3LWAA

The crystal structure of a secreted thiol-disulfide isomerase from corynebacterium glutamicum to 1.75a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
170
structure length
167
Chain Sequence
GGTFQFHSPDGKMEIFYDEADRQQLPDIGGDSLMEEGTQINLSDFENQVVILNAWGQWCAPCRSESDDLQIIHEELQAAGTPGGTVLGINVRDYSRDIAQDFVTDNGLDYPSIYDPPFMTAASLGGVPASVIPTTIVLDKQHRPAAVFLREVTSKDVLDVALPLVDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted thiol-disulfide isomerase
publication title The Crystal Structure of a Secreted Thiol-disulfide Isomerase from Corynebacterium glutamicum to 1.75A
rcsb
source organism Corynebacterium glutamicum
molecule tags Isomerase
total genus 45
structure length 167
sequence length 170
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lwaA01
5F8BA 2R4VA 1M9BA 3LWAA 2YNXA 1YEPA 5G31A 1SYXA 3GIXA 1GTAA 3P2AA 3EYTA 5KEJA 4POMA 1U88A 3TUEA 4K9ZA 2LJAA 4Q5RA 5FHIA 1NSWA 2E2GA 1XWKA 2X8GA 3DYRA 3C7MA 2R37A 4V1Ag 2VLTA 4IQ1A 3NZNA 4GRFA 5J4UA 5J41A 1EOGA 3UL3A 3L9SA 1R26A 1TP9A 3LYKA 4TW5A 5B6MA 5J9CA 3L9UA 4AF2A 3F6DA 2AAWA 3A2XA 3F0IA 1QK8A 1V57A 2M72A 3ZITA 1TK5B 2LS5A 3EC3A 1KNGA 3M8NA 1V40A 2VL2C 5J5NA 1B4QA 3GX0A 5A4WA 4EDYA 3TRQA 12GSA 3C1RA 4BPYA 1SD8A 2H74A 3GNJA 4WR4A 3MAKA 1PX7A 4ZB8A 3KMNA 2E0QA 3VK9A 2XBIA 4KUNA 2TRXA 3D0ZA 4MPFA 4L0WA 1BYEA 2QSIA 2DJKA 3H8QA 3LQ7A 3APQA 2DBCA 4K6XA 2OE0A 1ILOA 2VCQA 2QC7A 5H5SA 2H70A 2RM6A 4PQHA 1TTZA 4IHUA 5DQYA 1SU9A 5D96A 3DEXA 1SL1B 5ECHB 3CBUA 1X9WB 3TGZA 2X99A 2DMLA 4NXIA 2ES7A 3TRXA 2GVPA 2JADA 3A3TA 2WULA 4FYCA 1G0TA 3UAPA 2VL3A 4F0CA 3Q19A 5E4WA 1EGRA 1S3DA 3DMLA 2X64A 2DIZA 2H1DA 4HI7A 5AN1A 2H0IA 1RK4A 3W8SA 3IRAA 4MF7A 5G1LA 3EE2A 4I5QA 3ZVJD 4D73A 1M2DA 4EDZA 5IOXA 1TRWA 4OFTA 4IELA 1TRVA 2FD3A 4DSSA 5COHA 3IV4A 3WYWA 1YZXA 3H93A 5CRGA 3KEBA 1GSDA 6GSUA 2V6OA 8GSSA 2NBSA 2H71A 3F63A 3EMXA 3DWVA 3C73A 2JSYA 3WT2A 2NPBA 2FWEA 3UEMA 4OO4A 4JBBA 1GNEA 5D9XA 3LXTA 5DCGA 5B8BA 4HUAA 3US3A 4O5RA 2AUVA 1M7TA 4YQUA 2NTOA 2X8HA 4ISDA 4MF6A 1EOHA 5AGYA 2IIYA 5ELGA 2V41A 2IL3A 3ZMKA 3KD0A 5ECNB 1G7EA 1XW6A 1WIKA 4KDYA 5D9TA 3EU3A 5G2ZA 4D73B 1K0CA 2IMIA 4NAXA 4ZIJA 2DJ1A 2VCTA 3F6FA 4DSSB 2JSZA 3HHVA 2OE1A 2LRTA 1N8JA 3GSSA 3APSA 4ZXGA 1B4PA 3KXOA 2B3SA 4KW6A 4E8HA 2B7KA 4DSQA 4MK3A 3GH6A 3E3EA 6GSXA 3GUSA 3I43A 5ECOB 1A8YA 2O87A 3F3QA 1SJZA 2C0FA 2GT6A 3KM6A 4O92A 3HZ4A 2ALBA 4LMVA 4V2LA 1DUGA 2KP1A 3QR6A 1RW1A 3HVVA 1E2YA 4J56E 2ON7A 3QD9A 2GLRA 4L0UA 6GSYA 1FHEA 2FUG2 4CHSA 1T4ZA 2C3NA 4CDOA 4EC0A 5CAXA 2YWOA 2GS3A 2WCIA 1X5EA 4MF5A 3O3TA 2MZCA 3NIVA 1GSFA 3D6IA 4WF4A 3UVTA 4MP4A 1U3IA 2GZYA 4PQIA 1W4VA 1WRYA 3EVIA 3L0HA 1DSBA 4YAVA 3ZVJA 3IBHA 5ID2A 1VF4A 4K0GA 3DXBA 2G2QA 1SK1A 1G6WA 4MH3A 4HOJA 2E2MA 4LA1A 1M2BA 4I8BA 5DCHA 4NMUA 5IQYA 4ZBBA 2TIRA 1T7PB 6GSTA 5ECSA 4ID0A 4HDEA 2HI7A 5H5RA 2LNSA 1T4YA 1VRSD 5ECIB 1EZKA 2IWTA 1IYIA 4OD7A 1TRUA 1QXHA 3SWLA 5KN1A 3K8NA 4YQMA 1KTEA 3VWWA 3QPMA 3HXSA 3M9JA 1WOUA 4JZQA 3SBCA 4ML6A 3CRUA 2LNTA 5ABRA 2RLIA 4TR1A 3NOFA 1XOBA 2MMZA 3E0UA 1SKRB 2KOKA 2DJJA 2H0HA 3FR6A 5JWRB 2KHPA 5ID2B 1NHOA 4J2FA 3DVWA 2AB6A 4MABA 1UC7A 3CRTA 2YV7A 1XWGA 3ME7A 1OE8A 4HZ2A 1BG5A 1R5PA 1Y25A 3QMXA 1MDKA 2ZNMA 1K0MA 2QKEA 4OFMA 1X0RA 1A8LA 4F03A 3J7Yb 4LL4B 2C4JA 2HXKA 2YOIA 2BMXA 1C72A 2CX3A 2TRCP 1GUMA 4ML1A 3LEFA 7GSSA 2OBKA 1QQ2A 1WWJA 1SJ6A 3VPQA 4TR1B 4ZBDA 1TRSA 4EO3A 4DEJA 2H1GA 1V9WA 4BA7A 4HQZA 1Q98A 4IJIA 2RM5A 1TI1A 1EV9A 2CV4A 5J3RA 1HYUA 1K3YA 2HNLA 2YP6A 2LV3A 2WJUA 2VAFA 2XHFA 5IMFA 1PA3A 4HS1A 1THOA 3ZTLA 1U6TA 2L5OA 2OACA 4YAPA 2R3XA 3QFBC 1PKZA 1PMTA 3RHBA 2HZFA 3G7JA 5HFIA 4EE0A 5DQSA 3F8UA 19GSA 2H8LA 2HT9A 2PN8A 4NHZA 2FWHA 1Z3EA 3P7XA 1A0RP 4N30A 2GDRA 2LKUA 1GP1A 4AJ8A 4BVXA 2WGRA 5HQPA 4GWRA 3HJMA 2DJ0A 4AJ7A 2XPDA 6GSSA 2Z9SA 4N10A 4Q5QA 1FVJA 3KCMA 2CQ9A 4LLRA 3GL5A 5HFGA 2HYXA 4IGJA 2ON5A 2YZUA 2O8VB 1U87A 1CQGA 5G1KA 2DJ2A 5AIVA 3H79A 2H6YA 4GSSA 2F8FA 1WJKA 2V6KA 3ZIVA 3RBTA 3GYKA 3HCZA 1ON4A 3LXZA 1EGOA 1VF3A 4ECBA 1YY7A 2HFDA 3VWVA 13GSA 3WGEA 1QMVA 1MEKA 2WB9A 4FH8A 4K7NA 1KEBA 4WF5A 5GZZB 4ECIA 1I5GA 3Q74A 3KMOA 2HLSA 2VIMA 1V2AA 1R5AA 1F3AA 1UVZA 2VLUA 3BJ5A 2YANA 4MPGA 5JCGA 3HVSA 1U3AA 1JFUA 1WE0A 4NHWA 1HQOA 4TKYA 3LYPA 4IVFA 3UOMA 3TKRA 5LNKe 1JLVA 2OADA 5IPGA 1TOFA 2GSRA 4MJEA 5ENUA 3TCOA 3UIWA 3FW2A 2N5BA 1F6MC 3DGQA 2HSHA 5HR3A 4G2EA 1GUHA 2HZEA 1GLPA 4G9HA 20GSA 3C8EA 9GSSA 1AQWA 1HNBA 4TXVA 1E6BA 1OYJA 1VF2A 4Z7XA 3VFIA 3LSZA 5JCWA 4F2IA 1DE1A 1M99A 2AHEA 4RI7A 2B1KA 18GSA 5ECQB 2LRCA 3BOAA 2H73A 3IOSA 1T3BA 4X43A 2B1LA 4JU5A 16GSA 2N5FA 5ECLB 2VD0A 4YH2A 5IMZA 2O7KA 2KP2A 1PGTA 4FYBA 2VL9A 1SL0B 4JE1A 4PURA 3RPPA 1YKAA 5EPFA 2HZEB 3ED3A 3TDGA 4GCIA 3FK8A 4F9ZA 4EUYA 4PUFC 1O8WA 5IM9A 2DIYA 2DJ3A 4XRAA 4ECJA 3F3RA 2F3MA 2PERA 3VLNA 3EMPA 2JZTA 2GZZA 4K7IA 4NPBA 2KUCA 2FNOA 1XVWA 5IMDA 5IPHA 1TW9A 1FO5A 5A4VA 2IMEA 1GWCA 1PQNA 2DSAA 1CQHA 1EEJA 3HKRA 3FR3A 4QL7A 4MJBA 1VGLA 1H4OA 1SK0A 4KSOA 4K2DA 3DIEA 4X0XA 2JZRA 2ZCTA 1K3OA 4PGTA 1O6JA 5KN0A 1YEXA 4HU9A 5G5EA 3GV1A 3KH7A 2R6KA 2MBSA 2CVDA 2B6MA 1BEDA 5ECPB 2CAQA 3CXGA 1YF1A 2J9HA 1F37A 1Z6NA 2K8VA 2B5YA 3H1NA 1TU8A 3IA1A 1X9SB 5GSTA 3KZQA 4L5OA 1TK8B 1ZZYA 5IMCA 1NW2A 1R4WA 3PGTA 3A2WA 4F82A 1ML6A 3KGKA 3GKKA 2BJXA 1TKDB 3PH9A 4HEA2 4OFNA 1XWCA 5JWOB 3LG6A 4V2MA 2HE3A 4I2UA 3F4TA 2PPTA 2K9FA 3HJPA 3AY8A 4GLTA 1ABAA 3G7IA 5CREA 2EIQA 3P90A 2EIOA 1MD3A 2P5QA 4RUVA 5A4UA 2VLVA 1T00A 10GSA 2B5XA 2NDOA 3HD5A 3D4TA 1ZL9A 4TRXA 4MZBA 5C00A 1G6YA 5HR1A 4DSRA 1PD21 3ZIJA 2B7JA 1SKSB 2OJLA 2I81A 1K0AA 4BVYA 5D8IA 2IFQA 1QFNA 2ZUPA 3O6TA 1J0FA 4H86A 5B6NA 2OA7A 3GA4A 2LQQA 2H6XA 4KX4A 2MYGA 2A4VA 1A2MA 1GULA 1MDIA 1K3LA 2PVOC 5HR2A 1YF0A 1Q4JA 1Y6EA 2JL4A 3H4KA 4ZL7A 2YWIA 1OE7A 1YDKA 4K8MA 3HA9A 1JZWA 3N5OA 3ME8A 3IK9A 5DJLA 4K1FA 2FY6A 4N11A 5KN3A 3I69A 2FWFA 3TJKA 5CP1A 1S3CA 4F0BA 2KLXA 1THXA 4TR0A 4MLYA 2FA4A 4MCUA 4EXJA 1FB0A 2IFQB 3V1WA 14GSA 1XWBA 3F9UA 3ZREA 4EF0A 2GTUA 3IR4A 5EL8A 2C8UA 3CSHA 2C1YA 1FW1A 4ZILA 4EVMA 3TJBA 4NWYA 3UBLA 4KCAA 1SENA 1Z6MA 1O85A 2PWJA 1AW9A 2LJKA 1SL2B 1AAZA 3TRPA 1XW9A 3ERWA 2WDUA 4OMVA 1GSSA 5HR0A 1FG4A 4ACSA 3GN3A 2YWNA 3TKSA 3EINA 4L5LA 1X5DA 4IKHA 1AUCA 4POLA 3ZZXA 2RUEA 3BD2A 3FR9A 1Z7PA 4GXZA 5B7CA 3TKSE 2PMTA 2FGXA 3QCPA 5GAND 1V98A 2B5EA 4CW9A 3DKSA 4MZWA 2I3YA 2R5GA 2AYTA 2WS2A 1FAAA 4K7OA 2C3TA 4KGIA 3IE3A 3W6GA 3QAGA 3KP9A 3DVXA 3HZ8A 3VPTA 3MSZA 3GMFA 2XBQA 4AJ6A 4LL1B 3GKMA 5IMAA 2FLSA 3KTLA 2K6VA 5JWQB 2H6ZA 4ZB6A 3CTGA 3KP8A 4V2NA 2C0GA 5AIXA 1AXDA 3MWHA 1USBA 2PGTA 2C3QA 2OE3A 2WFCA 4NV5A 2M46A 2FCHA 2L5LA 1ERTA 5IIZA 1XIYA 1TK0B 4L8EA 1XVQA 2GQMA 1FOVA 4KDUA 1OVNA 2H72A 3GHAA 1UA5A 5FT3A 2GSQA 3VURA 3FKFA 3FYGA 4GTUA 3ZRDA 1GL8A 3QDNA 3OR5A 1TU7A 4XS4A 2L4QA 2JZSA 4X1UA 2QGVA 1B48A 6GSWA 2F8AA 3TKSC 3WD6A 2V1MA 4XTSA 1EV4A 3CSJA 3JCML 4WR5A 22GSA 4RQRA 3D5JA 2H19A 2LUSA 5CRDA 3GSTA 4ZL9A 3S9FA 1URMA 3UJ1A 1J08A 4XIHA 4GSTA 1XXUA 1F3BA 2I4AA 1AC1A 4IQAA 1TJDA 5DBQA 1IYHA 1OC8A 2PVQA 3ZFLA 3I6AA 3QOUA 4MH2A 1V58A 4DVCA 3L78A 2IPAA 5INYA 4Q5NA 4O32A 1PRXA 1XWAA 3D4MA 4PUAA 3GTUA 1EP7A 2C0EA 3M3MA 5FWGA 1GSUA 2L4CA 4KH7A 3FEUA 5LCZA 4XS4B 4FIWA 3N9JA 3Q18A 4I97A 3DRNA 3RHCA 3A2VA 3EU4A 2CVKA 4RI6A 4KA0A 1MTCA 1PX6A 1SYRA 5ECMB 1PL2A 2JACA 4WEYA 5B8AA 3Q6OA 2H66A 4HU7A 3IDVA 5IO2A 2MMNA 5D73A 4ECCA 1FB6A 1PKWA 2K18A 2GZPA 3CTFA 5J9BA 3FY7A 2GGTA 1DE2A 1B9YC 17GSA 2MMAA 3HY2A 2IMDA 3TOTA 1T1VA 11GSA 5CRWA 4MJAA 2LTKA 1BAYA 4QL9A 5G5FA 4OO5A 1ST9A 4POKA 3HDCA 5D93A 1XZOA 4Q5FA 1ERUA 3PINA 2YCDA 1ZGNA 1QGVA 3GTUB 1TXXA 1BX9A 3KTBA 4XRDA 2R2JA 2LJRA 5LD0A 2YZHA 2GSSA 1GUKA 1HNCA 3LJRA 1GSQA 4N0ZA 1LBKA 4HJ2A 4PNFA 4XS6A 1A24A 3HJOA 3WGXA 2YN1A 5A5KA 2IMKA 4OCFA 3IAM2 3QAWA 4XS1A 2YJHA 1NHYA 2N5AA 3C71A 4MA9A 1T8EB 4O7HA 1GTIA 2MMOA 3EURA 2V2GA 4IP1A 2O89A 5H5QA 4EL1A 4ULXA 2CA8A 4KCEA 1YKCA 1QUWA 3E9JB 3WGDA 3HVXA 5CNWA 5G30A 2J23A 1MDJA 1ERWA 1XOAA 4KAEA 1XPVA 2O85A 2XC2A 4MJCA 2JU5A 3TJGA 2VCWA 3KH9A 2WZ9A 5IOWA 4TOPA 3ERFA 2WRTA 4TN8A 1ACVA 3FZAA 4ZBAA 4KSMA 2GT5A 4AGSA 2H1BA 1JHBA 4IW9A 2E7PA 1GH2A 4ZB9A 1XBSA 1S3AA 1HD2A 3D22A 2GQLA 2FHEA 3FRCA 2A2RA 2C0DA 2CZ3A 1JZDA 1NM3A 1B8XA 4YQVA 3W8JA 1VF1A 4FYUA 3TJFA 1A2LA 3BCKA 1TI3A 2A2SA 2MBTA 4POBA 4XCSA 3IC4A 2YJ7A 1N2AA 4IP6A 1RQMA 4JR4A 4WBJA 4QQ7A 2VD1A 3WT1A 2VM1A 3L9VA 3F4SA 2V32A 3I9V2 2IN3A 2F51A 2YPMA 1K0OA 3GX8A 4RQXA 2IJYA 3U6VA 2FWGA 1GSYA 5ECRB 1AQVA 1B9XC 3P8WA 2P31A 3UMAA 1PL1A 1X5CA 2CX4A 1EEMA 3RPNA 5KN2A 4KB3A 2P0GA 3GKNA 2H76A 4PQ1A 5IMVA 1W89A 3RDWA 4GF0A 3DD3A 4OWYA 3TJJA 5F05A 4ZL8A 2LRNA 1XW5A 3LFLA 2DMMA 2X8CA 3GH9A 1LU4A 1JLWA 3UARA 3A5WA 1ZYEA 2L59A 4TVEA 1SKWB 5DDLA 2YWMA 4FO5A 3PR8A 1ZOFA 1GTBA 4JEDA 2C80A 5DAKA 3TKQA 4ILFA 3MNGA 4OCEA 1OKTA 1ERVA 4G19A 2F9SA 2M80A 2LQOA 1K0BA 3MDKA 4TR4A 4PXOA 1K0NA 3IPZA 1ZCPA 3VI5A 1GLQA 2H01A 2HSYA 2VCXA 4IN0A 6GSVA 2HRNA 3QAVA 1AQXA 5F0GA 2CVBA 1OC3A 3ZMLA 2K8SA 3ZL5A 3GURA 4GQFA 4GSNA 1Z9HA 3M9KA 1A2JA 3C1SA 1O73A 5DAKB 1BQ7A 4KNDA 1AIUA 5GAPD 5F07A 1XCCA 2DC5A 2VUPA 4MDCA 4BL7A 1HNAA 2CAIA 5L71A 3FZ4A 2XPEA 1M9AA 1BJXA 4WBRD 5CO3A 2H1AA 1GSEA 3TB2A 4LMWA 3GRXA 3R2QA 4JR6A 4BWSA 4KE3A 2RUFA 3D21A 2VM2A 1O81A 1JZOA 3G9BA 3VI7A 4EKZA 4MZCA 3GKXA 4TR3A 1A0FA 3UBKA 1YQ1A 3FZ5A 1DBYA 3CMIA 3CYNA 2HRFA 3ZYWA 1EP8A 4HZ4A 4J57E 1R7HA 4P3YB 2PBJA 3BBYA 1OC9A 2EC4A 4WXTA 2L57A 5DALA 1SK2A 1F9MA 5HFKA 4JRRA 3KJYA 5D9VA 5GSSA 2LEGA 2FA8A 2RIIA 2H0GA 4I6XA 4KDXA 2I9HA 1XFLA 5EVOA 2EIRA 5C04A 3M0FA 3IAS2 1J9BA 5E59A 3LORA 3FZ9A 1G7OA 3APOA 3M1GA 2GSTA 5CRHA 2DLXA 1PN9A 5AISA 5ELAA 3KIJA 4HQSA 4PNGA 3U5RE 3O76A 3QFAC 3ZFBA 2H30A 2PUKC 5IO0A 1WMJA 2REMA 1WP0A 2I1UA 2YV9A 1I9DA 2VOCA 1SD9A 1A23A 2P5RA 1TDIA 1O7UA 1OC9B 1KBNA 1K0DA 2OBIA 4XHMA 1O8XA 4MMMA 4TXOA 5DALB 1GNWA 1M0UA 2IMFA 1JZRA 1EWXA 3HYPA 1ZMAA 4K0NA 4GQCA 4G10A 4I2TA 1X9MB 3VWUA 2NVLA 3IK7A 3GL3A 2OKAA 2VCVA 3TOUA 4E8EA 3CSIA 4IJ3A 1M2AA 4N0VA 5EY6A 3IHQA 5ECKB 3VWXA 1WPIA 3F4RA 1Z7RA 1ZYQB 3L4NA 3GFKA 3UVHA 1SJIA 2G0FA 1YJ6A 3IXRA 2VL2A 2L6DA 4IS0A 1PSQA 3J7Yk 3ZLPA 1F2EA 1GTUA 4V1Ap 2AJQB 1LJRA 2AV4A 4WETA 2GQKA 3EWLA 5F06A 1FVKA 4HJMA 1MD4A 3ERGA 2VO4A 4TXOB 5DJMA 3RAZA 3ISOA 2BTOT 2LSTA 5JCUA 5CYYA 4IBPA 1GRXA 4BWQA 1UN2A 2H75A 3TKPA 5D9WA 2CZ2A 2PU9C 2D2ZA 3G7YA 1Z5YE 3FHKA 2CT6A 1OAZA 3BCIA 5DVBA 4NV2A 3LGCA 2L6CA 2VCZA 1H75A 4PX1A 1OKDA 4WKWA
