3LW8A

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
b'GPLGSAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rhoa-binding protein
total genus 62
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw8A00
1P73A 5KNDA 3KXKA 2RKOA 2LWIA 1WA5A 3ECCA 3OE7D 3AF2A 4KSBA 1DAEA 3TIFA 4XWAA 3QENA 3EZ2A 3KQUA 4E03A 4B3GA 2QBYB 4D4JA 5A4JA 3SQXA 2WPDA 2YNMA 1JQLB 1MO5A 2R6CA 4HZIA 4B2PA 4DIDA 4Q9JA 2AR7A 3B1XA 1JB1A 5G3YA 2CNWA 5FL7A 1D9XA 3SR0A 4DUGA 1KI7A 5TDHA 3GLGB 1G6OA 1R10A 2DPXA 2UZ3A 3RABA 2WSSD 4DLXA 4A8JC 2NIPA 4W7SA 3VKGA 2FZ4A 3BFXA 3VR4A 4C0KA 2Q3FA 3REGA 4GL2A 2J0QA 1US8B 2FF7A 5EUMA 1F60A 1WQ1R 2REXB 1II8A 1EX7A 3T5DA 2WHXA 2AKYA 2KE5A 4TMKA 4B76A 3WMGA 2GBLA 5JJKA 1U8YA 1J90A 4RD3A 1VYTA 3T1VA 4NU0A 2ZRPA 4AYXA 4CEIA 4J0QA 4LYJA 3V4FA 3E70C 2BKEA 2PZGA 1CRQA 2ECKA 4M0LA 4WXRA 1WRBA 4C0HA 3IO5A 3T15A 4M1SA 1DOAA 2NZ8A 4MGZR 5ANRB 4NYMQ 5FBVB 3K0SA 2YWGA 1B23P 2NZJA 1EGAA 1TL7C 2WIBA 3Q85A 3GLIA 5BQ5A 2ZRIA 2Q9BA 3LLUA 4A2QA 5TY0A 1CJUC 1E4YA 1W2GA 3KXLA 1U99A 5TARA 4ACBA 4DRZA 2CCJA 1JR6A 4EJSA 4PO9A 1E32A 4KV9A 3RAPR 2ANCA 3IPXA 5IHPA 1NMYA 5DI3B 2FGJA 3K9NA 4S2EA 4URVR 4ARZB 1XWIA 2CHQA 2GZDA 1NL3A 1MO4A 4V0OA 4GMDA 1ESMA 2JCSA 3PFIA 3WMFA 3W3ZB 4FCWA 2W2XA 1Y63A 4LJ5A 3WYGA 2FDCA 4B3XA 2WJVA 2BV3A 5DISB 4ITRC 2QM8A 4DEXA 1YRAA 4HSEA 3I1FA 4OI0A 3I62A 1KNQA 4MYUA 1NJFA 4LV8B 4URUR 2IK8A 3UK6A 2Q21A 4IOLA 3PCRB 4Q00A 5EE1A 1TQ2A 4WXPA 1N3BA 2CHVA 4QBGB 1GG2A 2W83A 4LWZA 1FQKA 2MSEB 3K0CA 3VHXA 5JFGA 1WF3A 1ETUA 4MRNA 2DB3A 3V4RA 1GKIA 1XDBA 2XNSA 1XD2A 2V6IA 4GSYA 3DZDA 3PJRA 2QE7D 5E7IA 2QU8A 2ZE7A 3AF4A 1VYVA 3EXAA 4QNMA 2F7SA 4DSOA 3IIJA 1E94E 3DOFA 4GP6A 3BOSA 1P62B 1PZNA 3AGPA 4TMWA 1W36B 3MMPA 4BFXA 3CRQA 4NYJQ 3PR1A 3SI7A 1Z6XA 5FPKA 3IIKA 3UXMA 3LNCA 3QUSA 1AS0A 1FL9A 2QI9C 4A6PA 4AG6A 4B33A 1M1YE 1T5LA 2XNDD 4AKEA 3U3MA 3FPAA 4Q9KA 2IYYA 3L82B 1Q20A 4M22A 1NN0A 1O87A 2VP9A 4I1VA 1GM5A 2EYQA 4OQNA 1ZCAA 1KO1A 2QRNA 4PSAA 1JQJC 4Q7KA 4PPQA 1TUEA 1UAAA 3DPUA 3KKQA 1U0HC 5HCIA 221PA 2XEXA 3BK7A 4N0DA 3AVXA 5EE3A 3NDBB 3NKVA 1J8MF 4PXAA 3A1TA 2FFBA 1LVGA 1M7BA 2AX4A 3H2YA 3LO5A 2V3CC 1KZGB 1JALA 1W47A 1DAGA 4A6XA 3DHWC 5EP1A 2HEIA 2WKRA 3X1YA 3K70B 1ZUHA 3MWYW 3GD7A 3KTAB 5E7MA 4RZXA 1YQTA 1EG7A 1ZC4A 4Q02A 4RJLA 3KB1A 3QEOA 4D82A 2YC2C 1ZW6A 3U4QB 2F3TA 1QG2A 4NZYA 3AVTA 4JLAA 4RD1A 1Q44A 5K8TA 4WIAA 4XVQA 1XPRA 1TTTA 2BMFA 5E95A 3C5HA 3RWMB 3CR8A 4F38A 1XXHA 3ZIAD 2RGBA 5F9FA 3T06B 1GL6A 2EU8A 2IS4A 5B57C 1SVWA 2G1JA 4GFDA 2KJQA 2H57A 1V43A 3BORA 4HZUB 3O8RA 2XXAA 2KBEA 3KKOA 4WAUA 4F91B 1PUIA 2RB4A 3AB3A 3KFVA 1E0SA 5BXQC 1TPZA 4B73A 3QXJA 1E9RA 5AJYA 1YZUA 2IYLD 1CP2A 3K0EA 1XF9A 4JL5A 1VKJA 4MRVA 5FPTA 1ZINA 1GWNA 1IM2A 1JR3E 2NOAA 2K5UA 2IUUA 1R5OA 4KYIB 1P72A 1N25A 2PH1A 1JXMA 1ZUNB 2DBYA 2P0EA 1X6VA 4IEEA 1XCPA 1XD8A 1QHSA 3H0KA 4LJ9A 1CU1A 1OW3B 2CLCX 3OF5A 3B85A 4NP6A 2ATXA 3U3KA 2DWPA 1TQDA 2GAAA 1MH1A 5CYPA 4D6PA 2N46A 2ZVQX 3FKQA 1Q0UA 3N5CA 1ZJ6A 2IYTA 1N5IA 2ONKA 1UKVY 3CF6R 5H68A 4ERNA 1G8HA 1WBBA 4Q4JA 1AKYA 1P9NA 2DWOA 4QKQA 2NQ2C 5JRJA 1TEVA 3KJGA 3F5FA 3UATA 4B71A 2IYSA 1TEXA 3H4MA 3CNNA 2ZE8A 1EX6A 3GJ6A 2BC9A 2Q3HA 1KK2A 4P32A 6Q21A 4OBEA 1JNYA 4P4SB 2IS2A 2OXRA 3OEHA 4RVCA 3DM9B 3TAUA 5KSOA 4P4UA 1E1QD 1OFHA 3ZYCA 4PPNA 2OHFA 4CEHA 821PA 2ZRDA 4BEJA 1VTKA 2FGKA 3ADDA 4BWYA 5K8IA 1PUJA 2AK3A 4XD7D 5D3MB 2ANBA 1N6KA 1QBKC 2C8VA 2WWGA 3LW8A 1F2UB 2WM9B 4ZIRA 3ICEA 2QENA 2R9VA 3QJYA 121PA 4U5XA 2WICA 3Q5DA 4WBSA 4I1OA 4B44A 4OKSA 2Q6TA 1XJCA 1VCNA 2XSZD 1H65A 4YMSA 3QSYA 1YHNA 5SZKB 4BFWA 1ZRHA 1RYHA 1W2HA 1N5LA 1W36D 3LFUA 5G40A 1T0JB 2ZANA 1M74A 4GZMA 5DLQC 2IS1A 1RKBA 2I4IA 2JDIA 3CRRA 2NGRA 1KSFX 3BFKA 4EPYA 1OXTA 1G7SA 2BIFA 3OZXA 4Q1BA 3RHFA 2VO1A 3NH6A 2A5YB 4QHYA 3EZ7A 3CR7A 1P9WA 3QBTA 4X8OA 4B43A 3TSZA 5IRCD 4JBYA 1MO3A 2RHDA 4IVQA 4TZ6A 2BMJA 4B6FA 4PSVA 2HT1A 1HY3A 1TQ4A 3BB3A 2J5XA 1G41A 1G17A 4QL3A 3EIQA 3L0OA 4AK9A 1W4RA 1G18A 3C41J 1ZNWA 4FMDF 2JLYA 5J4KA 4PAMA 4ACAA 1NIJA 3ZD7A 2D4HA 5JJIA 1FTSA 3TSOA 3RNLA 3P26A 1KDPA 4N0EA 1UFQA 2PEZA 3Q7PA 3KFXA 2FH5B 1J2JA 1Z6AA 1OXVA 1ZMXA 4JLVA 3S1AB 2V1UA 4BASA 4B48A 4FCTA 4CVNA 3GJXC 1N0UA 4M1MA 1RYFA 3TBKA 2IYWA 2EWVA 3SJCA 2YWHA 2CLDX 1H8HA 1N6IA 1OXXK 2X2FA 2FPLA 1SVOA 4OHWA 4URYR 5EZ6B 1KSGA 2GCOB 3ZJYA 4YMVA 4C2TA 4FMCB 4B47A 3GPLA 5FL3A 2Z43A 3LY5A 4A36A 4HUTA 3EWSA 3RLFA 5DN6D 5JWHA 3FHOA 5EE9A 1YRBA 3TQCA 4DLZA 2GXUA 3H84A 3TUIC 2IYVA 4PO1A 2KSQA 5GVRA 1OH6A 3QOFA 4IDOA 4HYYA 4MH0R 5GJCA 2QL6A 3A1UA 2R6FA 3WBJA 1S4QA 3UKDA 4UXIA 4PHFA 2CL7X 2VIIA 1OV4A 2FSIA 2P67A 1E2MA 2WPDD 3FWYA 5DI9A 3FMOB 4MUBA 3AQ4A 4JLMA 1W36C 2RGDA 3FHCB 4LSGA 2CK3D 1RFLA 2JA1A 1OIVA 2ZI4A 3B60A 5FUXA 3AF3A 4PC2A 2PLRA 3OEEA 4AYTA 3QF4B 1G9XA 2GKSA 2QQEA 3A58B 2O8DA 1XB2A 2O8BA 3AVQA 1AQUA 3ZS9A 1OFTA 2ZUDA 1XXHB 1KO7A 1RRCA 4ON9A 3KX2A 2H92A 2HYDA 1R8QA 4DIEA 4DZZA 2CJWB 4LHXA 2ZRCA 1MO6A 1NLFA 1T6NA 3PXGA 2O0KA 2VH5R 1TMKA 2AWOA 4L9WA 3HU2A 5CJPA 5DGXA 3KUCA 1V5WA 2WWFA 1ZM7A 4LJ8A 4JVLA 2B92A 2PJZA 1R8SA 