3LW8A

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
GPLGSAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rhoa-binding protein
molecule keywords Transforming protein RhoA
total genus 62
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw8A00
5SZHB 5CIQA 2X1VA 2OM2A 1VTKA 3K0EA 1G8YA 1ZYUA 2PBRA 5CK4A 2I3BA 4C0QC 4S35A 1NLYA 4MGKR 3QENA 3GFPA 5J40A 1PUIA 1EK0A 3KXIA 1IM2A 1U8YA 1KK2A 4OQFA 4UNNA 3B7GA 4LJYA 1TQ6A 4ARZB 3TKLA 1W49A 2Q0HA 3ZLJA 4LBYA 1KKMA 2R65A 3HPRA 4GP7A 1TU4A 3KUCA 2EWWA 4QOSA 1QHXA 1H8HA 5BW8A 4MRSA 2GETA 5JJIA 2AD5A 2GZDA 2AXPA 2CLSA 5H8WA 3WHKA 1W36C 4AG5A 2XNDA 2WPDD 1G19A 1U9IC 1Z28A 1E2EA 1XTRA 4HB2A 4PPGA 3SE0A 4NYJQ 3HU1A 5C1BA 4DDVA 1E9FA 1NKTA 1EX6A 4MGZR 2FEOA 2RGBA 1E9DA 3QPUA 4EUNA 4LGMA 5FBRB 1U81A 4Q4AB 4DDWA 3SFZA 1GP2A 3DL0A 1E0AA 5JI3E 4X8HA 1UJ2A 5AUNB 4LSGA 4MDFA 2H7VA 2XB4A 5H68A 4WOPA 1G5PA 1OE0A 3OFND 4HLCA 2IYWA 2JLVA 1J8YF 2OAQ1 2VHQA 4B3BA 3W5IA 4B35A 1XBTA 1OYYA 4KLZA 3C7KA 2J41A 2GXSA 4GOKA 3U60B 4URVR 3QXXA 5TARA 4DSNA 3ZD7A 3AF4A 2J0VA 2XX3A 2YOHA 3DMDA 1AN0A 2WM9B 1SXJD 1RRFA 2YC2C 1UKZA 2CBZA 2IEZA 4DCSA 1VMAA 5FL7A 3DKPA 4G5GA 2RCNA 5HZKA 4Q7LA 4V03A 1UBCA 4PHTA 2DFTA 1U99A 2CEAA 2Z0MA 4LYJA 4RZ3A 1KI9A 2WWWA 2ZRDA 2IXEA 1NVUQ 1AQUA 4JSTA 4DSTA 3AVWA 3K53A 3K8YA 3D8BA 2W6IA 3VNUA 1KIMA 2CNWD 4MRVA 1XPOA 1N0WA 3C16C 4Q4LA 1Q20A 4Z54A 4KJZA 1RJ9A 1SVWA 4W7SA 1J8MF 4B43A 3UXMA 1T0JB 3K0FA 1CJVC 1TNDA 4NONA 5F9HA 1MO3A 4IEEA 2WSSA 2Q3MA 3OAAD 4ARZA 3CRW1 4DLSA 2ODBA 1R10A 2WICA 1A2KC 3CRMA 3PEVA 4BRWA 1E3MA 4OI2A 2Y8EA 5KNCA 1ZBDA 1XTKA 1M7GA 2JATA 2IK8A 3B1XA 1G8PA 3KQNA 1MT0A 2HYIC 1OPXA 1JEEA 5K8TA 2IXGA 4K46A 3CH4B 1KSHA 2IYSA 3CWQA 2WWXA 2JGNA 3B8HA 3PV0A 2VPPA 4QHSA 3V00A 2RGDA 1E0JA 2PJZA 2IT1A 4NCIA 3AUXA 3VX4A 1QHYA 3KXLA 4JLBA 4IJMA 5KDOA 4Q9IA 2ZM5A 1AS2A 1G5RA 4A2PA 1U94A 3U3JA 4B3DA 3THYA 2ATXA 3RANA 5DI9A 3LX5A 3QEOA 1S96A 1QVRA 1P3JA 2A5DA 3S1AB 3AF2A 3SBEA 1FX0A 4OJQA 4TMWA 1GUAA 4CEHB 3SC3A 2VTKA 2KJQA 4PZLA 2F9MA 3NC0C 3WYFA 4JVMA 2Z4SA 4Z51A 4JL6A 1TPZA 2VP4A 2ERYA 1HH4A 4MQBA 3Q5EA 3B1YA 5DGXA 4LHWA 2RHDA 4OI0A 1JAHA 3X1YA 2OCPA 2OBNA 3GJXC 2LKDA 1BMFA 3AM1A 4L4UA 4PO8A 4QKQA 3MAAC 3THWA 3TBKA 1X1SA 2W0SA 4BFZA 3EIQA 4P4UA 4PTLA 3OESA 1JI0A 2RGNC 4V0NA 4E09A 5EE3A 1ZD1A 1AS0A 4U00A 4YC7A 1Z07A 3H86A 5KDDA 4TN1A 4A6XA 2HDNB 4IVQA 3QKRB 3O8DA 4QBGB 2JLWA 4DB2A 1G9XA 4XTCS 4W9MC 1KO5A 4NPHA 4EFLA 3NKVA 2ZR9A 5FUXA 4Q02A 3ADKA 4C2TA 1TQDA 2DFKB 1F6BA 1G8HA 3RS2A 2FFQA 5JJLA 5CLLA 4CDGA 1G17A 2IS2A 4DC9A 3HP1A 1E2FA 2XTMA 3JVVA 1F5NA 1W0JA 4PSAA 1FUKA 4RCYA 4IOLA 4KFTA 1GITA 4Q1BA 4WIAA 3W5JA 3U4QA 2D4HA 1KHTA 3A4NA 3QBVA 2FZ4A 4FINA 2D3WA 3A4MA 1XXHA 4Q21A 4F92B 4GNKA 3AUYA 3KJGA 3TAUA 4C0HA 1CF4A 4QGFA 3FVQA 1I4DD 2QT0A 3L0IB 4ZKDA 4K81B 1GTVA 1N6LA 2QG6A 4A1FA 1CKEA 2XGJA 1OYWA 3GJ4A 1ZJ6A 1D2NA 4OHYA 3CH5A 3QBTA 2GJKA 1VCNA 4HAUA 1FFHA 4JZKA 4LJ8A 2QTFA 2OT3B 1E2KA 3U3MA 2D62A 1EWRA 2AWNA 2ERXA 1T8TA 1ZD8A 1K5DA 4IHQA 4RZUA 1F2UA 2GCPA 2IUSA 3ZIAA 4DWJA 3NH6A 3A4LA 4NYIR 4NHOA 1II0A 1KTVA 2RGCA 1G7CA 1SVKA 1N3BA 3D3QA 4PZYA 3MGCA 2PZFA 1Q1QA 2NIPA 2ZRGA 1CS4C 4LJ5A 4D82A 3VNVA 1YR8A 8OHMA 4XIGS 2EU8A 2GK7A 1DG1G 2EFDB 3AEZA 4GZMA 1Z2AA 3AP3A 4GMXA 1AK2A 3AKDA 2OO7A 3WY9A 4PAQA 2D7DA 3BB1A 4TL8A 3V4RA 2FGKA 2ZS7A 4EPXA 2IC5A 2ZU0C 4D4KA 3MWKA 3AVPA 2EFCB 2V1UA 4TYPA 2OLKA 3AP2A 2BKEA 2WJYA 1BO6A 1MH1A 2ZUDA 5CJ2A 4AKEA 5KU1A 1PV4A 1K5GA 2BOVA 2QQEA 2WPDA 3QNUA 5CM8B 4A0GA 1SKYB 5JLJA 2FMXA 2ZRLA 2G83A 4M22A 721PA 4Q48A 3BK7A 3IO3A 3QF7A 3FKQA 2ZE6A 3G5UA 4TZ0A 2Q9AA 1UM8A 2DB3A 3AKEA 4ACAA 1GVNB 1Q3HA 2Q9BA 3K0AB 1ZM3A 3FDIA 4P33A 1V5WA 5FI1B 5J5CA 3CBQA 3TAHA 1MO4A 1NG9A 2AN9A 4URYR 3MWJA 4JLPA 3BORA 3NEYA 4HB4A 3I8SA 3U2QA 4EPRA 3O8CA 2NO7A 3RDPA 3LO5A 1OIVA 2W83A 4ZDWA 1T3LA 1IXSB 2ORVA 1DPFA 4KO8A 4IOMA 3Q3JB 1ZNWA 4BRUA 1G3MA 3PUZA 2ZE5A 3RRZA 1XU4A 3EW9A 2IUUA 3PUYA 4DLXA 4M9ZA 4ZCMA 4OK3A 1GKYA 1P61B 4EJSC 2GZHA 4IFEA 5J4VA 2GEVA 4TLEA 1OH7A 1KGDA 1DBSA 4CGZA 3GLHA 1R5NA 3NHBA 4Q4JB 4LHVA 4EFNA 3VX3A 1D9XA 4RKEA 3GLGA 2ZRCA 3VAAA 1E98A 4MH0R 1E9BA 1DE0A 3I62A 4B73A 3QF4A 1XRJA 2PEZA 1Z08A 1ZM2A 2FN4A 3C5HA 4CVNA 3R8FA 1NVVR 3WYAA 1QHHB 5EE9A 1K6MA 2F1HA 4NYJR 2VRWA 2H18A 4JLJA 4ZIRA 3CPHA 2WAYA 3WBKA 3FKSA 3GEEA 2NPIA 2GCOA 3EA0A 2DY1A 1IN4A 3T34A 1M8PA 4TQUS 4DVGA 3DO6A 3RHFA 4I1VA 2AFIE 4JT4A 4LPKA 4JKIA 1W44A 5BN5A 2IS1A 5K8LA 5KTYA 1Z8FA 1TX4B 3IUYA 1N6OA 2Z6VA 3ICQB 4L9SA 4D0GA 4UJ5A 3VFDA 3LW8A 4DLWA 5JWRA 4P4SB 3RC8A 2ASEA 3CWZA 2REXB 4QJ3A 1PZNA 3MCAA 1AQYA 2B7BA 5FR1A 4C9BA 4HUQB 4LOAA 3MMPA 1G7RA 1NVVQ 1UEIA 2FU5C 2GTPA 2VQSA 4O0MA 3SHFA 2J59A 4JLNA 2WJJA 1VG0B 4DEYA 3GJ0A 3TW4A 2C04A 4Q9JA 1R0YA 2VYFA 5E95A 5DNYB 3LXRA 2Q3HA 2IUTA 1FZQA 2J0QA 4TLCA 1XTQA 2CCKA 1W4AA 1W2HA 4BZQA 2AKAB 1JJ7A 2FWRA 3L0OA 4GT1A 3UMSA 2CMKA 1G7TA 4OL0A 3BFKA 1Y63A 4LHXA 3LLMA 4XTRA 3RNLA 2IF2A 2RGGA 1U2RA 4IDHA 3AVTA 2GXUA 4OJKA 4Q47A 2GJAA 2OE2A 1Q0UA 1HY3A 1NI3A 5JI2E 3QKRA 3W34A 1RRGA 1JECA 1JPNA 1ZW6A 4XD7D 2OCYC 