chains in the Genus database with same CATH superfamily
5F8BA 2R4VA 1M9BA 3LWAA 2X4AA 2YNXA 1YEPA 5G31A 1SYXA 3GIXA 1FOHA 1GTAA 3P2AA 3EYTA 4K2XA 5KEJA 4POMA 2A2PA 1U88A 3TUEA 4K9ZA 2LJAA 4Q5RA 5FHIA 1NSWA 2E2GA 1XWKA 2X8GA 3DYRA 3C7MA 2R37A 4V1Ag 2VLTA 4IQ1A 3NZNA 4GRFA 5J4UA 5J41A 1EOGA 3UL3A 3L9SA 1R26A 1TP9A 3LYKA 4TW5A 5B6MA 5J9CA 3L9UA 4AF2A 3F6DA 2AAWA 3A2XA 3F0IA 1QK8A 1V57A 2M72A 3ZITA 1TK5B 2LS5A 3EC3A 1KNGA 3M8NA 1V40A 2VL2C 5J5NA 1B4QA 3GX0A 5A4WA 4EDYA 3TRQA 2QA1A 12GSA 3C1RA 4BPYA 1SD8A 2H74A 3GNJA 4WR4A 3MAKA 1PX7A 2DKIA 4ZB8A 3KMNA 2E0QA 3VK9A 2XBIA 4KUNA 2TRXA 3D0ZA 4MPFA 4L0WA 1BYEA 2QSIA 2DJKA 3H8QA 3LQ7A 3APQA 2DBCA 4K6XA 2OE0A 1ILOA 2VCQA 2QC7A 5H5SA 2H70A 2RM6A 4PQHA 1XG8A 1TTZA 4IHUA 5DQYA 1SU9A 5D96A 3DEXA 1SL1B 5ECHB 3CBUA 1X9WB 3TGZA 2X99A 2DMLA 4NXIA 2ES7A 3TRXA 2GVPA 2JADA 3A3TA 2WULA 4FYCA 1G0TA 3UAPA 2VL3A 4F0CA 3Q19A 5E4WA 1EGRA 1S3DA 3DMLA 2A4HA 2X64A 2DIZA 2H1DA 4HI7A 5AN1A 2H0IA 1RK4A 3W8SA 3IRAA 4MF7A 5G1LA 3EE2A 4I5QA 3ZVJD 4D73A 1M2DA 4EDZA 5IOXA 1TRWA 4OFTA 4K5SA 4IELA 1TRVA 2FD3A 4DSSA 5COHA 3IV4A 3WYWA 1YZXA 3H93A 5CRGA 3KEBA 1GSDA 6GSUA 2V6OA 8GSSA 2NBSA 2H71A 3F63A 3EMXA 3DWVA 3C73A 2JSYA 3WT2A 2NPBA 2FWEA 3UEMA 4OO4A 4JBBA 1GNEA 5D9XA 3LXTA 3LW9A 5DCGA 5B8BA 4HUAA 3US3A 4O5RA 2AUVA 1M7TA 4YQUA 2NTOA 2X8HA 4ISDA 4MF6A 1EOHA 5AGYA 2IIYA 5ELGA 2V41A 2IL3A 3ZMKA 3KD0A 5ECNB 1G7EA 1XW6A 1WIKA 4KDYA 5D9TA 3EU3A 5G2ZA 4D73B 1K0CA 2IMIA 4NAXA 4ZIJA 2DJ1A 1M3JA 2VCTA 3F6FA 4DSSB 2JSZA 3HHVA 2OE1A 2LRTA 1N8JA 3GSSA 3APSA 4ZXGA 1B4PA 4G0LA 3KXOA 2B3SA 4KW6A 4E8HA 2B7KA 4DSQA 4MK3A 3GH6A 3E3EA 6GSXA 3GUSA 3I43A 4Z2RA 5ECOB 4Z2TA 1A8YA 2O87A 3F3QA 1SJZA 2C0FA 2GT6A 3KM6A 4O92A 3HZ4A 2ALBA 4LMVA 4V2LA 1DUGA 2KP1A 3QR6A 1RW1A 3HVVA 1E2YA 4J56E 2ON7A 3QD9A 2GLRA 4A5PA 4L0UA 6GSYA 1FHEA 2FUG2 4CHSA 1S3RA 1T4ZA 2C3NA 4CDOA 4EC0A 4MNNA 5CAXA 2YWOA 2GS3A 2WCIA 1X5EA 4MF5A 3O3TA 2MZCA 3NIVA 1GSFA 3D6IA 4WF4A 3UVTA 4MP4A 1U3IA 2GZYA 4PQIA 1W4VA 1WRYA 3EVIA 3L0HA 1DSBA 4YAVA 3ZVJA 3IBHA 5ID2A 1VF4A 4K0GA 3DXBA 2G2QA 1SK1A 1G6WA 4MH3A 4HOJA 2R0CA 2E2MA 4LA1A 1M2BA 4I8BA 5DCHA 4NMUA 5IQYA 4ZBBA 2TIRA 1T7PB 6GSTA 5ECSA 4ID0A 4HDEA 2HI7A 5H5RA 2LNSA 1T4YA 1VRSD 5ECIB 1EZKA 2IWTA 1IYIA 4OD7A 1TRUA 1QXHA 3SWLA 5KN1A 3K8NA 4YQMA 1KTEA 3VWWA 3QPMA 3HXSA 2QA2A 3M9JA 1WOUA 4JZQA 3SBCA 4ML6A 3CRUA 2LNTA 5ABRA 2RLIA 4TR1A 3NOFA 1XOBA 2MMZA 1PFOA 3E0UA 1SKRB 2KOKA 2DJJA 2H0HA 3FR6A 5JWRB 2KHPA 5ID2B 1NHOA 4J2FA 3DVWA 2AB6A 4MABA 1UC7A 3CRTA 2YV7A 1XWGA 3ME7A 1OE8A 4HZ2A 1BG5A 1R5PA 1Y25A 3QMXA 1MDKA 2ZNMA 1K0MA 2QKEA 4OFMA 1X0RA 1A8LA 4F03A 3J7Yb 4LL4B 2C4JA 2HXKA 2YOIA 2BMXA 1C72A 2CX3A 2TRCP 1GUMA 4ML1A 3LEFA 7GSSA 2OBKA 1QQ2A 1WWJA 1SJ6A 3VPQA 4TR1B 4ZBDA 1TRSA 4EO3A 4DEJA 2H1GA 1V9WA 4BA7A 4HQZA 1Q98A 4IJIA 2RM5A 1TI1A 1ZYPA 1EV9A 2CV4A 5J3RA 1HYUA 1K3YA 2HNLA 2YP6A 2LV3A 2WJUA 2VAFA 2XHFA 5IMFA 1PA3A 4HS1A 1THOA 3ZTLA 1U6TA 2L5OA 2OACA 4YAPA 2R3XA 3QFBC 1PKZA 3FMWA 1PMTA 3RHBA 2HZFA 3G7JA 5HFIA 4EE0A 5DQSA 3F8UA 19GSA 2H8LA 2HT9A 2PN8A 4NHZA 2FWHA 1Z3EA 3P7XA 1A0RP 4N30A 2GDRA 2LKUA 1GP1A 4AJ8A 4BVXA 2WGRA 5HQPA 4GWRA 3HJMA 2DJ0A 4AJ7A 2XPDA 6GSSA 2Z9SA 4N10A 4Q5QA 1FVJA 3KCMA 2CQ9A 4LLRA 3GL5A 4HSCX 2HYXA 5HFGA 4IGJA 2ON5A 2YZUA 2O8VB 1U87A 1CQGA 5G1KA 2DJ2A 5AIVA 3H79A 2H6YA 4GSSA 2F8FA 1WJKA 2V6KA 3ZIVA 3RBTA 3GYKA 3HCZA 1ON4A 3LXZA 1EGOA 1VF3A 4ECBA 1YY7A 2HFDA 3VWVA 13GSA 4G0IA 3WGEA 1QMVA 1MEKA 2WB9A 4FH8A 4K7NA 1KEBA 4WF5A 5GZZB 4ECIA 1I5GA 3Q74A 3KMOA 4BVXB 2HLSA 2VIMA 1V2AA 1R5AA 1F3AA 1UVZA 2VLUA 3BJ5A 2YANA 4MPGA 4K5RA 5JCGA 3HVSA 1U3AA 1JFUA 1WE0A 4NHWA 1HQOA 4TKYA 3LYPA 4IVFA 3UOMA 3TKRA 5LNKe 1JLVA 2OADA 5IPGA 1TOFA 2GSRA 4MJEA 5ENUA 3TCOA 3UIWA 3FW2A 2N5BA 1F6MC 2HRKA 3DGQA 2HSHA 5HR3A 4G2EA 1GUHA 2HZEA 1GLPA 4G9HA 20GSA 3C8EA 9GSSA 1AQWA 1HNBA 4TXVA 1E6BA 1OYJA 1VF2A 4Z7XA 3VFIA 3LSZA 5JCWA 4F2IA 1DE1A 1M99A 2AHEA 4RI7A 2B1KA 18GSA 3IC8A 5ECQB 2LRCA 3BOAA 1M3IA 2H73A 3IOSA 1T3BA 4X43A 2B1LA 4JU5A 16GSA 2N5FA 5ECLB 2VD0A 4YH2A 5IMZA 2O7KA 2KP2A 1PGTA 4FYBA 2VL9A 1SL0B 4JE1A 4PURA 3RPPA 4O5QA 4Z2UA 1YKAA 5EPFA 2HZEB 3ED3A 3TDGA 4GCIA 3FK8A 4F9ZA 4EUYA 4PUFC 1O8WA 5IM9A 2DIYA 2DJ3A 4XRAA 4ECJA 3F3RA 2F3MA 2PERA 3VLNA 3EMPA 2JZTA 2GZZA 4K7IA 4NPBA 2KUCA 2FNOA 1XVWA 5IMDA 5IPHA 1TW9A 1FO5A 5A4VA 2IMEA 1GWCA 1PQNA 2DSAA 1CQHA 1EEJA 3HKRA 3FR3A 4QL7A 4MJBA 1VGLA 1H4OA 1SK0A 4KSOA 4K2DA 3DIEA 4X0XA 2JZRA 2ZCTA 1K3OA 2DKHA 4PGTA 1O6JA 5KN0A 1YEXA 4HU9A 5G5EA 3GV1A 3KH7A 2R6KA 2MBSA 2CVDA 2B6MA 1BEDA 5ECPB 2CAQA 3CXGA 1YF1A 2J9HA 1F37A 1Z6NA 2K8VA 2B5YA 3H1NA 1TU8A 4EIQA 3IA1A 1X9SB 5GSTA 3KZQA 4L5OA 1TK8B 1ZZYA 5IMCA 1NW2A 1R4WA 3PGTA 3A2WA 4F82A 1ML6A 2R0GA 3KGKA 3GKKA 2BJXA 1TKDB 3PH9A 4HEA2 4OFNA 1XWCA 5JWOB 3LG6A 4V2MA 2HE3A 4I2UA 3F4TA 2PPTA 2K9FA 3HJPA 3AY8A 4GLTA 1ABAA 3G7IA 5CREA 2EIQA 3P90A 2EIOA 1MD3A 2P5QA 4RUVA 5A4UA 2VLVA 1T00A 10GSA 2B5XA 2NDOA 3HD5A 3D4TA 1ZL9A 4TRXA 4MZBA 5C00A 1G6YA 5HR1A 4DSRA 1PD21 3ZIJA 2B7JA 1SKSB 2OJLA 2I81A 1K0AA 4BVYA 5D8IA 2IFQA 1QFNA 2ZUPA 3O6TA 1J0FA 2X49A 4H86A 5B6NA 2OA7A 3GA4A 2LQQA 2H6XA 4KX4A 2MYGA 2A4VA 1A2MA 1GULA 1MDIA 1K3LA 2PVOC 5HR2A 1YF0A 1Q4JA 1Y6EA 2JL4A 3H4KA 4ZL7A 2YWIA 1OE7A 1YDKA 4K8MA 3HA9A 1JZWA 3N5OA 3ME8A 3IK9A 5DJLA 4K1FA 2FY6A 4N11A 5BMUA 5KN3A 3I69A 2FWFA 3TJKA 5CP1A 1S3CA 4F0BA 2KLXA 1THXA 4TR0A 4MLYA 2FA4A 4MCUA 4EXJA 1FB0A 4BVYB 2IFQB 3V1WA 14GSA 1XWBA 3F9UA 3ZREA 4EF0A 2GTUA 3IR4A 5EL8A 2C8UA 3CSHA 4USSA 2C1YA 1FW1A 4ZILA 4EVMA 4BIKA 3TJBA 4NWYA 3UBLA 4KCAA 1SENA 1Z6MA 1O85A 2PWJA 1AW9A 2LJKA 1SL2B 1AAZA 4CY6A 3TRPA 1XW9A 3ERWA 2WDUA 4OMVA 1GSSA 5HR0A 1FG4A 4ACSA 3GN3A 2YWNA 3TKSA 3EINA 1ZYNA 4L5LA 1X5DA 4IKHA 1AUCA 4POLA 3ZZXA 2RUEA 3BD2A 3FR9A 1Z7PA 4GXZA 5B7CA 3TKSE 2PMTA 2FGXA 3QCPA 5GAND 1V98A 2B5EA 4CW9A 3DKSA 4MZWA 2I3YA 2R5GA 2AYTA 2WS2A 1FAAA 4K7OA 2C3TA 4KGIA 3IE3A 3W6GA 3QAGA 3KP9A 3DVXA 3HZ8A 3VPTA 3MSZA 4O5UA 3GMFA 2XBQA 4AJ6A 4LL1B 3GKMA 5IMAA 2FLSA 3KTLA 2K6VA 5JWQB 2H6ZA 4ZB6A 3CTGA 3KP8A 4V2NA 2C0GA 5AIXA 1AXDA 3MWHA 1USBA 2PGTA 2C3QA 2OE3A 2WFCA 4NV5A 2M46A 2FCHA 2L5LA 1ERTA 5IIZA 2HSMA 1XIYA 1TK0B 4L8EA 1XVQA 2GQMA 1FOVA 4KDUA 1OVNA 2H72A 3GHAA 1UA5A 5FT3A 2GSQA 3VURA 3FKFA 3FYGA 4GTUA 3ZRDA 1GL8A 3QDNA 3OR5A 1TU7A 4XS4A 2L4QA 2JZSA 4X1UA 2QGVA 1B48A 6GSWA 2F8AA 3TKSC 3WD6A 2V1MA 4XTSA 1EV4A 3CSJA 4YKFA 3JCML 4WR5A 22GSA 4RQRA 3D5JA 2H19A 2LUSA 5CRDA 3GSTA 4ZL9A 3S9FA 1URMA 3UJ1A 1J08A 4XIHA 4GSTA 1XXUA 1F3BA 2I4AA 1AC1A 4IQAA 1TJDA 5DBQA 1IYHA 1OC8A 2PVQA 3ZFLA 3I6AA 3QOUA 4MH2A 1V58A 4DVCA 3L78A 2IPAA 5INYA 4Q5NA 4O32A 1PRXA 1XWAA 3D4MA 4PUAA 3GTUA 1EP7A 2C0EA 3M3MA 5FWGA 1GSUA 2L4CA 4KH7A 3FEUA 5LCZA 4XS4B 4FIWA 3N9JA 3Q18A 4I97A 3DRNA 3RHCA 3A2VA 3EU4A 2CVKA 4RI6A 4KA0A 1MTCA 1PX6A 1SYRA 1PL2A 2JACA 5ECMB 2HRAA 4WEYA 5B8AA 3Q6OA 2H66A 4HU7A 3IDVA 5IO2A 2MMNA 5D73A 4ECCA 1FB6A 1PKWA 2K18A 2GZPA 3CTFA 5J9BA 3FY7A 2GGTA 1DE2A 1B9YC 17GSA 2MMAA 3HY2A 2IMDA 3TOTA 1T1VA 11GSA 5CRWA 4MJAA 2LTKA 1BAYA 4QL9A 5G5FA 4OO5A 1ST9A 4POKA 3HDCA 5D93A 1XZOA 4Q5FA 1ERUA 3PINA 2YCDA 1ZGNA 1QGVA 3GTUB 1TXXA 1BX9A 3KTBA 4XRDA 2R2JA 2LJRA 5LD0A 2YZHA 2GSSA 1GUKA 1HNCA 3LJRA 1GSQA 4N0ZA 1LBKA 4HJ2A 4PNFA 4XS6A 1A24A 3HJOA 3WGXA 2YN1A 5A5KA 2IMKA 4OCFA 3IAM2 3QAWA 4XS1A 2YJHA 1NHYA 2N5AA 3C71A 4MA9A 1T8EB 4O7HA 1GTIA 2MMOA 3EURA 2V2GA 4IP1A 2O89A 5H5QA 4EL1A 4ULXA 2CA8A 4KCEA 1YKCA 1QUWA 3E9JB 3WGDA 3HVXA 5CNWA 5G30A 2J23A 1MDJA 1ERWA 1XOAA 4KAEA 1XPVA 2O85A 2XC2A 4MJCA 2JU5A 3TJGA 2VCWA 3KH9A 2WZ9A 5IOWA 4TOPA 3ERFA 2WRTA 4TN8A 1ACVA 3FZAA 4ZBAA 4KSMA 2GT5A 4AGSA 2H1BA 1JHBA 4IW9A 2E7PA 1GH2A 4ZB9A 1XBSA 1S3AA 1HD2A 3D22A 2GQLA 4YKGA 2FHEA 3FRCA 2A2RA 2C0DA 2CZ3A 1JZDA 1NM3A 1B8XA 4YQVA 3W8JA 1VF1A 4FYUA 3TJFA 1A2LA 3BCKA 1TI3A 2A2SA 4FQUA 2MBTA 4POBA 4XCSA 3IC4A 2YJ7A 1N2AA 4IP6A 1RQMA 4JR4A 4WBJA 4QQ7A 2VD1A 3WT1A 2VM1A 3L9VA 3F4SA 2V32A 3I9V2 2IN3A 2F51A 2YPMA 1K0OA 3GX8A 4RQXA 2IJYA 3U6VA 2FWGA 3A5IA 1GSYA 5ECRB 1AQVA 1B9XC 3P8WA 2P31A 3UMAA 1PL1A 1X5CA 2CX4A 1EEMA 3RPNA 5KN2A 4KB3A 2P0GA 3GKNA 2H76A 4PQ1A 5IMVA 1W89A 3MYDA 3RDWA 4GF0A 3DD3A 4OWYA 3TJJA 5F05A 4ZL8A 2LRNA 1XW5A 3LFLA 2DMMA 2X8CA 3GH9A 1LU4A 1JLWA 3UARA 3A5WA 1ZYEA 2L59A 4TVEA 1SKWB 5DDLA 2YWMA 4FO5A 3PR8A 1ZOFA 1GTBA 4JEDA 2C80A 5DAKA 3TKQA 4G0KA 4ILFA 3MNGA 4OCEA 1OKTA 1ERVA 4G19A 2F9SA 2M80A 2LQOA 1K0BA 