1VDZA 3SZRA 4MKIA 3UG7A 3CH4B 3QKRB 2WWYA 3IIMA 2BCGY 3EASA 2Q9AA 4NMMA 3BH7A 1XEWX 1QHIA 1U9IC 2X77A 3FVQA 4DB4A 1OHHA 3EPLA 1D2NA 2KI5A 1OYYA 2QQ0A 3K1JA 3E5HA 2IBMA 2F1HA 3FB4A 3PV0A 4GPTA 3NDPA 1RZ3A 2YOGA 1CTQA 4A2PA 1U90A 2W6ID 1J99A 1JR3A 4LHZA 4U00A 5EP3A 1JXOA 4R71A 2WSMA 2H1LA 2J7PA 3A1WA 2F3RA 2V9PA 5E7JA 3B7GA 4DCUA 3K09C 3DMNA 5CB6A 5FUYA 4DB2A 5GADl 1YKSA 3FOZA 1BIFA 4K8OA 1E0JA 1CF4A 3X1XA 1Z8FA 3U6KA 3NVAA 2WAXA 1E79D 2BMEA 1AQYA 3LVRE 5M04A 1COWD 2KBFA 4M9SA 1OH5A 4F4CA 1MRSA 4JS0A 4CRWB 2XTNA 5J4LA 1F6BA 1UJ2A 3VR3A 1WDTA 3L8YA 1G3RA 4ZCIA 4AG5A 2R65A 3DEFA 3MCAA 1G4UR 2CEAA 1Q21A 2O8EB 5J4VA 2ZAOA 3GJ8A 3HPRA 1VCOA 4BFYA 1FMLA 1YVDA 2GZHA 5CDFE 2UVQA 1XFAA 2GXQA 5L3QB 2V6JA 4DDTA 3TE6A 2GETA 3BAFA 4BRWA 2F1IA 2O8FB 3ZLJA 4ZIRB 4B75A 3NHBA 1NBME 4AIIA 2LKCA 3REFA 3ADCA 3M4YA 3AVWA 1QG4A 3SEAA 1KI6B 4MRPA 1ZD9A 2R44A 2PBRA 4YDHB 1H8EA 3JZMA 1PJRA 3LBHA 2JJ1D 1IY1A 1QVAA 1GSIA 3KQKA 1UM8A 4OK6A 4TMVA 4JVSB 2J9RA 4P3YA 3W6NA 4W9MC 2VBCA 3A4MA 3ADKA 5CITA 1XMIA 2AL7A 2ZJOA 4DCVA 4CYMA 1NVUQ 4QJ4A 4HEJA 2GBLC 4O25A 1P6XA 4B6EA 1TQ6A 1KI4A 5CB8A 1NY6A 5KNBA 2WWWA 2XX3A 1W5TA 1P3JA 3CNLA 4FWIB 1L4YA 3F8TA 4V0LA 2JLWA 1GUAA 4MKHA 2FWRA 5HR5A 3AVPA 1S3GA 4JJKA 5FBRB 1C1YA 1AS3A 1XEWY 1UBFA 2IYZA 2MMCA 3KQNA 3SBDA 2F43A 1QHHB 5KSPA 1N5KA 4OQLA 4ZCLA 4Q7MB 1E2KA 5DNYB 2BBOA 1KK1A 4Q4AB 3K9GA 1JJVA 1ZAKA 2OILA 1Z0DA 2QAGA 5JBQA 2QPOA 3RC8A 1P75A 1P2TA 1EFHA 3A8TA 2YZ2A 3CRVA 4QC2A 3U5ZB 3RSLA 1N0VC 1L2TA 4AKIA 3LBNA 1E2PA 1G3MA 2FFAA 2J59A 3VNUA 3C16C 3C7KA 4QGFA 2G3YA 4LCBA 4DEYA 1F2TA 1R7RA 1XMSA 3TUJC 4CT5A 3QG1A 3FKSA 4M53A 3GJ7A 3IGFA 2JLSA 3U44B 4EAQA 1U2RA 2RMKA 4XVUA 3I5XA 4XH9B 1SXJB 1ZP6A 1T5IA 1Z28A 4FD2A 3VR1A 5D3QA 1E0AA 2WMOB 3PEWA 3R9IA 2GDJA 3U60B 3U7HB 3LRPA 2ZJ2A 3SS8A 421PA 1YR6A 4KBFA 5FPYA 4PC3A 4QJ3A 2JEOA 4RZ3A 2JLXA 3GLHB 3K0CC 3WBKA 2OLJA 2ASEA 4PQYA 2XOKA 2W2VA 3IILA 4KXFB 3QPVA 3MFYA 4L16A 4EDHA 1PVOA 1M7GA 1VG9B 1IXRC 3OAAA 5KPJA 2CDNA 3CRMA 1JEEA 1KJWA 3P27A 4M8NE 3PUZA 3BB1A 4US1R 1S0UA 3ADBA 5FR2A 2BHRA 1CULC 2DY1A 2ZJZA 4WZ6A 5HE8A 1OPXA 5C4MA 1DO0A 2H18A 2IUTA 1NG1A 5EQTA 2IC5A 4IEIA 4Q4HB 5HTKA 1W0JA 3GEEA 3QKSA 1NN1A 4HUQB 2ZSEA 3ZVNA 4ESHA 3CO5A 3L2OB 1E69A 4PX9A 4HI0E 3OIYA 3CM0A 4G5QA 1GZSA 1HTWA 4EPRA 4LBVA 4QHTA 1ZUIA 1U81A 2R6GA 4M21A 1RIFA 2C9CA 2WJJA 1GNQA 1KAGA 1FUKA 2NG1A 5FFMA 2DFNA 1G5RA 5JS7A 4RZUA 1ONBA 1M8PA 4Q66C 2IEYA 2DR3A 3I73A 3OEHD 4KVAA 4QFMA 4RFSB 4Q1DA 4DC9A 2PZFA 4Z1MA 1SHKA 3BC1A 2AK2A 3THWB 1IN7A 3K0AA 2G0NA 3EPHA 3H86A 3EC1A 1Q57A 1NSTA 3I32A 3MG9A 4Q9HA 1NG9A 4IVRA 4R2HA 3SFVA 3AM1A 5FOSA 2NMVA 2IWRA 5DHFA 1DPFA 1CXZA 1MABB 2WOOA 3WHLA 3CONA 1M34E 5JLJA 4G3XA 3QY0A 2NPIA 2QPTA 5JI2E 2Q0HA 1SZPA 4TLBA 1A2KC 1E99A 3K8YA 2ZRAA 1AS2A 3L0SA 2D3WA 1CR4A 2Q3MA 3CX6A 4XTCS 3U2QA 2P5TB 3FMIA 4LBYA 5FI1B 4KFTA 3DDCA 2JDID 1GAJA 4NHOA 4FIDA 4DLYA 3B78A 2GRJA 4LJ4A 4OJKA 2H16A 4I1SA 5IF9A 1KI9A 4KVGA 1TU4A 4B3DA 4YMWA 1BS1A 2BEKA 2FX3A 2RGNA 2VRWA 3P20A 1R0XA 3AVOA 4EFLA 4DKXA 1R5NA 4DLTA 4OHZA 1G7RA 1GILA 4ASUD 5EXSA 3BH6A 2J0UA 4HLDA 2R6DA 4OI4A 4QG7A 4MITA 3VR6A 4C7OB 4ILEA 4AYWA 1IXZA 5KDOA 5LBIA 2ZYVX 4TLDA 5KUTA 3RS4A 2PT5A 1TU3A 2RGXA 1KKLA 3WY9A 2HYIC 2ATVA 1FFHA 2ZSBA 4A82A 2A2ZA 4W5JA 5G3ZA 5CDFA 5EUQB 2F9LA 4C0BA 4PO8A 3T12A 4Q5IA 2OBLA 1AN0A 1L4UA 2HLDA 4BLOA 4JLPA 4KODA 3GLFE 4MRSA 2RGAA 4BZPA 1NBMA 3LH5A 3L0IB 2HF8A 3PENA 3I72A 2XGJA 1D8TA 2YV5A 1IN5A 1II0A 4V02A 3KKNA 5FTJA 4CEJB 1VIYA 3AH8A 5AK0A 5L8VA 3P4XA 4TMTA 5FBWB 3BRWD 2FFQA 3LXRA 1S1MA 2B8WA 4HAXA 4MYTA 5FUWA 2HXYA 4OHYA 4POAA 1SXJD 1Z0AA 1IXSB 3PQCA 1RW4A 3AKCA 4JVNA 4ZCMA 3AUYA 3NBXX 4DLRA 3HU1A 2HV8A 2ERYA 4E09A 4IOMA 2FZLA 3TW8B 4ZKEA 2O52A 4BGDA 4H1VA 1Q1QA 1IBRA 3SYNA 1KO5A 1Q12A 2Z0MA 4JSTA 2FU5C 4YC7A 1P60A 1IQPA 2IWHA 4B2LA 4DLSA 3IBYA 5B64A 2VP5A 1Y3AA 2BM0A 3BGWA 4AI6A 4Q1EA 3N2IA 4DSTA 1NF3A 4XSHA 2DHRA 2WWXA 1ZNXA 2CL0X 1TADA 4LV5B 4C3ZA 1E2FA 1MR3F 1VMAA 4BECA 2VQSA 1W0KD 4EKDA 2EWWA 3IHLA 4AC9A 1VCMA 5IK2D 4EUNA 2I1VB 1CJKC 2ZITA 1W7AA 1Z6GA 1E0KA 1XJQA 4LC0A 3WNCA 4DT1A 1EFRA 2QT1A 4TL7A 1E2GA 3THYB 1F2TB 1N6NA 2VHCA 1CBUA 4F4IA 3U6BA 1JEDA 1WBDA 2CCGA 4BE7B 1P2UA 5JI3E 3Q5EA 1IHUA 4FW9A 1KMHA 1Z08A 4IJMA 2FG5A 2FSHA 4QRHA 1E96A 1K5GA 2V4ZA 1Z2AA 2MMGA 4TLAA 3KJEA 1HURA 4QNRA 3RS2A 4A1FA 3SE0A 2P3SA 4BFZA 4DDVA 3ASZA 2AXPA 3VNVA 3RANA 1AM4D 3EW9A 2AD5A 2ZJAA 3X1WA 4ZV4A 1G5TA 1XEXA 4XWKA 1AIPA 1E9EA 1KY2A 5FOWA 3WP0A 3WYFA 2WBLC 4LYFA 3G0HA 3CKLA 2QM7A 1SQ5A 3ICQB 2QG6A 2XZOA 3OIWA 1TNDA 1G1MA 2FPKA 3SU8A 3PUVA 5HKKD 4YMTA 1OSNA 4RY2A 2QGZA 2VEDA 3M1IA 4IHQA 3W5IA 5FTNA 1T3HA 4LI0A 1G3IA 1FX0B 2ZRNA 1OHHD 1X1RA 3DVLA 5FBLB 1R2QA 3ONWA 3SFZA 4PZYA 4PAQA 4YLGA 1N6RA 3ETLA 4G01B 1KOFA 4IFEA 1Z0KA 2WIAA 2XAUA 1JJ7A 2O8CA 1Z0FA 3WYAA 1BMFD 1OE0A 4OI2A 5L3SB 4IVPA 2W6JA 4QGGA 3TSWA 1I2MA 1N6LA 1KAOA 1PLJA 3P4YA 2W00A 4A8JA 1S9DA 2Z5FA 4D26A 3MLEA 3B2EA 2WJHA 3ZDQA 3VHLB 5F98A 1OIXA 3MWLA 2VSXA 4JBXA 2A5FA 1SXJC 2BVNA 2ORIA 3IQWA 3W3AA 4PSKA 3RRYA 