4QXAA 1XNJA 1XEFA 1COWD 4PXAA 4LV6A 2B8WA 5FL3A 5B30A 2PJRA 4IEIA 1E96A 1KI6B 1OHHA 3KFXA 3AVYA 1NMZA 4LY6A 5B2ZA 4R71A 1Q57A 4E03A 1VG8A 4HLQB 3RSOA 3UG6A 1ZC4A 2ODEA 3SYNA 4Q7KA 3DEFA 1CJMA 1KO8A 3ZVMA 3DVLA 4XH9B 5JWHA 4Q4HB 2JJ8A 4TL9A 2C98A 2QMOA 3NBXX 5FFMA 1H65A 3TNFA 4MA4A 1M1YE 4QGHA 5EXSA 3W6NA 1OIXA 4RY2A 1V43A 1BYIA 1JPJA 2IEYA 4QJ4A 2TMKA 2UVQA 1FNNA 1KDTA 3TK1A 2OILA 1N5JA 4YLGA 1ZIOA 2XEXA 1PLLA 5KSZA 4RVCA 1P6XA 1TAGA 2OHFA 4XWAA 2ZI7A 4A6PA 2GVZC 1YZNA 2IYQA 5HE9A 1OHHD 4DDTA 2AKYA 3FMPB 4PC6A 3EC2A 1IAQA 2WTUA 1R8SA 4OBEA 3QEJA 1VKJA 2OXCA 2ZJ5A 3ZYCA 1XJCA 4HDQB 1OLOA 2QMEA 3OEEA 1GL9B 2PCLA 4Q18A 4BLRA 5JS8A 1OH8A 4GL2A 3C41J 4UXIA 1Z06A 2GJ9A 2R62A 2WKPA 2ZJ8A 4JLKA 3GLIE 2E87A 1LB1B 1DAMA 4M21A 1MABA 1XEWY 1YU9A 4D4MA 3FYHA 3TH5A 2WWYA 4B2PA 4KFUA 1P73A 4Q7MB 2A5YB 3ASZA 3LLUA 1G5TA 1IXRC 1SVIA 4GOXA 4DKXA 1BOFA 3ZVRA 4CEJB 3FGNA 4ZV4A 3THXB 3BERA 2UZIR 1JQJC 3QXCA 1ZNXA 3LQRA 3THXA 3RLFA 3I61A 2KE5A 2YZ2A 1XPUA 4LJ9A 2NZ8A 2IYXA 3X1XA 2PX3A 1CXZA 4JJKA 5EZ6B 2B8TA 5EE5B 4B32A 5A4JA 1T4GA 1X86B 3X1ZA 4PHFA 2FSIA 4BUJA 4IDPA 1SHKA 4R9UC 3HU2A 3WBJA 5DO9A 3QXJA 2NZJA 5JHHB 1KO7A 2N42A 5CIWA 2K5UA 1KI8A 4AKGA 2IYVA 5KSYA 1ANKA 1UKEA 4JYBA 4H1UA 2QBYB 1WCV1 5FTNA 2C9YA 3I32A 1D6JA 1OKKD 4JL5A 2VF7A 1IOZA 3DKVA 4CRWB 1WB9A 4MUAA 4NTZA 2BBOA 3KQLA 3EASA 4A8JA 4DZZA 3NC1C 2F3TA 2DWOA 4V0ME 2OV2A 4FMDB 2IHYA 3CF6R 2XTNA 3PEWA 3E1SA 2FFAA 1UFQA 5CLQA 2XB2A 2JLYA 2V1XA 4TLDA 5KUTA 3RS5A 2JEOA 2WOJA 3BFXA 1IY1A 2BCJQ 3QQ5A 4A2QA 3MFYA 4NYMR 5B64A 1KJZA 3Q72A 4HAZA 1NBME 1YR6A 4LHZA 3MUFA 4NYIQ 1Z6XA 3TGPA 2LWIA 2ZI5A 2O0HA 1MRSA 3ETLA 3FMIA 4B74A 3KDSE 2ZREA 4B6EA 3BB4A 1Q21A 2FEMA 2SHKA 4MKIA 1UPTA 4A0FA 3RWMB 2PLFA 4KLNA 2OAP1 1M34E 2BVNA 1GSIA 1F3OA 2WMOB 1J70A 1W7AA 4AYTA 1G41A 2ZRMA 2C96A 1NJFA 1AKYA 4D80A 2AL7A 4K8OA 2V6JA 1E2IA 2CJWA 3K09C 4WZBE 3R7WA 2QY9A 3KB1A 1XB2A 5L3SA 4BPBA 4GI7A 5CK5A 3U7HB 1XD2B 1ZRHA 3CR8A 3U3RA 3TUJC 1OH5A 1E2DA 2EVWX 2UZ3A 1R7RA 4NYMQ 3OFNA 5JSZA 1DAIA 3IIJA 1XJQA 5FOTA 5C18A 4BZPA 3GFOA 4F4JA 1W5TA 3A8TA 1WQ1R 5K8UA 1HT1E 1DAFA 4LK2A 1T5LA 1AA9A 2Q6TA 2WVJA 2GF0A 4MGIR 2A7QA 1RYFA 2J1LA 1KI1A 4QHYA 1G291 2ZE8A 4Y0VA 2FV8A 2EFEB 2EFGA 2GZAA 2FNAA 1KKLA 1U98A 2GKSA 3EIHA 1VHLA 2F7SA 1W0KD 1SXJA 4Q1CA 4QBFA 2ODWA 2XZLA 4QGGA 5JZVA 5C4MA 3TLXA 2JLRA 1KOFA 1ZU4A 2GAOA 2WZQA 5DLQC 1KK3A 1P9NA 4B47A 2IYLD 5CDFE 3K0AA 2WJHA 3BJIC 1NMXA 1RFLA 1Z47A 3CX7A 2D74A 3L43A 5FOXA 4EQ6A 1XZQA 2DPXA 3I73A 1G3QA 3TR5A 4CYMA 2OSBA 4A92A 3ASYA 1VPLA 2JDIA 3KJEA 3VU9B 1AGPA 1WP9A 2PT5A 4C7OB 3RAPR 1XTJA 1KSGA 3UWOA 3WP0A 2GA8A 1QBKC 4KFSA 5EXPA 2RGXA 3LVRE 1E9RA 2C9CA 5J4YA 1A5TA 4NMMA 1N2CE 2ZRNA 1W4CA 3A6PC 2AHOA 1E2JA 4Q19A 1VYTA 2YJTD 5D3MB 1A82A 4LUCA 3ZQ6A 3VR4A 2V55B 4RD1A 1AS3A 3HPQA 4AG6A 2R6GA 2I1VB 1U9IA 1GOTA 4CEJA 1C4OA 2NO6A 4BFUA 4L16A 2W2TA 1UADA 3Q85A 4EPVA 2HF8A 2Z43A 3F5FA 4G5OA 3Q7QA 1LF0A 4BLSA 2YC4C 4F91B 4CEHA 2BBSA 4I1SA 4KCGA 4C0AC 4MYHA 3VR1A 3AVOA 4B75A 1U8ZA 4GP6A 3THYB 5EZ5A 4MRRA 4MRNA 4P4TA 4PQRA 5FBVB 2ZR7A 1FL9A 3DZ8A 3IEUA 4G5RA 5TMPA 3IO5A 2OCAA 2BMEA 5L3RA 5TV2A 3WP1B 4JLDA 3FHCB 1B0UA 3K70C 4NCKA 1M74A 1QHSA 1HE1C 1MR3F 4IRUB 1TADA 3RWOA 3REFA 4ZI3A 2ZROA 2O8EA 1E69A 3LQQA 4V0MA 5IK2D 1R6BX 4HZUA 3BH7A 4QG7A 4DSOA 3E5HA 3RYTC 5KSOA 4TSFD 2FDCA 1G16A 1ZM4A 5FPTA 3K0CC 1H8HD 1IQPA 1MKYA 3AGQA 4NH0A 4Q9LA 4AY2A 3TQFA 2JLXA 4WXPA 2OXRA 1NLFA 5JEEA 3WYGA 3TR0A 3UIEA 4ZDJA 3AF0A 4LPSA 1CLUA 1FUUA 1NIJA 3OEED 4OHZA 2ANBA 1AZTA 4Q1FA 5HKKD 4JYCA 3GMTA 4YXWD 1XXHE 4OI1A 4CZ2A 2V4ZA 5EP3A 4ZI2A 3NEJA 1M2OB 1BKDR 5B58C 3ZZTA 4JT2A 4LYHA 2ZYUX 4MYCA 1OXTA 3T1QA 3VR5A 4C0JA 5JWOA 3DMNA 2PL3A 3H4MA 4DEXA 5D3MA 2FSHA 4C7OA 3B9QA 1YZLA 2ZI6A 2P65A 3E2IA 4PO1A 1DO0A 2OG2A 3T5DA 3U7EB 2P5TB 5CJPA 4RD3A 5FPKA 3PQCA 2Q3FA 3BIFA 2OUKA 3MRSA 3UG7A 1IN8A 1MO5A 2B92A 5IT5A 2V54A 2QP4A 1LW7A 4LYAA 4Q66C 1T5IA 2YKGA 1GNQA 1Z63A 2NTYC 1NNEA 1HV8A 3GLGB 1FMLA 1P5ZB 4B76A 4R2HA 4NBSA 1ZU5A 2IBMA 3BOSA 2OLJA 3ADDA 2QL6A 4IVPA 3FHTA 3A58B 2MMCA 2ZYTX 1G3UA 5EE1A 4B2LA 5BXQC 4GFDA 3SDZA 3W90A 1KDOA 3Q9LA 2QGNA 5LDDC 2FOLA 2BM1A 3EXAA 5SZKB 5TXGA 4AYWA 5JRZA 4HUQA 4PAMA 2A30A 4PQFA 1W48A 1XMVA 2WWHA 1VECA 3BD9A 3WHLA 3GD7A 1NJGA 1HA3A 2JASA 3PCRB 1OFIA 1FP7A 2GESA 5DI3A 2I1QA 2QP3A 2XAUA 2HYDA 4TMXA 2KB0A 2ZSEA 3GJ8A 1OB5A 2X2EA 4RKFA 3MJRA 2W6JD 4B3FX 3KKNA 3OZXA 4Q9KA 1Q1BA 3F0TA 3SEAA 5EP2A 3CB4A 4GDFA 3F3YA 4Q9HA 2ORWA 2G1KA 1OXXK 1RZ3A 1RJ9B 3LBIA 3OEHA 1E9CA 1ONBA 4YMTA 1VYVA 1SKQA 3IILA 3U44A 2CL0X 4YMUA 4X8LA 5KPJA 1E1RD 1VIAA 4NCNA 1DOAA 5HKKA 2KSQA 1XTIA 4PC3A 5HZHA 1TEVA 5IHPA 2BEJA 2XZPA 3KKPA 1E2GA 1XCMA 3ZZ0A 3CKLA 3T15A 2G88A 2ZXUA 4ZKEA 3ONWA 2RB4A 4XOIA 2O8DB 1YRAA 3AVQA 4I1UA 1CP2A 2ORIA 3GCGA 4FMCF 2V6IA 1QDEA 5AUOB 3U61B 1FP6A 3HWSA 3IPYA 3B1ZA 3FOZA 4FMDF 1EFTA 2BKUA 3LDAA 4AYXA 3WXMA 2WKQA 4BEBA 4II7A 2C99A 1KAGA 2REBA 1Y3AA 2W00A 4TYNA 2JIZA 2J3EA 2P67A 5DN6A 5DYIA 3BWDD 1UF9A 4LI0A 2BBTA 2A5GA 4ESVA 4QM6A 1G8FA 5CM9C 3I92A 3AF1A 3DZDA 4PC7A 