3LWCA

Crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
104
Chain Sequence
MKMRKFTIADASLERSPGQEADISVGNLGPITIGYGRYAPGQSLTETMAVDDVMIVLEGRLSVSTDGETVTAGPGEIVYMPKGETVTIRSHEEGALTAYVTYPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of Structural Genomics, unknown function (YP_766765.1) from Rhizobium leguminosarum BV. viciae 3841 at 1.40 A resolution
rcsb
source organism Rhizobium leguminosarum
molecule tags Structural genomics, unknown function
total genus 19
structure length 104
sequence length 110
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06249 EutQ Ethanolamine utilisation protein EutQ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lwcA00
5LEJA 4LUMA 1CAVA 3DN7A 4N9IA 4XF0A 4R52A 5FPXA 1YFWA 2O1QA 2QDRA 2I45A 2MNGA 1V70A 4HSJA 4WVZA 1OFNA 1ZRFA 4XFHA 5BY5A 4PIXA 1GQGA 4E2QA 1OMIA 3S7IA 4I09A 2N7GA 3G7DA 4HLTA 1X82A 2D5HA 1CAXB 3L2HA 5CU1A 4XFGA 3O14A 4H7LA 2ETEA 1J3PA 4B29A 5KHIA 3KCCA 2UYBA 2ZCWA 1NE6A 2EAAA 4YNIA 3GBFA 1L3JA 3SCFA 2H6CA 4HVRA 1O3SA 5FLJA 1UCXA 1ZVFA 2D93A 3LAGA 1WGPA 2P17A 2HJIA 2VECA 5I93A 1CAUB 4HN1A 3WW2A 1J3QA 1SEFA 1ZZ8A 4BHPA 3D0SA 3IDBB 2GH2A 2IXCA 3LWCA 4PIYA 1O3RA 2PQQA 5FLHA 1JUHA 4KU7A 1UIKA 1TQ5A 1OD5A 3WW3A 1Y3TA 1VJ2A 2D5FA 3LA2A 4LA3A 3M3IA 2PAMA 5FDBA 4AVAA 4FBFA 4UXAA 5J7MA 3RPQA 5KHGA 1YWKA 3RYRA 4LULA 3LOIA 1QXJA 4I0AA 4XFAA 4JTOA 1H1IA 4UBGA 3UKNA 2BGCA 1Y9QA 4XFBA 3U11A 2OZJA 2OPKA 5T3NA 3OF1A 3GYDA 1FT9A 2PHDA 2XLFA 4I0BA 2HKXA 1NYWA 4AQ2A 4QX5A 1PMIA 5FLIA 3EHKA 3FZ3A 4O9EA 3I7DA 4IEWA 4L2NA 1LRHA 1I5ZA 2MPFA 3VHRA 2QNKA 5BPXA 2XGXA 1WLTA 4IEPA 2BNOA 1O3TA 3EJKA 2GU9A 1RUOA 1H1MA 3IWZA 1CAXA 3ZDSA 1CX4A 4J1XA 4META 3TNPB 2VPVA 4XETA 4HVQA 4FAGA 3MYXA 4Q0SA 3C3VA 4IERA 3H1WA 4AXOA 1DGRA 1YHFA 5BXXA 5JSRA 2B5HA 4HVOA 4QGNA 1RUNA 1FI2A 4EROA 3CO2A 1FXZA 3UKTA 3KMHA 4KWJA 2PHLA 4OFGA 1Q5OA 4ONUA 1RL3A 2PTMA 3DV8A 2GC1A 3KGZA 1G6NA 2Q0AA 4EWAA 4IESA 2GC3A 1ZRCA 3MPBA 4MGYE 5I0SA 3QACA 4MZUA 2IXHA 3DKWA 3FX3A 4I01A 1UIJA 1RC6A 3E97A 4P9GA 1O3QA 1IPKA 1CAWB 5D1IA 2H6BA 3ELNA 4LEJA 4WBBA 4Q0VA 4IEZA 3H7JA 2XHKA 3H1MA 2EVXA 4AVBA 5KHJA 1IPJA 2ATFA 2Z69A 4HSLA 1VP6A 3NSTA 4TLFA 3I54A 4MH0E 2PYTA 3IIAA 4E2GA 4XFCA 2DCTA 1X8MA 5JR7B 1VR3A 3FJSA 2IXLA 4KL1A 4QMAA 4A2UA 1HW5A 1OI6A 4E2SA 1X8EA 5KHKA 2PAEA 3KSCA 5K8SA 3JZVA 2IC1A 4ZU5A 1YFXA 3U0ZA 3OCPA 1YFYA 4AVCA 2EA7A 5JSOA 4OLLA 4XF1A 3E6DA 2BNMA 1X7NA 4YRDA 1J59A 2OYZA 1O7FA 4XF4A 3E5UA 1PM7A 5E1RA 4F8AA 3E6CC 1DGWA 3ETQA 4D7TA 4D7SA 2B8MA 1RGSA 4ZU4A 4O9GA 1XRUA 4YSFA 4XEZA 5I0RA 1O4TA 5AVPA 5LRSA 4DINB 4XF9A 2BYVE 1CAWA 4ZU7A 5E16A 2XKOA 3DL3A 2C0ZA 4Q29A 3EO6A 3FE5A 2IXKA 5EZWA 2H0VA 2D40A 4K8FA 5FQ0B 3PVBB 3ACLA 4Q0UA 1CGPA 1UPIA 3H3UA 1WA4A 2XKPA 4IEQA 3BCWA 3PNAA 3S7EA 3M70A 5I8YA 3H3ZA 2PAKA 1SQ4A 5HI0A 2UYAA 3CLPA 3D82A 3U10A 1Q43A 2QJVA 2IXJA 2K0GA 5JSPA 2VQAA 1YLLA 1CAUA 4GULA 2Z2SB 3LZZA 4QM8A 4MX3A 1UW8A 3E6BA 2B9UA 4EWDA 1YFUA 1DZTA 3HT1A 2QCSB 5FCCA 3OD0A 4KWKA 2ET1A 3H50A 4HBNA 2ET7A 1QXRA 2FQPA 1ZZBA 2XL9A 3RYKA 5I8SA 5J3UA 5LRRA 3SCGA 1O5LA 2GZWA 2CAUA 3CF6E 4JV4A 3ES1A 3WW4A 1ZZ9A 3D0JA 3CJXA 2IXIA 3MDPA 2MHFA 