3DOEA 4BFTA 2B6HA 1Z3IX 2ODNA 2PLFA 3D3QA 2B21A 5DO9A 2G9NA 4OQMA 2BBTA 1OFUX 1W44A 3OFNA 4JL8A 2IYXA 4LPKA 4L4UA 4W5HA 1NRJB 3GEIA 1XTSA 1GP2A 3DM5A 4MDEA 1W1WA 3QXCA 2QP4A 1WE2A 3NHAA 3Q8XB 2F1JA 2MSDB 1NMZA 3W6PA 4HLCA 1VYUA 1LS6A 2VSFA 2A5JA 2ZI9A 4TL9A 2GXSA 1LNZA 1OIWA 2QSZA 3GLGE 3THXA 2PCJA 1HE8B 2C5LA 4I81A 5BYJA 1II8B 1QRAA 3K53A 1OKKA 3QEJA 3U61B 3A4NA 1FUUA 1DE0A 4A2WA 1SKQA 4FMCF 1UDXA 2CL6X 3GMTA 2QTVB 4BPBA 4HLUC 4CEIB 4H9GA 1VG8A 3DKPA 5K8UA 1FTNA 2P65A 4HB4A 5FTLA 2PZEA 1CS4C 5KPDA 1NSFA 4LHVA 2NO9A 1ANKA 2D74A 4Q18A 3AP2A 3VU9A 1XP8A 2DFTA 1E1RD 2O5VA 4GOJA 1E2HA 1D5CA 5EZ5A 1OB2A 2A5DA 1Z6TA 4WOPA 4TYYA 3GLIB 5F9HA 1XRJA 3D31A 3NTUA 3T1QA 2D7DA 1SULA 1LY1A 4LJYA 4MYHA 3FDIA 2V7QA 4D0NA 4MUAA 2QUZA 2ZU6A 1JPNA 4HAYA 1W5SA 4IRUB 1J7KA 3LV8A 5FPSA 2YOFA 5G53C 4EJSB 621PA 3D8BA 3O8CA 5FOTA 1LB1B 3OE7A 4AURA 2X1VA 5JCPA 4YXWD 3AVYA 1G8PA 2SHKA 5JWOA 2JIZD 1QHNA 2IHBA 4C4PA 1R4AA 2GJSA 4RD0A 3CWZA 1I4DD 5JSZA 4TYPA 1VPLA 1E6CA 2KB0A 3BE4A 1E2EA 2F55A 1CIPA 1MKYA 2WZQA 1IN6A 3WRYC 4M2LA 2JLZA 1IN4A 4XIGS 4C9BA 4HB3A 4UNPA 5AUPB 2A9KA 1JI0A 2ZE6A 5CM8B 1HQCA 1U94A 4EIWA 2QT0A 3FMPB 3KQHA 1KJYA 4L9SA 4QGAA 3GLFA 3K9HA 4BLRA 5KDLA 1OF1A 3GJ4A 3X2SA 3L0PA 4NPHA 3QIAA 3ZD6A 3C4JA 4L5BA 5UKDA 2GJ9A 2QN6A 3FFAA 1J70A 1NI3A 3CPEA 1TF5A 1XD2B 2RHMA 1DADA 3TQFA 5SZIA 2AHOA 3BB4A 4RD4A 1X3SA 3HP1A 3NC0C 2IF0A 4JLNA 2CE2X 1G20E 1EFCA 3ZQJA 4E07A 2RGEA 1WP9A 2RGGA 3W5JA 2BDTA 2ZS8A 2XJ9A 4LDJA 5KOYA 5JMTA 4IXNA 1S2MA 1XNJA 1Q22A 3VX4A 4D0GA 4Q1FA 1U8ZA 1UDWA 3Q9LA 3EPJA 2PJRA 3CF0A 2OEPA 1ELOA 2ZROA 2GJ8A 3B1ZA 2D7CA 4TSFD 3CX8A 1FNMA 4JLKA 5HZHA 4QBHA 1AZSC 3AVVA 4PFSA 2ZR9A 2J0SA 1XJ0A 4YONB 2J45A 1CR1A 1DG1G 2EFEB 1E2QA 4DDUA 4Z8YA 2H7VA 2OM2A 2QMUA 1HUQA 3RWOA 3EA0A 2CXXA 2ZR0A 4OHVA 2GJAA 3IDQA 3R9XA 1G8GA 1ZCBA 2OCAA 4Q01A 5DYIA 2P5SA 3L8ZA 2QA5A 4Q9LA 4HB0A 3MWJA 4D4MA 3SBEA 2ZVPX 1NN5A 1XCMA 5AJXA 4PTLA 3ZQ6A 2GEDA 4D25A 4BFSA 4EQ6A 1KKMA 2YVUA 1SKYB 1ZD1A 1AA9A 5C1BA 2X8AA 4BLSA 2PEYA 4B74A 2P6NA 4P31A 1I2DA 2QNRA 4MGIR 4Z1MD 721PA 5KYKA 3A6PC 2ODWA 3ZZUA 3LX5A 4JKYA 5LD2C 2GAOA 2ZRLA 4PHGA 4M1TA 2CNWD 5FOUA 2WOJA 5FL7D 5JHHB 3BIFA 4DUGD 3R7WA 5JEDA 1E9SA 1XTRA 5C4GB 2P2LA 5DH9A 1YZKA 1U0LA 4IDQA 1ZC3A 2OUKA 3X1ZA 2VL7A 3EG5A 2O8CB 1HYQA 2VLIA 5FOVA 1KI2A 5A0FA 4L8GA 4AKHA 3G82C 5AWFC 4BEBA 3J81k 2IYUA 5KO2A 3UIEA 2BWJA 1GTVA 3BH0A 2XNDA 4LHYA 5CK4A 2WJIA 1ZM4A 2CE7A 2JLRA 2XXAB 2YJTD 1IAQA 2JGNA 1EFTA 2GF9A 1ZD8A 4KITB 4NTZA 3WRXC 1CJMA 3C14C 4K81B 2HJGA 2KWIA 5EXTA 1GKYA 1Z0JA 2C78A 3SYKA 1I4LD 2RH5A 5LB2A 4D2IA 3A37A 4C0SA 4MDFA 2VTKA 3MJHA 3FMFA 1KDOA 1RPZA 4GRAA 2BOVA 1GNPA 2CHGA 2C77A 3KKPA 2HCJB 5BW8A 1DEKA 1B0UA 2ZPTX 2ZYUX 3CLVA 3C8UA 4X8HA 4CW7A 1NJGA 4N3NA 4Q03A 1XMVA 2YYZA 3PG5A 2IF2A 2J41A 4CGZA 3DZ8A 2AKAB 2BMDA 2OE2A 3HR8A 3THXB 1XPUA 2YWEA 2ZUBA 1F5NA 3CIOA 1LFDB 2W58A 3QBVA 1RRGA 4NDZA 4QHSA 2FSGA 2BM1A 2ZJ8A 4BFUA 3TUZC 3ASYA 4G5OA 1R0ZA 1KK3A 3JZAA 4FN5A 2HCBA 4JLJA 4Q4JB 2D06A 2R62A 3GLGA 3O8BA 3A4LA 3PUXA 2ZRBA 4P0TA 2PX3A 3L43A 2ZRJA 4PC1A 2EFCB 1US8A 1G21E 4URZR 4QM7A 1IY0A 1JECA 4HAVA 2ZRGA 2A7QA 1DAKA 2ZSDA 3QXXA 4TYQA 1QZXA 4CEHB 2A3RA 4D80A 2FFHA 1FW6A 3G5UA 4OI1A 1SVSA 3EZFA 1P4SA 1KY3A 5BN5A 5JHGB 1P2VA 1YE8A 2YKGA 1GL9B 1NVVR 2WKPA 5L3RA 1NN3A 1VHLA 2DFKB 1W4CA 2WWIA 1ZNZA 4KI0A 3W6OA 2E9SA 3CPJB 3PUWA 4V0KA 4Q1CA 1OYWA 3O8DA 1KI3A 1NKTA 3NBYC 1NVXQ 2Z4RA 4D4LA 3HU3A 3AF0A 3Q7QA 5J4YA 1IJEA 2VHJA 1LS1A 5DSZA 4M9QA 3PITA 2IYQA 4EPVA 2PL3A 4S35A 3UANA 5KSZA 4BRUA 2DWQA 4MRRA 4Q7LA 3NBFA 4IOJA 4TLEA 5DI3A 4C0QC 2XB2A 4ARZA 4LJ7A 3QF7A 4F4JA 3OESA 3GJ5A 4EFNA 1BYIA 3GQBA 1A5TA 3B6EA 5C2JB 1N0WA 2AD1A 2IHYA 1UBGA 4TL6A 2QROA 2N1BA 3DMDA 4DSUA 1Z29A 5AJWA 5EJEA 2ORWA 4P4TA 1J8YF 1G64A 4CDGA 1OFIA 1ZU5A 2ERXA 1WB9A 2JJ2A 4M4SA 4URWR 5DIFA 1FQJA 2CVHA 3PVSA 4OQFA 3V9PA 4Q7JB 1Z07A 3UWKA 2OT3B 4DCSA 4XJXA 1E1QA 1ZM3A 5EE5B 2P6RA 1XBTA 3IQXA 4EJSC 3AVUA 2VPPA 4R7ZA 3QXSA 3I3SR 4LYAA 4PR0A 2GK7A 4TYWA 1O3YA 2ZETA 4KO8A 3A1SA 5LPNA 1YR7A 4LHWA 3RC3A 3T34A 3BFVA 2NO1A 2I1QA 4BLTA 3RS7A 4F92B 4A0GA 2LKDA 2W0SA 4QJ5A 2B8TA 5E4FA 4Z54A 2C95A 5AUQA 1R5BA 3B8HA 4A92A 3KQLA 4ESVA 1AJEA 4UJ3A 4JT2A 3RVBA 3SN6A 2R6AA 3I4LA 3AP1A 4TMXA 3TRFA 5FR1A 4JYBA 4G5GA 4PHHA 5LDDC 1XEFA 3Q3JB 4PC7A 2GTPA 3EZ9A 5H70A 5K8LA 3PIRA 3VKHA 1G3UA 2ZRKA 1KGDA 3TMKA 3RS3A 2GNOA 4LJAA 3I61A 2ZR7A 3WNDA 2ZRMA 1E2NA 2GJKA 2IT1A 2NO0A 2Y8EA 1VCIA 3HWSA 5DE3A 1NP6A 1CJTC 3WP1B 1T3LA 1YZLA 2QTFA 2ZIAA 4GI7A 2ZS9A 1KIMA 4KYUA 1BO6A 2PMDA 3IHWA 2ZE5A 4PHTA 3IO3A 4D4KA 4OK3A 3MJRA 2GA8A 1VECA 4NE2A 3VKWA 5JCZA 1AGPA 1FPMA 1M7HA 3BJIC 4B35A 4BLQA 3R8FA 3JVVA 4ZI3A 5FPHA 3Q72A 2C9OA 2GILA 2ZRFA 2RCNA 1XZQA 2O8DB 2H8KA 2FA9A 4RSGA 2Z6VA 2AN9A 1MOZA 2ZJBA 5E3HA 1DBSA 2OLKA 2O8BB 1E98A 3QKUA 4MQBA 1XTQA 1S3SA 3GP8A 4U7DA 2FPMA 1SVIA 5JWRA 3U4QA 4YQFA 1P7CA 1T9HA 2G83A 4QGHA 3SQWA 1FMJA 2YC4C 3EX7C 1Z22A 2WKQA 4KU4A 5JEEA 5BWMA 5JRZA 2WTUA 3AP3A 3IEVA 5JZVA 3W8RA 3VX3A 4IKEA 2J3EA 3HYRA 3K09A 2VHUA 2XTMA 