4N0DA 2YWFA 1YQTA 4HB3A 4I4LA 1DO2A 1I2MA 4M8NE 1J7KA 2CHVA 4XWOA 1KO4A 4NP6A 2A78A 4G1UC 4LC1A 2O5VA 5CB8A 3EPJA 4PSKA 3SU8A 4KV9A 4WW0A 2F1JA 1GNPA 1J90A 1NMYA 2BM0A 3FFAA 2V7QD 4TZ6A 4PANA 1X1RA 1NY6A 3EARA 3WNDA 2CLCX 1EXMA 1P60A 3O8RA 1NSTA 2J7PD 1GKIA 3UK6A 2O8BA 4O2LA 1FPMA 1GWNA 3FKSD 3LY5A 3ZH9B 2IYUA 5KO2A 1KDRA 3ADBA 2FE4A 5J4KA 2DCUA 3CR7A 1WBDA 1L4UA 2YWHA 4LYFA 3R7WB 5L3SB 2ZE7A 4TYWA 5GJVC 2VSXA 1BIFA 1E2PA 3GQBA 3RS7A 4BFTA 4XWKA 1CIPA 1DELA 4QRHA 1ZNYA 2YVUA 4RCZA 2ZI9A 2G3YA 1HTWA 2QMHA 2ZRJA 2WIBA 2JCSA 2J0SA 3J81k 3O47A 4F4IA 1O3YA 1H8EA 1E9SA 3B13B 2NPFA 3HYTA 4HZUB 2V7QA 2P0EA 3R8CA 4B3GA 3B82A 2XZOA 2PMKA 3M0EA 2R6AA 1QVAA 1E2LA 2FFBA 4O25A 3X2SA 2VIIA 5TY0A 2YV5A 2GRJA 2GCNA 1OIWA 2ZRHA 2H57A 1E1RA 3H2YA 4V0KA 3I5YA 5A0FA 2QE7A 5L3VA 2BIFA 1S3GA 1K8RA 5HCNA 2GJSA 3H1TA 5BQ5A 1Q1EA 2F9LA 4URUR 2J5XA 4QFMA 1MOZA 3AH8A 4YMSA 5FBLB 2ZJYA 3P27A 1WRBA 1US8B 1IJEA 4A8JB 2QSZA 1WMSA 1Z0KA 4DB4A 1YVDA 1Z0IA 3BRWD 4F4CA 4MITA 5G3YA 1UEJA 3LNCA 3NBYC 3GLFB 4A15A 2XXAA 4TSFA 3K70B 1KI7A 1ZNZA 1E0KA 2QZ4A 2IYYA 3LWNA 2XXAB 3K0SA 1KMHA 1DAEA 4R2IA 3KQUA 3NBZC 3R9IA 1TU3A 4OQXA 3PITA 4MYUA 1OXVA 4A8JC 1DAKA 2A5JA 2JJ2A 2VP2A 4M9SA 4LRWA 2FJUA 3B2EA 4UNSA 3ZVLA 5FTKA 4Q4AA 4ACBA 1NN0A 3NHAA 3SI7A 3NIBA 2C03A 4HATA 3ZS8A 2QE7D 2ONKA 2Z83A 2ZSBA 3QKSA 3P4XA 5CYOA 2HXSA 2IA5A 1KJWA 2Q9CA 2QGZA 1P2TA 4DLUA 1CEEA 3LXXA 4QHTA 5DYGA 1S9DA 4HAVA 4BFXA 1D5CA 1YZKA 2H17A 4GRAA 3CONA 3GJ7A 1YZUA 1P62B 2WHXA 3IBGA 4Q01A 3NTUA 1WDTA 2J7PA 2PZEA 4JL8A 1ZM9A 2A9KA 1GIAA 1I2DA 1P2VA 2ZSFA 2J0UB 2ECKA 5ANRB 4MRPA 1PLJA 5DHFA 3HR8A 3W6OA 4JBWA 1QHGA 1NRJB 4EAQA 1LY1A 1VCMA 3HR7A 3A1WA 4DJTA 4DLZA 3FWYA 2QAGA 2JJ2D 3R20A 1SQ5A 3B5JA 3IGFA 221PA 4OQLA 3K70D 4RD0A 3CNLA 5BYKA 1E0SA 1R0WA 1C1YA 4DCVA 2VLIA 2AD1A 2IS4A 2E9SA 2MSEB 3HJNA 4EIWA 2HLDD 3CPJB 5KYKA 2HCJB 1H8ED 4JKYA 1KY2A 3EAQA 4AWXA 2OCBA 3C8UA 2V9PA 1TF2A 3CRQA 5JHGB 2VSFA 3REGA 3TRFA 2ZI3A 3CLVA 1NLZA 1JR3E 4M53A 4NCHA 4TQ9A 2ZRIA 3TUZC 1N5LA 1NBMD 3FTQA 1KMQA 2W58A 3VR2A 2CE2X 4BFWA 1W0JD 5FH9A 3TVDA 1AIPA 2A2ZA 1KMHB 1DG3A 3KJHA 1N0VC 3MJHA 1KY3A 2GAAA 2OBLA 3F8TA 3FMFA 4HLUC 4CT4B 1JB1A 1JJVA 2Z5FA 3SR0A 1QRAA 4XSHA 4ABYA 1JR3A 1NVXQ 4Q5IA 1HYQA 3IQXA 4X8OA 4KSCA 2O0KA 4HEJA 4OI4A 4A36A 5J4LA 2G9NA 3EPKA 4JLMA 3GLHB 3H0KA 5H70A 1Z0FA 3OEHD 4AURA 5EQTA 1JAIA 1E2HA 3PFIA 4AK9A 2J45A 1M7HA 2XNDD 3AV0B 3N5CA 2MSDB 2X2FA 1XCGB 3KJIA 4LJ7A 5UKDA 4JS0A 5L3QB 5AJZA 4C30A 3KQHA 3U3KA 2REOA 4EPWA 2OBMA 4OKSA 3T35A 1UAAA 1VYUA 4B6FA 3EIEA 3EZ2A 2AWOA 1NY5A 1XEXA 3VMFA 1YR7A 2WBLC 2KBFA 3JZAA 1EX7A 4OHXA 3SBDA 2F43B 4D0LB 4BZXA 4P32A 4KI0A 2F43A 2IXFA 4PFSA 4WVFA 4YDSA 1UBEA 2YINC 2ZQ5A 1XF9A 1T9HA 3CX8A 3QE0A 2IYZA 1SXJC 5BWMA 1E2MA 3NDBB 1VG9B 3A1VA 2VSOA 3JZMA 2OESA 2VP9A 2IHBA 3UPUA 2C8VA 4U5XA 4QBIA 3WRXC 1TEXA 1COWA 3CM0A 1TF7A 4D4LA 1XMSA 1S0UA 3V9PA 3QPWA 3WMEA 1YZGA 3K9LA 3L82B 4M1TA 3NVAA 4U02A 3LA6A 621PA 5JSZB 5BN4A 2YYZA 3ZD6A 2ZYWX 1P75A 4TL6A 1KSFX 1G20E 3TMKA 1UBGA 2HV8A 5AK0A 2ZVQX 1T91A 1CTQA 4AD8A 2FSFA 4PX9A 4IXNA 2P6NA 3PXGA 3SYKA 3HDTA 4PPFA 2JLZA 2A5FA 2XOKD 3KKOA 4L15A 2AXNA 2WJVA 2R6CA 2ZU6A 4FW9A 4G5SA 2H8KA 5EUMA 3ZVNA 2XTZA 5EUQB 5GJWC 4LX0A 1LS1A 4OYHA 1SVLA 2XITA 5J4HA 2NO1A 3K9GA 1KZGB 1F2TA 4RD6A 1ZCAA 2J46A 2WOOA 2HT1A 1XX6A 5JBQA 3OE7A 3FPAA 4IXMA 3IPXA 3NBFA 4ZIRB 4URWR 1GRQA 3PUWA 1WBBA 3HU3A 3EZ9A 4YMVA 2RKOA 3SOPA 2WWFA 4MGYR 2C2HA 3SQWA 5JEDA 4RFSA 5SZJA 2XJ4A 3VHXA 5JRJA 4KITB 5F9FA 5F3WB 1X8KA 3CUEF 1E99A 1P72A 2L0XA 3VR6A 1GKUB 1CULC 5HTKA 3MD0A 1S1CA 1XMIA 5AJXA 2O0JA 3CPEA 1AM4D 2MMGA 4I1OA 1F2UB 3UATA 2O8FA 5FPSA 1NL3A 4Q4JA 1FQJA 1IY2A 2GF9A 3UMRA 3WRYC 1DTSA 2JA1A 4PC2A 2X19A 3MWLA 5TDHA 1CRQA 3QG5A 5E7JA 1R8QA 1NN1A 3VR3A 2B7CA 3RC3A 2Z4RA 5H1YA 3AKYA 1SXJB 4US0R 3ZZUA 3L8ZA 3G82C 5JCZA 2BJWA 2FZLA 3MSXA 3DPUA 4E07A 5FBWB 4RD4A 3OIVA 1XXHB 3FE2A 4A0RA 2MSCB 1EESA 2GVDC 4C0SA 4C0LA 2FX3A 2QORA 5K8IA 1X6VA 1CRPA 4XVRA 2QQ0A 1YHNA 5DI3B 5KOYA 1MO6A 2FPMA 1TQ4A 4RSGA 1S2MA 2JLQA 2OEPA 2ZRPA 4LBZA 4PC1A 1IBRA 4Y0AA 4EJSA 4ERNA 3U7GA 3PIRA 4HSEA 2OZEA 2JLUA 2YOGA 1VIYA 4V02A 4Q1DA 3V4FA 1NG1A 1G6OA 1UDWA 3GJ5A 4JLVA 4N1AA 1IY0A 1ESMA 1YE8A 4DUGA 2GILA 1PUJA 2HF9A 2ZJOA 3BBPA 3UMFA 1OV4A 1SVOA 1T3SA 4Q1AA 2ZEJA 1DAHA 5EE0A 2IL1A 2RHMA 4KAXA 2ZYVX 1UKVY 3HYRA 4DDUA 3QKSB 1M7BA 5IF9A 1G3IA 4GBMA 2JJ1A 3B6EA 3QKUA 1YZTA 1S9HA 3Q5DA 1C9KA 1KI2A 1CR2A 2DFNA 2D2FA 3PG5A 2IYTA 1RC8A 1I4LD 4M1SA 3UANA 2RMKA 4DBLC 2CDNA 1EFUA 2QSYA 2ZI4A 5AJWA 3I4LA 1FTSA 5AWFC 2YNMA 2YOFA 3CRRA 3B85A 5JCPA 2GK6A 1Z3IX 3T61A 1G21E 2QNRA 1L4YA 4E22A 2WKRA 1LS6A 1SKYE 3K1JA 3AB3A 6Q21A 5GJCA 4HI0E 1FX0B 2QENA 3CNOA 5EP4A 2HXYA 1M6NA 2BMDA 2PEYA 2VBCA 2PX0A 1DVRA 2OFWA 3QIAA 1RRCA 3QXSA 1GFIA 1NN3A 2W0MA 1TUIA 2BWJA 2WWGA 5AJVB 4ZDKA 4O2RA 4MKHA 3A1TA 2N1BA 2R8RA 121PA 3SHWA 4F38A 2BMJA 3EX7C 5KNDA 1Z83A 3QY0A 3RRYA 4AKIA 2WAXA 5LD2C 3RS4A 4WZ6A 2GEDA 1GZSA 2G0TA 4URZR 1E94E 1E1QA 1W4RA 3QUSA 5JMTA 3QF4B 4OHVA 5E7MA 3LVQE 1G3RA 5JECA 4D26A 