1XE8A 4JVAA 3UKVA 4EWEA 4PJYA 1ZZ6A 2GC2A 3NW4A 3HT2A 3SMHA 1ZRRA 4X6QB 2Q1ZB 3BU7A 3SHRA 5JCTA 2XLGA 1EYBA 2XLAA 3FHIB 3KGLA 4MGZE 4LLOA 3BB6A 4XFFA 1DZRA 4QM9A 4JTNA 2XL7A 3QOPA 3R6SA 3CEWA 1ZNPA 2BNNA 2KXLA 4QXKA 4I02A 1GQHA 2Y0OA 1U12A 1LKNA 3ES4A 3S0MA 1YUDA 3OGJA 2OA2A 1XE7A 4YYOA 3ST7A 2CGPA 5I0UA 4EV0A 2ZKLA 4KU8A 4QGLA 4YARA 1NXMA 4ORFA 1J58A 2PFWA 3MZHA 2E9QA 3FFQA 1I6XA 1J3RA 2O8QA 2OZ6A 4I3PA 1O5UA 4IETA 3E5QA 4CYDA 3LA3A 3OTFA 3PLQA 5C6CA 3USSA 1ZRDA 2PA7A 1UD1A 3E5XA 3RNSA 1LB2A 3EQEA 2CV6A 1J1LA 4HZFA 1ZX5A 3I59B 5LEKA 3TNQA 3WW1A 4L11A 2CAVA 4AQ6A 3SXWA 3RDIA 2BEOA 2UY8A 2V09A 5CVRA 1ZREA 3IBMA 2WFPA 4Q0QA 1CAVB 1NZCA 3HIFA 4HN0A 4IEYA 3ROUA 2GAUA 4F7ZA 4PIZA 1RTVA 3H7YA 2F4PA 1LR5A 5I91A 3IDCB 1NE4A 5FPZA 4J1WA 3H8UA 4KWLA 3RZZA 3SCHA 4I2OA 4WZCA 3BPZA 4MV2A 4FAHA 3B02A 4BIFA 3LA7A 1Q3EA 3HQXA 4RD7A 3NKTA 4IEOA 5BV6A 5KHHA 2UY9A 3EBRA 4Z07A 2K9ZA 4X6RB 3FWEA 2FMYA 3RYPA 1EPZA 4BYYA 4FT8A 4MGIE 4XFIA 2Q30A 3N4MA 3NVCA 5I8TA 5KBFA 2WC2A 5F1RA 4Z82A 4LTAA 3H1YA 4LA2A 5BUVA 2QVSB 1EY2A 4MUVA 4NVPA 1QY4A 5EFUA 5J48A 1ZZCA 3H9AA 4N9HA 4UBHA 4LUKA 4MGKE 3BALA 4QGMA 3I59A 1EP0A 4Q0PA 2Q4SA 3NJZA 3NL1A 5CADA 4IEXA 4XF3A 5C8WA 4HMZA 5I0TA 4R8HA 1ZZ7A 4BH9A 1SFNA 1QWRA 5JAXA 5FQ0A 4IEUA 2GC0A 3CL1A 4IEVA
chains in the Genus database with same CATH superfamily
1T6GC 4LUMA 1CAVA 4MADA 4RGAA 3N36A 1RHI2 4R52A 3J9SA 1W0PA 1YFWA 4YW1A 1DFQA 1QDCA 2A6VA 1JOPA 2I45A 2VNVA 4CUGA 4WVZA 4BU2A 3CIHA 3JCIA 3AYAA 4QQHA 1IG0A 1ZRFA 2BQPA 4LOSA 1AJOA 1J83A 4PDWB 3SEEA 2JEMA 4E2QA 2DUQA 4PI0A 3GJAA 2BVBA 2IFWA 3DYPA 1AL21 3B7MA 2JE7A 4AW7A 2WN3A 2HWE2 2VNOA 2VUCA 4P9LA 3I49A 1EV12 2NYYA 3FC0A 4Q2FA 2Q5TA 2PLV2 4QKDA 5T54A 4QU2A 5GJ6A 2Q8CA 3SH5A 2ZEYA 1ZBA3 5BNNA 4YNIA 1MEC1 3GBFA 3WR0A 4HETA 4XAAA 2RS31 4XTPA 1QJY3 3SCFA 2H6CA 3RS6A 5IVBA 1O3SA 2W0XA 2E53A 2FZ1A 4CCEA 3I97A 4GB31 5FYCA 2HYKA 2EXHA 1RB8G 2RR13 1AYM2 2AR6A 3WW2A 1N1VA 3VBRC 1CIWA 2A70A 3JD71 1I3HA 2TNFA 5B4XA 4J6GA 1IS5A 2A75A 2WZPP 4YZ5A 2SBAA 3ZYRA 1OXCA 2WFF2 2RM21 5A6XA 1I9RA 1A78A 4V1PA 4AEDB 2VMCA 3WW3A 1UZVA 3AP7A 1W2TA 4NHMA 1VBB1 3LA2A 3M4FA 4LA3A 3M3IA 1C3HA 2C1FA 4O61A 5J96B 4AVAA 1NLSA 1NX9A 3OB8A 4AK3A 4FBFA 3KT1A 5KHGA 4LORA 4QKNA 4CCMA 1OA4A 4A3XA 3NWKA 5JZGB 2VNGA 5DG1A 1YQ6A 1GZTA 5L7OB 4NRMA 1IHMA 3O5SA 1AVBA 4HKLA 2PMWB 4ZZ8A 5CAZA 2WWJA 1H1IA 4GIQA 3WG1A 2E7QA 5K0UA 1W6NA 4V2VA 5BNPB 1XB9A 2OPKA 5FOJB 3RGBA 1XNTA 3RI8A 1V6OA 4UT5A 5T55A 2FCUA 2PHDA 5A1AA 4RS5C 5C71A 1XPWA 3A0KA 3KT4A 4QX5A 5LBBA 1PMIA 2WT2A 4YZ3A 3ZYHA 4UYBA 4PBPA 4D69A 1SMVA 4L2NA 1LRHA 1NLRA 3INAA 1I5ZA 1RHI1 4N90A 4A6SA 5AC92 3LFIA 5FMOL 2QNKA 3OG2A 5BPXA 4TZDA 4IEPA 2RJ2A 4HXCA 5FMBA 4FCAA 4GXLA 2VBDA 3MPPG 4YLZA 3WF2A 4BE3A 3OUHA 1O3TA 4NR1A 2XWJB 1OPOA 2W46A 4YZ2A 2XR4A 3POJA 1DQ4A 2BPA2 1PZ7A 3AM2A 2VTXJ 1CX4A 1EV11 4B1LA 3LPFA 5FYUA 2VPVA 4XETA 3TNPB 4BLIA 4FAGA 2J22A 3SISA 4AL9A 1V9U3 5IYYA 2VOWA 1S0CA 4AXOA 3VD7A 3X29B 4RHV3 5BXXA 1NCRB 1QOTA 3P3NA 1RUNA 1ENQA 2IUWA 4LHNA 1FI2A 5EQUA 5IK4A 4N43C 3VZKA 1ND3B 1F15A 3DPRB 4XPVA 1KDMA 4EROA 1HRI3 4F3JA 4Z2AA 1FXZA 1GFF2 4QHBA 2VZVA 4B7EA 