4ZDIA 5L3VA 1YJ5A 4XOIA 4AKGA 4DLVA 2UZIR 4HAUA 1UEIA 1VHTA 1XTIA 4NH0A 4G5SA 4LK2A 2AXNA 3IKJA 2YOHA 1CLUA 4ZDWA 4CZ2A 5KDDA 1X1SA 4HZUA 4LBZA 1ZIOA 3TLXA 2GEUA 3UMSA 1GRNA 1UKEA 1N6HA 4NONA 1KSHA 2IL1A 1II9A 3ZVLA 4HAZA 4ZO4A 3AUXA 4IDHA 1K5DA 2GEVA 2ONJA 1P5ZB 1GOTA 3GFOA 4I99A 2OAQ1 4B3FX 3TK1A 3R9WA 4KSCA 1VG1A 1EESA 2CK3A 5LB4A 1G4AE 1KDRA 1G16A 2JAQA 4TMZA 1GNRA 4FXPA 1E2LA 4BZQA 5H8WA 2XZPA 4M1KA 2A5GA 2QGNA 4ZDJA 1ZU4A 4QM6A 4K46A 1XD9A 1ODFA 4Q19A 3EIHA 1ZVQA 5GJVC 2QY9A 3UG6A 3EA5A 2YINC 3GCGA 5TB5A 4NYIR 1N2CE 2BJVA 4KLNA 4TYNA 1LW7A 4HATA 1KYIA 2OCPA 4MKGA 1GRRA 4XTRA 4LGMA 3TVTA 2Z83A 3LA6A 1HEIA 3LAWA 4RKEA 2QP3A 1HH4A 2OG2A 2WJYA 3VAAA 2ZSAA 2FE4A 1X86B 4P4SA 3LD9A 3CF2A 1KHTA 4EPXA 2J87A 1HA3A 1KDTA 2VHTA 3N70A 1EWQA 2WJGA 4URXR 3TKLA 3U7EB 8OHMA 4N1AA 5D3MA 1SVLA 2HXSA 1F2UA 1PLKA 2GCPA 1IOZA 2L0XA 1AZTA 4V0ME 2EFHB 3I8SA 1GITA 2GWHA 4LYHA 5B58C 2D2EA 1CKEA 2W6IA 4DJTA 1H8HD 1G6HA 1RJ9A 3EIEA 4M9ZA 1FOEB 2G1KA 5SZHB 2LCFA 3MGCA 2ZUCA 3NXSA 4A0RA 4LX0A 4LC1A 4PQFA 5CLQA 5DYGA 2G6BA 1FNNA 1ZYUA 2QEQA 1HT2E 3NC1C 2E87A 4LV6A 2DCUA 1FP6A 3W9YA 2VP6A 4KCGA 5GJWC 3CWQA 1E79A 2F43B 2QAJA 3GFPA 4KHZA 4O2RA 1NKSA 2B7CA 1COWA 2V1XA 1XCGB 4JLOA 1S1CA 4JT4A 3KB2A 3ZZ0A 1P61B 1A7JA 1U0JA 4JKIA 1EWRA 5LD2B 3NWJA 3KJHA 3KZ1E 2H17A 1D6JA 2QAGB 3FYHA 1ESNA 4DSNA 4IW3B 3B9PA 3VMFA 1W48A 2X2EA 1NLYA 1YZNA 2XITA 2C98A 1UBCA 4JBWA 2D2FA 1E4VA 5B30A 3FE2A 1KSJA 2FV8A 4ZI2A 2BCJQ 1OXUA 1D2EA 3OEED 4LJ6A 4R2IA 2OSBA 4BZXA 1TUIA 4RZ2A 2JJ1A 2I3BA 2WVJA 3B1VA 4XSGA 1MRNA 1OXSC 2VP0A 3IBGA 4IDNA 5J47A 1AK2A 3S1AA 3CBQA 3QKTA 3KJIA 1DARA 2G88A 2YHSA 4H1UA 4HLQB 3UPUA 1SXJE 3EAQA 3TGPA 4C0JA 4FWTA 3QPUA 1YZTA 3TR5A 2GCOA 4KFUA 1QHYA 1A4RA 2J46A 1RC8A 4GOKA 3P32A 3GLHE 1Z2CA 3DO6A 2OO7A 4P33A 3B82A 1OH7A 5TMPA 4TT3D 2GK6A 3M0EA 4D0LB 4V03A 4Z8XA 3HDTA 2ODBA 3R20A 2HF9A 2FEMA 4XVRA 1M2OB 4M9XA 3AKEA 3ZH9B 3QXHA 4HDCA 3U3RA 1Q3TA 1DG3A 2C96A 2V8OA 3QKSB 1HQYE 3TR0A 4F93B 1GVNB 1EXMA 1XMJA 1JR3D 3UMFA 2VF7A 2ZJ5A 2J7PD 3LX8A 1LF0A 4A4DA 2W0MA 4U02A 2C04A 2MSCB 2VSOA 3LWNA 3EWAA 4PPGA 1BYUA 1SVMA 5JJLA 4DWJA 2PCLA 3K0FA 1OJLA 3QF4A 4Y0AA 1UEJA 1CJVC 2BJWA 1E2IA 2C2HA 5CLLA 4DCTA 1BOFA 4E22A 2ZM5A 1YR8A 2EQBA 2FMXA 3QVUA 1GRQA 4PZZA 2CJWA 2IEZA 2QSYA 3MUFA 4TQUS 4BLPA 2GESA 3MSXA 3K0AB 4B34A 4ZKDA 5FI0B 3NIBA 1DAHA 2PT7A 5F2EA 1XZPA 2XTZA 4L15A 2OFWA 1IN8A 3B9QA 3LXXA 4CF7A 3QKRA 1GL7A 2JLUA 1H8ED 3ND8A 4US2R 1Z6YA 4HAWA 4PANA 5A5GA 1EK0A 1NVVQ 2C99A 2OV2A 4KAXA 2H5EA 3T1TA 3RS5A 1C4OA 1UKYA 2OCYC 3NG1A 4JJZA 4JIMA 4HDQB 3UWOA 2BKUA 4MA4A 1NLZA 1KMQA 5IT5A 3C15C 4CT4B 2N42A 3THOA 4F7WA 2GZAA 3CH5A 4TQAA 4AY2A 4KBGA 2F6RA 2JATA 2R2AA 4TT3A 3KL4A 3U7GA 1QHGA 2AWNA 1XU4A 3VTKA 1DVRA 1Z83A 2J0UB 4NCHA 4DLWA 1E3MA 4DXAA 4A9AA 1QF9A 1SHZA 4Q21A 2REBA 2JJ2D 1UKZA 1OT3A 3I92A 1GDDA 2ZRHA 4Y0VA 1MV5A 1TF2A 3CX7A 4IFBA 3RRNA 3T61A 4MYCA 5TVKA 2WMNB 5FH9A 2DYKA 2Q9CA 4IOKA 4AWXA 1BH2A 2W2TA 2O8EA 1W49A 2OAP1 1NY5A 3LW7A 2WSSA 5L3QA 4Z51A 3EC2A 2O8FA 1S96A 2NO6A 3OIVA 4DCNA 1WMSA 2ZU0C 1WXQA 3LVQE 5KSYA 1KI6A 1RJ9B 4GOXA 3BS4A 3FKSD 4KFSA 4R98A 4X8LA 2EFGA 3GJ0A 3VFDA 2GVZC 1SVKA 5FTMA 3GJ3A 5EP2A 1G8FA 1HE1C 1YU9A 1TX4B 4NYMR 2VA8A 1E9CA 5EP4A 4V0MA 4A15A 2CCKA 2NTYC 2QMEA 5GVSA 1LF5A 3QI2A 1E2DA 1G7CA 1GIAA 1K6MA 3MWKA 3M6AA 1IY2A 2FJUA 3K9LA 4UXHA 3PEVA 1MT0A 4XWOA 2F1RA 1L7VC 3AKDA 1TF7A 3IUYA 4LUCA 3VQTA 3UMRA 5AUNB 4R9UC 4BUJA 4MGYR 2EYUA 2XOKD 3B1YA 2RGCA 4TTPA 1Q1ZA 2FN4A 5EXXA 2EVWX 4TL8A 3OAAD 3VR2A 3ZGXA 1G7TA 4ASUA 1AKEA 5BYKA 5H1YA 1LV7A 3E2IA 2ZXUA 1QHHA 3SC3A 4C0AC 4O2LA 4TTRA 4DT1B 5JS8A 1G8YA 1M6NA 2ZI5A 3LQRA 3FTQA 3NEYA 1JAIA 3LDAA 4LRWA 4Q4AA 3TH5A 4RKFA 2OFXA 1FP7A 1L8QA 2VP2A 4HB2A 3E1SA 4LY6A 3K70D 1W0JD 2XB4A 4D81A 1A1VA 3RSOA 2ZEJA 3SHWA 1KMHB 3CZQA 4A0FA 5KTYA 2Z4SA 2JLVA 2XZLA 3U3OA 2ZSFA 2PMKA 1TAGA 4M1WA 5HE9A 5J40A 4NKRA 2ZYWX 4TTQA 2UKDA 4NCNA 4OK5A 3WMEA 2WV9A 1OH8A 1QDEA 1XEXB 2BBWA 1A82A 3V00A 3U44A 2CVFA 4I4LA 1IJFA 2FOLA 1Q3HA 2J0VA 2IUSA 1SXJA 2IXEA 4Q48A 1ZM2A 1NIPA 2VHQA 4RCYA 3C5CA 1NNEA 3TAHA 1VIAA 1RVDA 3T35A 2QE7A 3JVUA 4NYJR 2OFOA 4RCZA 4B3BA 3LBIA 1KK0A 2VF8A 3D7MA 2QAGC 3QNUA 1X8JA 5GJBA 4TWZA 3GLHA 5FUVA 4X8MA 1I4TD 5HZKA 2XJ4A 3AKYA 5AJZA 1E9FA 4WZBE 4IXMA 2PX0A 3RRMA 4AD8A 3X1DA 4TLCA 5ELXA 2QPAA 3QVVA 2RAPA 4E5UA 1W0KA 4JL6A 4A8JB 1DAIA 2ODEA 5CK5A 5IK2A 1LTQA 3MD0A 3NBZC 3I8XA 1G3QA 5BN3A 1QHXA 4HDOB 5C46F 4BFVA 1P9RA 3PUYA 1C9KA 2G77B 3K0FB 4LPSA 1RRFA 2ORVA 3N2EA 4EPTA 4Q4HA 5CM9C 4YMUA 4HUQA 3FFBA 1K8RA 2QP9X 3U7FB 3OIUA 3NEJA 4HLUA 3IPYA 3B1WA 3AGQA 2X19A 1P2SA 1Z47A 5EE0A 1KO8A 4FI3C 1YZGA 1XPOA 3QG5A 4DVGA 3SYLA 1G5PA 3W34A 2ZTSA 4CIDA 4FCVA 2JASA 1R6BX 1KNXA 2A30A 4GT1A 4B32A 4PZLA 3B13B 4NYIQ 2QBYA 1QVRA 4B3CA 4RFSA 4RD6A 1OLOA 4M1YA 4KFRA 2OZEA 1DTSA 4NL4H 2YWFA 2AFIE 5FOXA 5HKKA 3RS0A 4FMDB 4YDSA 4PC6A 2ZI3A 1PV4A 1JBKA 3K70C 3THWA 2HLDD 3H1TA 3AEZA 4JLBA 1E2JA 1NBMD 521PA 3F0TA 4UQOA 5TV2A 1UADA 4UNSA 2BEJA 5KNCA 1CEEA 1BMFA 4QOSA 5F3WB 1Z06A 4UNNA 2EFDB 