2HJGA 2ZS8A 2J87A 1E9AA 3DOEA 5P21A 4FI3C 4NZYA 4KBGA 5EXTA 1XEXB 1EWQA 4B3XA 1SGWA 1XWIA 5SZIA 4FIDA 2VL7A 4RZ2A 3KX2A 1YRBA 4TTQA 2PT7A 4QBHA 2G0NA 4B3CA 2IX3A 4EJSB 4PR0A 4NU0A 2CL7X 4EPTA 4P4SA 3B1WA 3W6PA 4C4PA 3M4YA 3KQKA 3ND9A 1KI4A 1GRRA 2EFHB 3B60A 4TMVA 4GSYA 1D9ZA 3NWJA 2ZR0A 3CW2A 3SNHA 4HAYA 2ZPTX 3WNCA 3EPLA 1IN5A 2P6UA 4RFSB 4DT1B 1ZC3A 1BS1A 1T0HB 4BLPA 2CJWB 3D6TB 4WA7A 3LX8A 4M1YA 4LHYA 5FTLA 4MDEA 2BEKA 1ZVQA 3EPHA 4AC9A 1XFAA 2P3SA 5LBIA 3WMGA 2JJ1D 2V3CC 4D25A 2WJIA 4PHHA 1G18A 3LD9A 3AGPA 1R0XA 4C3ZA 3U5ZB 5AJYA 1ZINA 4WBSA 1IONA 4TTRA 3CF0A 4QJ5A 5FOWA 3T06B 2H1LA 5J47A 4LJ4A 1ZUNB 3L0PA 3ICEA 3AKCA 2QRNA 5DISB 2IS6A 1VCIA 2P2LA 4AI6A 3KTAB 4ILEA 2ZAMA 3P20A 1NIPA 1R4AA 1X8JA 4F93B 2RGEA 1P9RA 2QPAA 2ZRKA 1P7CA 2ONJA 3FFBA 3CX6A 3SJCA 3W3ZB 2FG5A 3CZQA 4US2R 4A82A 2GJ8A 1F2TB 1F48A 1JQLB 2IYRA 4M9QA 5JS7A 1XD8A 2IF0A 3BAFA 1XD2A 4BGDA 1KNXA 4TWZA 4HZIA 3ZGXA 1D2EA 1F60A 4M0LA 4TYQA 2EW1A 4IOKA 3ND8A 5HCIA 2AR7A 3MWYW 4FCTA 4YQFA 4U7DA 4ZCIA 5CITA 2O52A 3OF5A 5KSPA 3WMFA 1QHNA 3IEVA 5EJEA 4TLBA 4RJLA 4C0KA 1A2BA 2NQ2C 3RRMA 4OQNA 1Z0AA 1GILA 2GWHA 1YZQA 4C2UA 2QN6A 3GLGE 1EG7A 4B71A 5KNBA 3KKMA 5IK2A 1GG2A 3EWSA 4UXHA 3ZQJA 3ZDQA 2N46A 1TF5A 1D2MA 2V8OA 3NDPA 4BFVA 1YKSA 2KWIA 5G3ZA 5DH9A 2GNOA 4BECA 4TTPA 1JNYA 2D2EA 5FOVA 1QG2A 2PMDA 4MUBA 1XPRA 1N25A 5AUPB 2A3RA 4R98A 4B48A 4FCVA 5TVKA 1N5KA 4PZZA 4ON9A 4RD2A 3I5XA 4LV5B 2ATVA 2ZRBA 2EYQA 2JLSA 3GP8A 2WSMA 2CE7A 1E6CA 3QXHA 1NN5A 1D8TA 4J0QA 4DSUA 3GFTA 4ZPXA 2WWIA 1II8A 4LV8B 1MABB 1G64A 2CCJA 1LNZA 1PJRA 4LC0A 1B23P 1HQYE 4Q00A 1UDXA 1GAJA 1JXMA 3LFUA 4IDNA 4Z1MD 521PA 5M04A 1OFTA 5HE8A 1N6PA 4JBXA 3IHWA 2J7KA 4H1VA 4PQYA 1ZCBA 4M2LA 1WF3A 1OSNA 2VP0A 4XSGA 3BFVA 3LV8A 1OB2A 3EZ7A 2ZVPX 4W5JA 3DM5A 4KYIB 3L8YA 1N6NA 4JVLA 1IN7A 3X1DA 2P5SA 1RYHA 1GL6A 1KAOA 2CVHA 2QAGC 5DHAA 4C0BA 2GCOB 1OF1A 3PENA 3THWB 1GM5A 3AVXA 2QMUA 4BQSA 3GLIB 1W46A 4EQ6B 3B9PA 1RW4A 1CBUA 4DUGD 3OIWA 4M1MA 1GDDA 1J99A 2QA5A 2EYUA 1DAGA 2QAGB 5ELXA 1E2QA 5E3HA 3U4QB 1UKYA 2IWHA 2NG1A 1US8A 3EC1A 4JIMA 3OIUA 2FSGA 2R44A 3S1AA 3VHLB 4B2IA 4OHWA 4IVRA 2I4IA 3SZRA 4D4JA 5EP1A 4M9XA 4QGAA 3D31A 3T1OA 4Q03A 1PVOA 1SVSA 4A9AA 3BB3A 3U6KA 2F55A 1TMKA 4KU4A 1P2SA 2ZJBA 5FR2A 4JJZA 2C77A 4TMKA 3N2EA 4BFSA 2J9RA 5G53C 4LJ6A 2UKDA 3QPVA 3LBNA 5JJKA 2YWGA 1IXZA 4LCBA 3PEYA 1Q44A 3IIMA 1QF9A 4FMCB 4DIDA 5KHOC 2IWRA 5E7IA 1BMFD 3CO5A 1AKEA 1BH2A 1G6HA 1I4TD 2CL6X 3X1WA 421PA 4D81A 4BASA 5HR5A 1LTQA 1YR9A 5FPYA 5FTMA 1DARA 1OXSC 1TUEA 1OW3B 1RRPA 2GDJA 3LW7A 4B34A 2BDTA 3M1IA 3RSLA 1Z6TA 3K09A 2R6FA 3KUDA 4TT3A 1ZP6A 3IIKA 3PVSA 3SN6A 3TUIC 4DCTA 2FF7A 4KSBA 4N0EA 2QM8A 2DWQA 4CEIA 3C5CA 2PH1A 3KB2A 3KL4A 1CJKC 1HE8B 4V0LA 1FMJA 3K9NA 4HLUA 4CEIB 4TYYA 1SHZA 1Z5ZA 5FOSA 2FPKA 1N6IA 1PLKA 3ECCA 1GL7A 2DR3A 4I81A 3ZJYA 3TE6A 4OK6A 1QHHA 3FHOA 3GEHA 2W2VA 4MKGA 2QRZA 2ZUCA 4HAWA 3GLIA 4KYUA 3TSZA 4Z1MA 1T3HA 4DXAA 3P1JA 4P0TA 2JDID 4KVAA 3CZPA 3A36A 4BWYA 2O8CB 4ZO4A 3IDQA 3VU9A 2ZTSA 4ASUA 3VTKA 3KXKA 4WXRA 5E4FA 4ESHA 4L9WA 1FOEB 5G41A 4F7WA 5L8VA 1KI6A 1HURA 3SJAA 3E70C 4NL4H 1J2JA 3DM9B 1Z0JA 4QNMA 1FNMA 1YJ5A 3QSYA 5FI0B 2QBYA 1ZUIA 4IOJA 3CNNA 4Q1EA 5IRCD 4DLTA 4Z8YA 1G8GA 3PUXA 3QOFA 2NMVA 4BEJA 2CCGA 5GVSA 2GBLC 4LJAA 2DHRA 1W47A 1L8QA 1ZUHA 1MRNA 1XP8A 2H5EA 2ZJAA 3AVVA 5FL7D 2RAPA 4GOJA 3TQCA 4TMTA 1CU1A 2HJVA 2B6HA 4DT1A 2F1IA 3P4YA 4R7ZA 5FBQB 2OFOA 1IHUA 1ZMXA 5D3QA 3C4JA 5DE3A 4ITRC 1RPZA 1CJTC 2BMFA 2QI9C 1Z22A 5DSZA 1W5SA 3IQWA 3RABA 3EZFA 1OKKA 3IBYA 4CF7A 1OT3A 5LB2A 1U0HC 5IDVA 1XJ0A 1S4QA 4FD2A 3C15C 1SULA 3RRNA 1KSJA 1WXQA 4A4DA 3SJBA 4BE7B 4HAXA 1P4SA 3SJZA 4PPQA 4CT5A 1W36D 3I1FA 5LD2B 1GNRA 3NXSA 1QG4A 3GEIA 821PA 2HEIA 1LF5A 4AKHA 2QU8A 2QUZA 5LPNA 1XTSA 2ZETA 1JR3D 5TB5A 3OIYA 3AQ4A 4D0NA 1ZIPA 1HEIA 2CXXA 4PPNA 3CRVA 2PZGA 3IKJA 3QVVA 1IJFA 1NVWQ 1RVDA 4EPYA 3P26A 3M6AA 3D7MA 1X8LA 2W2XA 4NCJA 1TL7C 4P3YA 1KYIA 1G4UR 1OH6A 2D06A 3TJZA 1RKBA 4GPTA 4MYTA 2VP6A 2ZAOA 4FCWA 3LAWA 2O8BB 3G0HA 2CK3D 4TT3D 2IW3A 4RFVA 5B57C 2EQBA 1W1WA 4PO9A 4X8MA 1II8B 1KJYA 3GJ3A 2NOAA 1P9WA 2ZJ2A 1TTTA 3SYLA 3MLEA 3Q8XB 4KHZA 5CYPA 3NH9A 1EFCA 2C95A 4XVUA 3O8BA 2DWPA 4JLAA 3BE4A 4B33A 4BLTA 2QT1A 3U6BA 2O8FB 3I3SR 1Q12A 4KXFB 2Q21A 2DYKA 4POAA 1HT2E 3U7FB 4LWZA 2YWEA 1ELOA 1S8FA 1VCOA 2W6JA 3QG1A 4M1KA 4NDZA 5DIFA 1AJEA 3LRPA 2ZSAA 4FXPA 2BHRA 2WJGA 4D6PA 3W9YA 3BXZA 4NKRA 2XNSA 2B21A 1EFHA 2BBWA 4UKDA 3EA5A 3ZS9A 2AX4A 3TIFA 1BYUA 3OHMA 1E4VA 1OXUA 4GMDA 2ZSDA 1ZD9A 1DS6A 2CK3A 1Q22A 4JVNA 4DLRA 1EFRD 3T1TA 4E5UA 5C4GB 4Q4HA 1XCPA 3GPLA 2ANCA 4XJXA 3SFVA 3L2OB 5FUVA 1W0KA 3FB4A 3UKDA 2ZIAA 3LH5A 3PR1A 4W5WA 5FUYA 3N2IA 4YONB 1SZPA 2RH5A 1XMJA 2YHSA 4LBWA 5AR1A 4AIIA 2PCJA 1NF3A 1QZXA 1E1QD 1LV7A 4IDOA 2ZANA 1Z2CA 1DADA 4DRZA 3CIOA 3K9HA 5GADl 4IDQA 3I72A 3VQTA 3EZ6A 2O8EB 5CDFA 1UBFA 4EDHA 4XVQA 4TL7A 2X77A 5FTJA 3GLHE 2JAQA 4UXJA 4IKEA 3BH6A 2G77B 2WIAA 4GZLA 4LDJA 3W3AA 4HB0A 2VH5R 4JLOA 4OK5A 4Z8XA 4FWTA 1WE2A 3VKHA 1QHIA 2NO9A 3BGWA 3FMOB 1LFDB 4H9GA 