA 4DA6A 3FPCA 5BSWA 1J90A 1PR4A 4RUKA 3STHA 3C3PA 3ZHRA 3PX3A 3TW4A 2REBA 2VWQA 3E1KA 3NBMA 3CUUA 2O4UX 3VA7A 4NFHA 1Q2XA 3UOAB 2NYRA 2VUSA 3IT1A 4K46A 4GC9A 2C78A 1IN8A 1A0OA 1NVTA 2Q4EA 5KNDH 3BMNA 4DLPA 5KPDA 1ESEA 2DFLA 2C8KA 4AKHA 5L3SA 2ZE8A 1X6VA 1Y1QA 4NCBA 2XGSA 3A1NA 2CXOA 4JB0A 1F4VA 2XZOA 3RQIA 4HATA 2GAJA 1R4NB 2HDOA 1IYZA 1FFEA 1E62A 1P80A 2G6BA 2YFQA 3JYPA 3OAAA 4GX1A 2ZYAA 4PZUA 2NXNA 4PLPA 1FZQA 3VR3A 4D3ZA 1I8TA 5BVHA 5JRZA 1E1RA 2D1SA 2I22A 4FR2A 2Q9BA 3OQVA 4NJEA 1XJCA 2NSJA 4D46A 1A9XB 4GR9A 1SELA 1L5WA 4PGHA 4BLSA 5LP6B 4DMRA 1PL6A 3DDWA 3PE3A 4QT0A 3UK2A 2X8JB 3OQBA 3QMVA 9ABPA 2A86A 3FVRA 3NR2A 3RK1A 3PU6A 2BCJQ 1S5PA 1FFHA 2I71A 4GLFA 3WGLA 1D4ZA 1JJBA 2PD4A 2Z9BA 1WMAA 2GERA 3OE7D 2P5TB 1NDUA 4I4LA 3U80A 2MJLA 1G66A 5GVRA 4R2JA 1U0SY 1T2VA 2XRYA 1OV4A 3PRHA 1V7ZA 4IZIA 2R6JA 3A6JA 4ZO4A 4O3MA 4I4TA 3TBFA 3EXG1 3EZLA 4V1CI 3FTFA 3EAGA 1TZCA 2ZG6A 3AR3A 2WIJA 5F5LA 2F7SA 2OO7A 3QW4B 3PXCX 1X77A 1GT91 2B5OA 4Q48A 4WDQA 3WAGA 5AJYA 3GAFA 4K05A 3LFTA 1H5QA 2QLLA 5KOYA 3A9TA 4XGRA 1G8MA 2JCVA 4MJLA 1Y6GA 2QRQA 1AS2A 4P81A 1Q95A 1YE5A 4LF8B 3HZRA 1URPA 4FTWA 1K7YA 3HY4A 4RKFA 4UUOA 2XNJA 3RVOA 1Q7RA 4JQCA 1WA5A 2JFYA 4MMXB 3V8QA 1P1BA 5LQSA 3IVAA 1QHYA 3SJBA 1BN6A 2AZMA 2PZKA 7AT1A 3FWKA 2D7JA 3SFZA 4B0PA 3FPKA 1CERA 2C82A 3EUEA 3A6PC 2CNKA 1JU3A 1KJJA 2XDQB 3CRW1 5K51A 2I6GA 2RK4A 1UKVY 4FDUA 4OYRA 3V8VA 3I9MA 2PKYX 1UK7A 1R8QA 3BRWD 3GLVA 3IE0A 2RAFA 4FDVA 4M8KA 2IYSA 3INRA 1PZNA 1IVSA 3UMCA 3ZTTA 4PNEA 4UEWA 4X85A 5BSHA 2QRGA 3JAWA 1NUUA 3NUZA 1XDBA 3ABOB 4OFBA 2WFLB 1XTBA 3U7EB 3GU3A 2RGXA 3DL7A 4Y9DA 2IZ5A 1Z29A 4AO7A 