3SJBA 1KTVA 4G5RA 3ZIAA 1MABA 1XTJA 1U98A 1PLLA 3HR7A 3VU9B 2GXAA 1T8TA 3SJZA 3KDSE 4B2IA 2ZI7A 1DS6A 1RRPA 1R0YA 2DFLA 4G1UC 4MGKR 1F48A 1A2BA 1N6PA 2CBZA 5FTKA 5HPYB 3A36A 4GP7A 4LOAA 4EPWA 2IXGA 4W5WA 4WZAE 3GLIE 1UF9A 1JAHA 1T91A 4MKFA 5G41A 1N5JA 4UNRA 5CIWA 3GEHA 4NBSA 5HCNA 4JYCA 1VG0B 3NH9A 4GBMA 5EXPA 1SGWA 1KI1A 4KJZA 3HPQA 1T3SA 4WA7A 1YZQA 2WWHA 3RDPA 3PEYA 4II7A 1X8KA 5J5CA 5JSZB 4QXAA 1YR9A 1CR2A 3CZPA 4TQ9A 1GFIA 2HJVA 4GDFA 5CIQA 3DKVA 2IXFA 3SOPA 3CB4A 3I5YA 4C7OA 4EFMA 2HDNB 2OBMA 4TN1A 1EFRD 2TMKA 3EPKA 2ZQ5A 3KXIA 2ZREA 5FBQB 3SDZA 3ZZTA 3ZS8A 3GLFB 2J1LA 3RRZA 1IONA 1UBEA 3OHMA 3KKMA 4C30A 4DBLC 4O3MA 2CLSA 4NCJA 2FNAA 4RFVA 1E9DA 2IYRA 5CYOA 3RYTC 3BD9A 3BXZA 2OESA 5P21A 3EARA 1UPTA 2B7BA 2V55B 4M1OA 3QPWA 1G19A 2ZAMA 2RGNC 4CEJA 4Q47A 5SZJA 2VYFA 5J4HA 5IDVA 3WNBA 3HYTA 3WXMA 3O47A 3TW4A 4G0NA 4LBWA 3W8NA 2CMKA 1S9HA 1E1RA 1DELA 4WVFA 4V0NA 1XX6A 2QORA 4OQXA 2NPFA 4OHXA 3SJAA 4JZKA 3CUEF 3B5JA 4Q1AA 1ZNYA 2IW3A 4DLUA 4XD7A 1Z63A 1CR0A 4PAOA 4JMPA 1ZIPA 2P6UA 3D6TB 2GHIA 4JLDA 4UXJA 1NMXA 2JLQA 1HV8A 3SHFA 2OBNA 3LLMA 4PQRA 2O0HA 3HJNA 3TJZA 3TNFA 4GZLA 2QRZA 3P1JA 4KLZA 1R0WA 4YXWA 4JSYA 3U3JA 4UNQA 4ZPXA 4NCKA 1GKUB 2XSZA 3BWDD 3PEUA 2QTHA 2JIZA 4DHEA 2E1RA 1E9BA 1DAMA 1N6OA 1KI8A 4ZDKA 5BN4A 2OCBA 3MRSA 2W6JD 2QZ4A 1BKDR 2ZI6A 5AJVB 3R8CA 5CJ2A 4GMXA 1DAFA 1W46A 2D62A 4A0HA 2HUPA 5AR1A 1ZM9A 3QQ5A 1CRPA 2ZJYA 3CNOA 3MAAC 3THYA 2C03A 3FHTA 4FMBB 1U8AA 4FINA 5DHAA 3TVDA 1ZBDA 2GF0A 2QMHA 1KZ7B 4EQ6B 1D9ZA 3CPHA 2J7KA 3OFND 3BERA 1AGRA 1RE0A 5JECA 2EW1A 4US0R 1XTKA 1SKYE 3CW2A 3AF1A 1D2MA 2IA5A 3ND9A 4RD2A 3W90A 1WCV1 2GVDC 1Z0IA 3WHKA 3F3YA 1W4AA 3R7WB 2BBSA 1E9AA 4QBIA 1U9IA 3T1OA 1Z5ZA 2OXCA 5KU1A 3KTAA 3KUDA 5AUOB 5B2ZA 1JPJA 5KHOC 2GCNA 4UKDA 4TZ0A 5TXGA 5C18A 2AFHE 2JJ8A 3QE0A 4O0MA 1KJZA 1OKKD 4IDPA 2IS6A 3CRW1 4WW0A 1G291 1XXHE 2A78A 2ZS7A 1EFUA 2WAYA 1FX0A 2R8RA 3SNHA 3IEUA 4JVMA 1Q1EA 4OYHA 1X8LA 4TSFA 4C0LA 4UJ5A 4C2UA 4OL0A 4LZZA 2C9YA 3GFTA 2HT6A 4QBFA 2VP4A 4Q9IA 3ZVMA 2QMOA 4NCIA 1S8FA 1F3OA 1T0HB 3EZ6A 1Q1BA 5L3SA 4ABYA 2F9MA 3DL0A 3ZVRA 3A1VA 2G0TA 1DO2A 1OB5A 1NVWQ 4DDWA 5DN6A 4BQSA 4PPFA 3T5GA 1W4BA 2REOA 4GNKA 1HT1E 1T4GA 3FGNA 1T8UA 2FEOA 4I1UA 3LQQA 3VR5A 2IX3A 2O0JA 1KO4A 2FSFA 4Q4LA 1FZQA 2NO7A 2V7QD 3BBPA 4OJQA 2V54A 3AV0B 2ZYTX
chains in the Genus database with same CATH superfamily
2C07A 3RRJA 3KXKA 4RZHA 3SR3A 2R25B 2LWIA 1U8EA 1WA5A 4FFOA 4XB2A 5ALWA 1H2HA 1PL7A 5I9MA 1T1EA 4OBBA 2H9YA 3QENA 2DY0A 5A4JA 3FROA 1JQLB 1J42A 4ZVQA 1UBUS 4DMCA 3BXFA 1YDEA 4H3HB 4GDMA 4B2PA 4CFZA 3ZE1B 3BWVA 4B40A 2PT6A 2WLSA 5FL7A 2EXXA 1E64A 1YDHA 3LPLA 3NORA 1R10A 4J7XA 2DPXA 1N5MA 3LGSA 1FDUA 2WSSD 3RABA 2F9FA 1K06A 2NIPA 3WYNA 3VKGA 2FZ4A 1EQUA 2BLNA 1YBMA 3F6CA 4C0KA 3FHLA 2XWSA 2JCVA 1Y6GA 2ID8A 3H8WA 1JIQA 1JHQA 1IB6A 2HA7A 5CNJA 1D5WA 4Q4CA 1EX7A 1ACLA 1M72A 4IGEA 1D03A 2AKYA 4TMKA 4TTAA 3ROEA 3TTXA 4B76A 1IWPB 2NPOA 2GBLA 3K05A 1U8YA 5K4AA 2PX5A 3NOOA 3RUEA 2XOXA 1RR6A 2QTVA 5A5FA 3T7SA 5IDYA 3VVLA 4J0QA 4CEIA 1E7RA 4DGQA 4REQA 4KGXA 1M5TA 4HXYA 2O1SA 2C7BA 2P1DA 4M1SA 3IMGA 1XRRA 4MKRA 3T15A 1VSQA 4BWFB 4EUFA 4NYMQ 1IXYA 1VRWA 2LW7A 2B1RA 1U2ZA 2NZJA 1R4MB 3JRNA 3LHIA 4WZAA 4ZOAA 5ADUS 1LGYA 2BFBB 5BQ5A 1TVKA 3ANSA 2J3KA 3D0RA 2QM0A 3LLUA 4J4HA 3QH4A 3U1TA 3IKTA 3FPEA 5HW0A 2O1XA 1B8NA 2XBMA 4DRZA 3PQ4A 3I2FA 1JR6A 2CL5A 2W6OA 1SBHA 3RAPR 3IPXA 2G5CA 1WW3A 5KAMA 4YUYA 1Z62A 2XVMA 1XWIA 5MN6A 1NL3A 1RFGE 1VI6A 3AHCA 4MLPA 4LWPA 1CUUA 4V0OA 5T6MA 1UINA 4Z4IA 3PT5A 1Z38A 2JAUA 3O1IC 3QWAA 4U2EA 5D51S 4ABTA 3FFTA 4ZI7B 1QF6A 1WOYA 5TRTA 1EI9A 2XVXA 3IAHA 4HGYA 1LQUA 4MCJA 4LGVA 4F4UA 1DBIA 2C20A 3A70A 1WTCA 2H9IA 1FVFA 4MVJM 4Z9BA 4BNTA 3OZFA 4DJFC 4JBHA 4B87A 2QM8A 4BO5A 1HG1A 4DA6A 1YRAA 4AG3A 4OI0A 4KPFC 2DPGA 4ZO6A 1KNQA 4MYUA 3TTWA 4DJAA 2XUAA 4URUR 4JK3A 3T54A 5HIIA 3ZV4A 2GN8A 3SD7A 5EE1A 1TQ2A 4WXPA 4N18A 4I3HA 2BGGA 4WESB 3R24A 5ALZA 4TRNA 1FQKA 1RXIA 3D3NA 3K0CA 1ECGA 1GA4A 3ESBA 4P38A 1ETUA 5JFGA 1FFYA 3DFIA 2VK1A 4DZTA 4EVSA 3V4RA 2XNSA 2C61A 4G37A 3HVRA 1XD2A 1CT9A 4GSYA 2ZBPA 1TLTA 3E8XA 1T0PA 5FI5A 5EJ7A 4FEGA 5E7IA 1KQFA 2ZE7A 1ZMTA 1VYVA 3EXAA 3IUJA 4QNMA 4FJ2A 2F7SA 2AB0A 4H7DA 4C6TA 5CXUA 4KTTE 3DOFA 5SYMA 4CI9A 1T4CB 3KWMA 4XIJA 5GMOA 2BW0A 3WG9A 2R8PA 4BNJA 4ESEA 4F7DA 4MARA 3MS2A 4LE0A 1JLSA 2JHAA 4RC9A 2DHDA 1AS0A 3WMRA 4AG6A 2OMEA 4TM8A 2VZLA 3ZJ5A 4EL5A 1M2KA 5CFPA 1TU0A 1QANA 1PJ4A 1XRMA 1ZIXA 1KS2A 3GUVA 1AB5A 3MJEA 3FPAA 4QTXA 3U3MA 4YV2A 5JQGF 2IYYA 3W1VA 1Q20A 2H07A 3FYUC 1FYWA 5FA5A 4MQFB 2IX9A 2VP9A 4UDOA 3HKBB 4I1VA 1NUHA 1UPBA 4UHDA 4CR7A 2EYQA 4CTJA 1T9CA 1SOAA 1ZCAA 2PKXA 5DX1A 3C4QA 4Q7KA 4ZJUA 5LL6P 4QDJA 2BFNA 3WX0A 4R2WA 3II6X 4CQNA 5JOQA 2H2GA 3DPUA 3I05A 3KKQA 3OCVA 1GADO 2PR2A 2WQ6A 3CUYA 4HEHA 5LU8A 3NKVA 3QELA 4PXAA 2PKQO 5JSYA 1CK4A 3SQLA 5J58A 4LSMA 4X97A 2C2YA 1UBHS 2NU7A 1UBKS 2NU6B 3IJ5A 4FGWA 4K9KA 5AVQA 2B3DA 1X80B 3HVHA 3MWEB 4KQMA 4N7MA 1YI8A 1CRPA 3DHWC 2YYSA 5T4HA 5H4GA 1UOPA 5DOVA 2HEIA 2QVBA 4I6JA 