3MDKA 4TR4A 4PXOA 1K0NA 3IPZA 1ZCPA 3VI5A 1GLQA 2H01A 2HSYA 2VCXA 4IN0A 6GSVA 2HRNA 3PPUA 3QAVA 1AQXA 5F0GA 2CVBA 1OC3A 3ZMLA 2K8SA 3ZL5A 3GURA 4GQFA 4GSNA 1Z9HA 3M9KA 1A2JA 3C1SA 4ICYA 1O73A 5DAKB 1BQ7A 4KNDA 1AIUA 3CQFA 5GAPD 5F07A 1XCCA 2DC5A 2VUPA 4MDCA 4BL7A 1HNAA 2CAIA 5L71A 3FZ4A 2XPEA 1M9AA 1BJXA 4WBRD 5CO3A 2H1AA 1GSEA 3TB2A 4LMWA 3GRXA 3R2QA 4JR6A 4BWSA 5KOWA 4KE3A 2RUFA 3D21A 2VM2A 1O81A 1JZOA 3G9BA 3VI7A 4X4JA 4EKZA 4MZCA 3GKXA 4TR3A 1A0FA 3UBKA 1YQ1A 3FZ5A 1DBYA 1PN0A 3EPTA 3CMIA 4PTSA 3CYNA 2HRFA 3ZYWA 1EP8A 4HZ4A 4J57E 1R7HA 4P3YB 2PBJA 3BBYA 1OC9A 2EC4A 4WXTA 2L57A 5DALA 1SK2A 1F9MA 4BL7B 5HFKA 4JRRA 3KJYA 5D9VA 5GSSA 2LEGA 2FA8A 5KOXA 2RIIA 2H0GA 4I6XA 4KDXA 2I9HA 3MIXA 1XFLA 5EVOA 2R0PA 2EIRA 5C04A 3M0FA 3IAS2 1J9BA 5E59A 3LORA 3FZ9A 1G7OA 3APOA 3M1GA 2GSTA 5CRHA 2DLXA 1PN9A 5AISA 5ELAA 3KIJA 4HQSA 4PNGA 3U5RE 3O76A 3QFAC 3ZFBA 2H30A 2PUKC 5IO0A 1WMJA 2REMA 4CY8A 1WP0A 2I1UA 2YV9A 1I9DA 2VOCA 1SD9A 1A23A 2P5RA 1TDIA 1O7UA 4EIPA 1OC9B 1KBNA 1K0DA 2OBIA 4XHMA 1O8XA 4MMMA 4TXOA 5DALB 1GNWA 1M0UA 2IMFA 1JZRA 1EWXA 3HYPA 1ZMAA 4K0NA 4GQCA 4G10A 4I2TA 1X9MB 3VWUA 2NVLA 3IK7A 3GL3A 2OKAA 2VCVA 3TOUA 4E8EA 3CSIA 4IJ3A 1M2AA 4N0VA 5EY6A 3IHQA 5ECKB 3VWXA 5BRTA 1WPIA 3F4RA 1Z7RA 1ZYQB 3L4NA 3GFKA 3R3EA 3UVHA 1SJIA 2G0FA 1YJ6A 3IXRA 2VL2A 2L6DA 4IS0A 1PSQA 3J7Yk 3ZLPA 3HVNA 1F2EA 1GTUA 4V1Ap 2AJQB 1LJRA 2AV4A 4WETA 2GQKA 3EWLA 5F06A 1FVKA 4HJMA 1MD4A 3ERGA 2VO4A 4TXOB 5DJMA 3RAZA 3ISOA 2BTOT 2LSTA 5JCUA 5CYYA 4IBPA 1GRXA 4BWQA 1UN2A 2H75A 3TKPA 5D9WA 2CZ2A 3IHGA 4KF9A 2PU9C 2D2ZA 3G7YA 1Z5YE 3FHKA 2CT6A 1OAZA 3BCIA 5DVBA 4NV2A 3LGCA 2L6CA 2VCZA 1H75A 2UZ8A 4PX1A 1OKDA 4WKWA
chains in the Genus database with same CATH topology
5F8BA 2R4VA 1M9BA 3LWAA 2X4AA 2YNXA 1YEPA 5G31A 1SYXA 3GIXA 1FOHA 1GTAA 3P2AA 3EYTA 4K2XA 5KEJA 4POMA 2A2PA 1U88A 3TUEA 4K9ZA 2LJAA 4Q5RA 5FHIA 1NSWA 2E2GA 1XWKA 2X8GA 3DYRA 3C7MA 2R37A 4V1Ag 2VLTA 4IQ1A 3NZNA 4GRFA 5J4UA 5J41A 1EOGA 3UL3A 3L9SA 1R26A 1TP9A 3LYKA 4TW5A 5B6MA 5J9CA 3L9UA 4AF2A 3F6DA 2AAWA 3A2XA 3F0IA 1QK8A 1V57A 2M72A 3ZITA 1TK5B 2LS5A 3EC3A 1KNGA 3M8NA 1V40A 2VL2C 5J5NA 1B4QA 3GX0A 5A4WA 4EDYA 3TRQA 2QA1A 12GSA 3C1RA 4BPYA 1SD8A 2H74A 3GNJA 4WR4A 3MAKA 1PX7A 2DKIA 4ZB8A 3KMNA 2E0QA 3VK9A 2XBIA 4KUNA 2TRXA 3D0ZA 4MPFA 4L0WA 1BYEA 2QSIA 2DJKA 3H8QA 3LQ7A 3APQA 2DBCA 4K6XA 2OE0A 1ILOA 2VCQA 2QC7A 5H5SA 2H70A 2RM6A 4PQHA 1TTZA 4IHUA 5DQYA 1SU9A 5D96A 3DEXA 1SL1B 5ECHB 3CBUA 1X9WB 3TGZA 2X99A 2DMLA 4NXIA 2ES7A 3TRXA 2GVPA 2JADA 3A3TA 2WULA 4FYCA 1G0TA 3UAPA 2VL3A 4F0CA 3Q19A 5E4WA 1EGRA 1S3DA 3DMLA 2A4HA 2X64A 2DIZA 2H1DA 4HI7A 5AN1A 2H0IA 1RK4A 3W8SA 3IRAA 4MF7A 5G1LA 3EE2A 4I5QA 3ZVJD 4D73A 1M2DA 4EDZA 5IOXA 1TRWA 4OFTA 4K5SA 4IELA 1TRVA 2FD3A 4DSSA 5COHA 3IV4A 3WYWA 1YZXA 3H93A 5CRGA 3KEBA 1GSDA 6GSUA 2V6OA 8GSSA 2NBSA 2H71A 3F63A 3EMXA 3DWVA 3C73A 2JSYA 3WT2A 2NPBA 2FWEA 3UEMA 4OO4A 4JBBA 1GNEA 5D9XA 3LXTA 3LW9A 5DCGA 5B8BA 4HUAA 3US3A 4O5RA 2AUVA 1M7TA 4YQUA 2NTOA 2X8HA 4ISDA 4MF6A 1EOHA 5AGYA 2IIYA 5ELGA 2V41A 2IL3A 3ZMKA 3KD0A 5ECNB 1G7EA 1XW6A 1WIKA 4KDYA 5D9TA 3EU3A 5G2ZA 4D73B 1K0CA 2IMIA 4NAXA 4ZIJA 2DJ1A 2VCTA 3F6FA 4DSSB 2JSZA 3HHVA 2OE1A 2LRTA 1N8JA 3GSSA 3APSA 4ZXGA 1B4PA 4G0LA 3KXOA 2B3SA 4KW6A 4E8HA 2B7KA 4DSQA 4MK3A 3GH6A 3E3EA 6GSXA 3GUSA 3I43A 4Z2RA 5ECOB 4Z2TA 1A8YA 2O87A 3F3QA 1SJZA 2C0FA 2GT6A 3KM6A 4O92A 3HZ4A 2ALBA 4LMVA 4V2LA 1DUGA 2KP1A 3QR6A 1RW1A 3HVVA 1E2YA 4J56E 2ON7A 3QD9A 2GLRA 4A5PA 4L0UA 6GSYA 1FHEA 2FUG2 4CHSA 1T4ZA 2C3NA 4CDOA 4EC0A 4MNNA 5CAXA 2YWOA 2GS3A 2WCIA 1X5EA 4MF5A 3O3TA 2MZCA 3NIVA 1GSFA 3D6IA 4WF4A 3UVTA 4MP4A 1U3IA 2GZYA 4PQIA 1W4VA 1WRYA 3EVIA 3L0HA 1DSBA 4YAVA 3ZVJA 3IBHA 5ID2A 1VF4A 4K0GA 3DXBA 2G2QA 1SK1A 1G6WA 4MH3A 4HOJA 2R0CA 2E2MA 4LA1A 1M2BA 4I8BA 5DCHA 4NMUA 5IQYA 4ZBBA 2TIRA 1T7PB 6GSTA 5ECSA 4ID0A 4HDEA 2HI7A 5H5RA 2LNSA 1T4YA 1VRSD 5ECIB 1EZKA 2IWTA 1IYIA 4OD7A 1TRUA 1QXHA 3SWLA 5KN1A 3K8NA 4YQMA 1KTEA 3VWWA 3QPMA 3HXSA 2QA2A 3M9JA 1WOUA 4JZQA 3SBCA 4ML6A 3CRUA 2LNTA 5ABRA 2RLIA 4TR1A 3NOFA 1XOBA 2MMZA 3E0UA 1SKRB 2KOKA 2DJJA 2H0HA 3FR6A 5JWRB 2KHPA 5ID2B 1NHOA 4J2FA 3DVWA 2AB6A 4MABA 1UC7A 3CRTA 2YV7A 1XWGA 3ME7A 1OE8A 4HZ2A 1BG5A 1R5PA 1Y25A 3QMXA 1MDKA 2ZNMA 1K0MA 2QKEA 4OFMA 1X0RA 1A8LA 4F03A 3J7Yb 4LL4B 2C4JA 2HXKA 2YOIA 2BMXA 1C72A 2CX3A 2TRCP 1GUMA 4ML1A 3LEFA 7GSSA 2OBKA 1QQ2A 1WWJA 1SJ6A 3VPQA 4TR1B 4ZBDA 1TRSA 4EO3A 4DEJA 2H1GA 1V9WA 4BA7A 4HQZA 1Q98A 4IJIA 2RM5A 1TI1A 1ZYPA 1EV9A 2CV4A 5J3RA 1HYUA 1K3YA 2HNLA 2YP6A 2LV3A 2WJUA 2VAFA 2XHFA 5IMFA 1PA3A 4HS1A 1THOA 3ZTLA 1U6TA 2L5OA 2OACA 4YAPA 2R3XA 3QFBC 1PKZA 3FMWA 1PMTA 3RHBA 2HZFA 3G7JA 5HFIA 4EE0A 5DQSA 3F8UA 19GSA 2H8LA 2HT9A 2PN8A 4NHZA 2FWHA 1Z3EA 3P7XA 1A0RP 4N30A 2GDRA 2LKUA 1GP1A 4AJ8A 4BVXA 2WGRA 5HQPA 4GWRA 3HJMA 2DJ0A 4AJ7A 2XPDA 6GSSA 2Z9SA 4N10A 4Q5QA 1FVJA 3KCMA 2CQ9A 4LLRA 3GL5A 5HFGA 2HYXA 4IGJA 2ON5A 2YZUA 2O8VB 1U87A 1CQGA 5G1KA 2DJ2A 5AIVA 3H79A 2H6YA 4GSSA 2F8FA 1WJKA 2V6KA 3ZIVA 3RBTA 3GYKA 3HCZA 1ON4A 3LXZA 1EGOA 1VF3A 4ECBA 1YY7A 2HFDA 3VWVA 13GSA 4G0IA 3WGEA 1QMVA 1MEKA 2WB9A 4FH8A 4K7NA 1KEBA 4WF5A 5GZZB 4ECIA 1I5GA 3Q74A 3KMOA 4BVXB 2HLSA 2VIMA 1V2AA 1R5AA 1F3AA 1UVZA 2VLUA 3BJ5A 2YANA 4MPGA 4K5RA 5JCGA 3HVSA 1U3AA 1JFUA 1WE0A 4NHWA 1HQOA 4TKYA 3LYPA 4IVFA 3UOMA 3TKRA 5LNKe 1JLVA 2OADA 5IPGA 1TOFA 2GSRA 4MJEA 5ENUA 3TCOA 3UIWA 3FW2A 2N5BA 1F6MC 2HRKA 3DGQA 2HSHA 5HR3A 4G2EA 1GUHA 2HZEA 1GLPA 4G9HA 20GSA 3C8EA 9GSSA 1AQWA 1HNBA 4TXVA 1E6BA 1OYJA 1VF2A 4Z7XA 3VFIA 3LSZA 5JCWA 4F2IA 1DE1A 1M99A 2AHEA 4RI7A 2B1KA 18GSA 3IC8A 5ECQB 2LRCA 3BOAA 2H73A 3IOSA 1T3BA 4X43A 2B1LA 4JU5A 16GSA 2N5FA 5ECLB 2VD0A 4YH2A 5IMZA 2O7KA 2KP2A 1PGTA 4FYBA 2VL9A 1SL0B 4JE1A 4PURA 3RPPA 4O5QA 4Z2UA 1YKAA 5EPFA 2HZEB 3ED3A 3TDGA 4GCIA 3FK8A 4F9ZA 4EUYA 4PUFC 1O8WA 5IM9A 2DIYA 2DJ3A 4XRAA 4ECJA 3F3RA 2F3MA 2PERA 3VLNA 3EMPA 2JZTA 2GZZA 4K7IA 4NPBA 2KUCA 2FNOA 1XVWA 5IMDA 5IPHA 1TW9A 1FO5A 5A4VA 2IMEA 1GWCA 1PQNA 2DSAA 1CQHA 1EEJA 3HKRA 3FR3A 4QL7A 4MJBA 1VGLA 1H4OA 1SK0A 4KSOA 4K2DA 3DIEA 4X0XA 2JZRA 2ZCTA 1K3OA 2DKHA 4PGTA 1O6JA 5KN0A 1YEXA 4HU9A 5G5EA 3GV1A 3KH7A 2R6KA 2MBSA 2CVDA 2B6MA 1BEDA 5ECPB 2CAQA 3CXGA 1YF1A 2J9HA 1F37A 1Z6NA 2K8VA 2B5YA 3H1NA 1TU8A 4EIQA 3IA1A 1X9SB 5GSTA 3KZQA 4L5OA 1TK8B 1ZZYA 5IMCA 1NW2A 1R4WA 3PGTA 3A2WA 4F82A 1ML6A 2R0GA 3KGKA 3GKKA 2BJXA 1TKDB 3PH9A 4HEA2 4OFNA 1XWCA 5JWOB 3LG6A 4V2MA 2HE3A 4I2UA 3F4TA 2PPTA 2K9FA 3HJPA 3AY8A 4GLTA 1ABAA 3G7IA 5CREA 2EIQA 3P90A 2EIOA 1MD3A 2P5QA 4RUVA 5A4UA 2VLVA 1T00A 10GSA 2B5XA 2NDOA 3HD5A 3D4TA 1ZL9A 4TRXA 4MZBA 5C00A 1G6YA 5HR1A 4DSRA 1PD21 3ZIJA 2B7JA 1SKSB 2OJLA 2I81A 1K0AA 4BVYA 5D8IA 2IFQA 1QFNA 2ZUPA 3O6TA 1J0FA 2X49A 4H86A 5B6NA 2OA7A 3GA4A 2LQQA 2H6XA 4KX4A 2MYGA 2A4VA 1A2MA 1GULA 1MDIA 1K3LA 2PVOC 5HR2A 1YF0A 1Q4JA 1Y6EA 2JL4A 3H4KA 4ZL7A 2YWIA 1OE7A 1YDKA 4K8MA 3HA9A 1JZWA 3N5OA 3ME8A 3IK9A 5DJLA 4K1FA 2FY6A 4N11A 5BMUA 5KN3A 3I69A 2FWFA 3TJKA 5CP1A 1S3CA 4F0BA 2KLXA 1THXA 4TR0A 4MLYA 2FA4A 4MCUA 4EXJA 1FB0A 4BVYB 2IFQB 3V1WA 14GSA 1XWBA 3F9UA 3ZREA 4EF0A 2GTUA 3IR4A 5EL8A 2C8UA 3CSHA 4USSA 2C1YA 1FW1A 4ZILA 4EVMA 3TJBA 4NWYA 3UBLA 4KCAA 1SENA 1Z6MA 1O85A 2PWJA 1AW9A 2LJKA 1SL2B 1AAZA 4CY6A 3TRPA 1XW9A 3ERWA 2WDUA 4OMVA 1GSSA 5HR0A 1FG4A 4ACSA 3GN3A 2YWNA 3TKSA 3EINA 1ZYNA 4L5LA 1X5DA 4IKHA 1AUCA 4POLA 3ZZXA 2RUEA 3BD2A 3FR9A 1Z7PA 4GXZA 5B7CA 3TKSE 2PMTA 2FGXA 3QCPA 5GAND 1V98A 2B5EA 4CW9A 3DKSA 4MZWA 2I3YA 2R5GA 2AYTA 2WS2A 1FAAA 4K7OA 2C3TA 4KGIA 3IE3A 3W6GA 3QAGA 3KP9A 3DVXA 3HZ8A 3VPTA 3MSZA 4O5UA 3GMFA 2XBQA 4AJ6A 4LL1B 3GKMA 5IMAA 2FLSA 3KTLA 2K6VA 5JWQB 2H6ZA 4ZB6A 3CTGA 3KP8A 4V2NA 2C0GA 5AIXA 1AXDA 3MWHA 1USBA 2PGTA 2C3QA 2OE3A 2WFCA 4NV5A 2M46A 2FCHA 2L5LA 1ERTA 5IIZA 2HSMA 1XIYA 1TK0B 4L8EA 1XVQA 2GQMA 1FOVA 4KDUA 1OVNA 2H72A 3GHAA 1UA5A 5FT3A 2GSQA 3VURA 3FKFA 3FYGA 4GTUA 3ZRDA 1GL8A 3QDNA 3OR5A 1TU7A 4XS4A 2L4QA 2JZSA 4X1UA 2QGVA 1B48A 6GSWA 2F8AA 3TKSC 3WD6A 2V1MA 4XTSA 1EV4A 3CSJA 4YKFA 3JCML 4WR5A 22GSA 4RQRA 3D5JA 2H19A 2LUSA 5CRDA 3GSTA 4ZL9A 3S9FA 1URMA 3UJ1A 1J08A 4XIHA 4GSTA 1XXUA 1F3BA 2I4AA 1AC1A 4IQAA 1TJDA 5DBQA 1IYHA 1OC8A 2PVQA 3ZFLA 3I6AA 3QOUA 4MH2A 1V58A 4DVCA 3L78A 2IPAA 5INYA 4Q5NA 4O32A 1PRXA 1XWAA 3D4MA 4PUAA 3GTUA 1EP7A 2C0EA 3M3MA 5FWGA 1GSUA 2L4CA 4KH7A 3FEUA 5LCZA 4XS4B 4FIWA 3N9JA 3Q18A 4I97A 3DRNA 3RHCA 3A2VA 3EU4A 2CVKA 4RI6A 4KA0A 1MTCA 1PX6A 1SYRA 1PL2A 2JACA 5ECMB 2HRAA 4WEYA 5B8AA 3Q6OA 2H66A 4HU7A 3IDVA 5IO2A 2MMNA 5D73A 4ECCA 1FB6A 1PKWA 2K18A 2GZPA 3CTFA 5J9BA 3FY7A 2GGTA 1DE2A 1B9YC 17GSA 2MMAA 3HY2A 2IMDA 3TOTA 1T1VA 11GSA 5CRWA 4MJAA 2LTKA 1BAYA 4QL9A 5G5FA 4OO5A 1ST9A 4POKA 3HDCA 5D93A 1XZOA 4Q5FA 1ERUA 3PINA 2YCDA 1ZGNA 1QGVA 3GTUB 1TXXA 1BX9A 3KTBA 4XRDA 2R2JA 2LJRA 5LD0A 2YZHA 2GSSA 1GUKA 1HNCA 3LJRA 1GSQA 4N0ZA 1LBKA 4HJ2A 4PNFA 4XS6A 1A24A 3HJOA 3WGXA 2YN1A 5A5KA 2IMKA 4OCFA 3IAM2 3QAWA 4XS1A 2YJHA 1NHYA 2N5AA 3C71A 4MA9A 1T8EB 4O7HA 1GTIA 2MMOA 3EURA 2V2GA 4IP1A 2O89A 5H5QA 4EL1A 4ULXA 2CA8A 4KCEA 1YKCA 1QUWA 3E9JB 3WGDA 3HVXA 5CNWA 5G30A 2J23A 1MDJA 1ERWA 1XOAA 4KAEA 1XPVA 2O85A 2XC2A 4MJCA 2JU5A 3TJGA 2VCWA 3KH9A 2WZ9A 5IOWA 4TOPA 3ERFA 2WRTA 4TN8A 1ACVA 3FZAA 4ZBAA 4KSMA 2GT5A 4AGSA 2H1BA 1JHBA 4IW9A 2E7PA 1GH2A 4ZB9A 1XBSA 1S3AA 1HD2A 3D22A 2GQLA 4YKGA 2FHEA 3FRCA 2A2RA 2C0DA 2CZ3A 1JZDA 