4FLMA 5EJEA 3MHTA 2XEXA 2FPPB 2GXUA 1N5DA 4NMMA 3TTSA 4HUQB 5FHRA 4ZFNA 3CRRA 3RUDA 2X5OA 1FJ2A 1E1LA 1BGWA 1O5OA 2G5TA 2H1WA 2XF8A 2EJTA 1RQ2A 2ORED 3JALA 1VIMA 2Z04A 4XYLA 3SHQA 1L5HB 1SR8A 4OUDB 3IB6A 4HN2A 4RMHA 2V6GA 1M1NA 4R01A 3KOYA 3E23A 2FPSA 1KTVA 1UOPA 1AHNA 2ZIFA 4YGXB 1XNQB 5AM4A 2R8BA 1DUSA 3WFIA 1Z7EA 4WIAA 4DSOA 3KKEA 1RM3A 2XT9A 3WQHA 1U8EA 2BTOA 3H5TA 5KNBA 5HG0A 421PA 4WCFC 4F06A 1OASA 2IL1A 4R7ZA 4F93B 1LK7A 1BS2A 5D7NA 4ESEA 4DRXB 1OXVA 1SCUB 1UAAA 1H2XA 5KYGA 1P2UA 1WQ1R 1M5UA 4AD8A 2JAQA 3R3UA 5FEMA 3L02A 1V11A 1MW9X 2G63A 3QU2A 3NVMB 1PFGA 3OBIA 5T8KC 3TKYA 3RC3A 4AQ7A 2DR2A 3D31A 4K0KB 5FWYB 3CE9A 3F4BA 1N7JA 1YRWA 2W6QA 1QF6A 2ZEJA 2HJ9A 1P5JA 2W2LA 3F2VA 1LX7A 1B1CA 2CUZA 3DW3X 2UUPA 1MO3A 2KM1A 4IJUA 1H0HA 2XIJA 3H75A 4IL5A 4ECEA 1BMFA 2BZGA 4UM9D 4WNAB 4HDMA 3WDLA 1JZTA 1V8BA 3OVMA 3U7RA 4RVDA 5EVCA 4XARA 1L7RA 2VSNA 1OKKA 5C7OO 2DG2A 1C9NA 3OEED 4D41A 3E5RA 3NTRA 4N18A 3H1BA 3TLYA 4BQFA 3CUVA 3A70A 3ZJTA 2H5LA 3OC6A 1E7YA 1KO1A 3OZVA 1VLQA 5JS7A 1HFWA 2ZJ6A 4I81A 5A3SA 4EOGA 4NBVA 4YMLA 2AOTB 4RZ2A 1DQPA 3LUDA 3OPYA 5KQMA 2YWGA 1K88A 4TLLB 4BZQA 2SKEA 4RLQA 4ZP1A 3VNBA 1CUDA 2HNBA 1DQNA 4YO8A 4YN3A 3A8TA 5JR3A 1WXQA 2RD2A 1YIDA 2FZVA 4DLAA 2WSYB 2LKDA 4UEJA 2FPWA 3EXIA 5DMXA 5ER9A 3MCWA 3EOBI 4NJMA 4CLXA 3VISA 4ZJPA 3JYQA 4B6QA 2Y05A 3NEJA 2ASVA 4TUYB 1KDOA 4LIPD 4R6WA 3UV7A 1XQXA 1TF7A 4MVJD 3WZ2A 3VZQA 5JV5A 2X8AA 1QHFA 2H85A 2QR3A 3WG9A 4AI6A 3C6MA 3TLEA 2X3YA 1G59A 3JWPA 4K6CA 1FFAA 3PHHA 1Y9DA 3C3XA 4OCZA 1Q1ZA 2YH2A 5EGNA 4N6OA 2VAMA 3QVXA 3MWDB 3WL8A 1KDRA 3D81A 1P2FA 1OI7A 2ECQA 2II6A 3D6FA 2FUG6 4OHXA 5FTNA 