4KWJA 3LF7A 4ZZ5A 2CNAA 4WM8A 1C28A 5DZGA 2WFF1 4ONUA 1ONAA 1PGW2 1LENA 1E5IA 2GC1A 2PTMA 5FZOB 1FNZA 5C4WC 2FD8A 1COV2 4AEDA 5CFDB 1AYN1 2P5BA 2C26A 4CDQA 1XNBA 4MGYE 1NA1B 5FZIA 4L97A 4XUNA 3QACA 5FJKA 3ECQA 5JZGA 2P3YA 5C9AB 2ORXA 3KM5A 4I01A 4FP3A 4A7ZA 1UIJA 1O91A 1RC6A 4IV3B 4TYSA 1OF4A 2XJRA 5BNPA 3WDXA 5D1IA 4Y20A 4LKDA 2B42B 3ELNA 5CG8A 3AZZA 4WBBA 4CSWA 3QD6A 1UOBA 2ZHKA 4Q4V1 1D4M2 2DU0A 2XHKA 1QJEA 2NN8A 4CP1A 5AC91 2DBIA 1ASJ2 1WWYA 5L36A 2P4EA 4AI0A 3VDCA 5LA0A 1LGNA 3N9LA 4XZPA 1HLCA 1VBE3 4BDVB 2EXIA 2ZMLA 1MEC3 3GZAA 2RS33 4HSLA 5GLVA 5FO9B 2PYTA 3PVEA 4E9KA 3WVJA 1BBT1 2RS12 4XFCA 1X8MA 4BA6A 4A6OA 5IWFA 5JR2A 1PO22 4ATFA 1GP4A 4LKSA 4GAZA 4MGQA 3NNLA 2IXLA 2YDEA 4OHZA 1QIQA 1GANA 3CJIC 3I3MA 1HW5A 2VZQA 1WUVA 4HONA 1WMFA 1SLAA 2RS52 3KSCA 5K8SA 1K45A 1AR62 1JH5A 1YIFA 2IC1A 2WN2A 2Y34A 1G7YA 4ZU5A 1NCRA 1QF3A 3N9QA 4BXFA 1VBB3 1CZTA 1WZXA 2KD7A 2VZ3A 2ZTNA 3TAYA 1LOEA 1YFYA 4QQ2A 1F4HA 4AVCA 3DPRA 5JSOA 4CP9B 4XF1A 4XCBA 3VL8A 5LB6A 1ODNA 2Y64A 3VD9A 2RV9A 1W8OA 4LNVA 1SLLA 3QLQA 3I3QA 4LMFA 3IB3A 1EUTA 1PGW1 2EF6A 5FZOA 3UGHA 3MFCA 3I2JA 1COV1 5FZLA 3WQBA 1PM7A 4AE2A 1QQP2 4W6YA 1Q8PA 4D8MA 3KCXA 2HWF3 5K9YA 3HN3A 1TZOA 2QQKA 2XJPA 5LW9A 3I2IA 4ZU4A 3WOGA 2R16A 2XUEA 4FPEA 1KGYA 4YSFA 3BIEA 4KI5M 4AG4A 5C9AA 3RI9A 1U5YA 1ZM1A 1ACCA 1QXPA 4U2AA 5AVPA 5LRSA 4Q4X3 4XF9A 3TEXA 1MS4A 4BB3A 2B46X 1XYNA 5E16A 4XILA 2HWD3 3RMYA 1UPSA 3Q8AA 4Y3OA 4D6QA 3VN4A 2VL4A 2IXKA 2X05A 4LBMA 2H0VA 2D40A 5M0TA 4FPCA 3GJBA 1D4M1 1W39A 1R64A 3ZFFB 3RQ0A 3C8XA 3U37A 4GH4C 1C8M2 1QHDA 2HEVF 2BTVC 1ASJ1 2VE1A 4Q0UA 1JMUB 4URAA 3G6JB 2HLEA 3HN1A 1CGPA 3J8F3 3H3UA 4B8EA 3KV4A 2BFUS 3SKJE 3ZDVA 4JDMA 4JGYA 4IEQA 4XBQA 5KXEA 3ZPYA 3S7EA 3M70A 3PTYA 1U0AA 2XJSA 2RS11 3ON7A 4PQQA 2EIGA 2DVAA 3T1LA 1UY4A 1PO21 5HV4A 3AFKA 2VXJA 3WDUA 2P6HA 4W8JA 4OUMA 3PU3A 2RJKA 3VBFC 4H3WA 4M4RA 3MLLA 1W28A 1Q43A 1YO8A 1ULGA 2IXJA 2K0GA 2VQAA 1VBA2 3NQHA 5JSPA 2ZA9A 2C24A 2PHWA 5HCFA 1CAUA 3ASIA 3T3YA 3MIGA 5EJ1B 1AR61 1KJRA 4LBOA 2XMLA 4A41A 1AYN3 4JKMA 1FPN2 5FMDA 4EN6B 5JPMB 3AZYA 2DVGA 2VOVA 4NE9A 4ZS3A 4DRVA 1UW8A 2AEZA 1LOBA 1QU0A 3PIJA 2B9UA 3U75A 3MIEA 1HB1A 2D43A 2PELA 1HN1A 4OHXA 3WNOA 5HPOA 3AL5A 1E5SA 4RFT0 2Q1FA 4CXYA 2VULA 3HT1A 5F3EA 1H30A 3A22A 1JZ6A 3KD4A 4YVSC 3NV3A 5F2WA 5FBJA 1JS9A 1QQP1 4IL7A 4Z8BA 2A7AA 1RUF1 2QCSB 4NAMA 5DZEA 3UV9A 2HWC2 3OD0A 5IK8A 4JRLA 5JPNB 1QXRA 4RN5A 2XL9A 4Q4V3 2GNBA 2WNVC 3GNEA 1OA3A 3VBRB 4OI0A 3AMHA 2R041 3A7QA 1UU5A 3BYWA 5LRRA 3KZ4C 4BK4A 5ACA2 5KXDA 1S1AA 2BOJA 2LW8A 2FBEA 5F39A 4DS0A 4JV4A 3B94A 1GNZA 3WW4A 5C33A 3IPVB 3CJXA 3JUUA 1BBT3 2Y8KA 4S2HA 1G9CA 2MHFA 1DGLA 1XE8A 3BTXA 3FBMA 2GH8A 2WZEA 4EWEA 3W5MA 2I2SA 4QXHA 1C8M1 1VBD2 2L9LA 4ES8A 2DFCA 5BYNA 5HXMA 3AMPA 3H0OA 1Y9GA 1LOFA 2Q1ZB 3MICA 5EYYA 5HCAA 4FSJA 1TG7A 3FHIB 1I5PA 4MHUA 1BXHA 3AP6A 4TSVA 4H14A 4Z1VA 3BB6A 4FXGB 5FY1A 4RS5B 3R6SA 3AMQA 1ZNPA 3MW3A 3VBHC 2BNNA 2IWGB 4K21A 3MV11 2A1XA 1W8ZA 2BU9A 5C3OA 4EQVA 2JG8C 4QXKA 4I02A 4LLFA 1ND2C 1U12A 4CXWA 4NIAA 1VBA1 1ZYBA 1K3IA 3A0NA 4C0BA 1RUE3 4XAEA 5E88A 4XZUG 5E89A 1YUDA 3ETPA 3OGJA 4TTGA 1RJ8A 