1NM3A 1B8XA 4YQVA 3W8JA 1VF1A 4FYUA 3TJFA 1A2LA 3BCKA 1TI3A 2A2SA 4FQUA 2MBTA 4POBA 4XCSA 3IC4A 2YJ7A 1N2AA 4IP6A 1RQMA 4JR4A 4WBJA 4QQ7A 2VD1A 3WT1A 2VM1A 3L9VA 3F4SA 2V32A 3I9V2 2IN3A 2F51A 2YPMA 1K0OA 3GX8A 4RQXA 2IJYA 3U6VA 2FWGA 3A5IA 1GSYA 5ECRB 1AQVA 1B9XC 3P8WA 2P31A 3UMAA 1PL1A 1X5CA 2CX4A 1EEMA 3RPNA 5KN2A 4KB3A 2P0GA 3GKNA 2H76A 4PQ1A 5IMVA 1W89A 3MYDA 3RDWA 4GF0A 3DD3A 4OWYA 3TJJA 5F05A 4ZL8A 2LRNA 1XW5A 3LFLA 2DMMA 2X8CA 3GH9A 1LU4A 1JLWA 3UARA 3A5WA 1ZYEA 2L59A 4TVEA 1SKWB 5DDLA 2YWMA 4FO5A 3PR8A 1ZOFA 1GTBA 4JEDA 2C80A 5DAKA 3TKQA 4G0KA 4ILFA 3MNGA 4OCEA 1OKTA 1ERVA 4G19A 2F9SA 2M80A 2LQOA 1K0BA 3MDKA 4TR4A 4PXOA 1K0NA 3IPZA 1ZCPA 3VI5A 1GLQA 2H01A 2HSYA 2VCXA 4IN0A 6GSVA 2HRNA 3PPUA 3QAVA 1AQXA 5F0GA 2CVBA 1OC3A 3ZMLA 2K8SA 3ZL5A 3GURA 4GQFA 4GSNA 1Z9HA 3M9KA 1A2JA 3C1SA 4ICYA 1O73A 5DAKB 1BQ7A 4KNDA 1AIUA 5GAPD 5F07A 1XCCA 2DC5A 2VUPA 4MDCA 4BL7A 1HNAA 2CAIA 5L71A 3FZ4A 2XPEA 1M9AA 1BJXA 4WBRD 5CO3A 2H1AA 1GSEA 3TB2A 4LMWA 3GRXA 3R2QA 4JR6A 4BWSA 5KOWA 4KE3A 2RUFA 3D21A 2VM2A 1O81A 1JZOA 3G9BA 3VI7A 4X4JA 4EKZA 4MZCA 3GKXA 4TR3A 1A0FA 3UBKA 1YQ1A 3FZ5A 1DBYA 1PN0A 3EPTA 3CMIA 4PTSA 3CYNA 2HRFA 3ZYWA 1EP8A 4HZ4A 4J57E 1R7HA 4P3YB 2PBJA 3BBYA 1OC9A 2EC4A 4WXTA 2L57A 5DALA 1SK2A 1F9MA 4BL7B 5HFKA 4JRRA 3KJYA 5D9VA 5GSSA 2LEGA 2FA8A 5KOXA 2RIIA 2H0GA 4I6XA 4KDXA 2I9HA 3MIXA 1XFLA 5EVOA 2R0PA 2EIRA 5C04A 3M0FA 3IAS2 1J9BA 5E59A 3LORA 3FZ9A 1G7OA 3APOA 3M1GA 2GSTA 5CRHA 2DLXA 1PN9A 5AISA 5ELAA 3KIJA 4HQSA 4PNGA 3U5RE 3O76A 3QFAC 3ZFBA 2H30A 2PUKC 5IO0A 1WMJA 2REMA 4CY8A 1WP0A 2I1UA 2YV9A 1I9DA 2VOCA 1SD9A 1A23A 2P5RA 1TDIA 1O7UA 4EIPA 1OC9B 1KBNA 1K0DA 2OBIA 4XHMA 1O8XA 4MMMA 4TXOA 5DALB 1GNWA 1M0UA 2IMFA 1JZRA 1EWXA 3HYPA 1ZMAA 4K0NA 4GQCA 4G10A 4I2TA 1X9MB 3VWUA 2NVLA 3IK7A 3GL3A 2OKAA 2VCVA 3TOUA 4E8EA 3CSIA 4IJ3A 1M2AA 4N0VA 5EY6A 3IHQA 5ECKB 3VWXA 5BRTA 1WPIA 3F4RA 1Z7RA 1ZYQB 3L4NA 3GFKA 3R3EA 3UVHA 1SJIA 2G0FA 1YJ6A 3IXRA 2VL2A 2L6DA 4IS0A 1PSQA 3J7Yk 3ZLPA 1F2EA 1GTUA 4V1Ap 2AJQB 1LJRA 2AV4A 4WETA 2GQKA 3EWLA 5F06A 1FVKA 4HJMA 1MD4A 3ERGA 2VO4A 4TXOB 5DJMA 3RAZA 3ISOA 2BTOT 2LSTA 5JCUA 5CYYA 4IBPA 1GRXA 4BWQA 1UN2A 2H75A 3TKPA 5D9WA 2CZ2A 3IHGA 4KF9A 2PU9C 2D2ZA 3G7YA 1Z5YE 3FHKA 2CT6A 1OAZA 3BCIA 5DVBA 4NV2A 3LGCA 2L6CA 2VCZA 1H75A 2UZ8A 4PX1A 1OKDA 4WKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F8B A;  2R4V A;  1M9B A;  3LWA A;  2YNX A;  1YEP A;  5G31 A;  1SYX A;  3GIX A;  1GTA A;  3P2A A;  3EYT A;  5KEJ A;  4POM A;  1U88 A;  3TUE A;  4K9Z A;  2LJA A;  4Q5R A;  5FHI A;  1NSW A;  2E2G A;  1XWK A;  2X8G A;  3DYR A;  3C7M A;  2R37 A;  4V1A g;  2VLT A;  4IQ1 A;  3NZN A;  4GRF A;  5J4U A;  5J41 A;  1EOG A;  3UL3 A;  3L9S A;  1R26 A;  1TP9 A;  3LYK A;  4TW5 A;  5B6M A;  5J9C A;  3L9U A;  4AF2 A;  3F6D A;  2AAW A;  3A2X A;  3F0I A;  1QK8 A;  1V57 A;  2M72 A;  3ZIT A;  1TK5 B;  2LS5 A;  3EC3 A;  1KNG A;  3M8N A;  1V40 A;  2VL2 C;  5J5N A;  1B4Q A;  3GX0 A;  5A4W A;  4EDY A;  3TRQ A;  12GS A;  3C1R A;  4BPY A;  1SD8 A;  2H74 A;  3GNJ A;  4WR4 A;  3MAK A;  1PX7 A;  4ZB8 A;  3KMN A;  2E0Q A;  3VK9 A;  2XBI A;  4KUN A;  2TRX A;  3D0Z A;  4MPF A;  4L0W A;  1BYE A;  2QSI A;  2DJK A;  3H8Q A;  3LQ7 A;  3APQ A;  2DBC A;  4K6X A;  2OE0 A;  1ILO A;  2VCQ A;  2QC7 A;  5H5S A;  2H70 A;  2RM6 A;  4PQH A;  1TTZ A;  4IHU A;  5DQY A;  1SU9 A;  5D96 A;  3DEX A;  1SL1 B;  5ECH B;  3CBU A;  1X9W B;  3TGZ A;  2X99 A;  2DML A;  4NXI A;  2ES7 A;  3TRX A;  2GVP A;  2JAD A;  3A3T A;  2WUL A;  4FYC A;  1G0T A;  3UAP A;  2VL3 A;  4F0C A;  3Q19 A;  5E4W A;  1EGR A;  1S3D A;  3DML A;  2X64 A;  2DIZ A;  2H1D A;  4HI7 A;  5AN1 A;  2H0I A;  1RK4 A;  3W8S A;  3IRA A;  4MF7 A;  5G1L A;  3EE2 A;  4I5Q A;  3ZVJ D;  4D73 A;  1M2D A;  4EDZ A;  5IOX A;  1TRW A;  4OFT A;  4IEL A;  1TRV A;  2FD3 A;  4DSS A;  5COH A;  3IV4 A;  3WYW A;  1YZX A;  3H93 A;  5CRG A;  3KEB A;  1GSD A;  6GSU A;  2V6O A;  8GSS A;  2NBS A;  2H71 A;  3F63 A;  3EMX A;  3DWV A;  3C73 A;  2JSY A;  3WT2 A;  2NPB A;  2FWE A;  3UEM A;  4OO4 A;  4JBB A;  1GNE A;  5D9X A;  3LXT A;  5DCG A;  5B8B A;  4HUA A;  3US3 A;  4O5R A;  2AUV A;  1M7T A;  4YQU A;  2NTO A;  2X8H A;  4ISD A;  4MF6 A;  1EOH A;  5AGY A;  2IIY A;  5ELG A;  2V41 A;  2IL3 A;  3ZMK A;  3KD0 A;  5ECN B;  1G7E A;  1XW6 A;  1WIK A;  4KDY A;  5D9T A;  3EU3 A;  5G2Z A;  4D73 B;  1K0C A;  2IMI A;  4NAX A;  4ZIJ A;  2DJ1 A;  2VCT A;  3F6F A;  4DSS B;  2JSZ A;  3HHV A;  2OE1 A;  2LRT A;  1N8J A;  3GSS A;  3APS A;  4ZXG A;  1B4P A;  3KXO A;  2B3S A;  4KW6 A;  4E8H A;  2B7K A;  4DSQ A;  4MK3 A;  3GH6 A;  3E3E A;  6GSX A;  3GUS A;  3I43 A;  5ECO B;  1A8Y A;  2O87 A;  3F3Q A;  1SJZ A;  2C0F A;  2GT6 A;  3KM6 A;  4O92 A;  3HZ4 A;  2ALB A;  4LMV A;  4V2L A;  1DUG A;  2KP1 A;  3QR6 A;  1RW1 A;  3HVV A;  1E2Y A;  4J56 E;  2ON7 A;  3QD9 A;  2GLR A;  4L0U A;  6GSY A;  1FHE A;  2FUG 2;  4CHS A;  1T4Z A;  2C3N A;  4CDO A;  4EC0 A;  5CAX A;  2YWO A;  2GS3 A;  2WCI A;  1X5E A;  4MF5 A;  3O3T A;  2MZC A;  3NIV A;  1GSF A;  3D6I A;  4WF4 A;  3UVT A;  4MP4 A;  1U3I A;  2GZY A;  4PQI A;  1W4V A;  1WRY A;  3EVI A;  3L0H A;  1DSB A;  4YAV A;  3ZVJ A;  3IBH A;  5ID2 A;  1VF4 A;  4K0G A;  3DXB A;  2G2Q A;  1SK1 A;  1G6W A;  4MH3 A;  4HOJ A;  2E2M A;  4LA1 A;  1M2B A;  4I8B A;  5DCH A;  4NMU A;  5IQY A;  4ZBB A;  2TIR A;  1T7P B;  6GST A;  5ECS A;  4ID0 A;  4HDE A;  2HI7 A;  5H5R A;  2LNS A;  1T4Y A;  1VRS D;  5ECI B;  1EZK A;  2IWT A;  1IYI A;  4OD7 A;  1TRU A;  1QXH A;  3SWL A;  5KN1 A;  3K8N A;  4YQM A;  1KTE A;  3VWW A;  3QPM A;  3HXS A;  3M9J A;  1WOU A;  4JZQ A;  3SBC A;  4ML6 A;  3CRU A;  2LNT A;  5ABR A;  2RLI A;  4TR1 A;  3NOF A;  1XOB A;  2MMZ A;  3E0U A;  1SKR B;  2KOK A;  2DJJ A;  2H0H A;  3FR6 A;  5JWR B;  2KHP A;  5ID2 B;  1NHO A;  4J2F A;  3DVW A;  2AB6 A;  4MAB A;  1UC7 A;  3CRT A;  2YV7 A;  1XWG A;  3ME7 A;  1OE8 A;  4HZ2 A;  1BG5 A;  1R5P A;  1Y25 A;  3QMX A;  1MDK A;  2ZNM A;  1K0M A;  2QKE A;  4OFM A;  1X0R A;  1A8L A;  4F03 A;  3J7Y b;  4LL4 B;  2C4J A;  2HXK A;  2YOI A;  2BMX A;  1C72 A;  2CX3 A;  2TRC P;  1GUM A;  4ML1 A;  3LEF A;  7GSS A;  2OBK A;  1QQ2 A;  1WWJ A;  1SJ6 A;  3VPQ A;  4TR1 B;  4ZBD A;  1TRS A;  4EO3 A;  4DEJ A;  2H1G A;  1V9W A;  4BA7 A;  4HQZ A;  1Q98 A;  4IJI A;  2RM5 A;  1TI1 A;  1EV9 A;  2CV4 A;  5J3R A;  1HYU A;  1K3Y A;  2HNL A;  2YP6 A;  2LV3 A;  2WJU A;  2VAF A;  2XHF A;  5IMF A;  1PA3 A;  4HS1 A;  1THO A;  3ZTL A;  1U6T A;  2L5O A;  2OAC A;  4YAP A;  2R3X A;  3QFB C;  1PKZ A;  1PMT A;  3RHB A;  2HZF A;  3G7J A;  5HFI A;  4EE0 A;  5DQS A;  3F8U A;  19GS A;  2H8L A;  2HT9 A;  2PN8 A;  4NHZ A;  2FWH A;  1Z3E A;  3P7X A;  1A0R P;  4N30 A;  2GDR A;  2LKU A;  1GP1 A;  4AJ8 A;  4BVX A;  2WGR A;  5HQP A;  4GWR A;  3HJM A;  2DJ0 A;  4AJ7 A;  2XPD A;  6GSS A;  2Z9S A;  4N10 A;  4Q5Q A;  1FVJ A;  3KCM A;  2CQ9 A;  4LLR A;  3GL5 A;  5HFG A;  2HYX A;  4IGJ A;  2ON5 A;  2YZU A;  2O8V B;  1U87 A;  1CQG A;  5G1K A;  2DJ2 A;  5AIV A;  3H79 A;  2H6Y A;  4GSS A;  2F8F A;  1WJK A;  2V6K A;  3ZIV A;  3RBT A;  3GYK A;  3HCZ A;  1ON4 A;  3LXZ A;  1EGO A;  1VF3 A;  4ECB A;  1YY7 A;  2HFD A;  3VWV A;  13GS A;  3WGE A;  1QMV A;  1MEK A;  2WB9 A;  4FH8 A;  4K7N A;  1KEB A;  4WF5 A;  5GZZ B;  4ECI A;  1I5G A;  3Q74 A;  3KMO A;  2HLS A;  2VIM A;  1V2A A;  1R5A A;  1F3A A;  1UVZ A;  2VLU A;  3BJ5 A;  2YAN A;  4MPG A;  5JCG A;  3HVS A;  1U3A A;  1JFU A;  1WE0 A;  4NHW A;  1HQO A;  4TKY A;  3LYP A;  4IVF A;  3UOM A;  3TKR A;  5LNK e;  1JLV A;  2OAD A;  5IPG A;  1TOF A;  2GSR A;  4MJE A;  5ENU A;  3TCO A;  3UIW A;  3FW2 A;  2N5B A;  1F6M C;  3DGQ A;  2HSH A;  5HR3 A;  4G2E A;  1GUH A;  2HZE A;  1GLP A;  4G9H A;  20GS A;  3C8E A;  9GSS A;  1AQW A;  1HNB A;  4TXV A;  1E6B A;  1OYJ A;  1VF2 A;  4Z7X A;  3VFI A;  3LSZ A;  5JCW A;  4F2I A;  1DE1 A;  1M99 A;  2AHE A;  4RI7 A;  2B1K A;  18GS A;  5ECQ B;  2LRC A;  3BOA A;  2H73 A;  3IOS A;  1T3B A;  4X43 A;  2B1L A;  4JU5 A;  16GS A;  2N5F A;  5ECL B;  2VD0 A;  4YH2 A;  5IMZ A;  2O7K A;  2KP2 A;  1PGT A;  4FYB A;  2VL9 A;  1SL0 B;  4JE1 A;  4PUR A;  3RPP A;  1YKA A;  5EPF A;  2HZE B;  3ED3 A;  3TDG A;  4GCI A;  3FK8 A;  4F9Z A;  4EUY A;  4PUF C;  1O8W A;  5IM9 A;  2DIY A;  2DJ3 A;  4XRA A;  4ECJ A;  3F3R A;  2F3M A;  2PER A;  3VLN A;  3EMP A;  2JZT A;  2GZZ A;  4K7I A;  4NPB A;  2KUC A;  2FNO A;  1XVW A;  5IMD A;  5IPH A;  1TW9 A;  1FO5 A;  5A4V A;  2IME A;  1GWC A;  1PQN A;  2DSA A;  1CQH A;  1EEJ A;  3HKR A;  3FR3 A;  4QL7 A;  4MJB A;  1VGL A;  1H4O A;  1SK0 A;  4KSO A;  4K2D A;  3DIE A;  4X0X A;  2JZR A;  2ZCT A;  1K3O A;  4PGT A;  1O6J A;  5KN0 A;  1YEX A;  4HU9 A;  5G5E A;  3GV1 A;  3KH7 A;  2R6K A;  2MBS A;  2CVD A;  2B6M A;  1BED A;  5ECP B;  2CAQ A;  3CXG A;  1YF1 A;  2J9H A;  1F37 A;  1Z6N A;  2K8V A;  2B5Y A;  3H1N A;  1TU8 A;  3IA1 A;  1X9S B;  5GST A;  3KZQ A;  4L5O A;  1TK8 B;  1ZZY A;  5IMC A;  1NW2 A;  1R4W A;  3PGT A;  3A2W A;  4F82 A;  1ML6 A;  3KGK A;  3GKK A;  2BJX A;  1TKD B;  3PH9 A;  4HEA 2;  4OFN A;  1XWC A;  5JWO B;  3LG6 A;  4V2M A;  2HE3 A;  4I2U A;  3F4T A;  2PPT A;  2K9F A;  3HJP A;  3AY8 A;  4GLT A;  1ABA A;  3G7I A;  5CRE A;  2EIQ A;  3P90 A;  2EIO A;  1MD3 A;  2P5Q A;  4RUV A;  5A4U A;  2VLV A;  1T00 A;  10GS A;  2B5X A;  2NDO