3KSUA 2PGAA 5HDQA 3R7WA 1E2QA 1WXDA 3FWYA 4JIGA 3WJAA 3ZOKA 4DMHA 3T7RA 4JVSB 3VC2A 3KXKA 1T91A 1KQOA 3R76A 3UK7A 4OJTA 2E49A 1PLLA 3SYRA 3TMYA 2VP5A 4NKRA 4AF6A 4IFEA 4V0RA 3I62A 2HYIC 1ZSNA 4LCJA 2R1UA 4Q7MB 2ARKA 5KJ1A 1BQ3A 3OEHA 1T5TA 3U7HB 2JCBA 1VI2A 1LJ8A 4RF4A 2CHFA 1KYXA 1T35A 1Z2OX 6Q21A 1I0ZA 1Z16A 3DOIA 1AOXA 3NNDA 4BTEA 5GVSA 5EIEA 3UC5A 2AFIE 3N0RA 4LG1A 1P7YA 2IPMA 3AUKA 4GC5A 4J2OA 3PT9A 1DLIA 4YDSA 1G5HA 3ZKWA 1V1RB 3WLEA 3EDCA 3ZWWA 1K5PA 2FE4A 4Y9UA 5JUWA 1PT6A 4MGZR 4IV0A 4TZ0A 2QRUA 1ORDA 3LPCA 3QKSB 5ES3A 4KN8A 1Z56C 1G2PA 2WM9B 3KZCA 3TQHA 3ZD8A 5BURA 1K2WA 2ATVA 5I8WA 1G0OA 2QN6A 4CL2A 2Q49A 2FLWA 3QEJA 2AMJA 1OBVA 4JNKA 3N2EA 4GEKA 3FTQA 5CLFA 2HKIA 3P2MA 1U2DA 1JU4A 2B25A 1P29A 2QR2A 1GQQA 1MJ5A 2Q6KA 2F6RA 4FIZA 4P4UA 4XGIA 5D3MB 1ECGA 2FWJA 1M0EA 1N2HA 2PX2A 4CKWA 4MS3A 1EFHA 4RLFA 4I08A 1DXHA 2JKVA 4TS1A 5KJFA 5AH0A 2W58A 3E9EA 2DAPA 4EGFA 3NKVA 3EA0A 4MP8A 3TLGB 2C2HA 2F64A 4YJ3A 4DPKA 3DTNA 4AX4A 7REQA 1PV1A 1L4BA 4QD3A 1DTSA 4WUTA 1GZHB 5E4FA 2JJ2D 4PIPA 4Z9BA 1BU8A 1SXJB 2FG7C 4M0DA 5DM0A 1XELA 4JY7A 3OSZA 4YJ2A 4LFCB 1NDQA 4LHXA 1IH8A 3JQAA 1GGFA 4L4RA 2WWXA 3TTYA 2AE1A 1A96A 1SY7A 1XU9A 1MD9A 4C21A 1Y3IA 4R69A 1O9HA 3MRVA 5FORA 1STOA 3SIPA 4J4TA 4DYDA 2C97A 4PCUA 3DMTA 4IDEA 4G4SO 2GCIA 3L7OA 1ZS9A 5BWLA 3O4IA 1FLDA 2JFWA 3G1WA 4GMKA 4WECA 4BNMA 1SIBE 4ZMSA 1EGMB 1XDGA 2C03A 4M98A 2A1UB 1NE7A 3RFXA 4GI5A 4YI3A 5TQ0A 2ZWMA 4YBZA 4L9WA 3EQ7A 3UK6A 1ILEA 3GLFB 2A5DA 4DQVA 3ME5A 1YC5A 1DCMA 1LQ2A 1VE6A 2ZANA 3HC7A 4IJ5A 4MEJA 4I4CA 4P53A 1X8XA 3PIIA 4Z0PA 3BDIA 3DKPA 5NULA 5LQDA 1RRCA 2KI5A 4RY8A 4LRSB 2QJWA 