3ZIWA 1FPN1 4YYOA 5JI9A 3ST7A 2CGPA 4XE9A 2OPWA 1SLTA 2ZKLA 4TLGA 4LO8A 2E33A 5FRAA 2OQ7A 1NXMA 4GD4A 2KA3A 4ORFA 4KG8A 4DMIA 1K42A 3HWJA 4YWAA 1IZ3A 1QJZA 1RUI3 3FFQA 3ITQA 3OYWB 4G3YC 4X8PA 2OZ6A 1SBDA 2GP3A 2GMMA 4OMDA 4C0HA 1O4YA 2ADEA 2F4LA 3HAGA 3E5QA 1TNFA 4YM0A 2QQMA 3ZXDA 3CHXA 1UQXA 3ZN4A 3PLQA 2DBNA 5C6CA 5ABJB 3USSA 4SLIA 3PDQA 3CKHA 2E26A 2AGSA 3Q8BA 1UD1A 2CSGA 5DAXA 4JX0A 5FY9A 5F3CA 3I59B 5LEKA 1Q8QA 2DVDA 4N43B 5KXBA 1W90A 2XVGA 5JVVA 2VW2A 2VBBA 4AQ6A 3FHAA 1BEV1 4XVHA 3ZMNA 5LCWL 2DF7A 1W3VA 5ACA1 3W9AA 1LODA 2YUEA 5CVRA 2QQPA 2YU1A 2VD7A 3H3LA 1GP6A 4PLNA 2EIBA 1ZREA 5C4WB 1BMV1 1X9TA 3RZMA 2Y6JA 4HT1T 4S2DA 2RDNA 1S55A 3C7FA 3OJBA 3L2YA 3HIFA 5E8AA 1R1A2 2W1SA 2ZABA 4MOAA 4CDUC 2VO5A 3Q8FA 2VAUA 2BWAA 1VBD1 4JHZA 1YXWA 4OCTA 4QU1A 1DQ1A 4KBZA 3NJXA 3WSOA 3SC7X 4WZFA 2VQTA 2R061 3NAPC 5J1XA 5FUIA 1F5JA 2F4PA 1NCQC 2Z79A 4O7XA 1NE4A 2WL1A 3N9OA 1G9AA 4QPWA 3PTRB 1KFXL 3RZZA 2ZGTA 3VBSB 5JWPA 4WZCA 4FOQA 1VMJA 4RR3C 4Y24A 4MV2A 4DUXA 3B02A 4UFJA 1JZ8A 5CZKA 5CIRA 5EJZB 4BIFA 2W68A 1LNSA 1RUJ3 3NNFA 3ZYGA 5FWJA 1Q3EA 3PUQA 5FZMA 1JI6A 1PMHX 4XQWA 5F6LB 2KM2A 5BV6A 3LEIA 4LQRA 3HQRA 4Z07A 2K9ZA 5A70A 2FDHA 3VLBB 1RUF3 1PNGA 3FWEA 4CDWC 3K4AA 1LESA 4P9IA 1CWPA 4F83A 4E4ZA 1U5XA 3RYPA 4BYYA 4NPMA 1REDA 1XQNA 5FKBA 3W21A 3N4MA 1WW6A 1VRH3 1PX4A 4IE7A 3PIGA 3I3BA 5I8TA 2OIIA 3TEWA 3AYDA 2R043 4GKXA 5F5IA 3I2FA 1OT5A 4EZ4A 5AVAA 1Z78A 4NMIA 3AMNA 4LA2A 3NNMA 2GNMA 1EY2A 4HKOA 5ABJA 4MUVA 4AEMA 4QB2A 2WZR1 4IGPA 1UZZA 3DUIA 1D0HA 2X5IA 4CE8A 4AEKA 4LBNA 3H9AA 4UBHA 5FK7A 4BQYA 1W04A 1W9YA 5LBFA 4CU8A 1DF0A 3BALA 4MSVA 3I59A 3ZXJA 2YU2A 2V72A 2IZWA 4OVEA 2OX0A 2Q4SA 2VZSA 1H2KA 3MUY1 5C70A 3NL1A 1MVEA 5A7SA 5CKNA 5FZ9A 3O1VA 3ZSJA 3BOPA 2XVKA 1ZZ7A 2ZGKA 2CHHA 2WUHA 1QWRA 2YROA 4GWJA 5IVYA 5C8CC 3CL1A 4QQLA 4R9DA 4W4ZA 2P37A 5FYSA 5T5LA 3RFRA 3DN7A 1H2MA 5LEJA 1R093 1R1A1 4XJAA 5CYYA 2EXKA 3KHCA 5JIAA 3CMGA 3WF3A 2D97A 4FTBA 3AKRA 2NQYA 4INDA 1W8HA 2UWBA 5GZDA 5EYXA 4AVTA 1IGOA 4N7IA 3VBUC 4XFHA 2WS92 3S7IA 1Z7S1 4HLTA 1W03A 1OURA 4RQPC 3IDEA 2D5HA 1DYOA 5FAXA 4NAOA 3WNNA 3VBSA 2JDHA 4XFGA 1JZ5A 3O14A 1BVP1 3MLJA 2ETEA 4Q1RA 1LHOA 3O12A 1CN1A 1RXFA 2XBO1 4Y1YA 3N7JA 1W2UA 2QQIA 4M00A 5FO7B 2WDBA 1NE6A 4GH4B 2C6SA 4P00B 2CU5A 3N3HA 4PBOA 2Q8DA 4ASLA 5ANQA 5A33A 3AC0A 5FLJA 3O1TA 4AYUA 4A44A 4LBQD 4XUTA 5IHRA 1VAVA 1LU2A 1RUD1 4LK7A 4LIVA 2QQNA 2MEV1 3K46A 4XJZA 4NIIA 5FYMA 2A6ZA 4AQSA 1NKGA 2Q1MA 3DXUA 4L92A 4AAPA 3WQ7A 4JGZC 4YW7A 1R1ZA 1FMD2 1IQAA 1PGSA 1RIRA 2JDZA 3M1HA 3O0XA 1JOBA 1BEV3 2VUJA 1BYHA 2DUPA 3EMRA 1CPMA 1K12A 4XC9A 2D5FA 2ARXA 1AHSA 5CFCC 3MBWA 2X09A 2YC0A 1PK6C 2OT7A 3GBGA 4UXAA 3RPQA 2BZDA 4EN9B 1EAH2 1F5FA 4XXAA 1UZYA 1YIPA 3FLRA 1UF2C 3FBYA 5JXIA 4AF9A 1JZ3A 3BIWE 2JDAA 2V5DA 1PVXA 4I0AA 3J7LA 4JTOA 3JQWA 4CU9A 4XFBA 4UW5A 5FP7A 4AWDA 3P5BA 5DUUA 5DMYA 5T3NA 2R063 3NRUA 4GA9A 2VZTA 3GYDA 2WQ4A 3B9CA 1RUH2 4AQ2A 1NYWA 2WSUA 3K3NA 2XJUA 4YVSB 4QPGC 1AR93 1G86A 1H1AA 5FPUA 1WW7A 3FZ3A 4O9EA 3HBKA 4P08A 5A32B 3V0BA 3WCSA 4COUA 1WLDA 4MXWA 4PI2A 5A6YA 4NN0A 4CCLA 2WNVB 2JB4A 1LOAA 3CZJA 3IKWA 5FUNA 2VBPA 1ZBE1 