3OE7D 4L8GA 5KDLA 3KTAA 1Q3TA 2AK2A 3BS4A 4V0OA 1JXOA 3CF2A 3RVBA 4ZDIA 4HUTA 1VG1A 3UWKA 1E32A 1U8AA 2R9VA 3B78A 4DHEA 5KPDA 3GJ6A 1EGAA 4OQMA 5LB4A 1KDPA 3THOA 1SVMA 2ODNA 2QPOA 1P2UA 1S1MA 1KNQA 1ETUA 2H92A 1KK0A 4HYYA 2G1JA 1NKSA 3T1VA 4A2WA 2J0UA 2QM7A 2GXQA 4UQOA 1N6HA 4QC2A 2D7CA 3BH0A 4P31A 2EWVA 3ADCA 1OFHA 2CLDX 1CR0A 5FOUA 4JBYA 2C9OA 3WNBA 2NO0A 2FPLA 3DOFA 5L3QA 2CVFA 2KBEA 3ZIAD 2HT6A 2C5LA 5F2EA 1T6NA 2W6ID 5G40A 3RS0A 1OJLA 2CNWA 4G01B 4DCUA 4Q7JB 1ODFA 4ZCLA 4EFMA 3RS3A 3C14C 3PEUA 4DIEA 3TSOA 2LCFA 1N0UA 4PSVA 2FGJA 3R9WA 1R2QA 2BJVA 2QTHA 4FWIB 2WSSD 3OAAA 4PAOA 1II9A 4PHGA 4XD7A 2O8CA 4KFRA 3VKWA 4IW3B 4URXR 1MV5A 3K0CA 4G3XA 1Z29A 2BCGY 1R5OA 2ZUBA 4JVSB 1E9EA 2ZS9A 1W4BA 4EKDA 2RGNA 4M1OA 3IHLA 3KZ1E 3AP1A 3NG1A 1Z6YA 2WV9A 1Q1ZA 5EXXA 4DCNA 5C2JB 2E1RA 1XD9A 2FFHA 2R2AA 3U44B 2CHQA 3A1UA 1NP6A 2NGRA 1FQKA 2VO1A 4BFYA 4BLQA 1JR6A 1RE0A 3W8NA 5JFGA 5C46F 5BYJA 1KK1A 1EFRA 4NE2A 1O87A 1S3SA 3R9XA 2AFHE 2F1RA 1KI3A 2P6RA 4DLVA 5GVRA 1W36B 4L5BA 4S2EA 4FN5A 1FW6A 2RGAA 4O3MA 2XJ9A 3L0SA 2VHTA 1Z6AA 3MG9A 1N5IA 4YXWA 1XZPA 1JEDA 4CW7A 4IFBA 1XDBA 1W2GA 2QEQA 1TQ2A 4QNRA 2HCBA 2X8AA 1E4YA 1ZM7A 4I99A 1DEKA 3GLFE 2FA9A 4WZAE 3SQXA 1G4AE 5HPYB 3I8XA 2WMNB 4UNQA 2QTVB 2DFLA 4ASUD 2QP9X 1JALA 1FTNA 4YDHB 2CHGA 2QPTA 1CJUC 3H84A 3A1SA 4D2IA 5BN3A 4JMPA 3U3OA 1N6KA 1CR4A 4HLDA 1KZ7B 3A37A 4M1WA 2C78A 2FH5B 2F6RA 2G6BA 1A4RA 4LBVA 1U90A 3TW8B 2VA8A 1X3SA 2GBLA 1N6RA 3T12A 1SXJE 4N3NA 3Q7PA 1E79A 1Z0DA 2GEUA 3GLFA 2BC9A 4UNRA 1T8UA 2XSZD 5FUWA 4G0NA 2ZRFA 5GJBA 2H16A 2VF8A 4W5HA 1OFUX 2VHJA 1VDZA 2PLRA 4KBFA 3TSWA 2R6DA 1R0ZA 3KFVA 4BLOA 1R5BA 4HDCA 4UNPA 2ZRAA 4RZXA 1G1MA 4CIDA 2XOKA 1KO1A 2VHCA 1L2TA 2KI5A 3N70A 1E2NA 4FMBB 1ESNA 2ZITA 4M4SA 1WA5A 5AUQA 2VP5A 2O8DA 3EWAA 1HQCA 1A1VA 3B1VA 3BC1A 4HDOB 1A7JA 2DBYA 2JIZD 5DN6D 4KVGA 1U0JA 4QM7A 4YMWA 4KODA 4TLAA 2AK3A 3AF3A 1NSFA 4TQAA 2QROA 3QI2A 1XEWX 1AGRA 3EG5A 4A0HA 2ZJZA 2LKCA 4LZZA 1E79D 1L7VC 1JBKA 2VHUA 3PUVA 4WAUA 1IN6A 2XSZA 5A5GA 5FPHA 2F3RA 4QL3A 3PJRA 1HUQA 5CB6A 3TVTA 2HLDA 1U0LA 5F98A 2HUPA 3VKGA 3AVUA 4B44A 1LVGA 3K0FB 1Z6GA 2OFXA 1CR1A 1ZAKA 4DLYA 4UJ3A 2VEDA 3DDCA 2QAJA 3KKQA 1RIFA 3DHWC 4JSYA 1VHTA 4G5QA 1AZSC 1GRNA 1NBMA 3QJYA 3QKTA 3W8RA 3SS8A 2GXAA 1G7SA 3JVUA 2GHIA 4US1R 3T5GA 2BV3A 3QVUA 4MKFA 3P32A 4TMZA 3LBHA
chains in the Genus database with same CATH superfamily
2QVXX 4QDUA 3UWPA 3KZXA 1G8YA 2PBRA 3DDSA 3A1CA 3RO7A 5LZ5A 4EG1A 4S35A 1BHQ1 5I4CA 1RDFA 4MGKR 3K2QA 4RLHA 4ZFNA 5IT9A 1PUIA 2PUDA 4H18A 1U8YA 1Z5VA 1KK2A 1NW7A 4CHGA 3SVZA 3B7GA 2VJBA 3KEOA 3PHBE 4FTWA 5J2UB 2Q0HA 3W2GA 1KKMA 1NLUA 1JIVA 4CKXA 1Y8QB 1IMJA 3HXLA 4HN9A 2EWWA 1H8HA 3PUIA 4JKOA 3EZXA 5JJIA 2AD5A 2FUEA 1C3LA 4I50F 1W36C 3PRHA 2P5YA 2QRJA 3RU9A 3RNOA 1Z28A 2OKGA 2GNAA 2NSLA 2I0FA 4NYJQ 3RUDA 4MB0A 1EX6A 4QPZA 5ADVA 2RGBA 5IKPA 4IV5A 3UFXA 3E8MA 4Y2JA 4EUNA 1M2FA 1U81A 2BZ1A 1P7ZA 1KH1A 1ML4A 1PSWA 2KX7A 5B7QA 3NHLA 1IB6A 2G1AA 2HLNA 1AUOA 4I4IA 4X8HA 5AUNB 4G56A 4O4IB 5BQPA 5H68A 4BQEA 2RGRA 2AOTB 2BR3A 3AONB 1G5PA 5DULA 5EZYF 2I2DA 3RT7A 2C94A 1EX1A 4E5DA 2WP8J 2O2GA 1O5OA 4B1FA 3ESXA 1J8YF 4MMZB 2X9QA 1ISSA 5E38A 3W5IA 5FBHA 4D1YA 4RABA 5JNUA 2WP0A 2IDMA 4ZYUA 1OYYA 2BFNA 2OAEA 2Z2IA 5AW8A 4KLZA 3GCWA 4H7DA 4J91A 3WIDA 4GOKA 2RI0A 1Y7LA 2OFFA 1YTUA 4CQMA 2VQDA 2XX3A 4UD6A 3LBAA 1CUEA 4WD3A 3ZE1B 2Q27A 4F71A 3MB5A 2B4KA 2G28A 3DMDA 1A9XB 3E7XA 4RY0A 1SXJD 2VUIB 1RRFA 4HO1X 4JB2A 1PQWA 4NAUA 1UKZA 2CBZA 1VMAA 3WWPA 3LOQA 1PFKA 2CXSA 2BFBA 2IE0A 2RCNA 2QN1A 4LA4A 3H9EO 4Q7LA 4V39A 3V48A 5HZKA 4HVTA 1P45A 1NPTO 1BC5A 1PK9A 1QTIA 3TLAA 3T3MB 1L4HA 2CEAA 2VTVA 2Z0MA 3HC7A 4BHTA 3ZHXA 2DHQA 1GUDA 2ZRDA 1NVUQ 1AQUA 3MJCA 1YRLA 1TYEB 1OWMA 4JSTA 4UCFA 2ATCA 4K86A 2DWUA 4JXZA 1P2DA 3C3AA 5DT2A 1JEYB 1KIMA 1ZPDA 2CNWD 3WQSB 4B40A 1ULAA 2PHZA 1XQXA 1Q20A 3F78A 3MWGA 4FYXA 4KJZA 4Z54A 1RJ9A 2WJ4A 4JP2A 5FWYB 1NF8A 2JGAA 2DY0A 2ECFA 4P08A 4FNGA 4J0IA 3K0FA 3LUGA 2QZSA 1E3WA 5GONF 3FNFA 4NONA 1NTOA 2DHEA 3V8VA 4YUVA 1WEHA 2HPZA 1FXWA 1ZOOA 2CNBA 2ODBA 2DBRA 3ACDA 2BDUA 1WPQA 1FJ2A 3PNQA 3T1NA 3T7AA 3AL0C 1EK6A 4HBZA 4IIGA 1KDZA 5ALSA 3HEMA 2AF3C 2IK8A 1G8PA 4Z4GA 2PZBA 1QZTA 2W8ZA 1C7IA 1OPXA 3UK2A 2CLHB 1UFRA 4IJ6A 5K8TA 2YCBA 4MQLA 3CH4B 1ZXLA 4WCFB 2JGNA 3B8HA 1NTRA 2EKQA 4LZLA 5U4QA 3X3HA 2VTBA 1PYDA 1JEAA 4JX8A 3EGIA 1LDYA 1UAYA 1FTQA 3B3JA 4O4HA 1QHYA 2X8LA 5LP6A 1O54A 3KXLA 3KPJA 2ATIA 4IJMA 3ZBPA 3OOEA 2HPVA 2Y1GA 3ASVA 2XD9A 1AS2A 2ZQYA 2XWSA 5JSKA 4DLPA 4A2PA 2BFAA 3OM0A 4WCFC 5HIAA 4MS4A 2HK6A 4UPDA 3THYA 4U8GA 3RANA 3UV3A 1WNTA 1P39A 3E48A 3QVGB 5EJFA 5BT8A 3ZGZA 1B76A 2FETA 3M6LA 2DQYA 3ZHQA 4WLUA 2R1UA 3SC3A 2WJPA 3INGA 2KJQA 1TVEA 2AFVA 1E9VA 3ZJTA 2Z4SA 1O7JA 3P9YA 4XQCA 2R60A 4WQMA 4DNOA 1Q6YA 1YR1A 2BGRA 4JL6A 1DKQA 1TPZA 2ERYA 1HH4A 1E5VA 3Q5EA 4IQ4A 4MQBA 5JWOA 5DGXA 3I8OA 4FD3A 4LW8A 2QRVA 4P3NA 1PWEA 2EX4A 3BK2A 1DQZA 3X1YA 2OENG 2PZMA 3M4XA 2H9IA 4L4UA 5KKAA 1GJRA 1ZZGA 3MAAC 4QKQA 3TBKA 3THWA 5MF6A 1RJFA 1XZ8A 1I2ZA 4B83A 2DQZA 