A;  3HD5 A;  3D4T A;  1ZL9 A;  4TRX A;  4MZB A;  5C00 A;  1G6Y A;  5HR1 A;  4DSR A;  1PD2 1;  3ZIJ A;  2B7J A;  1SKS B;  2OJL A;  2I81 A;  1K0A A;  4BVY A;  5D8I A;  2IFQ A;  1QFN A;  2ZUP A;  3O6T A;  1J0F A;  4H86 A;  5B6N A;  2OA7 A;  3GA4 A;  2LQQ A;  2H6X A;  4KX4 A;  2MYG A;  2A4V A;  1A2M A;  1GUL A;  1MDI A;  1K3L A;  2PVO C;  5HR2 A;  1YF0 A;  1Q4J A;  1Y6E A;  2JL4 A;  3H4K A;  4ZL7 A;  2YWI A;  1OE7 A;  1YDK A;  4K8M A;  3HA9 A;  1JZW A;  3N5O A;  3ME8 A;  3IK9 A;  5DJL A;  4K1F A;  2FY6 A;  4N11 A;  5KN3 A;  3I69 A;  2FWF A;  3TJK A;  5CP1 A;  1S3C A;  4F0B A;  2KLX A;  1THX A;  4TR0 A;  4MLY A;  2FA4 A;  4MCU A;  4EXJ A;  1FB0 A;  2IFQ B;  3V1W A;  14GS A;  1XWB A;  3F9U A;  3ZRE A;  4EF0 A;  2GTU A;  3IR4 A;  5EL8 A;  2C8U A;  3CSH A;  2C1Y A;  1FW1 A;  4ZIL A;  4EVM A;  3TJB A;  4NWY A;  3UBL A;  4KCA A;  1SEN A;  1Z6M A;  1O85 A;  2PWJ A;  1AW9 A;  2LJK A;  1SL2 B;  1AAZ A;  3TRP A;  1XW9 A;  3ERW A;  2WDU A;  4OMV A;  1GSS A;  5HR0 A;  1FG4 A;  4ACS A;  3GN3 A;  2YWN A;  3TKS A;  3EIN A;  4L5L A;  1X5D A;  4IKH A;  1AUC A;  4POL A;  3ZZX A;  2RUE A;  3BD2 A;  3FR9 A;  1Z7P A;  4GXZ A;  5B7C A;  3TKS E;  2PMT A;  2FGX A;  3QCP A;  5GAN D;  1V98 A;  2B5E A;  4CW9 A;  3DKS A;  4MZW A;  2I3Y A;  2R5G A;  2AYT A;  2WS2 A;  1FAA A;  4K7O A;  2C3T A;  4KGI A;  3IE3 A;  3W6G A;  3QAG A;  3KP9 A;  3DVX A;  3HZ8 A;  3VPT A;  3MSZ A;  3GMF A;  2XBQ A;  4AJ6 A;  4LL1 B;  3GKM A;  5IMA A;  2FLS A;  3KTL A;  2K6V A;  5JWQ B;  2H6Z A;  4ZB6 A;  3CTG A;  3KP8 A;  4V2N A;  2C0G A;  5AIX A;  1AXD A;  3MWH A;  1USB A;  2PGT A;  2C3Q A;  2OE3 A;  2WFC A;  4NV5 A;  2M46 A;  2FCH A;  2L5L A;  1ERT A;  5IIZ A;  1XIY A;  1TK0 B;  4L8E A;  1XVQ A;  2GQM A;  1FOV A;  4KDU A;  1OVN A;  2H72 A;  3GHA A;  1UA5 A;  5FT3 A;  2GSQ A;  3VUR A;  3FKF A;  3FYG A;  4GTU A;  3ZRD A;  1GL8 A;  3QDN A;  3OR5 A;  1TU7 A;  4XS4 A;  2L4Q A;  2JZS A;  4X1U A;  2QGV A;  1B48 A;  6GSW A;  2F8A A;  3TKS C;  3WD6 A;  2V1M A;  4XTS A;  1EV4 A;  3CSJ A;  3JCM L;  4WR5 A;  22GS A;  4RQR A;  3D5J A;  2H19 A;  2LUS A;  5CRD A;  3GST A;  4ZL9 A;  3S9F A;  1URM A;  3UJ1 A;  1J08 A;  4XIH A;  4GST A;  1XXU A;  1F3B A;  2I4A A;  1AC1 A;  4IQA A;  1TJD A;  5DBQ A;  1IYH A;  1OC8 A;  2PVQ A;  3ZFL A;  3I6A A;  3QOU A;  4MH2 A;  1V58 A;  4DVC A;  3L78 A;  2IPA A;  5INY A;  4Q5N A;  4O32 A;  1PRX A;  1XWA A;  3D4M A;  4PUA A;  3GTU A;  1EP7 A;  2C0E A;  3M3M A;  5FWG A;  1GSU A;  2L4C A;  4KH7 A;  3FEU A;  5LCZ A;  4XS4 B;  4FIW A;  3N9J A;  3Q18 A;  4I97 A;  3DRN A;  3RHC A;  3A2V A;  3EU4 A;  2CVK A;  4RI6 A;  4KA0 A;  1MTC A;  1PX6 A;  1SYR A;  5ECM B;  1PL2 A;  2JAC A;  4WEY A;  5B8A A;  3Q6O A;  2H66 A;  4HU7 A;  3IDV A;  5IO2 A;  2MMN A;  5D73 A;  4ECC A;  1FB6 A;  1PKW A;  2K18 A;  2GZP A;  3CTF A;  5J9B A;  3FY7 A;  2GGT A;  1DE2 A;  1B9Y C;  17GS A;  2MMA A;  3HY2 A;  2IMD A;  3TOT A;  1T1V A;  11GS A;  5CRW A;  4MJA A;  2LTK A;  1BAY A;  4QL9 A;  5G5F A;  4OO5 A;  1ST9 A;  4POK A;  3HDC A;  5D93 A;  1XZO A;  4Q5F A;  1ERU A;  3PIN A;  2YCD A;  1ZGN A;  1QGV A;  3GTU B;  1TXX A;  1BX9 A;  3KTB A;  4XRD A;  2R2J A;  2LJR A;  5LD0 A;  2YZH A;  2GSS A;  1GUK A;  1HNC A;  3LJR A;  1GSQ A;  4N0Z A;  1LBK A;  4HJ2 A;  4PNF A;  4XS6 A;  1A24 A;  3HJO A;  3WGX A;  2YN1 A;  5A5K A;  2IMK A;  4OCF A;  3IAM 2;  3QAW A;  4XS1 A;  2YJH A;  1NHY A;  2N5A A;  3C71 A;  4MA9 A;  1T8E B;  4O7H A;  1GTI A;  2MMO A;  3EUR A;  2V2G A;  4IP1 A;  2O89 A;  5H5Q A;  4EL1 A;  4ULX A;  2CA8 A;  4KCE A;  1YKC A;  1QUW A;  3E9J B;  3WGD A;  3HVX A;  5CNW A;  5G30 A;  2J23 A;  1MDJ A;  1ERW A;  1XOA A;  4KAE A;  1XPV A;  2O85 A;  2XC2 A;  4MJC A;  2JU5 A;  3TJG A;  2VCW A;  3KH9 A;  2WZ9 A;  5IOW A;  4TOP A;  3ERF A;  2WRT A;  4TN8 A;  1ACV A;  3FZA A;  4ZBA A;  4KSM A;  2GT5 A;  4AGS A;  2H1B A;  1JHB A;  4IW9 A;  2E7P A;  1GH2 A;  4ZB9 A;  1XBS A;  1S3A A;  1HD2 A;  3D22 A;  2GQL A;  2FHE A;  3FRC A;  2A2R A;  2C0D A;  2CZ3 A;  1JZD A;  1NM3 A;  1B8X A;  4YQV A;  3W8J A;  1VF1 A;  4FYU A;  3TJF A;  1A2L A;  3BCK A;  1TI3 A;  2A2S A;  2MBT A;  4POB A;  4XCS A;  3IC4 A;  2YJ7 A;  1N2A A;  4IP6 A;  1RQM A;  4JR4 A;  4WBJ A;  4QQ7 A;  2VD1 A;  3WT1 A;  2VM1 A;  3L9V A;  3F4S A;  2V32 A;  3I9V 2;  2IN3 A;  2F51 A;  2YPM A;  1K0O A;  3GX8 A;  4RQX A;  2IJY A;  3U6V A;  2FWG A;  1GSY A;  5ECR B;  1AQV A;  1B9X C;  3P8W A;  2P31 A;  3UMA A;  1PL1 A;  1X5C A;  2CX4 A;  1EEM A;  3RPN A;  5KN2 A;  4KB3 A;  2P0G A;  3GKN A;  2H76 A;  4PQ1 A;  5IMV A;  1W89 A;  3RDW A;  4GF0 A;  3DD3 A;  4OWY A;  3TJJ A;  5F05 A;  4ZL8 A;  2LRN A;  1XW5 A;  3LFL A;  2DMM A;  2X8C A;  3GH9 A;  1LU4 A;  1JLW A;  3UAR A;  3A5W A;  1ZYE A;  2L59 A;  4TVE A;  1SKW B;  5DDL A;  2YWM A;  4FO5 A;  3PR8 A;  1ZOF A;  1GTB A;  4JED A;  2C80 A;  5DAK A;  3TKQ A;  4ILF A;  3MNG A;  4OCE A;  1OKT A;  1ERV A;  4G19 A;  2F9S A;  2M80 A;  2LQO A;  1K0B A;  3MDK A;  4TR4 A;  4PXO A;  1K0N A;  3IPZ A;  1ZCP A;  3VI5 A;  1GLQ A;  2H01 A;  2HSY A;  2VCX A;  4IN0 A;  6GSV A;  2HRN A;  3QAV A;  1AQX A;  5F0G A;  2CVB A;  1OC3 A;  3ZML A;  2K8S A;  3ZL5 A;  3GUR A;  4GQF A;  4GSN A;  1Z9H A;  3M9K A;  1A2J A;  3C1S A;  1O73 A;  5DAK B;  1BQ7 A;  4KND A;  1AIU A;  5GAP D;  5F07 A;  1XCC A;  2DC5 A;  2VUP A;  4MDC A;  4BL7 A;  1HNA A;  2CAI A;  5L71 A;  3FZ4 A;  2XPE A;  1M9A A;  1BJX A;  4WBR D;  5CO3 A;  2H1A A;  1GSE A;  3TB2 A;  4LMW A;  3GRX A;  3R2Q A;  4JR6 A;  4BWS A;  4KE3 A;  2RUF A;  3D21 A;  2VM2 A;  1O81 A;  1JZO A;  3G9B A;  3VI7 A;  4EKZ A;  4MZC A;  3GKX A;  4TR3 A;  1A0F A;  3UBK A;  1YQ1 A;  3FZ5 A;  1DBY A;  3CMI A;  3CYN A;  2HRF A;  3ZYW A;  1EP8 A;  4HZ4 A;  4J57 E;  1R7H A;  4P3Y B;  2PBJ A;  3BBY A;  1OC9 A;  2EC4 A;  4WXT A;  2L57 A;  5DAL A;  1SK2 A;  1F9M A;  5HFK A;  4JRR A;  3KJY A;  5D9V A;  5GSS A;  2LEG A;  2FA8 A;  2RII A;  2H0G A;  4I6X A;  4KDX A;  2I9H A;  1XFL A;  5EVO A;  2EIR A;  5C04 A;  3M0F A;  3IAS 2;  1J9B A;  5E59 A;  3LOR A;  3FZ9 A;  1G7O A;  3APO A;  3M1G A;  2GST A;  5CRH A;  2DLX A;  1PN9 A;  5AIS A;  5ELA A;  3KIJ A;  4HQS A;  4PNG A;  3U5R E;  3O76 A;  3QFA C;  3ZFB A;  2H30 A;  2PUK C;  5IO0 A;  1WMJ A;  2REM A;  1WP0 A;  2I1U A;  2YV9 A;  1I9D A;  2VOC A;  1SD9 A;  1A23 A;  2P5R A;  1TDI A;  1O7U A;  1OC9 B;  1KBN A;  1K0D A;  2OBI A;  4XHM A;  1O8X A;  4MMM A;  4TXO A;  5DAL B;  1GNW A;  1M0U A;  2IMF A;  1JZR A;  1EWX A;  3HYP A;  1ZMA A;  4K0N A;  4GQC A;  4G10 A;  4I2T A;  1X9M B;  3VWU A;  2NVL A;  3IK7 A;  3GL3 A;  2OKA A;  2VCV A;  3TOU A;  4E8E A;  3CSI A;  4IJ3 A;  1M2A A;  4N0V A;  5EY6 A;  3IHQ A;  5ECK B;  3VWX A;  1WPI A;  3F4R A;  1Z7R A;  1ZYQ B;  3L4N A;  3GFK A;  3UVH A;  1SJI A;  2G0F A;  1YJ6 A;  3IXR A;  2VL2 A;  2L6D A;  4IS0 A;  1PSQ A;  3J7Y k;  3ZLP A;  1F2E A;  1GTU A;  4V1A p;  2AJQ B;  1LJR A;  2AV4 A;  4WET A;  2GQK A;  3EWL A;  5F06 A;  1FVK A;  4HJM A;  1MD4 A;  3ERG A;  2VO4 A;  4TXO B;  5DJM A;  3RAZ A;  3ISO A;  2BTO T;  2LST A;  5JCU A;  5CYY A;  4IBP A;  1GRX A;  4BWQ A;  1UN2 A;  2H75 A;  3TKP A;  5D9W A;  2CZ2 A;  2PU9 C;  2D2Z A;  3G7Y A;  1Z5Y E;  3FHK A;  2CT6 A;  1OAZ A;  3BCI A;  5DVB A;  4NV2 A;  3LGC A;  2L6C A;  2VCZ A;  1H75 A;  4PX1 A;  1OKD A;  4WKW A; 
#chains in the Genus database with same CATH topology
 5F8B A;  2R4V A;  1M9B A;  3LWA A;  2X4A A;  2YNX A;  1YEP A;  5G31 A;  1SYX A;  3GIX A;  1FOH A;  1GTA A;  3P2A A;  3EYT A;  4K2X A;  5KEJ A;  4POM A;  2A2P A;  1U88 A;  3TUE A;  4K9Z A;  2LJA A;  4Q5R A;  5FHI A;  1NSW A;  2E2G A;  1XWK A;  2X8G A;  3DYR A;  3C7M A;  2R37 A;  4V1A g;  2VLT A;  4IQ1 A;  3NZN A;  4GRF A;  5J4U A;  5J41 A;  1EOG A;  3UL3 A;  3L9S A;  1R26 A;  1TP9 A;  3LYK A;  4TW5 A;  5B6M A;  5J9C A;  3L9U A;  4AF2 A;  3F6D A;  2AAW A;  3A2X A;  3F0I A;  1QK8 A;  1V57 A;  2M72 A;  3ZIT A;  1TK5 B;  2LS5 A;  3EC3 A;  1KNG A;  3M8N A;  1V40 A;  2VL2 C;  5J5N A;  1B4Q A;  3GX0 A;  5A4W A;  4EDY A;  3TRQ A;  2QA1 A;  12GS A;  3C1R A;  4BPY A;  1SD8 A;  2H74 A;  3GNJ A;  4WR4 A;  3MAK A;  1PX7 A;  2DKI A;  4ZB8 A;  3KMN A;  2E0Q A;  3VK9 A;  2XBI A;  4KUN A;  2TRX A;  3D0Z A;  4MPF A;  4L0W A;  1BYE A;  2QSI A;  2DJK A;  3H8Q A;  3LQ7 A;  3APQ A;  2DBC A;  4K6X A;  2OE0 A;  1ILO A;  2VCQ A;  2QC7 A;  5H5S A;  2H70 A;  2RM6 A;  4PQH A;  1XG8 A;  1TTZ A;  4IHU A;  5DQY A;  1SU9 A;  5D96 A;  3DEX A;  1SL1 B;  5ECH B;  3CBU A;  1X9W B;  3TGZ A;  2X99 A;  2DML A;  4NXI A;  2ES7 A;  3TRX A;  2GVP A;  2JAD A;  3A3T A;  2WUL A;  4FYC A;  1G0T A;  3UAP A;  2VL3 A;  4F0C A;  3Q19 A;  5E4W A;  1EGR A;  1S3D A;  3DML A;  2A4H A;  2X64 A;  2DIZ A;  2H1D A;  4HI7 A;  5AN1 A;  2H0I A;  1RK4 A;  3W8S A;  3IRA A;  4MF7 A;  5G1L A;  3EE2 A;  4I5Q A;  3ZVJ D;  4D73 A;  1M2D A;  4EDZ A;  5IOX A;  1TRW A;  4OFT A;  4K5S A;  4IEL A;  1TRV A;  2FD3 A;  4DSS A;  5COH A;  3IV4 A;  3WYW A;  1YZX A;  3H93 A;  5CRG A;  3KEB A;  1GSD A;  6GSU A;  2V6O A;  8GSS A;  2NBS A;  2H71 A;  3F63 A;  3EMX A;  3DWV A;  3C73 A;  2JSY A;  3WT2 A;  2NPB A;  2FWE A;  3UEM A;  4OO4 A;  4JBB A;  1GNE A;  5D9X A;  3LXT A;  3LW9 A;  5DCG A;  5B8B A;  4HUA A;  3US3 A;  4O5R A;  2AUV A;  1M7T A;  4YQU A;  2NTO A;  2X8H A;  4ISD A;  4MF6 A;  1EOH