4OHWA 1QHHA 1UADA 5F9FA 1TQ2A 2AI3A 3ZQJA 4G63A 1DCFA 3KQSA 1NNEA 2XUIA 1BCSB 5H8WA 1SAYA 1TYDE 4GP7A 3IIKA 3PUHA 4HQNA 5F21A 4CKBB 3A25A 2GA9A 5KYUB 2C99A 3CRMA 1USVA 2JBHA 4JBYA 3LQRA 3ZWNA 2HCTA 1I6MA 5AJUA 5H3CA 2O3QA 4EUNA 1PFYA 1S7CA 2PO7A 2VDWA 1JDPA 4P86A 5AVOA 1DDIA 1GFSA 1P9RA 4GICA 4LOIA 3VH1A 3HP1A 3L4JA 3THSA 1QFYA 1T5BA 2YMLA 3DB1A 4BB5A 2ECKA 1UM8A 1C41A 5LU8A 2WTBA 4D45A 3JWIA 2VXOA 3PUJA 3R6WA 3PHJA 4LUCA 3BICA 1WZNA 5GV7A 3ZGXA 3TGLA 2AXQA 3OE1A 5FL3A 4V39A 3RYFA 3CF4G 2NSLA 5AWFC 4DQUA 1BQEA 4L07A 3E70C 3JD1A 3DE7X 3CIFA 4WLFA 2A14A 3B7WA 4OLHA 1E4EB 3W5DA 3HRIA 3OCUA 5KKAA 1X94A 2J41A 2JF0A 3AEKA 3TSCA 4Z4CA 2LDBA 4KJZA 3A05A 1DKRA 3BHMA 4O6VA 4QPZA 1U2QA 1Q0TA 2JKYA 4WZAA 3UT5A 2CL7X 1TUIA 1G3QA 4BCCA 4DDTA 1IPHA 1ULUA 4MRRA 3IQHX 2V6MA 4D99A 2HHAA 4JENA 2C5LA 3T7JA 2YHSA 1D4FA 1UWKA 2Q5OA 4XSGA 3TR5A 4RPKA 3OCVA 5AQ1A 1IEVA 1W4CA 1YMUA 4YT5A 4BASA 2VHQA 3BH0A 2FP4A 3RU2A 4G5GA 2CXXA 4WT7A 4XVHA 1ISSA 1X9IA 2VAXA 3KHSA 4JYMA 3ICOA 2DY0A 4IV8A 4BVBA 4ZOEA 1W73A 3WHKA 2P4EA 1N0UA 2JIQA 2G09A 3S28A 3K4QA 5DTRA 2NTJA 3SOPA 3W9BA 4QWMA 5LP1A 2G9QA 2EZ4A 1JDNA 5BN1A 2E4VA 4B82A 5KDOA 2J9YB 3DOCA 4J2HA 1QV7A 2DC1A 1JFRA 2HLNA 2R60A 3A9WA 3KOMA 3LP8A 3R5SA 3LIPA 1T6BY 3VOAA 4MRMB 4YRAA 3K5IA 1XCBA 1SRRA 4UCXA 3L18A 1XHFA 3UKOA 1ZO8A 1UBFA 1BNCA 2H00A 2CL0X 4KXVA 3WNCA 2WICA 1FL9A 1ZJJA 3HMQA 1CW2B 5AJXA 2A94A 2WLSA 3HH8A 3ANMA 4OKNA 3SX0A 2FPKA 1N92A 3N0WA 4B6EA 5E3IA 4MIOA 4NU6A 3ET5A 3IQGX 1DOZA 5JS2A 2NZJA 3Q6IA 4KFTA 4QQNA 4CF6A 2VQ3A 3KVNA 4M7PA 3HQ4O 2VHTA 3QMMA 4RFSA 3U1BA 1G8AA 2R7MA 1W48A 5G53C 1CE8A 1UDCA 2N0SA 1C9DB 1MT3A 