3LFTA 4PTLA 4RA9B 5FEMA 5H80A 3QEAZ 2PWZA 1E3IA 2RGNC 5U9CA 2GBPA 1DRUA 4E09A 5JAQA 5LXTB 1VHQA 1ZD1A 2YTZA 1ZSYA 4LAFA 3J7AC 4LGYA 2Q5FA 2FCRA 4C3OB 4DQDA 1Z07A 2JAXA 3H86A 4IINA 4QJBA 1RJWA 4QFBA 3UMMA 1EDEA 1GA1A 5E3IA 5JBNA 2X7XA 1DIRA 1D2AA 1ISGA 2ODQA 1E66A 1JDSA 1ECBA 1PJ3A 4FYMA 4HFNA 1C30A 5JVDA 4EKIA 3CVXA 3GRZA 4BC0A 4X1KB 4RORA 1KF0A 3BFJA 1JHPA 2W11A 2WTMA 4Q02A 3AILA 4ZGWA 4P8RA 7YASA 2DFKB 1N0HA 1ORDA 1GQRA 3WJ1A 2QLJA 2NT4A 4AMZA 4CDGA 1EHYA 4I1IA 1EGVB 4BMPB 1H0KA 2XWJI 4N76A 1F5NA 1W0JA 2CXPA 2J3KA 3OKAA 4RCYA 4IOLA 4AW9A 1GITA 1WEKA 5JARA 3IPRA 3UK0A 1U8UA 4GMFA 1KHTA 2OHVA 4IIBA 4BX3A 3QBVA 2IU4A 1FFXA 4FINA 3A4MA 4JOCA 2AMFA 4M0UA 1HG0A 1Z16A 1J2UA 4JJAA 2LV8A 1CZHA 1I8TA 3CRZA 2BGKA 3V5NA 3FVQA 3C3CA 4G81A 1LDGA 1RPAA 1QH1A 4J3NA 3S1LA 3WMXA 4TWRA 1RKXA 3TNJA 2QG6A 1CKEA 1ACJA 5ESDA 1UPXA 2OQIA 2VJMB 5EMJA 3PGA1 2XE8A 2C4HA 1ZJ6A 3UOAB 2C58A 4QJIA 3CH5A 3DE6X 3QBTA 1PDOA 2A0KA 4YJGB 3Q3CA 2AMJA 1SXHA 3M6XA 4JEMA 4AUMA 4DADA 4DYHA 2OT3B 1QH8A 4I6JA 3ZN2A 1WOYA 2X23A 4D92A 2H1WA 1EWRA 4HN4B 4BOYA 4U7PB 3R6LA 1W9HA 3CZ9A 3GT4A 4PNPA 4DR1B 4NAVA 3PNKA 2R3SA 4MR8A 4AM8A 3WLAA 1ZAYA 5BQXA 1G7CA 4BQRA 5IZ4A 2FPSA 2I76A 1EVQA 4PU0A 3D3QA 3DUFB 3JQ7B 4LJ5A 2AFIB 3KZNA 3QWIA 4LF7B 4OLFA 5AI5A 3LVFO 4UTZA 1DG1G 2EFDB 2QDKA 5BWLA 1Q7TA 4NZ9A 3WK8A 5BPFA 4L75A 5E4TA 5CXXA 3JPYA 4FSXA 3AKDA 2A88A 3OZVA 5SICE 5K5EA 2D7DA 2Z3WA 4AROA 4TL8A 1N7HA 4J2TA 1ECFA 3ROGA 3UJDA 4DMCA 1PNTA 1SQGA 4Z2AA 3MWKA 1FFSA 5AICA 4ALJA 4ZT5A 2V1UA 2WJYA 2ZUDA 1MH1A 4YDQA 3NVDA 2A0YA 5TT1A 2VT7A 3E58A 3ZZ1A 1PV4A 4WLNA 2QN8A 5JLJA 3I64A 4EDFA 4G26A 3GOHA 2I6SA 3PFBA 4P86A 721PA 1P18A 3BK7A 4Q48A 4RY9A 4CNBA 1FDRA 4TZ0A 3CURA 3D6JA 4PZPA 3H5LA 3O4IA 4FGZA 2C0PA 5DF1A 5FB3A 3EXHC 2DB3A 3LOUA 3AKEA 4GOMD 3HP7A 4JI0B 3GFVA 4M46A 1GVNB 1Q3HA 1XK6A 5CW2A 5DBIA 1JDNA 5BSRA 1I7PA 5AO9A 3WRXA 4LVUA 3TAHA 5KSWB 3JQ8B 2BHSA 2A1UB 2M1XA 3MWJA 4G65A 3BORA 2VPQA 3N0RA 4I2NA 3NEYA 4KXVA 4RSMA 4HB4A 3DOCA 4UAUA 3I8SA 2P35A 1MEEA 3O8CA 2JKYA 3FR7A 5IM5A 3RDPA 4ZJUA 1U2DC 2W83A 3LF2A 4ZDWA 2JFBA 2I67A 3HEAA 1G60A 4KO8A 1GTRA 3Q3JB 1K1EA 3FF4A 3LQKA 4S1TA 2WG1A 5U4XA 1YB2A 3WC4A 3WZ2A 3C4QA 1KEEB 2J67A 4M9ZA 2Q45A 1U3CA 3DAOA 4LRUA 1OGIA 3JS5A 1C30B 4JP1A 4O4LA 3MCZA 1N2IA 1P61B 5CVJA 3OECA 3A6ZA 4L3VA 1MJNA 1WDKA 1Q0LA 1QGOA 4JC8A 1OH7A 4Y6LA 1DTEA 3SJ7A 3NHBA 2JLAA 3FBWA 4LHVA 3IQDB 4GEGA 4RKEA 4O2AF 1R4NA 2ETXA 3GLGA 5KAMA 1PGQA 1E98A 1HYEA 3E23A 5KVQA 5L4LA 1DE0A 2Q5HA 3JQEA 3TS1A 2P9QA 3G8CA 3UHJA 4B73A 5IN4A 3VDXA 1ZM2A 5I4KA 1E4EA 2B36A 4IGKA 1OREA 2QRQA 1XCLA 4LXXA 1M67A 3TLZA 2CSUA 1ZL0A 2E1PA 3PR2B 4KTVE 4KUHA 2GHQA 4UBLA 1UFOA 4NYJR 1WZNA 2VRWA 4JLJA 5TSDA 1DBVO 1F8YA 3BX1A 3WBKA 3FKSA 4Z4FA 1MF7A 5IC5A 3IBFA 3LHIA 3O95A 4K9LA 1XT6A 1V9CA 2WZCA 3EA0A 4CM7A 5IDWA 1YK0A 2ICAA 2IDKA 3D3EA 3DO6A 3RHFA 1A2QA 2AFIE 4I1VA 5B12A 4CM1A 4LPKA 4JKIA 2O9JA 1SHTX 3KSUA 3D3WB 4E14A 4YROA 5BN5A 5KTYA 1TX4B 2Q62A 3KETA 1O94A 4PLCA 2V3VA 4ZTBA 4BO8A 3CF4A 1SBHA 3ITKA 4J43A 3VFDA 1DQNA 2BPOA 4HPXB 3H8JA 5HS6A 4GXNA 3CB2A 1G21A 4BX2A 3RC8A 1JG7A 2CZQA 1T6ZA 5A62A 1CFZA 4NNPA 4QDOA 3G68A 4ZVMA 4QLOA 1YOBA 1RMQA 2I6XA 1PNRA 3UUFA 2FG6C 3WWCA 1XVAA 5BWBA 2O2ZA 1UEIA 2RAVA 2VQSA 4WCVA 2PD4A 4D97A 2OHOA 4L8WB 3P9IA 2WJJA 3PC8A 3OZCA 4GM1A 5ADUS 1PO7A 1HR0B 1EJ2A 3EBPA 4Q9JA 2H8GA 2VK8A 2ADOA 4CLEA 2WDPA 1JG6A 2NWQA 4B4OA 5BN3B 1UM9B 3QKWA 2C7QA 2G4CA 3D3KA 4QU8A 1XTQA 4BZQA 1W4AA 4X84A 4XYGA 5JSQA 3R7BA 2EKLA 3H1EA 3UMSA 2CMKA 1G7TA 2EEZA 3O84A 1Y4DE 1Y63A 1ZLYA 1GN8A 4J7CA 4NK5A 2IF2A 4R1OA 5F77A 2RBGA 2E18A 4B17A 1WKBA 1B4DA 5B5SA 2X3UA 4C3VA 5EN4A 4E5VA 2GHTA 4I9FA 2Z5LA 4LI3X 4XDZA 5JANA 3W34A 1JKJB 3DW3X 1RRGA 1JECA 1TTPB 1U5BA 4B7AA 4DC0A 2G8NA 4EKYA 3N39C 3ROZA 3KVOA 4JELA 4LY3A 3STTA 3EIOA 2PJRA 3FSGA 3CFYA 3G7NA 3KFXA 4I4TF 4EI8A 3K35A 1V4BA 3T5TA 3RD5A 4E03A 1UK6A 1X1QA 4IIJA 1E7MA 2B1GA 3HO8A 1BEUB 3TE7A 3UG6A 1TZMA 2AG1A 2V6FA 4P54A 4AJKA 1QONA 1CDDA 1GLNA 3DEFA 1NV9A 1KO8A 3RYFB 5P8WA 5LA6F 3GN1A 1F5SA 2AZ4A 2HBQA 4XH9B 1GARA 4ZALA 4JODA 3HCOA 1SG6A 3ZZNA 1UXKA 2C98A 3O5AA 5FFMA 3UT6A 4P53A 2TYSB 1ORTA 2G0AA 5EXSA 3WK6A 1NC3A 4RPIA 4EMTA 1O4WA 4ND4A 4ARSA 3AERA 3JQ9A 4RY2A 2YXDA 1DEXA 5KYNA 1YRHA 2IEYA 1P0PA 1NE7A 1AHIA 2APJA 1SCQA 3T94A 4DV3B 3HVUA 5A3JA 1LV8A 4YLGA 1JR4A 4XYLA 4ALMA 2BONA 4IWYA 4C07A 5JSHA 5TLSA 3FNHA 1N5OX 1YFKA 3GFGA 5T4FA 5KQSA 1SCBA 5YASA 4OH1A 4M1ZA 2DAPA 4A6PA 2XB8A 5JZ9A 2GLXA 4HQ6A 1R4NB 4BBPA 3FMPB 1XSEA 4ZCQA 1EWYA 3F7NA 1J8DA 4DNFA 1H2YA 3TCXB 2WTUA 5DMHA 3P9SA 1R8SA 2NVBA 1H05A 1S01A 3UFXB 4BVAA 3LUKA 5BV1A 1XWFA 5LJLA 3BTSA 2XCOA 4GSLA 1C9NA 2R79A 5JPIA 4AJIA 4DKJA 1UC9A 3H42B 3PA6A 1J39A 1KH2A 1XJCA 2PX5A 3IAM6 2QMEA 1PFUA 3NTVA 3QHAA 4BLRA 5JRDS 3A2KA 5JS8A 2B0CA 2NVUA 2NTEA 4B7XA 4HT3B 5IMBA 1Z06A 1KP9A 1KFBB 2MR5A 5KB3A 4L0DA 3QU4A 4JLKA 2E87A 1BXGB 1LB1B 2EJUA 2HSEA 4LJRA 3CA8A 3L93A 4D4MA 3EQ7A 5B3KA 1Z4MA 3W7BA 2B4RO 3FD8A 3WLKX 4B2PA 2HBRA 5ILQA 3W2FA 1K88A 1G5TA 1IXRC 4LF4B 1QPBA 4GOXA 