4N7UA 2WS91 1RUOA 5JXGA 3J7MA 1H1MA 2JD9A 4R4ZA 2BRTA 2VNRA 2WO2A 1D7PM 3WCRA 3POYA 1UYXA 5DG2A 4META 1POQA 1RXGA 1W05A 3ZXAC 1B09A 2YY1A 2D6OX 4IERA 3KVBA 3O1UA 3H1WA 5FZ1A 2QBXA 1RUG1 1UYPA 1X33A 4MGSA 4DFSA 4XACA 2YGMA 5GZFA 2JE8A 5JSRA 1AX1A 3GGLA 1VALA 1YJKA 4GWIA 1TVGA 1OC1A 4P9YA 4FPYA 2WZR3 3ZLIA 5FZDA 4LBKA 3RJ2X 1VE0A 3UJOA 1DYKA 3UKTA 1SLBA 4OZOA 1NZIA 1R082 4TWTA 2PHLA 1HV1A 2D6NA 3FLTA 3WP5A 4HANA 1W0NA 5LA2A 2Q0AA 4EWAA 5DAVA 4FPHA 2GC3A 5LK7B 4QX0A 3MPBA 4AQTA 2R1DA 4Q4W3 4BM8A 2QQVA 2VMIA 2W94A 4M3CB 4NIHA 3H8XA 1UU6A 4QX8A 2VMDA 1U5IA 3OPTA 3ZXFA 4M0NA 1CVNA 2Y6LA 3EYPA 3MV01 1DGWX 5FPBA 1OKOA 3GHNA 5JDBA 2D3RA 1IPKA 3B01A 5EJ3A 3TOJA 1QNYA 2H6BA 3KHBA 4LK6A 3ZKUA 4Q4Y3 1XNCA 2J1SA 1LHUA 1RUH1 1Z7S3 3ZR5A 4BIOA 4Z2WA 1UX7A 3I2GA 2DWRA 5A1FA 2ZHNA 4IQPA 1TME3 5A32A 3POFA 2RDSA 5BNOB 2YC2A 4XBNA 2GSYA 1XSRA 4AVBA 5KHJA 1IPJA 4I0WB 2XBO3 3ZPOA 2YFZA 3U4SA 4E8CA 3UL2A 3R4UA 1UYZA 2Z69A 1H8TA 5FYHA 4BQ4A 1BK0A 2J1EA 1CJPA 4K9SA 2FZ2A 2BW8A 3IIAA 4E2GA 3MHZA 2YPJA 1W8FA 5FUPA 4FOVA 5JR7B 3WDWA 1RUD3 3ZFGC 4BK5A 1VR3A 4YGEA 2MEV3 3TWIA 2W52A 1SDWA 1W8UA 2G4IA 1PIV1 1MQTA 1DP0A 1HXS3 4CU6A 4CVUA 4KL1A 4COVA 4QMAA 4FPLA 3OGVA 2VXRA 2X29A 3W5NA 4E2SA 2NLRA 4AAXA 5KHKA 2VZRA 5F6KA 2R0HA 3JZVA 3Q8EA 4LBJA 2YC4A 1X36A 1E5HA 2OXBA 1NCQB 1YFXA 2W1QA 2D7FA 1PO12 3OCPA 2BBVA 1LULA 4L0PA 4WVVA 1QEXA 3IN9A 5G05L 3S5AA 1GZ9A 1MVQA 1UO9A 1GQPA 1X7NA 1R081 2BNMA 4YRDA 3PUIA 1J59A 2B7YA 3OUIA 3I2OA 2AH2A 2OYZA 1MS5A 1O7FA 4ARXA 3KQ4B 1Q8VA 3NV2A 3WQ0A 4F8AA 3E6CC 3PU8A 1DGWA 1FX5A 5FKCA 2I74A 4WV8A 3VDDB 4D7SA 2Y0IA 5CEHA 4EN7B 4CEWC 2BGOA 3W59A 1HDKA 5GZEA 2Q8OA 3AXEA 1G9FA 1V0AA 2Y26A 4CDWB 3PJQA 4XEZA 4JQRA 3WUDA 1UKGA 2E31A 2WNUC 3K4ZA 1RUC3 5JOXA 5GALA 4PF1A 1XNKA 2ZGUA 1OH3A 2ZZJA 3KT7A 3MW4A 1ZBE3 4ASMB 4NIGA 5FREA 2XKOA 3DL3A 4JKLA 1EPWA 4CUBA 5A6ZA 3EO6A 4N53B 2WA3A 3FE5A 3ZO0B 1W99A 3I2HA 2ZMNA 1DQ5A 1F4AA 5CBLA 5BNOA 4XIKA 3H8OA 4JC1A 2ZGLA 2LRPA 3IDAA 4PDWA 5FQ0B 4JRAA 3WG3A 3ACLA 5D8AB 1WCSA 1WMEA 3GHMA 1OD3A 3GDBA 4CCOA 3B69A 1WA4A 1RUG3 2HWE1 4PF5A 2XQXA 4EN8B 1IS3A 2Z42A 3BCWA 2V4VA 4DXSA 2PLV1 4IV1C 3AP9A 2P2KA 5JIUA 4DB5A 2XB6C 1HQLA 1SCSA 1SQ4A 4CDXC 3WINE 3WDVA 5C8CB 1XNAA 5I0DA 2BV4A 3U10A 1QGLA 1CD3G 4CCNA 1ULDA 2EAKA 5F32A 1HB4A 1BK1A 4AZZA 3GZEA 4HPKB 4OULA 1AXZA 1O6UA 2JG9B 1AYM1 4GULA 1UXXX 1ULCA 2Z2SB 3LZZA 3VBUB 4MO3M 4NOTA 4IE6A 1RVF3 2W1WA 3ACFA 1XOYA 2ZGSA 1PO11 5A6QA 5FZHA 1SCRA 4R9AA 2GMPA 1VIWB 4FP2A 1LOCA 1Q8SA 2PHTA 1VBC2 3Q9OA 1BZWA 2ZX0A 4K20A 1GZWB 2LALA 3ZN6B 3U4XA 2VZOA 4M4PA 3VB9A 5C7GA 3KCYA 3MUZ1 3VHNA 4FPFA 3ZR6A 3ZYIB 3BOWA 3LPGA 1UZ0A 1RYYA 4QKBA 3K3OA 5L7OA 3VDDA 3V64A 3ZN5A 3HR9A 1S0BA 2FQPA 2CWSA 1LHNA 5GLUA 1PX3A 5CG9A 1Y7BA 3VKFC 2DU1A 3OPZA 2YBPA 2JDYA 5I8SA 1PZ8A 1DBNA 1H4GA 1AL23 1KITA 1RMU2 2CAUA 3C2UA 2AEYA 3I2KA 3MW2A 2W47A 3DEMA 3BU0A 4I3GA 5F8PA 1SZBA 1LAJA 1RJ7A 1FOD2 2K46A 4WM7C 4LE4A 2IXIA 4N53A 1ENRA 2CWMA 3UKVA 2VMEA 4QPIC 1L7QA 3M8LA 3VKNA 4OYUA 3KF3A 3EB7A 2JJ6A 1NT0A 2UWCA 1PIV3 4WVMB 5DXDA 3SMHA 5D8AA 4DEVA 1YRZA 4GB33 1QMJA 4P02B 3SHRA 2CGOA 5JCTA 1D0GA 1EYBA 2C9KA 3M3QA 4JAAA 