4BZPA 2FMTA 1BE6A 5DEIA 2F17A 8ABPA 1I4EB 4ARAA 4GOXA 4L8GA 2B1IA 1UXOA 3TG8A 2AD1A 1KFJB 4YECA 1GUDA 4LQ4A 1GN9A 4JEUA 2WAYA 4BMDA 5KTYA 3LX8A 3OM1A 3PDJA 2XYGA 2O2EA 2QVLA 1C8KA 2XH8A 1DU4A 3AUFA 4MQEB 3RVPA 1QP7A 4Q47A 3CUKA 3FNEA 2VRBA 3UGJA 2H52A 2P69A 4FHEA 3QLVA 2IEGA 2VPYA 3H99A 4B7AA 2BV3A 4AXXA 3OCWA 4RENA 3BREA 4IXNA 4G2NA 4CLDA 4LWPA 1PL8A 1C1XB 3J81A 5HYVA 1WTAA 3G9ZA 4Y67A 3GPIA 1QZ3A 2B35A 3LI2A 1N5LA 3SS8A 4OLAA 3Q9NA 4PZPA 3M83A 2ZETA 2EHDA 4HX2A 3GFSA 4DXAA 4CQMB 1H2AS 1F2DA 1NUHA 1HE2A 1NOKA 2ORYA 4M3NA 3PJGA 3A9SA 2WZCA 2ZULA 4I50B 1IM5A 3WOVA 2VNKA 3K7EA 3OG9A 4I8DA 3TXAA 4RM3A 4DW8A 4CGYA 2AG6A 3HEAA 3HKDA 2OORA 4Y2HA 1A77A 1DB3A 4UD2A 4DANA 2YW9A 3VR6A 2BONA 2WWFA 4EY7A 5AOCA 3UMVA 2A4KA 2HNKA 1VPWA 3DE2X 2R7KA 2RARA 2VJOA 3C5CA 1DO2A 5C1IA 3FMPB 5TT0A 2I6FA 3MT7A 1UJBA 1QWSA 3QHAA 5GP1A 4IBOA 4XVCA 3GJ7A 3N7UA 1WBBA 2ZE5A 2BISA 2H65A 1T3ZA 4Q1EA 3ROQA 4MVWA 1S9HA 1UC5B 1VHWA 2QX8A 4H3SA 2NUAB 2LD4A 4TYYA 3PFIA 4PNPA 5FV7A 3TR6A 4AM8A 4BO4A 4KOAA 1CRWG 1K1EA 1E3IA 2EQBA 3CIOA 4CRWB 2W5UA 4A36A 2UYHA 4QUGA 1BGVA 3TSZA 1M6YA 2VC2B 3HEMA 4OGLA 4U7WA 1U5BB 3X43A 4NNOA 5CA0F 4Q6WA 4CQJA 5JHGB 1B8NA 1V5FA 3RVSA 4Z1OA 3HXKA 3AP3A 5FR1A 3AEZA 3P4UA 4FBGA 2Q62A 4WPGA 2GN1A 1M76A 3NFYA 3OT4A 4ZVUA 1CG6A 1OLXB 1Q20A 2ROQA 1K3FA 1GR0A 2OBYA 2HMUA 2P1DA 4ND8B 3MS7A 4NAHA 1QCCA 3W5UA 1CWUA 4IDGA 3IAEA 3OOEA 3A3OA 2PIAA 3D7KA 4HQRA 3OOHA 1PS8A 1QORA 2GN8A 4Z4FA 1ZGBA 1DOHA 3G7UA 4MUEA 4E6PA 5KMGA 5ECGC 2ZT7A 1ZJZA 2GI4A 3PUIA 1C9KA 2C8JA 2V7XA 4UM7A 5CCDA 3UQZA 2XVAA 3DL0A 3PXGA 1IJFA 4Q4HA 3HYTA 2QNBA 1THMA 3D02A 3JAKA 2Q2WA 3EEQA 