1F51E 2F3SA 3ELUA 4O2BF 2OECA 3ESZA 1Z6PA 1OBCA 4MIYA 4TV8F 3FCYA 3H2KA 3PPWA 4LF8B 4MIKA 1FVOA 1Y8RB 1A9PA 1R0BA 2FRXA 1O95D 1KY4A 3GFFA 2BELA 3LK7A 5JXGA 3OIFA 2VDOB 1A76A 1XPUA 1DKPA 2H54A 4QEKA 5FWXA 4JJKA 2WQ6A 1LDEA 1CUAA 1XAJA 3ZKWB 3AIMA 4KYTA 1BNCA 1I13A 3I62A 2A92A 3O92A 2P2YA 4B32A 1H94A 1M2VB 5I7EA 1A98A 4NE9A 2PX4A 4K26A 4IDPA 1Z5WA 1AG9A 3UOGA 3C2QA 3PXXA 4R9UC 1RR6A 1KOJA 3LLSA 3WBJA 2PUFA 2PTHA 3KPVA 4CKCA 3HS3A 1P6UA 4CU2A 5IASA 1V2HE 2YX1A 3F67A 3QXJA 3NHFA 3PHLA 2NZJA 1Q15A 1Z35A 3S8MA 5JHHB 3I2IA 5K4GA 1ES9A 5CIWA 3IAAA 5FI3A 3KLBA 3ZHRA 2WF8A 3FSJX 4FKZA 1JHRA 4KKXB 3PK0A 3NASA 2QSJA 1ANKA 1CY1A 1J97A 3F98A 4JYBA 5KSYA 3LYLA 4RENA 3DVAA 4JL5A 5AHXA 5KYYB 3QBDA 5KNBH 3OPQA 4OFWA 2VF7A 4NFHA 3TLMA 4CRWB 1X1TA 13PKA 1QFJA 2FOIA 3D6NB 2BBOA 4CQLA 1NJ5A 3TZKA 3KQLA 4GLFA 5G0TA 5G2OA 4A8JA 5EHIA 4CETA 3NC1C 2XE7A 4J7AA 4G1EB 4B6OA 2VSQA 2B83A 2QYOA 2BFEA 4FMDB 5EJAA 4Z7OB 5L45A 4GP9A 3T3OA 3OMXA 4IHJA 5KX5F 2XTNA 2Q3CA 2OK7A 2FFAA 1IQUA 1RI1A 4C4RA 1UFQA 5CLQA 4X6XA 2ORYA 1JHQA 3AUTA 3F7OA 4G0QA 4ILKA 3WA6A 2V1XA 4H0CA 1QH8B 1P8JA 2HKIA 2WU3A 2WOJA 3RS5A 4X64B 1QYVA 4R41A 4A2QA 1J06A 4WLEA 5COAA 2XYQA 4HWRA 1NBME 4LHZA 4X1IA 4BXOB 3GZ4A 4NYIQ 1ENPA 4X54A 3VZBA 1AO3A 1H0RA 2O0HA 3N53A 3UJCA 2M32A 5IWCA 4FYYA 5C3UA 3BB4A 3MVEA 2ISQA 3QLTA 3OH8A 1ZK0A 5K4AA 2SHKA 4G4GA 4N03A 5F2OA 4OQQA 3S7ZA 2EX0A 4W82A 1AXGA 3NEPX 3T3EA 4XGNA 3AUKA 1DBQA 2RHGB 2BKAA 4GQAA 4C7VA 1GSIA 3MEQA 1W7AA 4AYTA 3JWPA 4NBUA 4OIFA 1NJFA 2ZUWA 2P9JA 3I42A 4MS1B 2AG8A 4MV0A 4D80A 4EVQA 4WZBE 3L0CA 3A6JA 3R7WA 3KB1A 5L3SA 1AHPA 2YWXA 4GI7A 3JQFA 5CK5A 3AR2A 3T9AA 3CR8A 1XZDA 4UREA 4PRYA 3TUJC 1QVVA 5BSGA 4IP0A 5I8ZA 1DKRA 1PV2A 3O3OB 3RYIB 1VOTA 3S70A 3OFNA 1DAIA 1OGJA 2G5CA 3IIJA 1FFEA 3EWNA 1ZD4A 3IPLA 4G5YA 3SLRA 4BZPA 4F4JA 5CAEA 2IH5A 2EJCA 5K8UA 1AURA 3BE8A 2HW8A 2Q6TA 3IA2A 4QDKA 4XARA 2OSVA 1ZOSA 5JT1A 1EFVB 1MNQA 2VCEA 3EYWA 5EJ5A 4Y9SA 3O7WA 1RYFA 4BCBA 1UT8A 2J1LA 4YH1A 3IDAA 2ZE8A 4Z53A 2FV8A 1F2VA 1SY7A 3E9QA 4I4NA 4ZMBA 2GKSA 1R6XA 5EHGA 5F52A 4BMNA 5T6BA 3PC4A 3RTEA 2Y0PA 3BA1A 4GAEA 5EZYA 2J3JA 2RBEA 1KOFA 2ZVJA 1ZU4A 3G6KA 4J4HA 4H1WA 3L18A 1VXRA 2WZQA 5DLQC 4Y7DA 5CDFE 3E05A 1NMEA 1Q74A 1RJDA 4L73A 5B55A 4JI2B 1FYVA 2HWYA 3VSAA 3DUFA 2I4MA 4OA8A 4WK0B 4AY3A 2Q7XA 1GDTA 1NUHA 1X7GA 4CYMA 1A4UA 4EB3A 4GBGA 3JQAA 4EJFA 2VDKB 1L4KA 3W3AH 3BGVA 2FE1A 1ECLA 2FEKA 2ZSUA 1YI8A 4GI1A 3W9SA 2QJOA 2FWAA 1Y6JA 1ENZA 3SF8B 1NNI1 3UWOA 5LZ7A 2GA8A 1UQTA 1Z62A 5L3ZA 3DAHA 2FX2A 2RGXA 2PY6A 2VHEA 2IYNA 3G6WA 4EW2A 2CUNA 3I04A 4M36A 3QUQA 4E0BA 1JEQB 2PL5A 4G1MB 3G2OA 5EWMB 3FTEA 4OUKX 3PI6A 3ZQ6A 3H7AA 2XV1A 3VR4A 2V55B 4EF6A 1JIJA 3GUUA 1MX3A 3HPQA 1WY5A 4P36A 4Q7QA 1H2AS 3SHOA 4ND1A 4MMXB 1NNUA 1X9HA 3Q8WA 1GOTA 1UZLA 3E81A 2FW0A 4LZAA 1FBTA 1R74A 1ZI8A 3PJFA 3UK7A 4E2ZA 4L16A 2W2TA 3O26A 1J25A 4QWMA 5FJJA 5DOZA 4XEHA 5BR7A 4ZARA 2YHAA 4EPVA 4QUAA 1YR2A 2XHEA 3Q7QA 1EX9A 2YC4C 4BLSA 2BBSA 2QRGA 4K3UA 4C0AC 3C3KA 1QIMA 3AVOA 3PC3A 4BV8A 2Y9MB 3JD1A 3ODPA 4GQBA 5EZ5A 4YDRA 4MRRA 3PWSA 2PX6A 3FIUA 5ERXA 4AXXA 2QGFA 4F60A 3AEUA 4PQRA 3VNQA 1E8NA 4RV4A 5FBVB 3IEUA 4X65B 2R1VA 5CH3A 2PWPA 2IYPA 3NONA 3L7LA 2OZVA 4P3KA 5A6SB 3K70C 1Z6QA 3HGQA 1QHSA 1PR4A 1PVDA 1MR3F 3AMVA 3TZQA 3LQQA 5IK2D 4KQEA 1R6BX 4GPAA 3V7WA 2PRIA 4GOLD 3T7RA 3PQFA 2V0NA 1JHYA 1K86A 4QUJA 2A3NA 1NLMA 4K0KB 3AGQA 1JVSA 4L85A 4NH0A 3GBPA 4UVIA 3ORRA 1J5EB 2PXXA 2OXRA 4GGOA 2UAGA 3L1JA 1A88A 3HHEA 5JEEA 1D0SA 1WLSA 5ELMA 3TR0A 1I6WA 4BB9A 3GR6A 3UIEA 3AF0A 1YFLA 4Y2PA 2QKYA 2OOKA 1TD1A 4ETIA 1FY2A 4LPSA 3LZ6A 1GAQA 1NBOA 1NIJA 1QH9A 3AJAA 1QIFA 1YS6A 1T4MA 4WUTA 1VKRA 4L7QA 2MWMA 3CS3A 4YXWD 3G2QA 1YDWA 4LDQA 3OHSX 3UT0A 3ZWKA 1UBNA 4OQ4A 4ALIA 2V4ZA 3KSZO 3IXLA 4WASA 4AKTA 4CLXA 4DWVA 1LC3A 2AUTA 2PMFA 3I0ZA 3OZTA 3LE8A 3E5MA 2VNIA 3R6DA 2GKGA 4QGSA 1H4TA 1L5SA 5TRTA 3ZDRA 3WLFA 4LYHA 2ZYUX 1X39A 1OXTA 4RGBA 4ZZ3A 3JQAD 4DEXA 4C7OA 1LDNA 4D8VA 1YZLA 3O3MB 4IDCA 2P65A 3BWVA 3DZHA 4IH4A 3RODA 3D5TA 1KAMA 1I36A 2PYZA 4N54A 5CJPA 1J56A 1JHUA 1QOQB 2H59A 4RD3A 4C6HA 3PQCA 2RAUA 5FPKA 3NDJA 1IN8A 3VYSB 1EM6A 3ISTA 2CHFA 3B6ZA 2QP4A 3LPAA 4LYAA 4JI4B 1CIJA 3TOXA 2PMWB 1U1DA 4TKUB 3WKDA 2YKGA 1DIBA 4L5CA 2XKBA 4IAOA 3GLGB 3DUWA 4OQEA 4NABA 1BHO1 5EHZA 1RBZA 2X2PA 4EEXA 3PT9A 1YIAA 2OLJA 1TRKA 3ADDA 3FHTA 3H2GA 2MMCA 3T7DA 1YJAA 3O73A 3W90A 1MPTA 4WK4B 4XCVA 5K0FA 1OZGA 4KYVA 2C5FA 6AT1A 2REQB 2HSZA 3VR3D 3WIBA 2N3ZA 1GADO 3ETNA 3E27A 1GNSA 4IUBS 1IULA 3ETGA 3EXAA 4BVEA 1U7UA 1FS5A 2A30A 1J2RA 3PDWA 2IP2A 4PQFA 4TVSA 1FDWA 3BD9A 4TZKA 4ZHQB 1IWPB 4JCCA 4W7IA 3STVA 2PMBA 2GESA 1CVLA 3IR6A 4KDFA 4XPIA 3IP5A 3RC7A 3WZLA 4ENTA 5JH7B 6ADHA 3EVEA 2XAUA 3D02A 1OB5A 2EIXA 3O1IC 2X2EA 3WAJA 2DTXA 3MJRA 3CV3A 4P7FA 4LQ4A 5AQEA 3MGAA 3TWOA 3LKVA 3KKNA 5ENDA 3CTMA 1H2RS 3SEAA 5EP2A 1LVHA 4R1SA 1FLAA 2XR1A 1IOWA 4CIAA 3LQFA 4WNCA 3JQGB 2VPWA 4UHBA 3OEHA 3H0CA 1ONBA 3KCNA 1KZ6A 1PNVA 2VXBA 5DBHX 5AVTA 3SMVA 3KRTA 3IILA 3SJCA 1DT3A 4UTRA 1KPGA 4B5LA 3AXTA 5A7FA 1E1RD 