4Y26A 1LU1A 1GWLA 1AXYA 4MGZE 1HQWA 2YXSA 3JD73 3AKSA 4LLOA 5APAA 4EYUA 5JLVA 4XUQA 4CZSA 1B35C 1DZRA 4NJ4A 2W95A 4FFGA 4QM9A 1SPPB 1YI7A 1C57A 2RM23 3CEWA 4GMP1 1BVVA 2WR9A 3BGAA 4QPGB 1JYWA 4GJZA 2G9ZA 5DDJ2 5FZGA 4ISQA 3THTA 1GQHA 4HOOA 4GMP0 5JI7A 1W2OA 4HPKA 1JYCA 3LSDA 1KQRA 1LKNA 2JG9A 1ND3A 4XOGA 3S0MA 2WO7A 1XE7A 2E63A 4ARYA 1W9WA 3CDZB 4XDOA 3SITA 2YBKA 4OI4A 5CFDA 5C3RA 2PFWA 3MZHA 2E9QA 1VBC1 4YGDA 2O8QA 3N9PA 1S0JA 4IETA 3D4KA 1NA1A 1OOPC 3WNLA 4COYA 3PMEA 3LA3A 4S2FA 5A3PA 4A42A 3F2ZA 1OPMA 1PNFA 2O14A 1HRV2 1RHI3 3E5XA 4Y5SA 4BQ2A 3RNSA 1LB2A 2BWCA 1HB2A 3EQEA 1J1LA 4IV3A 4YG0A 5EV7A 2DCKA 4BQWA 3WW1A 4L11A 3MF9A 2CAVA 4ZPIA 3T30A 4DPNA 1OH4A 1OSGA 3SXWA 1O8SA 1JODA 2QQWA 2UY8A 3A4UA 3IIIA 3AYEA 3OBTA 1FNYA 2HWE3 1OFSA 1H6YA 2CDPA 3D8CA 1ODMA 1EV13 1OQDA 3NNGA 1OVSA 4NRPA 1FOD1 4MLOA 2WFPA 1AX2A 2PLV3 5FZAA 4UAPA 5DQ0A 4OHYA 4JDNA 1K5MB 4PLOA 2IVIB 5DAQA 1NZCA 2RMU2 2VZUA 5T50A 1QH6A 4Y22B 1GR3A 1IOAA 2HYXA 4IEYA 2W39A 1CIYA 5FZCA 3J4UH 2XQRA 1UZWA 2JDPA 3MGUA 2VW0A 1QJX2 4WVMA 1RTVA 1WA6X 1SFPA 3TN92 2XXZA 1W6OB 5FPZA 3LQCA 5A3NA 1AYM3 1STMA 2WLQA 1UXZA 4J1WA 4KGQA 4KNCA 1BJQA 4DUVA 3PVNA 5FP9A 2FDJA 4UFIA 4CCCA 1SPPA 4YVWC 2GNTA 2WFF3 1SLCA 1QDOA 2RS51 1JW6A 4PLMA 4V2WA 1NOVA 2OKXA 4FAHA 4BQ1A 5DDJ1 4PHZA 2W1UA 3NNJA 2I07B 3HNBM 2P3IA 3HQXA 3MEPA 3V0AB 3NKTA 4CP9A 4IEOA 5KHHA 4Q1PA 3APBA 3POWA 3VBOC 2XJVA 1W6PB 5G04L 3ZFEC 3RWKX 5IFPA 2D44A 4C1XA 3T1MA 2FMYA 1IG3A 2V5YA 2ZJCA 3I3EA 1H2NA 1IKQA 1JU3A 1XNDA 3MIFA 4FT8A 2Y6KA 2BBAA 1YQ5A 3JBG2 1S0EA 5KBFA 2A71A 4C1WA 4XQDA 1TNRA 4BISA 3I3DA 4LTAA 2YB7A 3ZXKA 2Q8EA 1SBFA 2WO1A 4H2AA 4YPJA 4FTSA 4CTEA 2P34A 2D98A 5AC93 5A7WB 4A3ZA 2Y6HA 4MGKE 2WSVA 3UGGA 4K6BA 3PUAA 4DNYA 2JKBA 4XURA 4Q0PA 4Y1XA 4QHZA 5FZEA 3K48A 5CADA 4W65A 5LA9A 1AR82 1OF3A 2WNEA 5A7NA 2XDVA 1AR72 2PN5A 5I0TA 2VMHA 4FVVA 2Y38A 2O0OA 3CU7A 3ZFFA 4BH9A 1SFNA 3AZWA 3CNAA 4BLJA 2GC0A 4HK8A 3UESA 5IFTA 1K5MA 1HV0A 5HBAA 2RMU1 2BP6A 4Y22A 1ALYA 4J25A 2AC1A 4GMP3 1BHGA 3L9JT 2G1MA 5IK5A 2GALA 4EN0A 2ZX3A 4Y5TA 2QDRA 1HJGA 1UAIA 1V00A 4HSJA 4ZHNA 4FPGA 3TN91 1OFNA 3UGFA 1WBFA 4I30A 4NUBA 4PIXA 1W6OA 3R05A 1Y4WA 2DTWA 4I09A 4LT5A 3G7DA 4QXCA 2FCVA 4BOWA 3TB0A 5J37A 1KDKA 2GNDA 3L2HA 3TBDA 5CU1A 5C3SA 1CESA 2JKXA 3U78A 3FUQA 4H7LA 4W50A 3VZLA 1SDDB 4LOTA 3SQOA 3OPWA 1COV3 2QKDA 4KGGA 5HCHA 2R072 1W0OA 3POSA 1JZ7A 2VJXA 1L3JA 1C1FA 4GWNA 2JDUA 2OW4A 4HVRA 2A3XA 4AFBA 3V0AA 3Q8CA 3SLIA 5FMCA 2WRAA 2RE9A 1WGPA 1W6PA 2P17A 5BNQA 4K1YA 4BCUA 3ACIA 2VECA 3O0WA 4QD2A 3M2MA 5HV0A 1W9FA 4HN1A 3FFZA 2D6PA 1SEFA 1ZZ8A 4IV1B 4BHPA 3VUOA 1E5RA 3IDBB 4XIOA 2GH2A 2IXCA 2LUWA 3LWCA 2DDUA 3RWNA 1GV9A 1TMF2 3VV1A 1MZFA 4CPBD 5LY2A 1VAMA 1XJAA 2RVAA 3JBG1 2TBVA 1W8NA 4TXWA 1PVC2 2HWC1 5FYVA 5FZ7A 1DIWA 3MFAA 4NRQA 1UIKA 1TQ5A 1OD5A 3AX4A 5T52A 4LPLA 1Y3TA 5K0UC 5FZ3A 2YG0A 1GUIA 4ET7A 1D4M3 4OQ8A 5FDBA 3OSDA 3ILNA 5T5OA 4BXSV 3VBRA 1VRBA 2XONA 5A7WA 3UJQA 5J7MA 1ASJ3 1N3PA 2HWB2 1SBEA 2J1TA 3OUJA 4LULA 4W6XA 1Z0HA 5FXZA 3HPNA 5FK8A 1CJDA 2ENRA 4PCRA 2VQ0A 4XFAA 1OUSA 1WCDJ 2BGCA 4UBGA 3IPVA 1QH7A 1UL9A 2RS13 4CA9A 4H7MA 5FZFA 1AR71 