A;  5AGY A;  2IIY A;  5ELG A;  2V41 A;  2IL3 A;  3ZMK A;  3KD0 A;  5ECN B;  1G7E A;  1XW6 A;  1WIK A;  4KDY A;  5D9T A;  3EU3 A;  5G2Z A;  4D73 B;  1K0C A;  2IMI A;  4NAX A;  4ZIJ A;  2DJ1 A;  1M3J A;  2VCT A;  3F6F A;  4DSS B;  2JSZ A;  3HHV A;  2OE1 A;  2LRT A;  1N8J A;  3GSS A;  3APS A;  4ZXG A;  1B4P A;  4G0L A;  3KXO A;  2B3S A;  4KW6 A;  4E8H A;  2B7K A;  4DSQ A;  4MK3 A;  3GH6 A;  3E3E A;  6GSX A;  3GUS A;  3I43 A;  4Z2R A;  5ECO B;  4Z2T A;  1A8Y A;  2O87 A;  3F3Q A;  1SJZ A;  2C0F A;  2GT6 A;  3KM6 A;  4O92 A;  3HZ4 A;  2ALB A;  4LMV A;  4V2L A;  1DUG A;  2KP1 A;  3QR6 A;  1RW1 A;  3HVV A;  1E2Y A;  4J56 E;  2ON7 A;  3QD9 A;  2GLR A;  4A5P A;  4L0U A;  6GSY A;  1FHE A;  2FUG 2;  4CHS A;  1S3R A;  1T4Z A;  2C3N A;  4CDO A;  4EC0 A;  4MNN A;  5CAX A;  2YWO A;  2GS3 A;  2WCI A;  1X5E A;  4MF5 A;  3O3T A;  2MZC A;  3NIV A;  1GSF A;  3D6I A;  4WF4 A;  3UVT A;  4MP4 A;  1U3I A;  2GZY A;  4PQI A;  1W4V A;  1WRY A;  3EVI A;  3L0H A;  1DSB A;  4YAV A;  3ZVJ A;  3IBH A;  5ID2 A;  1VF4 A;  4K0G A;  3DXB A;  2G2Q A;  1SK1 A;  1G6W A;  4MH3 A;  4HOJ A;  2R0C A;  2E2M A;  4LA1 A;  1M2B A;  4I8B A;  5DCH A;  4NMU A;  5IQY A;  4ZBB A;  2TIR A;  1T7P B;  6GST A;  5ECS A;  4ID0 A;  4HDE A;  2HI7 A;  5H5R A;  2LNS A;  1T4Y A;  1VRS D;  5ECI B;  1EZK A;  2IWT A;  1IYI A;  4OD7 A;  1TRU A;  1QXH A;  3SWL A;  5KN1 A;  3K8N A;  4YQM A;  1KTE A;  3VWW A;  3QPM A;  3HXS A;  2QA2 A;  3M9J A;  1WOU A;  4JZQ A;  3SBC A;  4ML6 A;  3CRU A;  2LNT A;  5ABR A;  2RLI A;  4TR1 A;  3NOF A;  1XOB A;  2MMZ A;  1PFO A;  3E0U A;  1SKR B;  2KOK A;  2DJJ A;  2H0H A;  3FR6 A;  5JWR B;  2KHP A;  5ID2 B;  1NHO A;  4J2F A;  3DVW A;  2AB6 A;  4MAB A;  1UC7 A;  3CRT A;  2YV7 A;  1XWG A;  3ME7 A;  1OE8 A;  4HZ2 A;  1BG5 A;  1R5P A;  1Y25 A;  3QMX A;  1MDK A;  2ZNM A;  1K0M A;  2QKE A;  4OFM A;  1X0R A;  1A8L A;  4F03 A;  3J7Y b;  4LL4 B;  2C4J A;  2HXK A;  2YOI A;  2BMX A;  1C72 A;  2CX3 A;  2TRC P;  1GUM A;  4ML1 A;  3LEF A;  7GSS A;  2OBK A;  1QQ2 A;  1WWJ A;  1SJ6 A;  3VPQ A;  4TR1 B;  4ZBD A;  1TRS A;  4EO3 A;  4DEJ A;  2H1G A;  1V9W A;  4BA7 A;  4HQZ A;  1Q98 A;  4IJI A;  2RM5 A;  1TI1 A;  1ZYP A;  1EV9 A;  2CV4 A;  5J3R A;  1HYU A;  1K3Y A;  2HNL A;  2YP6 A;  2LV3 A;  2WJU A;  2VAF A;  2XHF A;  5IMF A;  1PA3 A;  4HS1 A;  1THO A;  3ZTL A;  1U6T A;  2L5O A;  2OAC A;  4YAP A;  2R3X A;  3QFB C;  1PKZ A;  3FMW A;  1PMT A;  3RHB A;  2HZF A;  3G7J A;  5HFI A;  4EE0 A;  5DQS A;  3F8U A;  19GS A;  2H8L A;  2HT9 A;  2PN8 A;  4NHZ A;  2FWH A;  1Z3E A;  3P7X A;  1A0R P;  4N30 A;  2GDR A;  2LKU A;  1GP1 A;  4AJ8 A;  4BVX A;  2WGR A;  5HQP A;  4GWR A;  3HJM A;  2DJ0 A;  4AJ7 A;  2XPD A;  6GSS A;  2Z9S A;  4N10 A;  4Q5Q A;  1FVJ A;  3KCM A;  2CQ9 A;  4LLR A;  3GL5 A;  4HSC X;  2HYX A;  5HFG A;  4IGJ A;  2ON5 A;  2YZU A;  2O8V B;  1U87 A;  1CQG A;  5G1K A;  2DJ2 A;  5AIV A;  3H79 A;  2H6Y A;  4GSS A;  2F8F A;  1WJK A;  2V6K A;  3ZIV A;  3RBT A;  3GYK A;  3HCZ A;  1ON4 A;  3LXZ A;  1EGO A;  1VF3 A;  4ECB A;  1YY7 A;  2HFD A;  3VWV A;  13GS A;  4G0I A;  3WGE A;  1QMV A;  1MEK A;  2WB9 A;  4FH8 A;  4K7N A;  1KEB A;  4WF5 A;  5GZZ B;  4ECI A;  1I5G A;  3Q74 A;  3KMO A;  4BVX B;  2HLS A;  2VIM A;  1V2A A;  1R5A A;  1F3A A;  1UVZ A;  2VLU A;  3BJ5 A;  2YAN A;  4MPG A;  4K5R A;  5JCG A;  3HVS A;  1U3A A;  1JFU A;  1WE0 A;  4NHW A;  1HQO A;  4TKY A;  3LYP A;  4IVF A;  3UOM A;  3TKR A;  5LNK e;  1JLV A;  2OAD A;  5IPG A;  1TOF A;  2GSR A;  4MJE A;  5ENU A;  3TCO A;  3UIW A;  3FW2 A;  2N5B A;  1F6M C;  2HRK A;  3DGQ A;  2HSH A;  5HR3 A;  4G2E A;  1GUH A;  2HZE A;  1GLP A;  4G9H A;  20GS A;  3C8E A;  9GSS A;  1AQW A;  1HNB A;  4TXV A;  1E6B A;  1OYJ A;  1VF2 A;  4Z7X A;  3VFI A;  3LSZ A;  5JCW A;  4F2I A;  1DE1 A;  1M99 A;  2AHE A;  4RI7 A;  2B1K A;  18GS A;  3IC8 A;  5ECQ B;  2LRC A;  3BOA A;  1M3I A;  2H73 A;  3IOS A;  1T3B A;  4X43 A;  2B1L A;  4JU5 A;  16GS A;  2N5F A;  5ECL B;  2VD0 A;  4YH2 A;  5IMZ A;  2O7K A;  2KP2 A;  1PGT A;  4FYB A;  2VL9 A;  1SL0 B;  4JE1 A;  4PUR A;  3RPP A;  4O5Q A;  4Z2U A;  1YKA A;  5EPF A;  2HZE B;  3ED3 A;  3TDG A;  4GCI A;  3FK8 A;  4F9Z A;  4EUY A;  4PUF C;  1O8W A;  5IM9 A;  2DIY A;  2DJ3 A;  4XRA A;  4ECJ A;  3F3R A;  2F3M A;  2PER A;  3VLN A;  3EMP A;  2JZT A;  2GZZ A;  4K7I A;  4NPB A;  2KUC A;  2FNO A;  1XVW A;  5IMD A;  5IPH A;  1TW9 A;  1FO5 A;  5A4V A;  2IME A;  1GWC A;  1PQN A;  2DSA A;  1CQH A;  1EEJ A;  3HKR A;  3FR3 A;  4QL7 A;  4MJB A;  1VGL A;  1H4O A;  1SK0 A;  4KSO A;  4K2D A;  3DIE A;  4X0X A;  2JZR A;  2ZCT A;  1K3O A;  2DKH A;  4PGT A;  1O6J A;  5KN0 A;  1YEX A;  4HU9 A;  5G5E A;  3GV1 A;  3KH7 A;  2R6K A;  2MBS A;  2CVD A;  2B6M A;  1BED A;  5ECP B;  2CAQ A;  3CXG A;  1YF1 A;  2J9H A;  1F37 A;  1Z6N A;  2K8V A;  2B5Y A;  3H1N A;  1TU8 A;  4EIQ A;  3IA1 A;  1X9S B;  5GST A;  3KZQ A;  4L5O A;  1TK8 B;  1ZZY A;  5IMC A;  1NW2 A;  1R4W A;  3PGT A;  3A2W A;  4F82 A;  1ML6 A;  2R0G A;  3KGK A;  3GKK A;  2BJX A;  1TKD B;  3PH9 A;  4HEA 2;  4OFN A;  1XWC A;  5JWO B;  3LG6 A;  4V2M A;  2HE3 A;  4I2U A;  3F4T A;  2PPT A;  2K9F A;  3HJP A;  3AY8 A;  4GLT A;  1ABA A;  3G7I A;  5CRE A;  2EIQ A;  3P90 A;  2EIO A;  1MD3 A;  2P5Q A;  4RUV A;  5A4U A;  2VLV A;  1T00 A;  10GS A;  2B5X A;  2NDO A;  3HD5 A;  3D4T A;  1ZL9 A;  4TRX A;  4MZB A;  5C00 A;  1G6Y A;  5HR1 A;  4DSR A;  1PD2 1;  3ZIJ A;  2B7J A;  1SKS B;  2OJL A;  2I81 A;  1K0A A;  4BVY A;  5D8I A;  2IFQ A;  1QFN A;  2ZUP A;  3O6T A;  1J0F A;  2X49 A;  4H86 A;  5B6N A;  2OA7 A;  3GA4 A;  2LQQ A;  2H6X A;  4KX4 A;  2MYG A;  2A4V A;  1A2M A;  1GUL A;  1MDI A;  1K3L A;  2PVO C;  5HR2 A;  1YF0 A;  1Q4J A;  1Y6E A;  2JL4 A;  3H4K A;  4ZL7 A;  2YWI A;  1OE7 A;  1YDK A;  4K8M A;  3HA9 A;  1JZW A;  3N5O A;  3ME8 A;  3IK9 A;  5DJL A;  4K1F A;  2FY6 A;  4N11 A;  5BMU A;  5KN3 A;  3I69 A;  2FWF A;  3TJK A;  5CP1 A;  1S3C A;  4F0B A;  2KLX A;  1THX A;  4TR0 A;  4MLY A;  2FA4 A;  4MCU A;  4EXJ A;  1FB0 A;  4BVY B;  2IFQ B;  3V1W A;  14GS A;  1XWB A;  3F9U A;  3ZRE A;  4EF0 A;  2GTU A;  3IR4 A;  5EL8 A;  2C8U A;  3CSH A;  4USS A;  2C1Y A;  1FW1 A;  4ZIL A;  4EVM A;  4BIK A;  3TJB A;  4NWY A;  3UBL A;  4KCA A;  1SEN A;  1Z6M A;  1O85 A;  2PWJ A;  1AW9 A;  2LJK A;  1SL2 B;  1AAZ A;  4CY6 A;  3TRP A;  1XW9 A;  3ERW A;  2WDU A;  4OMV A;  1GSS A;  5HR0 A;  1FG4 A;  4ACS A;  3GN3 A;  2YWN A;  3TKS A;  3EIN A;  1ZYN A;  4L5L A;  1X5D A;  4IKH A;  1AUC A;  4POL A;  3ZZX A;  2RUE A;  3BD2 A;  3FR9 A;  1Z7P A;  4GXZ A;  5B7C A;  3TKS E;  2PMT A;  2FGX A;  3QCP A;  5GAN D;  1V98 A;  2B5E A;  4CW9 A;  3DKS A;  4MZW A;  2I3Y A;  2R5G A;  2AYT A;  2WS2 A;  1FAA A;  4K7O A;  2C3T A;  4KGI A;  3IE3 A;  3W6G A;  3QAG A;  3KP9 A;  3DVX A;  3HZ8 A;  3VPT A;  3MSZ A;  4O5U A;  3GMF A;  2XBQ A;  4AJ6 A;  4LL1 B;  3GKM A;  5IMA A;  2FLS A;  3KTL A;  2K6V A;  5JWQ B;  2H6Z A;  4ZB6 A;  3CTG A;  3KP8 A;  4V2N A;  2C0G A;  5AIX A;  1AXD A;  3MWH A;  1USB A;  2PGT A;  2C3Q A;  2OE3 A;  2WFC A;  4NV5 A;  2M46 A;  2FCH A;  2L5L A;  1ERT A;  5IIZ A;  2HSM A;  1XIY A;  1TK0 B;  4L8E A;  1XVQ A;  2GQM A;  1FOV A;  4KDU A;  1OVN A;  2H72 A;  3GHA A;  1UA5 A;  5FT3 A;  2GSQ A;  3VUR A;  3FKF A;  3FYG A;  4GTU A;  3ZRD A;  1GL8 A;  3QDN A;  3OR5 A;  1TU7 A;  4XS4 A;  2L4Q A;  2JZS A;  4X1U A;  2QGV A;  1B48 A;  6GSW A;  2F8A A;  3TKS C;  3WD6 A;  2V1M A;  4XTS A;  1EV4 A;  3CSJ A;  4YKF A;  3JCM L;  4WR5 A;  22GS A;  4RQR A;  3D5J A;  2H19 A;  2LUS A;  5CRD A;  3GST A;  4ZL9 A;  3S9F A;  1URM A;  3UJ1 A;  1J08 A;  4XIH A;  4GST A;  1XXU A;  1F3B A;  2I4A A;  1AC1 A;  4IQA A;  1TJD A;  5DBQ A;  1IYH A;  1OC8 A;  2PVQ A;  3ZFL A;  3I6A A;  3QOU A;  4MH2 A;  1V58 A;  4DVC A;  3L78 A;  2IPA A;  5INY A;  4Q5N A;  4O32 A;  1PRX A;  1XWA A;  3D4M A;  4PUA A;  3GTU A;  1EP7 A;  2C0E A;  3M3M A;  5FWG A;  1GSU A;  2L4C A;  4KH7 A;  3FEU A;  5LCZ A;  4XS4 B;  4FIW A;  3N9J A;  3Q18 A;  4I97 A;  3DRN A;  3RHC A;  3A2V A;  3EU4 A;  2CVK A;  4RI6 A;  4KA0 A;  1MTC A;  1PX6 A;  1SYR A;  1PL2 A;  2JAC A;  5ECM B;  2HRA A;  4WEY A;  5B8A A;  3Q6O A;  2H66 A;  4HU7 A;  3IDV A;  5IO2 A;  2MMN A;  5D73 A;  4ECC A;  1FB6 A;  1PKW A;  2K18 A;  2GZP A;  3CTF A;  5J9B A;  3FY7 A;  2GGT A;  1DE2 A;  1B9Y C;  17GS A;  2MMA A;  3HY2 A;  2IMD A;  3TOT A;  1T1V A;  11GS A;  5CRW A;  4MJA A;  2LTK A;  1BAY A;  4QL9 A;  5G5F A;  4OO5 A;  1ST9 A;  4POK A;  3HDC A;  5D93 A;  1XZO A;  4Q5F A;  1ERU A;  3PIN A;  2YCD A;  1ZGN A;  1QGV A;  3GTU B;  1TXX A;  1BX9 A;  3KTB A;  4XRD A;  2R2J A;  2LJR A;  5LD0 A;  2YZH A;  2GSS A;  1GUK A;  1HNC A;  3LJR A;  1GSQ A;  4N0Z A;  1LBK A;  4HJ2 A;  4PNF A;  4XS6 A;  1A24 A;  3HJO A;  3WGX A;  2YN1 A;  5A5K A;  2IMK A;  4OCF A;  3IAM 2;  3QAW A;  4XS1 A;  2YJH A;  1NHY A;  2N5A A;  3C71 A;  4MA9 A;  1T8E B;  4O7H A;  1GTI A;  2MMO A;  3EUR A;  2V2G A;  4IP1 A;  2O89 A;  5H5Q A;  4EL1 A;  4ULX A;  2CA8 A;  4KCE A;  1YKC A;  1QUW A;  3E9J B;  3WGD A;  3HVX A;  5CNW A;  5G30 A;  2J23 A;  1MDJ A;  1ERW A;  1XOA A;  4KAE A;  1XPV A;  2O85 A;  2XC2 A;  4MJC A;  2JU5 A;  3TJG A;  2VCW A;  3KH9 A;  2WZ9 A;  5IOW A;  4TOP A;  3ERF A;  2WRT A;  4TN8 A;  1ACV A;  3FZA A;  4ZBA A;  4KSM A;  2GT5 A;  4AGS A;  