1QO9A 4N82A 3MMZA 2R6R1 3LSYA 2O3UA 4ZPJA 4NCNA 1C14A 2V7XA 1IEQA 4U6QA 2NYRA 3EMVA 2XMSA 4G2TA 3O2JA 1IWOA 2HWWA 5HZHA 1DTWA 2I7XA 2BEJA 5IHPA 4KXUA 2WYVA 3TOSA 1KERA 4IZHA 3HCNA 5M5BA 3E1GA 3CKLA 4FJ2A 5FBKA 2AJLI 1LI5A 4ZKEA 4H3HB 4XOIA 2L2QA 4HUJA 4NS4A 1SQ0A 1DC3A 3AVQA 3FFWA 3O21A 4I8DA 1CP2A 3GCGA 2XIQA 2CD9A 4QPNA 4OFBA 3DE2X 5AUOB 1CUGA 2O5RA 3ANTA 4N49A 3GLKA 3HWSA 4FBMA 3B1ZA 5C4IA 5EPUA 4BEBA 1EFTA 1NFRA 1Q2XA 2Q9UA 1X0XA 1K0FA 2J3IA 2RJNA 2WKQA 3HXKA 4EB8A 1SKBA 1HZZA 2NAPA 2QSUA 1CUIA 1S3IA 2J3EA 2PT9A 3JQAB 2QE6A 2PA0A 4YV2A 4KEAA 3HYSA 4CCAA 1C3OB 1G8FA 3C8ZA 4EATA 4UM9B 2YWFA 4HB3A 2GSWA 5EI5A 3L4JA 1RJGA 2CHVA 1PKEA 1LK0A 1KO4A 1ODCA 5AHRA 2A78A 1CRZA 1Q7BA 4QECA 4YMGA 5JPDA 2QIOA 2WNSA 4PSKA 3SU8A 2GN0A 2XMPA 4WW0A 2OORC 3ZNNA 4RSRA 1E1CA 1LBEA 3QTBA 3FFAA 2C1XA 2I87A 3C6YA 4E08A 4HWSA 3OLQA 4BEWA 4XWTA 2NO4A 2H07A 5EGSA 5J63A 3EARA 3C0KA 1JFFA 1XVIA 4HMPA 1RAAA 1EK2A 1Z0UA 3QFHA 3C87A 2GA9A 1NSTA 4DPKA 1ATIA 2H4ZA 2P4EA 3TSAA 1GKIA 2ZIFA 2O8BA 3VR6H 2AJDA 1GWNA 2IITA 3OPYB 4TV8B 1YTLA 2V7BA 1G8SA 3D8SA 1TJ4A 4HEA6 1U80A 1M6VA 2ET6A 2JL1A 3ELWA 3NO4A 3L7CA 3MJFA 2G76A 2OK8A 3FVWA 3OBBA 2HQ1A 1WBDA 2XKJE 3OQ6A 2R66A 2YMPA 4O63O 4UHHA 2UU9B 1CIPA 3F71A 1Y3IA 3MPOA 4MUXA 4CDMA 4J6EA 2PRSA 4BO7A 3J81k 1ZISA 3O47A 3N8DA 2DUUA 4JR0A 1Q92A 3V4PB 1E9SA 1XF1A 5E1BA 4QA9A 3O3NB 4IIVA 2FG7C 2GZ1A 1NW9B 4HZUB 2V7QA 7MDHA 2AN1A 2R47A 2YBEA 3B82A 5LYJB 4B3GA 2PWBA 1HDYA 1PBNA 3L07A 2VZ9A 5JSFA 3X2SA 2VIIA 3L6BA 5TY0A 1WHSB 2XQGA 3RKSA 2DG2A 2GRJA 2GCNA 3NIWA 1OIWA 1W30A 3I53A 4XQGA 4ZQGA 2H57A 3W2IA 1E1RA 1NVKA 4WV3A 3I5YA 1XDDA 2ZCUA 4PQEA 3VR2D 2BIFA 3SZMA 2BFOA 3RLIA 3EWIA 4YPFA 5CCBA 3FPFA 4BMYA 5E6SB 5FAXA 4E3ZA 5IXSA 1GFWA 4OF4A 4AP5A 2VBFA 5FYQA 2CY0A 2F9LA 1P7VA 3JWIA 2VNJA 4URUR 3OZGA 1GYRA 2ZUSA 3WO0A 4QQKA 1RXUA 1IXKA 3V32A 1V16B 2ZJYA 1WRBA 5K6TA 1JMYA 1C7FA 2QSZA 1Z0KA 3D3JA 3QY9A 1WD5A 2X9VA 4UOZA 1YVDA 2EL7A 3GARA 5G3YA 3AESA 1JU9A 2XH8A 2ILTA 5CG2A 4A15A 2XXAA 3K70B 1ML3A 3N3BC 1GTG1 2A8YA 2PQ2A 4Q3OA 1DAEA 3MT9A 1G9TA 1GZHB 3NBZC 2VK2A 3R9IA 2FPXA 5E6RB 2ZSHA 4UU8A 1DAKA 1HE2A 5DP2A 4ZREA 4IQ8A 2Y77A 4C1BA 2WTBA 2J5RA 3MRVA 4UNSA 4LRWA 5FTKA 3L6DA 1NN0A 2DCMA 3NHAA 2C03A 2NYVA 4MUIA 2OBFA 2QMZA 4WN9B 3QKSA 5HRCA 5LMNB 4LNHA 4RJJA 1VHDA 4HDRB 4HMOA 1J1IA 3NBAA 1YZ3A 1L5OA 3NAGA 3HA5A 4QHTA 5EL0A 4RAOA 1TVKA 3OURA 2HX1A 4UM9D 3ZGOA 2XLBA 1DC4A 1HFEL 4TS9A 4BFXA 4MHTA 3GJYA 1Z2PX 1D5CA 3QHQA 4IEFB 2RHWA 1YCGA 5JDIA 2ZUUA 1P62B 4ZQFA 3OPYI 4FKBA 5K03A 5IJ0B 4LF9B 4JL8A 3MELA 3MMXA 1GIAA 1BCRA 4ZO9A 1JG2A 2J0UB 3IOYA 4Q15A 5FP0A 3RUPA 1JAZA 3UJBA 3HR8A 4EW6A 5HKBA 3C7DB 1Y9EA 4EAQA 2W42A 3DE1X 2VZLA 2GSDA 2JJ2D 2ZJFA 2HWKA 3EQ2A 3H9UA 3R20A 3U39A 4OQLA 3K70D 4YFYA 4JQZA 1Y6ZA 3AKZA 4P5PA 1R0RE 1R0WA 2MU1A 4IO1A 4YA6A 5B53A 4ETWA 2FP4B 1SIOA 1VA4A 3L8EA 4F12A 4KREA 2GGSA 2YXBA 2H7XA 2BFBB 1PQPA 1PV1A 4JKYA 1SC9A 2WUEA 1VJDA 2X5JO 4AWXA 3F96A 3OLZA 1N36B 3RFFA 1DJNA 3C8UA 3ZKAA 4N01A 1K8XB 3KKEA 3VI3B 4CM3A 4G6ZA 3UJ9A 4X20A 2HPAA 1ZK2A 2ZI3A 4JI7B 1NLZA 5EIWA 3PWTA 2WA2A 4NR0A 4NCHA 2ZRIA 3FPLA 1YJCA 3O74A 1J5PA 5JJBA 3FTQA 3VR2A 1L5MA 1H9AA 4FHEA 4XGQA 1GGVA 4DLNA 3E3AA 4HV4A 5FH9A 4ZVRA 3TVDA 2NU9A 4G36A 2A2ZA 3AOGA 5IUNC 1DG3A 2Z57A 4HF7A 5I7AA 3F8TA 5F5NA 4CT4B 4I9UA 2J5QA 1A9TA 1XQ6A 1JJVA 4X3CA 3CT6A 2AE2A 4XSHA 3UAVA 5J2TA 2VVTA 4ABYA 3D0OA 4Q5IA 5DW0A 2W37A 1IYZA 3KSAC 2IDJA 1P3Y1 3I2YX 4O4IF 4HEJA 4KSCA 1MQ8B 1ZY2A 5J4LA 5FYDA 3TTYA 4G0PA 3UXHA 4J16A 5BSUA 3H0KA 3ENQA 5G0UA 3HMKA 3T4UA 4H6XA 3NQ41 1E2HA 1OC2A 3GO4A 10MHA 2HJRA 2J45A 1SOUA 5COQA 5K0NA 4AJ4A 1J7JA 4D4IA 2P9FA 4BO1A 3R44A 4IMRA 1SHLA 4CUKA 1E2BA 2YV4A 2XWQA 4K28A 4DGSA 5IF3A 2XCRB 1GTSA 1I7LA 4MCJA 2PZ8A 4BKPA 4B82A 2CKDA 2DM6A 4OKSA 4BMCA 2O50A 3BPSA 3EZ2A 1TUGA 2JFNA 3IIIA 5EKSA 2AJBA 3S1SA 2WBLC 5IYZA 4MVWA 3RUAA 4XCXA 4QVGA 1EX7A 1YACA 2ZQZA 3IOMA 4ID3A 4YJHB 1M2NA 1M6WA 3A6HA 4UBKA 4KI0A 4NATA 4PFSA 1Z4NA 4FX5A 3UMGA 4C0JA 3O1HB 5KYXB 1T9HA 3CX8A 5EIFA 1WHTB 3NDBB 1B00A 5JO0A 5A7HA 3V8RA 4TT8A 1QOZA 2JRCA 3AJ9A 2C8VA 4UFOA 4BMZA 5LOVB 1LZKA 1COWA 1KVSA 3VHQA 2BTOA 1WSBA 3A9CA 1H1LA 4GBED 4EGAA 1O0BA 3AB8A 3V9PA 1QRRA 5CT4A 3ZE8A 1D6MA 4F85A 4Z6KA 4BX9A 3KYJB 4D57A 4YBZA 1VLMA 1ZRMA 621PA 4JGIA 1I5RA 5JPCA 1YV9A 3GG2A 1M2GA 4F8EA 3E5NA 1ZGBA 5F7JA 4TL6A 2AOTA 3F1KA 2EJBA 3DNFA 3TMKA 4O1IA 4O6VA 4AZVA 4EUFA 5DPMA 1L7RA 3SYTA 3TBHA 4PXSA 1BROA 4GICA 2XUIA 2OC9A 4NENB 2ZVQX 3DMPA 3HUTA 4JBLA 4OQDA 3ITDA 5I9IA 1L7XA 3IUPA 1V4NA 4ITUA 3PSAA 2GN6A 2IOFA 3FGPA 3HDTA 4ZYXA 5BNIA 1ZD3A 1KEPA 3OM8A 3EVCA 1JHXA 4L15A 2KYRA 1V8ZA 2AXNA 3SSNA 5K4HA 1J2YA 3BICA 4RVUA 2QRHA 3E3OA 1UBSB 5EPOA 3ZE7A 5AKKA 5EUQB 3WMRA 3UH0A 4QYMA 3CVVA 2VHWA 3D7RA 2XEDA 2XITA 3BMCA 5KWJA 2NO1A 3K9GA 1OCEA 4CFZA 4DRXB 5JJCA 4H6WA 1B8OA 1Y80A 3WLRA 1E1KA 1U0RA 3G2LA 3O8QB 1TIPA 3IPXA 3KQWA 3H11A 1GRQA 2HC9A 4LG1A 1SIUA 2ZYGA 3GOQA 5JS2A 4RPKA 2WWFA 1GL3A 2WFMA 2C2HA 2WA1A 2XB9A 4TM8A 3QFTA 4JBHA 1KQOA 4RFSA 3TXYA 2EP8A 1JDBB 3R6TA 2G80A