3OF1A 3GCWA 4D7YA 3HJRA 2YZ4A 1PO23 4AR2A 2ZGMA 3FMGA 3IMMA 2VU9A 4CCJA 2SLIA 1WCKA 3BI3A 3PHMA 3EHKA 3B3QE 3LCPA 3CBNA 4IEWA 4GKYA 2D3PA 2MPFA 3POBA 5A3MA 3UNPA 2RS53 1VMFA 5FZ4A 1WD3A 2W92A 1V6JA 1AR63 1WLTA 2XGXA 3I2DA 3MI8A 5GLWA 3S5QA 1QJU2 2VVFA 3ZYJB 2QQJA 4HFSA 4P9JA 2FCTA 4RS5A 2GU9A 4AI8A 2R0FA 5H9QA 3CQOA 3IWZA 1PGL2 3CZUA 1S0GA 3QCWA 4NHKA 1PM4A 4WM7B 1N1TA 3AKQA 1E57A 3OBZA 3AZVA 3OEBA 1W8TA 3C7OA 4QQPA 3MYXA 4Q0SA 4QQOA 3C3VA 4YG3A 2A6XA 4HVQA 4QPIB 1C4RA 1QQP3 4XTMA 4B4QA 2R071 1DGRA 3LDRA 3VKOA 1AJKA 4WM8C 2VVEA 4LO4B 4QDRA 3LKJA 5CISA 2DYCA 3R4SA 5JOWA 3JB8A 4AEDC 3BODA 5FXWA 4TN7A 2A5ZA 1J84A 2DTYA 2WABA 5C5UA 4YW6A 1POV1 3NMBA 3OYWA 4CDQC 1BKZA 3CO2A 5F9TA 5FY5A 1AL0G 1N1YA 2F17A 2ZGRA 3CJIB 1OKQA 1TMF1 1POV0 5FZKA 1A8DA 5FPVA 4OFGA 4EJRA 3FUOA 4Q8KA 2VUDA 3HNYM 4W6WA 3AKTA 2UWAA 3DV8A 1PVC1 3KGZA 3QBQA 1REEA 5L9RA 3MF6A 1G6NA 1ZA7A 4R9BA 3DF0A 1ZRCA 1ZBA2 5BNPC 2AUYA 3I8TA 4N43A 5KC6A 4XMAA 1QJY2 2OS2A 4YW4A 1C8M3 5FMOS 4IGOA 4CUCA 2OQ6A 3LGRA 2B39A 2HWB1 1H0BA 1VAKA 3H42B 1T2XA 2RR12 5KR7A 1NG0A 1WLWA 2IXHA 5C4WA 3FX3A 3IAPA 3LDKA 2R49A 2WA4A 4P9GA 4P5HA 1OHFA 1O3QA 5LZ6A 1VMHA 5IT6A 5GZGA 2UURA 4XXPA 4LEJA 2WWSA 4Q0VA 3RSJA 1NLQA 3THDA 5FYYA 4DUWA 4IEZA 3LIHA 3H7JA 5L9VA 2VZ1A 5A1LA 1VBA3 3H1MA 4Q26A 2EVXA 1H9WA 2NZ9A 1EUUA 5H9SA 1PZ9A 2DFBA 3NO8A 1JOJA 2ZX2A 1FPN3 1VPHA 3P6BA 5FPAA 3K2OA 2ATFA 1JHNA 1OBNA 4K1ZA 3MLKA 3TRSB 1REFA 4OMCA 2WZ8A 1NCRC 2Z4FA 1VB4A 1VLNA 5HXVA 3URFA 2QZ3A 1JN2P 1LGBA 3FJSA 2WQZC 3DPRC 3WQ1A 4A7KA 1NQDA 1DLLA 2JIGA 4A2UA 2E7TA 3ILFA 3OGSA 1LJ7A 2PAEA 2HWC3 1T6BX 3AJYA 1H2LA 1D4VB 1JYXA 1CZVA 2ZGOA 4QAWA 2BFUL 2GN7A 3OGGA 4NPLA 5CKQA 3BKZA 2EA7A 1IS4A 4AI2A 3VBFB 1MZ6A 1TE1B 2LS6A 4ASKA 1N1SA 5DUWA 5ACA3 3CJIA 2ZAAA 4YVWB 1XC6A 5FY7A 4BQ3A 2JENA 3ZYBA 4ZXEA 5CA6A 4C8DA 5C9AC 2QE3A 1UNBA 5IVJA 4O65A 1A8MA 1V9U2 5T5PA 2XPJA 1AX0A 4XCAA 1WCQA 3ETQA 5A3LA 1RGSA 1QJY1 4Q8LA 4RHV2 1VBD3 4O9GA 3BN6A 1XRUA 4HL0A 5FIXA 3BTYA 4OUEA 1SHWB 4MGTA 2ORZA 2ZZQA 5FYZA 1HRI2 4LO7A 4A7YA 2ADDA 5IAXA 2BYVE 5IUQA 4FOYA 1JXNA 3AMMA 4OI1A 4FQ4A 1YC61 1Y9MA 2C0ZA 1HIXA 4JGYC 5A7PA 1G9DA 4M01A 5EZWA 4K8FA 2V73A 5AFBA 2VZPA 5GM0A 3KWVA 4NWVA 2ARAA 4FFFA 3USUB 5A3OA 3N9MA 2E7AA 4AOCA 1KD7A 1F8VA 1Q56A 1DQ6A 5FY4A 3WV6A 5DUXA 2LROA 2WAAA 3LIGA 3ACHA 5FZBA 4GWMA 2GMEA 3H3ZA 4D6SA 2W87A 1ULPA 1TEIA 4GH4A 1OQ1A 4AVVA 5HI0A 2P3KA 3ZSLA 4LITA 3JU9A 4MYEA 1S0FA 2FDGA 1V6NA 1FV2A 2JIJA 2E51A 2QJVA 3C7GA 5H9PA 3AKPA 1YLLA 2NMNA 1GOGA 2VTXA 2VW1A 1XYOA 4UW4A 1GP5A 1VBE2 5FXVA 1O59A 4XQ4A 1MEC2 2AZ5A 4N8MA 3FHQA 3VBHB 3BTAA 1UMHA 2NM1A 2RS32 1FMD1 5F37A 3PUHA 3JQXA 4RSUA 2R7EB 3RVHA 3VBFA 4EWDA 2JG8B 2ZBJA 3A23A 3THPA 3T2OA 1ND2B 5KC5A 4UOJA 5FOBB 5DAPA 2JICA 5FYBA 1GU3A 1YFUA 4YW5A 1GWMA 2D3SA 5FZ0A 4ZY9A 5A3WA 1N3OA 2HEYF 1EAH1 3AP4A 1AUYA 4L8QA 2VCBA 1H9PA 1R1A3 1MS0A 5J98B 5FCCA 1F2NA 1US3A 4RHV1 5GKAC 4D0QA 3GZTB 4KWKA 3M3CA 2ET1A 1J1TA 2ET7A 1ZZBA 3MIBA 5IAVA 1VBB2 3HQUA 2DUOA 1HB3A 4FFIA 5HCBA 4HKWA 3RRDA 4XDQA 3VDBA 2NMOA 1HRI1 1W6MB 5J3UA 3H8RA 4YVSA 3SCGA 4JDOA 1DCSA 1MS8A 1M4WA 2GZWA 3ZVXA 3R4DB 2YFUA 1LOFC 3WP6A 