2H1B A;  1JHB A;  4IW9 A;  2E7P A;  1GH2 A;  4ZB9 A;  1XBS A;  1S3A A;  1HD2 A;  3D22 A;  2GQL A;  4YKG A;  2FHE A;  3FRC A;  2A2R A;  2C0D A;  2CZ3 A;  1JZD A;  1NM3 A;  1B8X A;  4YQV A;  3W8J A;  1VF1 A;  4FYU A;  3TJF A;  1A2L A;  3BCK A;  1TI3 A;  2A2S A;  4FQU A;  2MBT A;  4POB A;  4XCS A;  3IC4 A;  2YJ7 A;  1N2A A;  4IP6 A;  1RQM A;  4JR4 A;  4WBJ A;  4QQ7 A;  2VD1 A;  3WT1 A;  2VM1 A;  3L9V A;  3F4S A;  2V32 A;  3I9V 2;  2IN3 A;  2F51 A;  2YPM A;  1K0O A;  3GX8 A;  4RQX A;  2IJY A;  3U6V A;  2FWG A;  3A5I A;  1GSY A;  5ECR B;  1AQV A;  1B9X C;  3P8W A;  2P31 A;  3UMA A;  1PL1 A;  1X5C A;  2CX4 A;  1EEM A;  3RPN A;  5KN2 A;  4KB3 A;  2P0G A;  3GKN A;  2H76 A;  4PQ1 A;  5IMV A;  1W89 A;  3MYD A;  3RDW A;  4GF0 A;  3DD3 A;  4OWY A;  3TJJ A;  5F05 A;  4ZL8 A;  2LRN A;  1XW5 A;  3LFL A;  2DMM A;  2X8C A;  3GH9 A;  1LU4 A;  1JLW A;  3UAR A;  3A5W A;  1ZYE A;  2L59 A;  4TVE A;  1SKW B;  5DDL A;  2YWM A;  4FO5 A;  3PR8 A;  1ZOF A;  1GTB A;  4JED A;  2C80 A;  5DAK A;  3TKQ A;  4G0K A;  4ILF A;  3MNG A;  4OCE A;  1OKT A;  1ERV A;  4G19 A;  2F9S A;  2M80 A;  2LQO A;  1K0B A;  3MDK A;  4TR4 A;  4PXO A;  1K0N A;  3IPZ A;  1ZCP A;  3VI5 A;  1GLQ A;  2H01 A;  2HSY A;  2VCX A;  4IN0 A;  6GSV A;  2HRN A;  3PPU A;  3QAV A;  1AQX A;  5F0G A;  2CVB A;  1OC3 A;  3ZML A;  2K8S A;  3ZL5 A;  3GUR A;  4GQF A;  4GSN A;  1Z9H A;  3M9K A;  1A2J A;  3C1S A;  4ICY A;  1O73 A;  5DAK B;  1BQ7 A;  4KND A;  1AIU A;  3CQF A;  5GAP D;  5F07 A;  1XCC A;  2DC5 A;  2VUP A;  4MDC A;  4BL7 A;  1HNA A;  2CAI A;  5L71 A;  3FZ4 A;  2XPE A;  1M9A A;  1BJX A;  4WBR D;  5CO3 A;  2H1A A;  1GSE A;  3TB2 A;  4LMW A;  3GRX A;  3R2Q A;  4JR6 A;  4BWS A;  5KOW A;  4KE3 A;  2RUF A;  3D21 A;  2VM2 A;  1O81 A;  1JZO A;  3G9B A;  3VI7 A;  4X4J A;  4EKZ A;  4MZC A;  3GKX A;  4TR3 A;  1A0F A;  3UBK A;  1YQ1 A;  3FZ5 A;  1DBY A;  1PN0 A;  3EPT A;  3CMI A;  4PTS A;  3CYN A;  2HRF A;  3ZYW A;  1EP8 A;  4HZ4 A;  4J57 E;  1R7H A;  4P3Y B;  2PBJ A;  3BBY A;  1OC9 A;  2EC4 A;  4WXT A;  2L57 A;  5DAL A;  1SK2 A;  1F9M A;  4BL7 B;  5HFK A;  4JRR A;  3KJY A;  5D9V A;  5GSS A;  2LEG A;  2FA8 A;  5KOX A;  2RII A;  2H0G A;  4I6X A;  4KDX A;  2I9H A;  3MIX A;  1XFL A;  5EVO A;  2R0P A;  2EIR A;  5C04 A;  3M0F A;  3IAS 2;  1J9B A;  5E59 A;  3LOR A;  3FZ9 A;  1G7O A;  3APO A;  3M1G A;  2GST A;  5CRH A;  2DLX A;  1PN9 A;  5AIS A;  5ELA A;  3KIJ A;  4HQS A;  4PNG A;  3U5R E;  3O76 A;  3QFA C;  3ZFB A;  2H30 A;  2PUK C;  5IO0 A;  1WMJ A;  2REM A;  4CY8 A;  1WP0 A;  2I1U A;  2YV9 A;  1I9D A;  2VOC A;  1SD9 A;  1A23 A;  2P5R A;  1TDI A;  1O7U A;  4EIP A;  1OC9 B;  1KBN A;  1K0D A;  2OBI A;  4XHM A;  1O8X A;  4MMM A;  4TXO A;  5DAL B;  1GNW A;  1M0U A;  2IMF A;  1JZR A;  1EWX A;  3HYP A;  1ZMA A;  4K0N A;  4GQC A;  4G10 A;  4I2T A;  1X9M B;  3VWU A;  2NVL A;  3IK7 A;  3GL3 A;  2OKA A;  2VCV A;  3TOU A;  4E8E A;  3CSI A;  4IJ3 A;  1M2A A;  4N0V A;  5EY6 A;  3IHQ A;  5ECK B;  3VWX A;  5BRT A;  1WPI A;  3F4R A;  1Z7R A;  1ZYQ B;  3L4N A;  3GFK A;  3R3E A;  3UVH A;  1SJI A;  2G0F A;  1YJ6 A;  3IXR A;  2VL2 A;  2L6D A;  4IS0 A;  1PSQ A;  3J7Y k;  3ZLP A;  3HVN A;  1F2E A;  1GTU A;  4V1A p;  2AJQ B;  1LJR A;  2AV4 A;  4WET A;  2GQK A;  3EWL A;  5F06 A;  1FVK A;  4HJM A;  1MD4 A;  3ERG A;  2VO4 A;  4TXO B;  5DJM A;  3RAZ A;  3ISO A;  2BTO T;  2LST A;  5JCU A;  5CYY A;  4IBP A;  1GRX A;  4BWQ A;  1UN2 A;  2H75 A;  3TKP A;  5D9W A;  2CZ2 A;  3IHG A;  4KF9 A;  2PU9 C;  2D2Z A;  3G7Y A;  1Z5Y E;  3FHK A;  2CT6 A;  1OAZ A;  3BCI A;  5DVB A;  4NV2 A;  3LGC A;  2L6C A;  2VCZ A;  1H75 A;  2UZ8 A;  4PX1 A;  1OKD A;  4WKW A; 
#chains in the Genus database with same CATH homology
 5F8B A;  2R4V A;  1M9B A;  3LWA A;  2X4A A;  2YNX A;  1YEP A;  5G31 A;  1SYX A;  3GIX A;  1FOH A;  1GTA A;  3P2A A;  3EYT A;  4K2X A;  5KEJ A;  4POM A;  2A2P A;  1U88 A;  3TUE A;  4K9Z A;  2LJA A;  4Q5R A;  5FHI A;  1NSW A;  2E2G A;  1XWK A;  2X8G A;  3DYR A;  3C7M A;  2R37 A;  4V1A g;  2VLT A;  4IQ1 A;  3NZN A;  4GRF A;  5J4U A;  5J41 A;  1EOG A;  3UL3 A;  3L9S A;  1R26 A;  1TP9 A;  3LYK A;  4TW5 A;  5B6M A;  5J9C A;  3L9U A;  4AF2 A;  3F6D A;  2AAW A;  3A2X A;  3F0I A;  1QK8 A;  1V57 A;  2M72 A;  3ZIT A;  1TK5 B;  2LS5 A;  3EC3 A;  1KNG A;  3M8N A;  1V40 A;  2VL2 C;  5J5N A;  1B4Q A;  3GX0 A;  5A4W A;  4EDY A;  3TRQ A;  2QA1 A;  12GS A;  3C1R A;  4BPY A;  1SD8 A;  2H74 A;  3GNJ A;  4WR4 A;  3MAK A;  1PX7 A;  2DKI A;  4ZB8 A;  3KMN A;  2E0Q A;  3VK9 A;  2XBI A;  4KUN A;  2TRX A;  3D0Z A;  4MPF A;  4L0W A;  1BYE A;  2QSI A;  2DJK A;  3H8Q A;  3LQ7 A;  3APQ A;  2DBC A;  4K6X A;  2OE0 A;  1ILO A;  2VCQ A;  2QC7 A;  5H5S A;  2H70 A;  2RM6 A;  4PQH A;  1TTZ A;  4IHU A;  5DQY A;  1SU9 A;  5D96 A;  3DEX A;  1SL1 B;  5ECH B;  3CBU A;  1X9W B;  3TGZ A;  2X99 A;  2DML A;  4NXI A;  2ES7 A;  3TRX A;  2GVP A;  2JAD A;  3A3T A;  2WUL A;  4FYC A;  1G0T A;  3UAP A;  2VL3 A;  4F0C A;  3Q19 A;  5E4W A;  1EGR A;  1S3D A;  3DML A;  2A4H A;  2X64 A;  2DIZ A;  2H1D A;  4HI7 A;  5AN1 A;  2H0I A;  1RK4 A;  3W8S A;  3IRA A;  4MF7 A;  5G1L A;  3EE2 A;  4I5Q A;  3ZVJ D;  4D73 A;  1M2D A;  4EDZ A;  5IOX A;  1TRW A;  4OFT A;  4K5S A;  4IEL A;  1TRV A;  2FD3 A;  4DSS A;  5COH A;  3IV4 A;  3WYW A;  1YZX A;  3H93 A;  5CRG A;  3KEB A;  1GSD A;  6GSU A;  2V6O A;  8GSS A;  2NBS A;  2H71 A;  3F63 A;  3EMX A;  3DWV A;  3C73 A;  2JSY A;  3WT2 A;  2NPB A;  2FWE A;  3UEM A;  4OO4 A;  4JBB A;  1GNE A;  5D9X A;  3LXT A;  3LW9 A;  5DCG A;  5B8B A;  4HUA A;  3US3 A;  4O5R A;  2AUV A;  1M7T A;  4YQU A;  2NTO A;  2X8H A;  4ISD A;  4MF6 A;  1EOH A;  5AGY A;  2IIY A;  5ELG A;  2V41 A;  2IL3 A;  3ZMK A;  3KD0 A;  5ECN B;  1G7E A;  1XW6 A;  1WIK A;  4KDY A;  5D9T A;  3EU3 A;  5G2Z A;  4D73 B;  1K0C A;  2IMI A;  4NAX A;  4ZIJ A;  2DJ1 A;  2VCT A;  3F6F A;  4DSS B;  2JSZ A;  3HHV A;  2OE1 A;  2LRT A;  1N8J A;  3GSS A;  3APS A;  4ZXG A;  1B4P A;  4G0L A;  3KXO A;  2B3S A;  4KW6 A;  4E8H A;  2B7K A;  4DSQ A;  4MK3 A;  3GH6 A;  3E3E A;  6GSX A;  3GUS A;  3I43 A;  4Z2R A;  5ECO B;  4Z2T A;  1A8Y A;  2O87 A;  3F3Q A;  1SJZ A;  2C0F A;  2GT6 A;  3KM6 A;  4O92 A;  3HZ4 A;  2ALB A;  4LMV A;  4V2L A;  1DUG A;  2KP1 A;  3QR6 A;  1RW1 A;  3HVV A;  1E2Y A;  4J56 E;  2ON7 A;  3QD9 A;  2GLR A;  4A5P A;  4L0U A;  6GSY A;  1FHE A;  2FUG 2;  4CHS A;  1T4Z A;  2C3N A;  4CDO A;  4EC0 A;  4MNN A;  5CAX A;  2YWO A;  2GS3 A;  2WCI A;  1X5E A;  4MF5 A;  3O3T A;  2MZC A;  3NIV A;  1GSF A;  3D6I A;  4WF4 A;  3UVT A;  4MP4 A;  1U3I A;  2GZY A;  4PQI A;  1W4V A;  1WRY A;  3EVI A;  3L0H A;  1DSB A;  4YAV A;  3ZVJ A;  3IBH A;  5ID2 A;  1VF4 A;  4K0G A;  3DXB A;  2G2Q A;  1SK1 A;  1G6W A;  4MH3 A;  4HOJ A;  2R0C A;  2E2M A;  4LA1 A;  1M2B A;  4I8B A;  5DCH A;  4NMU A;  5IQY A;  4ZBB A;  2TIR A;  1T7P B;  6GST A;  5ECS A;  4ID0 A;  4HDE A;  2HI7 A;  5H5R A;  2LNS A;  1T4Y A;  1VRS D;  5ECI B;  1EZK A;  2IWT A;  1IYI A;  4OD7 A;  1TRU A;  1QXH A;  3SWL A;  5KN1 A;  3K8N A;  4YQM A;  1KTE A;  3VWW A;  3QPM A;  3HXS A;  2QA2 A;  3M9J A;  1WOU A;  4JZQ A;  3SBC A;  4ML6 A;  3CRU A;  2LNT A;  5ABR A;  2RLI A;  4TR1 A;  3NOF A;  1XOB A;  2MMZ A;  3E0U A;  1SKR B;  2KOK A;  2DJJ A;  2H0H A;  3FR6 A;  5JWR B;  2KHP A;  5ID2 B;  1NHO A;  4J2F A;  3DVW A;  2AB6 A;  4MAB A;  1UC7 A;  3CRT A;  2YV7 A;  1XWG A;  3ME7 A;  1OE8 A;  4HZ2 A;  1BG5 A;  1R5P A;  1Y25 A;  3QMX A;  1MDK A;  2ZNM A;  1K0M A;  2QKE A;  4OFM A;  1X0R A;  1A8L A;  4F03 A;  3J7Y b;  4LL4 B;  2C4J A;  2HXK A;  2YOI A;  2BMX A;  1C72 A;  2CX3 A;  2TRC P;  1GUM A;  4ML1 A;  3LEF A;  7GSS A;  2OBK A;  1QQ2 A;  1WWJ A;  1SJ6 A;  3VPQ A;  4TR1 B;  4ZBD A;  1TRS A;  4EO3 A;  4DEJ A;  2H1G A;  1V9W A;  4BA7 A;  4HQZ A;  1Q98 A;  4IJI A;  2RM5 A;  1TI1 A;  1ZYP A;  1EV9 A;  2CV4 A;  5J3R A;  1HYU A;  1K3Y A;  2HNL A;  2YP6 A;  2LV3 A;  2WJU A;  2VAF A;  2XHF A;  5IMF A;  1PA3 A;  4HS1 A;  1THO A;  3ZTL A;  1U6T A;  2L5O A;  2OAC A;  4YAP A;  2R3X A;  3QFB C;  1PKZ A;  3FMW A;  1PMT A;  3RHB A;  2HZF A;  3G7J A;  5HFI A;  4EE0 A;  5DQS A;  3F8U A;  19GS A;  2H8L A;  2HT9 A;  2PN8 A;  4NHZ A;  2FWH A;  1Z3E A;  3P7X A;  1A0R P;  4N30 A;  2GDR A;  2LKU A;  1GP1 A;  4AJ8 A;  4BVX A;  2WGR A;  5HQP A;  4GWR A;  3HJM A;  2DJ0 A;  4AJ7 A;  2XPD A;  6GSS A;  2Z9S A;  4N10 A;  4Q5Q A;  1FVJ A;  3KCM A;  2CQ9 A;  4LLR A;  3GL5 A;  5HFG A;  2HYX A;  4IGJ A;  2ON5 A;  2YZU A;  2O8V B;  1U87 A;  1CQG A;  5G1K A;  2DJ2 A;  5AIV A;  3H79 A;  2H6Y A;  4GSS A;  2F8F A;  1WJK A;  2V6K A;  3ZIV A;  3RBT A;  3GYK A;  3HCZ A;  1ON4 A;  3LXZ A;  1EGO A;  1VF3 A;  4ECB A;  1YY7 A;  2HFD A;  3VWV A;  13GS A;  4G0I A;  3WGE A;  1QMV A;  1MEK A;  2WB9 A;  4FH8 A;  4K7N A;  1KEB A;  4WF5 A;  5GZZ B;  4ECI A;  1I5G A;  3Q74 A;  3KMO A;  4BVX B;  2HLS A;  2VIM A;  1V2A A;  1R5A A;  1F3A A;  1UVZ A;  2VLU A;  3BJ5 A;  2YAN A;  4MPG A;  4K5R A;  5JCG A;  3HVS A;  1U3A A;  1JFU A;  1WE0 A;  4NHW A;  1HQO A;  4TKY A;  3LYP A;  4IVF A;  3UOM A;  3TKR A;  5LNK e;  1JLV A;  2OAD A;  5IPG A;  1TOF A;  2GSR A;  4MJE A;  5ENU A;  3TCO A;  3UIW A;  3FW2 A;  2N5B A;  1F6M C;  2HRK A;  3DGQ A;  2HSH A;  5HR3 A;  4G2E A;  1GUH A;  2HZE A;  1GLP A;  4G9H A;  20GS A;  3C8E A;  9GSS