3ETHA 2IPXA 3ZWOA 3GD7A 1SVNA 3RGWS 3PXCX 3TN7A 5BORA 4RZXA 3I2GA 3K9CA 1EG7A 4GYYA 3TLBA 4Q02A 2YFQA 2P0AA 5LZ7A 4F06A 2PUEA 2VPQA 1CUDA 2YC2C 1ZW6A 1EA7A 3SYTA 4ER7A 2XUKA 1ZH8A 5HJ2A 3Q12A 3ZU3A 2YH2A 3LG2A 1T5DX 1TEHA 4BRSA 4DIMA 1O94A 2VXOA 3BZUA 2R86A 2XLCA 4GEKA 3LUJA 5B7GA 4WACA 2AFHA 2O1WA 1Y42X 1YC5A 3RWMB 3AF5A 4F38A 3S8EA 1ATZA 3CA8A 3T7AA 3P9QA 3ZQUA 5K0TA 2RGBA 3MWGA 2FMKA 1Q16A 3GXOA 1Y1RA 3DEKA 1LBSA 2IS4A 2WT4A 2R8YA 3ZTWA 4F97A 5B57C 5ER6A 1OROA 2W2NA 4BWGA 1C9EA 4AROA 5ICGA 4HZUB 1ZS9A 4G8CA 2VAVA 3O8RA 1RHJA 2YFYA 2BFEB 4YRNA 1UMBA 3AB3A 3MMZA 2O3TA 4EI7A 1TPZA 4WNAB 1DCFA 2GBFA 3TW6A 4BGEA 1PBNA 4AJ1A 1F14A 2QSUA 2XQIA 2PA0A 3PE4A 5DNVA 1L8XA 1C5KA 1YULA 2QM3A 2YZGA 1CP2A 3R3JA 3NT5A 5DN9A 3ZHOA 1XF9A 2QLMA 5KC9A 4M7PA 4MRVA 3DA8A 3I28A 4I4TB 2IZ7A 2IOFA 5ABPA 3PKJA 1GWNA 1YZYA 5CVTA 2O3SA 1N1MA 1CVRA 3AJRA 4KYIB 2P2YA 5AK3A 2WFLB 5HG0A 3ENVA 1JXMA 3FUCA 1SC1A 3F90A 5AVJA 4IEEA 4RORA 2YXDA 3WV4A 1I94B 1BQEA 1GQOA 2Q1YA 4R6XA 2LDBA 1UM9B 2WU4A 2ATXA 4LRSB 4MW6A 3S28A 4IDCA 1MH1A 4D6PA 4ZEWA 3WKCA 4D3DA 3HJHA 1KVRA 2QX8A 1JNXX 3HV0A 4Z99A 1BVUA 5C1DA 1N5IA 4J4TA 3UWDA 5HR5A 4XWWA 3F3KA 1E3JA 4A7PA 4NCBA 4BQRA 3DV2A 1VL6A 3H8SA 2P9JA 3H4MA 3GJ6A 2BC9A 2Q3HA 3U7QB 4PN3A 4OBEA 1UMDB 2Y1FA 2H65A 4UUMA 3MCVA 2IS2A 2P9EA 3V8EA 2IE0A 1KTIA 2ZWOA 4RVCA 2PK3A 3AR3A 5KSOA 1OFHA 4KRXA 2FUNB 3DHVA 4HL6A 5AJTA 2GSWA 4XYMA 4ETIA 3B3JA 5A1TA 1VTKA 821PA 4CEHA 5CVJA 4BWYA 2EW2A 2KPOA 1SU4A 2HUNA 3SF0A 4QEKA 5B30A 4MOWA 5D3MB 1CRWG 2DT8A 4YYZA 5TIIA 1QBKC 2ODPA 3K9BA 2VDMB 4N76A 2HPAA 2W6PA 2XNCA 5EQFA 3RVMA 2FAXA 2II6A 5DW3A 4BO7A 1VLJA 1X2BA 121PA 1NW3A 2WICA 3B1FA 3C24A 1ZA1A 4NZPA 1QZTA 4QAQA 4U2KA 2PKYX 2WUEA 1C3LA 5FI3A 2RJNA 5J2UB 1EXVA 2JIOA 1GR0A 1PW7A 1A7KA 1PG5A 2NXWA 4PX2A 5B3AA 1VCNA 3CW8X 1Z4QA 3DV0B 3Q7RA 5SZKB 4CL2A 1ADFA 4EF4A 1W2HA 4DV5B 1W36D 2CFOA 1QQTA 1U28C 2WB4A 1NX9A 2OHOA 2ZB3A 2X9LA 1T0JB 4INOA 2CB9A 2JJMA 2QRUA 3A28A 3VBCA 2OC4A 1M66A 3CRRA 4MCHA 2NGRA 2GPYA 1VJCA 1IQRA 3BFKA 1G7SA 1NNI1 4J7AA 3NH6A 1J33A 3QLTA 4E11A 3ZE2B 4FFPA 1PJ2A 1SD1A 4E14A 1UWCA 1RXYA 4HDMB 3JQ7A 1R50A 4H6VA 3PK0A 2P0YA 1XVVA 3K4HA 2FQ1A 2WJ6A 3R5KA 4GM1A 4KE8A 3TSZA 1QPGA 2EEZA 1MO3A 2RHDA 4TZ6A 4HOYA 4O4LA 1P4GA 1E1NA 2QMZA 1EPUA 4PSVA 5ALYA 3W78A 2DM6A 3MN1A 1J1ZA 1VLZA 3KYBA 3TOXA 1G41A 1G17A 2C2OA 1JAXA 4G41A 3S29A 2PPVA 4R0VA 4AK9A 1W4RA 4ENRA 1F8XA 3C41J 2Y4OA 3IKMB 4RHFA 2HTFA 2JLYA 5J4KA 4ZVOA 3DL4A 3BHMA 3R3UA 3WICA 4C6TB 1NIJA 4AJ4A 1C9DB 5JJIA 4CKCB 4R9VA 4Q4DA 1C7EA 3K5WA 3RNLA 1FDSA 4WK6A 5T8KC 3Q7PA 3UYLA 4F5YA 2AF3C 4IUCS 5B1SA 2FR0A 1M67A 3KQMA 2YYYA 1PS0A 2YMMA 2ODAA 1RHQA 3CYFA 4WY5A 3FWNA 3S1AB 4PYJA 5KVAA 5KX5B 1ZR4A 1RWNA 2V1UA 3BMXA 2FPIA 1Z5PA 2GRUA 2H85A 3QJ5A 4M1MA 4EA6A 4X91A 2YBDA 2EWVA 1SIOA 1XRSB 4RAQA 2YWHA 4KWEA 4CV1A 2EJVA 3TXYA 1SVOA 3I01M 1N2SA 4FB4A 4CCAA 4KI7A 1JA1A 1TDJA 4F9TA 4YJFA 1RQ7A 4HN4B 3O2NA 4TV9F 2WHPB 4QTTB 2QLTA 1RWQA 1GGMA 4Y9UA 5CA1F 4GMKA 3U7FB 4JUCA 1TAUA 4FYHA 3QUAA 5DNUA 1EFLA 1P1HA 2NM0A 3QI7A 3RLFA 4MIKA 4EP1A 1AXRA 4COKA 2ETXA 4FTWA 1Z39A 4U7FA 5BQOA 3BHIA 4KC0A 4H0NA 1W34A 1YL6A 2GXUA 5DHSA 3TUIC 3EDYA 3KAJA 2IYVA 1CUXA 3EQ6A 4DYHA 4BE4A 1Z4KA 5LBTA 1EFAA 2XQVA 5NULA 2ZAIA 2XKJE 2MINA 2R6FA 5C7OO 3WBJA 1BXGB 4UMFA 2REQA 3DDSA 2IE8A 3MTIA 3ZWPA 2Z6AA 1JDZA 2RSLA 4CR6A 1GQSA 5HF6A 3EIFA 4IYRA 5FNVF 2CL7X 2Z8YA 1OV4A 3M1AA 5AOCA 4EITA 4KXQA 2YNMD 5DI9A 1PJTA 2I7XA 1QYWA 4UDYX 3AQ4A 1NFRA 2AFVA 3UK0A 2GLXA 2RGDA 3FHCB 3L6BA 2NUTA 4YDRA 3V42A 4ZXFA 5BSFA 2F00A 1ZH4A 2ZI4A 3AF3A 4PC2A 5T64A 3FFWA 2B4QA 4A91A 1EINA 3QF4B 3MWDB 1G9XA 2LNDA 3IR5A 4R1PA 2QQEA 3UF0A 4BNXA 3UV6A 1PEYA 3DBVO 4QFBA 4C1NA 3DFKA 3AVQA 5DNCA 4N0QA 3MYYA 2QT9A 1HZZC 3P94A 4BMCA 1ULTA 5F12A 4UAVA 4DZZA 2CJWB 2BY4A 2R2GA 1KQPA 3P52A 3RTEA 3SCZA 5JADA 2IHJA 1T6NA 1T4MA 2AXQA 3HN6A 4ZVPA 1F0YA 2VH5R 4P81A 5L4LA 4RUKA 3AO0B 4MVJD 1UMBB 3WLAA 5K45A 4LJ8A 2NXEA 3I9FA 1SQSA 4R1QA 1SCDA 3L9XA 4EHAA 3SZRA 4IZIA 1JQDA 4HAIA 3CH4B 3DDHA 3QKRB 2WWYA 2BCGY 4PZCA 2G8LA 5DSXA 4K1LA 4NMMA 1CERA 2DP4E 5KOHB 3BH7A 1XEWX 3FVQA 1HLDA 2X77A 2ZWPA 3PR3A 5DFAA 5E9WA 2F8MA 3LGXA 3P2MA 3VRHA 3ZDBA 2I2XB 3ZD9A 1OHHA 1ORDA 2GQ0A 1ZX1A 4JITA 1D2NA 2KI5A 4XPIA 3V1KA 1NOKA 3RR2A 4F3NA 2PKRA 1CEXA 2R60A 1OAAA 2YQZA 5HRCA 3E5HA 5INTA 3PV0A 1NOJA 3KYDB 1PBTA 2I6SA 3LYHA 3ETJA 2DPYA 3VJLA 4BNLA 1RZ3A 3JD2A 3MJCA 4HQKA 2YFKA 1CTQA 3O8QA 3OZDA 2JFZA 1IRXA 1HWYA 2D1RA 2W6ID 4U00A 3NJ4A 1CQJA 4LHZA 5EP3A 1JXOA 4B84A 4BJ1A 2H1LA 2J7PA 4DBLE 4ETMA 3I1YA 5KU7A 4BZWA 2XW6A 3A2KA 2V9PA 3H2GA 1NJ5A 1I6LA 2AGVA 1HOXA 5DXFA 1VRCA 2AQKA 3B7GA 5TGDA 2HREA 3K09C 4DB2A 3I6ZA 1MDFA 3VYTB 3K5HA 1YKSA 2Q0XA 3G7NA 3ET4A 1GG9A 1E0JA 4L6IA 3IESA 4I5DA 3JQAB 5FQNA 1CF4A 3NVAA 2WAXA 4K6GA 1NXVA 3RLIA 2BMEA 3LVRE 4FOLA 3T5MA 4UDXX 4BMDA 1COWD 3AWIA 4MA0A 2ZRQA 5ENDA 4F4CA 4OXKA 4JS0A 3BSYA 5IF3A 2XTNA 1N2CB 2UXCB 3Q7IA 5LYJB 4AB1A 4U7GA 1R27A 2AZTA 5CLJA 1ZD4A 4TTTS 2O2JA 1LX6A 3BRQA 2EWMA 1S2IA 1NATA 5EC8A 2CEAA 3KJFA 