4YLYA 4P7JA 2Y67A 1Q1BA 3IAFA 4M8SA 3BCUA 2IOFA 3ZBTA 1R5JA 1A8HA 1CB0A 1CUSA 3P2IA 1WU7A 4CT4B 1JHUA 3G8CA 3BMQB 2CSUA 4PGMA 3ER9A 4ESVA 4FB4A 4C7KA 1DKQA 3NBYC 5EJIA 3M4JA 4JDPA 3ZU4A 1JJIA 2OXRA 3B53X 3JS5A 3KKMA 3CZCA 4DR2B 4QATA 3FYCA 3YASA 5JQWA 3NHZA 4EP1A 1E6CA 3GGGA 3NHAA 4PZYA 1VJDA 2D3WA 1X7ZA 2R11A 4KAXA 3RU3A 5I9MA 1FMLA 4GUDA 3DUFB 4AUNA 2ZSHA 4NE2A 1J7KA 2CVPA 1HDXA 1TVEA 4F4UA 1G4HA 1PIWA 2FX5A 1SXPA 3CF0A 2C1XA 3NYQA 4FFWA 3HCPA 4U3JB 3VJMA 1O8BA 4G86A 1OQAA 2X2OA 1PW7A 1WXEA 2BKXA 2XQVA 4MUFA 5LXTB 2C7OA 5SY6A 3ORSA 3S1AB 4IDPA 2WMOB 5TS3A 3GC6A 1OE0A 1XIVA 3KBBA 3DZIA 1RU3A 1TRHA 1L4GA 2ZWIA 3IIJA 5LB4A 5ALSA 4YR7A 5LD2B 2OAQ1 3IPYA 2O2HA 5ARCA 3UXYA 2QTMA 1XQYA 4ZQIA 1PDWA 4CEHB 5IUNC 4Q37A 4MYCA 1UC4B 4DSNA 5JO0A 1UMDB 3BA6A 3ZGNA 1PBNA 3O8OA 3VC1A 3OJEA 2R25B 4RTMA 4YMGA 4XSVA 5LMZA 3OLQA 4R2HA 5B2FA 1KO4A 2IF0A 4ZMRA 3QOYA 3W3AA 2ISQA 4G67A 1EDOA 4YP0A 5E4YA 2XRMA 1I3NA 1Y5NA 4L0CA 1JALA 1NW5A 2AUNA 1SPXA 2B2NA 1TLTA 2OQRA 2XCUA 2MWMA 3Q10A 1FNBA 1UM9A 4GHWA 4HLUC 3BJMA 2PNFA 2ZT6A 5IJ0B 2JCYA 2QD1A 1OXSC 2DUNA 2JAXA 4JJGA 5TMPA 3UHFA 4TT3D 5F9MA 5BSUA 2CFIA 4NZZA 4JKIA 1SOVA 1PJBA 1YFZA 3CG4A 4IIDA 2YZMA 3RQSA 3SYLA 5I7EA 3P52A 5KTTA 1FJXA 3KFVA 4YUAA 5ENZA 5I5EA 1CZNA 3FB1A 4LBVA 1D2CA 4YV7A 5CJPA 1O96A 4K9RA 1YL6A 1Q84A 2WHPA 3AX6A 3CINA 4RF3A 4TSFD 3L4BA 3QRWA 5E2BA 3DVLA 2VSOA 5D5PA 3GLIA 4QNRA 3H5AA 1H8HD 1NW6A 4ZICA 1UWCA 4GVLA 4CE6A 4HVAA 4UZFA 3W2FA 1ZI6A 5DM1A 1O94D 5L3RA 2P0AA 2GYYA 5I01A 4EHIA 2ERXA 1RYFA 2ZOSA 4QRDA 5DYWA 2VTEA 1NOIA 2BC9A 1J2EA 1NDHA 4YB8A 1VG1A 3GI1A 1A2BA 2D1YA 1UPTA 2YUIA 1JAIA 2BRUC 4MGEA