A;  1AQW A;  1HNB A;  4TXV A;  1E6B A;  1OYJ A;  1VF2 A;  4Z7X A;  3VFI A;  3LSZ A;  5JCW A;  4F2I A;  1DE1 A;  1M99 A;  2AHE A;  4RI7 A;  2B1K A;  18GS A;  3IC8 A;  5ECQ B;  2LRC A;  3BOA A;  2H73 A;  3IOS A;  1T3B A;  4X43 A;  2B1L A;  4JU5 A;  16GS A;  2N5F A;  5ECL B;  2VD0 A;  4YH2 A;  5IMZ A;  2O7K A;  2KP2 A;  1PGT A;  4FYB A;  2VL9 A;  1SL0 B;  4JE1 A;  4PUR A;  3RPP A;  4O5Q A;  4Z2U A;  1YKA A;  5EPF A;  2HZE B;  3ED3 A;  3TDG A;  4GCI A;  3FK8 A;  4F9Z A;  4EUY A;  4PUF C;  1O8W A;  5IM9 A;  2DIY A;  2DJ3 A;  4XRA A;  4ECJ A;  3F3R A;  2F3M A;  2PER A;  3VLN A;  3EMP A;  2JZT A;  2GZZ A;  4K7I A;  4NPB A;  2KUC A;  2FNO A;  1XVW A;  5IMD A;  5IPH A;  1TW9 A;  1FO5 A;  5A4V A;  2IME A;  1GWC A;  1PQN A;  2DSA A;  1CQH A;  1EEJ A;  3HKR A;  3FR3 A;  4QL7 A;  4MJB A;  1VGL A;  1H4O A;  1SK0 A;  4KSO A;  4K2D A;  3DIE A;  4X0X A;  2JZR A;  2ZCT A;  1K3O A;  2DKH A;  4PGT A;  1O6J A;  5KN0 A;  1YEX A;  4HU9 A;  5G5E A;  3GV1 A;  3KH7 A;  2R6K A;  2MBS A;  2CVD A;  2B6M A;  1BED A;  5ECP B;  2CAQ A;  3CXG A;  1YF1 A;  2J9H A;  1F37 A;  1Z6N A;  2K8V A;  2B5Y A;  3H1N A;  1TU8 A;  4EIQ A;  3IA1 A;  1X9S B;  5GST A;  3KZQ A;  4L5O A;  1TK8 B;  1ZZY A;  5IMC A;  1NW2 A;  1R4W A;  3PGT A;  3A2W A;  4F82 A;  1ML6 A;  2R0G A;  3KGK A;  3GKK A;  2BJX A;  1TKD B;  3PH9 A;  4HEA 2;  4OFN A;  1XWC A;  5JWO B;  3LG6 A;  4V2M A;  2HE3 A;  4I2U A;  3F4T A;  2PPT A;  2K9F A;  3HJP A;  3AY8 A;  4GLT A;  1ABA A;  3G7I A;  5CRE A;  2EIQ A;  3P90 A;  2EIO A;  1MD3 A;  2P5Q A;  4RUV A;  5A4U A;  2VLV A;  1T00 A;  10GS A;  2B5X A;  2NDO A;  3HD5 A;  3D4T A;  1ZL9 A;  4TRX A;  4MZB A;  5C00 A;  1G6Y A;  5HR1 A;  4DSR A;  1PD2 1;  3ZIJ A;  2B7J A;  1SKS B;  2OJL A;  2I81 A;  1K0A A;  4BVY A;  5D8I A;  2IFQ A;  1QFN A;  2ZUP A;  3O6T A;  1J0F A;  2X49 A;  4H86 A;  5B6N A;  2OA7 A;  3GA4 A;  2LQQ A;  2H6X A;  4KX4 A;  2MYG A;  2A4V A;  1A2M A;  1GUL A;  1MDI A;  1K3L A;  2PVO C;  5HR2 A;  1YF0 A;  1Q4J A;  1Y6E A;  2JL4 A;  3H4K A;  4ZL7 A;  2YWI A;  1OE7 A;  1YDK A;  4K8M A;  3HA9 A;  1JZW A;  3N5O A;  3ME8 A;  3IK9 A;  5DJL A;  4K1F A;  2FY6 A;  4N11 A;  5BMU A;  5KN3 A;  3I69 A;  2FWF A;  3TJK A;  5CP1 A;  1S3C A;  4F0B A;  2KLX A;  1THX A;  4TR0 A;  4MLY A;  2FA4 A;  4MCU A;  4EXJ A;  1FB0 A;  4BVY B;  2IFQ B;  3V1W A;  14GS A;  1XWB A;  3F9U A;  3ZRE A;  4EF0 A;  2GTU A;  3IR4 A;  5EL8 A;  2C8U A;  3CSH A;  4USS A;  2C1Y A;  1FW1 A;  4ZIL A;  4EVM A;  3TJB A;  4NWY A;  3UBL A;  4KCA A;  1SEN A;  1Z6M A;  1O85 A;  2PWJ A;  1AW9 A;  2LJK A;  1SL2 B;  1AAZ A;  4CY6 A;  3TRP A;  1XW9 A;  3ERW A;  2WDU A;  4OMV A;  1GSS A;  5HR0 A;  1FG4 A;  4ACS A;  3GN3 A;  2YWN A;  3TKS A;  3EIN A;  1ZYN A;  4L5L A;  1X5D A;  4IKH A;  1AUC A;  4POL A;  3ZZX A;  2RUE A;  3BD2 A;  3FR9 A;  1Z7P A;  4GXZ A;  5B7C A;  3TKS E;  2PMT A;  2FGX A;  3QCP A;  5GAN D;  1V98 A;  2B5E A;  4CW9 A;  3DKS A;  4MZW A;  2I3Y A;  2R5G A;  2AYT A;  2WS2 A;  1FAA A;  4K7O A;  2C3T A;  4KGI A;  3IE3 A;  3W6G A;  3QAG A;  3KP9 A;  3DVX A;  3HZ8 A;  3VPT A;  3MSZ A;  4O5U A;  3GMF A;  2XBQ A;  4AJ6 A;  4LL1 B;  3GKM A;  5IMA A;  2FLS A;  3KTL A;  2K6V A;  5JWQ B;  2H6Z A;  4ZB6 A;  3CTG A;  3KP8 A;  4V2N A;  2C0G A;  5AIX A;  1AXD A;  3MWH A;  1USB A;  2PGT A;  2C3Q A;  2OE3 A;  2WFC A;  4NV5 A;  2M46 A;  2FCH A;  2L5L A;  1ERT A;  5IIZ A;  2HSM A;  1XIY A;  1TK0 B;  4L8E A;  1XVQ A;  2GQM A;  1FOV A;  4KDU A;  1OVN A;  2H72 A;  3GHA A;  1UA5 A;  5FT3 A;  2GSQ A;  3VUR A;  3FKF A;  3FYG A;  4GTU A;  3ZRD A;  1GL8 A;  3QDN A;  3OR5 A;  1TU7 A;  4XS4 A;  2L4Q A;  2JZS A;  4X1U A;  2QGV A;  1B48 A;  6GSW A;  2F8A A;  3TKS C;  3WD6 A;  2V1M A;  4XTS A;  1EV4 A;  3CSJ A;  4YKF A;  3JCM L;  4WR5 A;  22GS A;  4RQR A;  3D5J A;  2H19 A;  2LUS A;  5CRD A;  3GST A;  4ZL9 A;  3S9F A;  1URM A;  3UJ1 A;  1J08 A;  4XIH A;  4GST A;  1XXU A;  1F3B A;  2I4A A;  1AC1 A;  4IQA A;  1TJD A;  5DBQ A;  1IYH A;  1OC8 A;  2PVQ A;  3ZFL A;  3I6A A;  3QOU A;  4MH2 A;  1V58 A;  4DVC A;  3L78 A;  2IPA A;  5INY A;  4Q5N A;  4O32 A;  1PRX A;  1XWA A;  3D4M A;  4PUA A;  3GTU A;  1EP7 A;  2C0E A;  3M3M A;  5FWG A;  1GSU A;  2L4C A;  4KH7 A;  3FEU A;  5LCZ A;  4XS4 B;  4FIW A;  3N9J A;  3Q18 A;  4I97 A;  3DRN A;  3RHC A;  3A2V A;  3EU4 A;  2CVK A;  4RI6 A;  4KA0 A;  1MTC A;  1PX6 A;  1SYR A;  1PL2 A;  2JAC A;  5ECM B;  2HRA A;  4WEY A;  5B8A A;  3Q6O A;  2H66 A;  4HU7 A;  3IDV A;  5IO2 A;  2MMN A;  5D73 A;  4ECC A;  1FB6 A;  1PKW A;  2K18 A;  2GZP A;  3CTF A;  5J9B A;  3FY7 A;  2GGT A;  1DE2 A;  1B9Y C;  17GS A;  2MMA A;  3HY2 A;  2IMD A;  3TOT A;  1T1V A;  11GS A;  5CRW A;  4MJA A;  2LTK A;  1BAY A;  4QL9 A;  5G5F A;  4OO5 A;  1ST9 A;  4POK A;  3HDC A;  5D93 A;  1XZO A;  4Q5F A;  1ERU A;  3PIN A;  2YCD A;  1ZGN A;  1QGV A;  3GTU B;  1TXX A;  1BX9 A;  3KTB A;  4XRD A;  2R2J A;  2LJR A;  5LD0 A;  2YZH A;  2GSS A;  1GUK A;  1HNC A;  3LJR A;  1GSQ A;  4N0Z A;  1LBK A;  4HJ2 A;  4PNF A;  4XS6 A;  1A24 A;  3HJO A;  3WGX A;  2YN1 A;  5A5K A;  2IMK A;  4OCF A;  3IAM 2;  3QAW A;  4XS1 A;  2YJH A;  1NHY A;  2N5A A;  3C71 A;  4MA9 A;  1T8E B;  4O7H A;  1GTI A;  2MMO A;  3EUR A;  2V2G A;  4IP1 A;  2O89 A;  5H5Q A;  4EL1 A;  4ULX A;  2CA8 A;  4KCE A;  1YKC A;  1QUW A;  3E9J B;  3WGD A;  3HVX A;  5CNW A;  5G30 A;  2J23 A;  1MDJ A;  1ERW A;  1XOA A;  4KAE A;  1XPV A;  2O85 A;  2XC2 A;  4MJC A;  2JU5 A;  3TJG A;  2VCW A;  3KH9 A;  2WZ9 A;  5IOW A;  4TOP A;  3ERF A;  2WRT A;  4TN8 A;  1ACV A;  3FZA A;  4ZBA A;  4KSM A;  2GT5 A;  4AGS A;  2H1B A;  1JHB A;  4IW9 A;  2E7P A;  1GH2 A;  4ZB9 A;  1XBS A;  1S3A A;  1HD2 A;  3D22 A;  2GQL A;  4YKG A;  2FHE A;  3FRC A;  2A2R A;  2C0D A;  2CZ3 A;  1JZD A;  1NM3 A;  1B8X A;  4YQV A;  3W8J A;  1VF1 A;  4FYU A;  3TJF A;  1A2L A;  3BCK A;  1TI3 A;  2A2S A;  4FQU A;  2MBT A;  4POB A;  4XCS A;  3IC4 A;  2YJ7 A;  1N2A A;  4IP6 A;  1RQM A;  4JR4 A;  4WBJ A;  4QQ7 A;  2VD1 A;  3WT1 A;  2VM1 A;  3L9V A;  3F4S A;  2V32 A;  3I9V 2;  2IN3 A;  2F51 A;  2YPM A;  1K0O A;  3GX8 A;  4RQX A;  2IJY A;  3U6V A;  2FWG A;  3A5I A;  1GSY A;  5ECR B;  1AQV A;  1B9X C;  3P8W A;  2P31 A;  3UMA A;  1PL1 A;  1X5C A;  2CX4 A;  1EEM A;  3RPN A;  5KN2 A;  4KB3 A;  2P0G A;  3GKN A;  2H76 A;  4PQ1 A;  5IMV A;  1W89 A;  3MYD A;  3RDW A;  4GF0 A;  3DD3 A;  4OWY A;  3TJJ A;  5F05 A;  4ZL8 A;  2LRN A;  1XW5 A;  3LFL A;  2DMM A;  2X8C A;  3GH9 A;  1LU4 A;  1JLW A;  3UAR A;  3A5W A;  1ZYE A;  2L59 A;  4TVE A;  1SKW B;  5DDL A;  2YWM A;  4FO5 A;  3PR8 A;  1ZOF A;  1GTB A;  4JED A;  2C80 A;  5DAK A;  3TKQ A;  4G0K A;  4ILF A;  3MNG A;  4OCE A;  1OKT A;  1ERV A;  4G19 A;  2F9S A;  2M80 A;  2LQO A;  1K0B A;  3MDK A;  4TR4 A;  4PXO A;  1K0N A;  3IPZ A;  1ZCP A;  3VI5 A;  1GLQ A;  2H01 A;  2HSY A;  2VCX A;  4IN0 A;  6GSV A;  2HRN A;  3PPU A;  3QAV A;  1AQX A;  5F0G A;  2CVB A;  1OC3 A;  3ZML A;  2K8S A;  3ZL5 A;  3GUR A;  4GQF A;  4GSN A;  1Z9H A;  3M9K A;  1A2J A;  3C1S A;  4ICY A;  1O73 A;  5DAK B;  1BQ7 A;  4KND A;  1AIU A;  5GAP D;  5F07 A;  1XCC A;  2DC5 A;  2VUP A;  4MDC A;  4BL7 A;  1HNA A;  2CAI A;  5L71 A;  3FZ4 A;  2XPE A;  1M9A A;  1BJX A;  4WBR D;  5CO3 A;  2H1A A;  1GSE A;  3TB2 A;  4LMW A;  3GRX A;  3R2Q A;  4JR6 A;  4BWS A;  5KOW A;  4KE3 A;  2RUF A;  3D21 A;  2VM2 A;  1O81 A;  1JZO A;  3G9B A;  3VI7 A;  4X4J A;  4EKZ A;  4MZC A;  3GKX A;  4TR3 A;  1A0F A;  3UBK A;  1YQ1 A;  3FZ5 A;  1DBY A;  1PN0 A;  3EPT A;  3CMI A;  4PTS A;  3CYN A;  2HRF A;  3ZYW A;  1EP8 A;  4HZ4 A;  4J57 E;  1R7H A;  4P3Y B;  2PBJ A;  3BBY A;  1OC9 A;  2EC4 A;  4WXT A;  2L57 A;  5DAL A;  1SK2 A;  1F9M A;  4BL7 B;  5HFK A;  4JRR A;  3KJY A;  5D9V A;  5GSS A;  2LEG A;  2FA8 A;  5KOX A;  2RII A;  2H0G A;  4I6X A;  4KDX A;  2I9H A;  3MIX A;  1XFL A;  5EVO A;  2R0P A;  2EIR A;  5C04 A;  3M0F A;  3IAS 2;  1J9B A;  5E59 A;  3LOR A;  3FZ9 A;  1G7O A;  3APO A;  3M1G A;  2GST A;  5CRH A;  2DLX A;  1PN9 A;  5AIS A;  5ELA A;  3KIJ A;  4HQS A;  4PNG A;  3U5R E;  3O76 A;  3QFA C;  3ZFB A;  2H30 A;  2PUK C;  5IO0 A;  1WMJ A;  2REM A;  4CY8 A;  1WP0 A;  2I1U A;  2YV9 A;  1I9D A;  2VOC A;  1SD9 A;  1A23 A;  2P5R A;  1TDI A;  1O7U A;  4EIP A;  1OC9 B;  1KBN A;  1K0D A;  2OBI A;  4XHM A;  1O8X A;  4MMM A;  4TXO A;  5DAL B;  1GNW A;  1M0U A;  2IMF A;  1JZR A;  1EWX A;  3HYP A;  1ZMA A;  4K0N A;  4GQC A;  4G10 A;  4I2T A;  1X9M B;  3VWU A;  2NVL A;  3IK7 A;  3GL3 A;  2OKA A;  2VCV A;  3TOU A;  4E8E A;  3CSI A;  4IJ3 A;  1M2A A;  4N0V A;  5EY6 A;  3IHQ A;  5ECK B;  3VWX A;  5BRT A;  1WPI A;  3F4R A;  1Z7R A;  1ZYQ B;  3L4N A;  3GFK A;  3R3E A;  3UVH A;  1SJI A;  2G0F A;  1YJ6 A;  3IXR A;  2VL2 A;  2L6D A;  4IS0 A;  1PSQ A;  3J7Y k;  3ZLP A;  1F2E A;  1GTU A;  4V1A p;  2AJQ B;  1LJR A;  2AV4 A;  4WET A;  2GQK A;  3EWL A;  5F06 A;  1FVK A;  4HJM A;  1MD4 A;  3ERG A;  2VO4 A;  4TXO B;  5DJM A;  3RAZ A;  3ISO A;  2BTO T;  2LST A;  5JCU A;  5CYY A;  4IBP A;  1GRX A;  4BWQ A;  1UN2 A;  2H75 A;  3TKP A;  5D9W A;  2CZ2 A;  3IHG A;  4KF9 A;  2PU9 C;  2D2Z A;  3G7Y A;  1Z5Y E;  3FHK A;  2CT6 A;  1OAZ A;  3BCI A;  5DVB A;  4NV2 A;  3LGC A;  2L6C A;  2VCZ A;  1H75 A;  2UZ8 A;  4PX1 A;  1OKD A;  4WKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...