3KZKA 1KBZA 2ZAOA 3E6AA 3RUFA 1ZW1A 3HZRA 3LU1A 1BHQ1 1C0IA 2GZHA 5FWXA 5B7QA 1Z7WA 2GXQA 3B5EA 2P91A 4GYKA 4DDTA 4BRWA 2YXEA 1HT0A 1IJKA 2ZZNA 2F1IA 2O8FB 4NENB 3ZLJA 1TFUA 5DBGA 4P0PB 4ZT2A 2QGFA 1NBME 4L2IB 3V4VB 5AKGA 5B6IA 4MI3A 4X65B 2I6UA 3REFA 1IZZA 1KI6B 3IHKA 1DG9A 3IPAA 2FXIA 2PBRA 1JHPA 1H8EA 1PJRA 3JWPA 3JZMA 4YDHB 5F1OA 1GYPA 3RU7A 1RBQA 4A03A 1XNRB 3EEFA 1SY7A 2NQTA 4TM7A 4JQYA 1LRJA 3LSYA 2J9RA 2PSSA 3W6NA 4W9MC 2VBCA 3A4MA 3ADKA 4K9NA 4Y2QA 1QGDA 2K7ZA 4ARIA 4DCVA 1JQEA 4CYMA 2IU3A 3OD1A 2XIJA 1CWUA 4NOJA 4CN8A 1Q7CA 1H0HA 3QWBA 4PBRA 4CU5A 1JKXA 5I3CA 3H8JA 5JT1A 4KNYA 3FJOA 4EI9A 4DBVO 3JQ7B 1SUCA 3CIFA 5CEEA 4BP8A 3RYIA 1XTVA 4V0LA 4ERXA 4OGGA 2OV4A 1W85A 1U6KA 1FSGA 1X7ZA 1WABA 4MKHA 4HEQA 1L8LA 1XLWA 4ZQBA 4JJKA 3V2IA 3OBBA 5FBRB 3QX9A 4QZVA 1XEWY 2XMRA 4D0RA 1Z15A 3H19A 3WGUA 3OTOB 2F62A 2TMDA 4LJKA 2ZIGA 4B8WA 4OQLA 2DAPA 2RK6A 3MJ4A 4Q7MB 2YRWA 1DKUA 3EH1A 1TO6A 2NLOA 1DMSA 1KK1A 1XU7A 1H9AA 1EDBA 4LIPD 2X13A 4PS1A 4R40A 3GPBA 1BMQA 3N7UA 3SFTA 5HIJA 2OILA 2O23A 3T9DA 4D56A 1Z0DA 3RC8A 4KSYA 3CINA 1CDZA 1PGQA 1WVGA 4MROA 3JAWA 9LDTA 1FYVA 3U5ZB 2GZSA 4J3FA 1PZXA 2GN0A 2I3DA 4C88A 1VLVA 5CDUA 1CNMA 1XN1A 5TQVA 5CEFA 5KZMB 5LJLA 2J59A 4ZJZA 5LXTA 3W9SA 1UR5A 1GAEO 1V9SA 2C92A 2PZBA 3C16C 2I3AA 3GFRA 3QV2A 3HJGA 4LCBA 4DR6B 3TUJC 2QMYA 2YV3A 3HCFA 4GOMD 4CT5A 1NONA 3OM8A 3GJ7A 5C7IO 3H9EO 1T9GR 2RMKA 4IIUA 3I5XA 1A71A 4UM7A 3KT8A 2PGNA 1ESEA 2QRJA 4XH9B 5ALSA 1JHVA 4K05A 1T5IA 3WLJA 2Y4NA 4FD2A 4KL8S 4UHBA 2HMSA 5D3QA 3TZ6A 3WRXA 1Z36A 3IUEA 4DDKA 3HO6A 5KOIA 4D0SA 4BVKA 1XCOA 5IT0A 3L5OA 4FNGA 4DF3A 5JNTA 3U60B 3VYUB 3PHIA 1U7ZA 2AOUB 3OETA 3SS8A 1Y0BA 4WADA 5FPYA 1E3IA 1FTWA 1N92A 2WF6A 4D57A 3NAZA 4RZ3A 1YRLA 3ZWDA 2V8BA 4WE3A 5ICSA 2AG5A 3GOQA 2H11A 3M2PA 4MUKA 2H1OA 2Y0PA 3DCYA 3LT2A 5AJHA 5AW0A 3P71T 2Z56A 2ASEA 1JRLA 2DJ5A 3IILA 4KXFB 1X7WB 2REQB 5F7JA 4ZHSA 3BTUA 5B7PA 3JAKB 4EMTA 5C7LO 1VG9B 2VTDA 4H15A 3WL4A 2OCLA 4MVJH 2TYSB 2BFAA 2QW0X 1Y1LA 1TZMA 1ZD2P 5G1PA 2RIRA 2C5HA 4JASB 1ZJ4A 2ZJZA 1UPUA 3AESB 3H13A 2ZUVA 1APBA 4BUCA 3W06A 2H18A 2IUTA 3BXPA 1NG1A 2PGOA 4FBGA 1FLVA 5EQTA 5GV7A 4IEIA 4Q4HB 1W0JA 1V25A 4ED9A 2LPMA 3SC6A 5JVDF 5HSGA 5I8PA 1O6ZA 2ONCA 3L2OB 2TSYB 2Y66A 3GNQA 4GMHA 3HB0A 3SC4A 4EGSA 3AL3A 4I4IA 2ID7A 3ENKA 5BSMA 2HRCA 4WLFA 4B4WA 1BQ4A 2NT4A 2PUHA 2A1IA 2V97A 3IS3A 1I0ZA 4O4JA 1IQ0A 3JVIA 4Y1GA 1U81A 2R6GA 1ZD3A 1GGJA 2XPCA 3G02A 4Y1EA 4YHBA 3WR5A 1FUKA 3GXBA 1YMUA 2DFNA 1G5RA 3DS8A 3KLMX 4M54A 1RWPA 5JS7A 1E3TA 2GPWA 1ONBA 1G55A 2VXCA 5JAOA 5JR3A 3LRXA 2IEYA 3OEHD 1U2SA 2CT8A 4BVFA 2PZFA 4Z1MA 3AHJA 3LT0A 3R6WA 4J2HA 4PXSA 2AK2A 1YNOA 1TKBA 3L0YA 1V11A 3THWB 4QX6A 2YL2A 4BQPA 4HTFB 4XPIB 2EX1A 2YRXA 3DBHB 3W4IA 5A7HA 4L50A 3CISA 4Q9HA 5YASA 4OQYA 3SFVA 3IAM6 3KZXA 3QBEA 4UMDA 1P44A 4ER5A 2NMVA 1FYEA 1MORA 3NHSA 2ON6A 3O8QB 1YR1A 1DPFA 3U4AA 3G7SA 3ZKAA 1MABB 3WHLA 4E1AA 2VDNB 2A94A 2VTBB 3WISA 4G3XA 1VKZA 4JC0A 5JI2E 1PL8A 2A0YA 2IZOA 5K3SA 3QPDA 4UU7A 3K8YA 5ESRA 1U1DA 2ZRAA 3L0SA 4H3SA 4WXEA 2ZIWB 4MV6A 4V0QA 4FI3F 2YICA 4C01A 4CFYA 5HZGA 4BX8A 2G8NA 2P5TB 3K6SB 4NJMB 1VP3A 3DDCA 2BR4A 3WTBA 2JDID 5FA6A 1GAJA 1FDVA 1XK6A 1ZZGA 4DLYA 4KXNA 4R2KA 1P91A 3B78A 2GRJA 2F59A 3DNMA 3L41A 1WCXA 3VU8A 2HA5A 4FZ5A 3WLOA 3ZHTA 1SURA 3ZBTA 5IF9A 1U3FA 4W7HA 4GI3A 2RGNA 1JILA 4J29A 3TFOA 1TM2A 3KEFA 4XOUA 2V6BA 3OZUA 3STHA 2DOKA 4DLAA 3R3SA 1MEJA 1UK9A 1S8NA 3O74A 1R0BA 2A58A 5FULA 1DC8A 1YF3A 1G7RA 1GA6A 1R15A 4ASUD 5CDSA 5A5VA 2R6DA 2I4LA 5FCDA 4ILEA 3VH2A 3YASA 3WTCA 1IXZA 4AYWA 1XK7A 3HS3A 1KQ3A 5AOBA 5HFNA 4Q9NA 4QLBA 5KDOA 1ZUD1 3QU9A 3UMYA 3EXHC 2MSKA 3P0HA 3LKVA 1P5JA 2GAFA 3WY9A 5IKMA 2ZYGA 2AI2A 1A7AA 1O95D 2A2ZA 2GTHA 3OIFA 2GEKA 2HA0A 3DO5A 3K2EA 5AXAA 1ULSA 4PO8A 2W7TA 3PQ7A 2P5UA 1AN0A 2R48A 4OGFA 4DM4A 3AFMA 3PQ6A 2PX2A 2VKTA 2EZ9A 2Q4TA 2YMLA 3DOJA 3K2BA 4KODA 4MRSA 5KYTA 3JRXA 2HF8A 1B2RA 5E8RA 3I72A 3WGHA 4C3UA 3GU3A 1KVSA 1VSBA 2YJ4A 4V02A 1QWOA 4GHWA 3QFFA 3C3DA 1H4TA 3R77A 2HX1A 4L0QA 1PE0A 2XUOA 4B3MB 4DSZA 3P4XA 5FBWB 4FHFA 3WK5A 3VO2A 1V48A 2FFQA 4OAOA 1S1MA 3AZOA 4MYTA 5LP6B 2HXYA 2P4UA 4IQGA 3AV3A 3T5AA 3DXZA 2JHGA 3E81A 1IXSB 4PCUA 4Q3EA 5CCDA 3NBXX 1S6YA 2IITA 3HU1A 4DLRA 3TW8B 2PMEA 5A3RA 2HSDA 3PI6A 3RIEA 3WNQA 1IMOA 2RAUA 4YUXA 3OJOA 3SYNA 4DRXA 1Q12A 2Z0MA 1I36A 1YJAA 2J5QA 3CFYA 2XRMA 4LVOA 4FYIA 4YCJA 4ZCQA 2IWHA 5EIBC 2DTEA 2C5FA 1GUYA 3UOWA 4B2LA 5REQA 3T99A 2Q5FA 3ZGYA 3HUEA 1CUJA 1WUJS 4Q1EA 4Y1RA 2Y05A 4OG2A 1E3EA 4X45A 1NF3A 5KTTA 4NH4A 2I9KA 4PZEA 1ZNXA 1ZAYA 3LO8A 2JGDA 3L79A 1WEKA 3C87A 1JFVA 4M0CA 4MQLA 1IZ7A 2DQKA 3IHLA 2XGGA 1H5UA 2ZUSA 5DLEA 4BATA 4JNCA 4D6YA 1T9KA 1XJQA 2H2FA 4LC0A 5TQ2B 1KYZA 3HB7A 4P3PA 1MC8A 1XDGA 3SEZA 3GARA 4R3UC 3GCZA 1OLSA 5K0SA 3L0DA 1JEDA 3BZBA 3U13A 2PRSA 1KY5A 2X4GA 4YCNA 1C8VB 1P2UA 2G72A 4EF5A 3X0DA 1GUBA 3KB6A 4ZC1A 1E60A 3MD9A 4FW9A 1KMHA 3AUSA 2Q6IA 2A0XA 5FLEX 4X44A 5CCXA 2ZK7A 3V4PB 3ZY3A 1K6EA 2V4ZA 2YWJA 3I6YA 4MEAA 4QDUA 1HURA 5EHQA 3WOVA 2JVIA 4A1FA 2P3SA 5DEIA 2GFQA 2WUWE 4DDVA 3DZHA 3FPSA 3NFRA 1LPAB 1AM4D 5AK5A 1P19A 1Z2EA 3ACBA 3TWOA 3IUMA 4QBTA 3DCJA 4AWBA 2MSNA 4Y6SA 1OI2A 3WYFA 4LYFA 5F33A 3CKLA 3G0HA 1KHHA 1DPGA 3ICQB 4HS9A 4JJ6A 1M5RA 8AT1A 1JMKC 1ODKA 2VXYA 2W48A 1Y1PA 4NJEB 3SU8A 1Y5RA 2B82A 3IKVA 3O38A 2JH8A 3Q0TA 5AKHA 4QE3A 2WUDA 4W82A 1OSNA 3EF0A 4YMTA 3A3KA 1WJGA 4IHQA 1NZJA 5FTNA 1PD0A 3AM3A 3Q11A 4LI0A 1G3IA 1Z17A 2C82A 3DVLA 1X9GA 3LOQA 4ZV7A 3SFZA 2QRHA 4YLGA 4YRJA 5C1IA 1GPNA 3V33A 3IP8A 3ZW9A 1JHZA 1JAYA 1YBHA 2BPOA 2XAUA 1G66A 3ITDA 1JJ7A 4OA5A 4U7TB 5I8ZA 1BN7A 1GQYA 1OE0A 3QBJA 4OV6B 5HEKA 2W70A 5A03A 4DR4B 1TIPA 4IVPA 1KJJA 1PU2A 4ROTA 2Q99A 3MF4A 1N6LA 3FR7A 2QN3A 1LPOA 3P4YA 3S2SA 2W00A 3ZXYA 3D4OA 4NULA 4D26A 4IWNA 1SXIA 4EL0A 1E8NA 2J6HA 3VHLB 5F98A 2Y1CA 2M6SA 2VSXA 2WRZA 1RLMA 2N0SA 2JIRA 4FUTA 2I67A 1SXJC 1G9SA 1SBYA 2ORIA 3SBXA 1DJNA 8MHTA 4CUZA 3BGIA 4Y9TA 2Y6VA 3RRYA 1MGPA 3STXA 4F5ZA 1Q6ZA 2ODTX 1H2WA 4GM4A 2GPSA 4HDAA 2VCYA 3EDRA 3LLSA 1W8DA 1YE5A 4IIGA 3X1KA 1BQ3A 4D46A 1T4BA 3OFNA 1W44A 3X2FA 5KTPA 4PGAA 4LPKA 1PFKA 2WQZA 4L4UA 5HQ3B 2O7QA 1GTZA 3RG2A 1JMVA 4W5HA 4N03A 1USGA 1XTSA 3VR3D 4DLLA 1EZ4A 4MDEA 1CEQA 4RTJA 4BMOB 2QL5A 3B6ZA 4K8RB 1FB5A 4FM9A 5KMGB 2OBFA 3Q8XB 2HSEA 2MSDB 3M4JA 4I3FA 1NMZA 4BBZA 1XFDA 1X0XA 4EARA 2BMVA 3W6PA 4JZYA 5I7OA 1NBOA 4JEMA 5TMBA 4CF6A 4D9MA 3JATA 3R3XA 1OIWA 1U0SY 2QSZA 1BHJA 3MQFA 1R64A 4XYBA 5ETJA 3W04A 1P45A 1QRAA 1RC0A 1Y7PA 1L9KA 4M99A 4NHEA 4NC9A 2QD4A 1TUBB 4K6HA 4YBRA 5EERA 3TI7A 1J06A 1NLUA 3A4NA 3F7NA 2P62A 4FFWA 5AM4A 1FUUA 1DE0A 4KR2A 3DG9A 4PRKA 4RZIA 1Z2NX 2CL6X 1P2BA 5JY6A 3V4LA 1ZJZA 2BGIA 3ZK9A 5LQRA 4H9GA 3DKPA 1WOMA 4YRRA 4LE2A 4DC0A 1NTRA 4LK3A 5DNDA 1FTNA 4KE6A 2IHKA 3IKLA 5K8UA 1SD2A 3SEFA 4C2BA 4IIXA 3DLTA 3N8KA 1CS4C 2G63A 4LHVA 3OQHA 1ZWKA 4Q24A 2PFGA 3AP2A 4P7FA 3ZDFA 2Q6KA 1E1RD 3DFFA 2JRCA 2BUBA 1EDZA 2PV0A 4C08A 2GHQA 5CHYA 3GLIB 1RACA 1LLDA 1P0PA 1SULA 1H2BA 3E22B 2AQHA 2I78A 5AHRA 1W581 4MUAA 1ZVMA 2QTNA 1K89A 2QUZA 2ZU6A 1Y8RA 3HYSA 4OTZA 3WK7A 1IAVA 5G4KB 5JAMA 1MTOA 2YOFA 2B2XA 4EJSB 2Y99A 4JODA 4F1JA 4RSMA 5FOTA 2I6GA 2FMHA 2IY9A 3P7MA 2P41A 4OHOA 5FO0A 1X7DA 3AHFA 4Y2PA 1V7PC 4YXWD 2UYCA 2R1ZA 1G8PA 4V3CA 1I9CA 2VHWA 2RHCA 1NXOA 3GZNB 5JWOA 1QHNA 4FYKA 1ZITA 2IH2A 4JCOA 5JSZA 4GVLA 1VPLA 4KGZA 2QUKA 3O21A 2WF8A 3ABZA 1E6CA 4KP7A 4E12A 2ZDHA 2WZQA 4WXYB 1IN6A 3WRYC 4G0OA 4N65A 3PWSA 4XIGS 1G5FA 3I0ZA 1T3ZA 4C9BA 4UNPA 4CM3A 4DA8A 5IP5A 5AUPB 2A9KA 2ZE6A 3DCNA 5CDTA 4JXZA 1EJ0A 2Q6OA 4BU1A 3O3OB 3LK6A 1B6SA 3FMPB 1KJYA 3ELYA 5CCBA 1UANA 3G8CA 3H5AA 4K1XA 5K51A 1OF1A 4N8DA 3KUUA 1YTLA 3L0PA 1RMTA 4NPHA 3KYCB 3PS9A 4HYEA 1DHRA 3BSWA 3PQ3A 3H4IA 1E1LA 1BFDA 2CLIB 1PQPA 1B4DA 2VK2A 5KVSA 2VWHA 3FFAA 3GELA 3HVKA 3TOZA 5AVTA 3R75A 4PN7A 2RHMA 3TQFA 2FW8A 1MXHA 4ZREA 2FCRA 3CTPA 3K0KA 2PZ8A 1K27A 3AKZA 5FAKA 3HP1A 3G68A 3R7NA 3ETEA 1EFCA 3JWIA 1SPBS 1AF4A 3EGEA 1PVVA 2JFNA 2F17A 1UBOS 3I1IA 4M37A 4F8YA 2M98A 1QORA 2XJ9A 5KOYA 5JMTA 4L3VA 3ZHXA 1XNJA 3DUWA 2Q2VA 3OE5A 4G86A 3DUFA 4Q9AA 1NJ6A 2QUAA 3ELBA 4EO4A 4RJJA 5I9NA 2C4UA 2Z1DA 4MPTA 3T5PA 1UDWA 2UYHA 5TMDA 3F96A 3CF0A 2AQ8A 4C6HA 5HIKA 2ZROA 3WE7A 1FP4A 3OTGA 2D7CA 4RQTA 1ULBA 3C6MA 4UHKA 4PIPA 1XDWA 3SX0A 3CX8A 1TM5E 3WO0A 5AI6A 3TLEA 4ZT4A 3VNRA 3W2TA 1AZSC 1SKUA 3DTYA 1OLSB 4QUHA 1MVLA 4HEA6 3B53X 2PLAA 1XJ0A 5CBPA 2Y71A 3Q1KA 3WWYA 1E2QA 3TCKA 3OQMA 1PUXA 2DQSA 3JRWA 1VPEA 1HUQA 4YCAA 4YECA 5A9SB 2VPIA 4HDSA 2I6XA 2CXXA 2ZR0A 1RWMA 1UBTS 1WMBA 2GJAA 3KZCA 3R9XA 1P0FA 4INZA 2HU2A 4RGBA 4E7PA 4HVCA 3VPCA 1H94A 3AFHA 5KYGA 3S6JA 3ZDZB 4XIIA 1L7PA 1XPJA 4RK0A 4MR7A 4X1KB 3ZQ6A 4C03A 2IPAB 3B6KA 3OQ6A 3NWBA 4RF2A 4QGSA 3H1GA 3QVXA 5EKXA 13PKA 4HUJA 2XQFA 2O3QA 2BEWA 2G7MC 2X8AA 1SUPA 3IH5A 3RRXA 4B74A 3RYHB 3HSKA 1GZDA 1H3NA 1I2DA 3IOMA 3OJXA 4FLMA 4IQ0A 2QW8A 3GRRA 3ZZUA 3LOUA 2J5KA 4JKYA 3W5VA 3UPDA 4B3JA 4QPCA 1KYYA 1MTZA 4FDUA 4M1TA 3NDRA 5JHHB 5ILOA 4L4SA 1XZMA 2HSWA 2XHEA 3ZNQA 1A2QA 1E9SA 1XTRA 2D2XA 4C22A 3CKMA 5JPCA 1YZKA 1WZNA 1YS4A 1I51A 1YV9A 2RHHA 3C48A 1F12A 3EG5A 3VR4D 4CODB 1A5ZA 2VLIA 3RUHA 1KI2A 4AKHA 2Q27A 1LXCA 1XAGA 5AJUA 1MG0A 4IFIA 4AW9A 3KSAC 2C29D 2X9NA 2XNDA 3NHFA 4YPVA 4LHYA 2A9JA 4QXPA 3HU5A 4X9XA 5CK4A 3SLGA 2CE7A 3AIMA 4UEJA 3TDKA 4B5LA 2CF5A 4J0JA 3GVCA 3M7IA 3TL3A 2JGNA 2P9HA 4WKCA 3G6KA 1ZD8A 4H35A 1BCRA 2V98A 4EG1A 1SBQA 3VVMA 3TO5A 4BX0A 2KWIA 1ZI9A 3QPCA 4EFDA 4Y6GB 3DZKA 2BSAA 1I4LD 1U1CA 2XKBA 4H7HA 5LB2A 3A37A 4C0SA 1N78A 4MDFA 1S8AA 3AFNA 3QQPA 3FMFA 2BOVA 1GNPA 2MTBA 2C77A 5BW8A 4F56A 2JIPA 2Q5CA 1NPTO 3CLVA 3C8UA 5DTJA 1SEPA 1NJGA 3TYXA 2IXTA 5EJ9A 2BM8A 1XMVA 2HJWA 4BKPA 1BDJA 2Q28A 2OGWA 4P2BA 3QHPA 2WYIA 2OE2A 2ISCA 4FX5A 1NAHA 2ZUBA 1L7BA 4OHUA 4XKJA 1JE0A 5BSRA 2JLAA 3CIOA 4G0QA 3RROA 4NDZA 1JH8A 1IPHA 1ICEA 5DW0A 3AUAA 4ND4A 2BM1A 4TUYA 4D4GA 1EX1A 2ZJ8A 3A6KA 3O3NB 3QKIA 2W5UA 1EUQA 3GFFA 3ZU6A 2FVXA 1R6DA 2D06A 1OZAA 4RMJA 3WLLA 2J67A 3O8BA 5JO0A 2ZRBA 4ARCA 1UMCB 2ZRJA 2A33A 3UPTA 3GLVA 1US8A 2CVQA 4GOLD 3GH1A 4UVGA 1VKHA 1G21E 2FFRA 2ZBEA 4FFDA