1URXA 2JDKA 3VGIA 2NPIA 3AVRA 5EIYB 3KB5A 3D0JA 4UW3A 2UU8A 2RG4A 2WNVA 3N7KA 4CRQA 1OVPA 2HWF2 4JVAA 4AHYA 5A3TA 5KWRA 3HD8B 4PJYA 1LECA 4K40A 4R9CA 1ZZ6A 3WP4A 1OA2A 3AP5A 5DABA 4LO6B 3USUA 2ZHLA 2EALA 4UI9L 2LM3A 1N47A 4X6QB 3TEZA 1Y43B 2XLGA 3FN9A 1X50A 1DDLA 4BMBA 3SH4A 4Q4X2 3KV6A 3O1RA 1NAEA 2A6WA 3ATGA 1YEWA 4MVTA 4RA0A 4RYDA 4URTA 1JYTA 1LHVA 4JTNA 2XL7A 4CDUB 2HWD2 3QOPA 5DN2A 3WG4A 2J1VA 4CCDA 1ENXA 2Y33A 1GYKA 1KJLA 3NAPB 3KLSA 3VHPA 4QHOA 1ENSA 4K8RB 4YZ4A 1IPSA 2E6VA 4QT6A 2VQUA 5D21A 2OUHA 3GXUA 4LHKA 2WT1A 2OA2A 4U36A 1GMMA 4NHYA 3J8F2 2BJSA 2W91A 1VBE1 3T2QA 4C90A 2JB8A 5EWSA 4RR3B 3VBHA 1S2BA 4KU8A 3M3EA 5LWBA 4QGLA 4C91A 2VGDA 5EPAA 1O8PA 4YARA 1SFYA 2JG8A 1J58A 3K77A 3WDYA 5ISLA 4FPOB 1H8VA 1ND2A 4XUOA 2HEWF 2B9VA 3U07A 1O5UA 5JXHA 2LTNA 1UY3A 1NY72 2D6MA 2XH6A 2PHXA 1L7LA 5FBZA 4M3CA 3U1XA 2HH9A 3K4DA 2W2IA 3OTFA 4CYDA 4B1MA 4WM8B 1ZRDA 2PA7A 2FDFA 2ARCA 5DUVA 3QH7A 4ZKTB 4M3CF 4FXKB 4YW3A 3VKMA 1AYN2 3THCA 2CV6A 4XJ9A 4NO4A 4HZFA 3AJZA 1JYVA 4KBBA 4XABA 4CDQB 1ZRIA 1OLQA 3DECA 3SKVA 2WS93 3VZMA 3AVSA 4UFHA 1W6MA 4FTEA 3RDIA 2A3YA 1A3KA 2G9FA 5IVVA 3LEMA 2BOIA 3IBMA 4WVWA 2B45X 4BJ0A 2PHFA 1XXNA 2HBUA 4Y20B 1V6LA 2HWF1 3B93A 4HN0A 3ROUA 2GAUA 2FMDA 2XHNA 2J7MA 4QDQA 4KH9A 1MS9A 4Q4V2 3H7YA 3P3PA 2E32A 4GALA 3KVAA 1UN1A 2Z5WA 1WKYA 3IM0A 4BQ5A 5I91A 3IDCB 2D6KA 4AHXA 4EE2A 2HBTA 3H8UA 4HK9A 1HN0A 4KWLA 4Q4X1 3VD5A 3WF1A 1MACA 4IE5A 3J7NA 4AGVA 3SCHA 4CDUA 4I2OA 2HWD1 1FMD3 4M3CE 1LOGA 2X10A 3BPZA 4OHVA 1GOHA 1BBT2 3R0RA 4CEYC 2JWPA 2IFRA 1DQ0A 3ENRA 3NAPA 4XDPA 3LA7A 3RZGA 2RHPA 1NCQA 2ZEWA 3RZLA 3FLPA 4G4FA 5JOYA 3P1IA 4RQPB 4LO5B 4YGCA 1EAH3 4K7JA 3J8F1 5ABJC 4RR3A 5GZCA 2X5IC 4KMQA 3PJYA 1EPZA 4X8NA 1F31A 1G8WA 1JZ2A 3MO4A 4XFIA 3TYJA 4MXVA 2Q30A 4YM3A 2WT0A 1QJFA 3D3AA 1JUIA 2WC2A 4AI1A 5F1RA 1RUH3 4Z82A 1NY71 1P8JA 4LJHA 4LKEA 5JMOA 4BZ4A 2VOTA 3ABZA 4AGRA 1GZCA 2F6BA 3RG0A 4EZHA 4CDWA 2P1BA 3AZXA 4XYXA 1RUE2 5EFUA 5J48A 1ZZCA 1JU4A 1UX6A 4JGZB 4N9HA 1JYNA 2JXAA 1S0DA 2EICA 1EP0A 4OQ9A 2P3JA 3WF4A 4XJWA 3HEIA 1JHJA 2AENA 5CNAA 1UMZA 2ARBA 3WNPA 5C8WA 4HMZA 5FJHA 5CFCB 1RUI2 1PK6B 3OD4A 3M3OA 1ULFA 2RJLA 5FQ0A 5K7PA 1NQJA 1L7RA 1KRIA 3HVDA 4E4HA 1SLIA 3NJVA 4N9IA 3T08A 1APNA 4ITCA 4XF0A 2R6QA 4Y4YA 4YW2A 3VBSC 1YQCA 5FPXA 2JD4A 4YZ1A 2O1QA 3SNMA 1AZDA 3UK9A 1JYIA 2J1AA 1V70A 2MNGA 5F5CA 3WEZA 1W3XA 4AFDA 5BY5A 1GQGA 4AHZA 1OMIA 5C8CA 3AK0A 2N7GA 3F95A 1X82A 2DVBA 3SH3A 2VTFA 1CAXB 3HBZA 1R083 4DXRA 1W6QB 2VOKA 4IGQA 4JGYB 5IVEA 3VD4A 3ZXGA 2A3WA 4JCKA 4B29A 1J3PA 5C3PA 5A7OA 5KHIA 3VBUA 4NHXA 2WJSA 2GN3A 2AREA 3KCCA 2DCYA 2UYBA 2ZAHA 2EAAA 2ZCWA 3LE0A 4L9BA 4CP0A 3S57A 3SEPA 2WBKA 2ZS6B 4RQPA 4AVSA 1UCXA 1W06A 1ZVFA 2D93A 3LAGA 3ZSEA 4CXXA 1GWKA 1UY2A 1YQ8A 2HJIA 3J26N 5I93A 4PQ9A 1CAUB 1GZWA 4JKKA 3ZN6A 4DZGA 1J3QA 4OZXA 3BTZA 1GSLA 1N3QA 1DYPA 1QOSA 2JDNA 3AXDA 3D0SA 5EHDA 4QX1A 2DVFA 4PIYA 2GDFA 1O3RA 2OVUA 3GBWA 2WAOA 2PQQA 4Y1ZA 5FLHA 2W5FA 1JUHA 4KU7A 1YJLA 2B4KA 4FFHA 3UYJA 2D6LX 1RUJ2 1VJ2A 2YHJA 4QKFA 4UFMA 4M0HA 2PAMA 4DXTA 1RUE1 3C7EA 1YNAA 3POGA 1YWKA 3N35A 3K75B 4JGZA 3RYRA 1UY1A 1RUF2 3N9NA 3LOIA 1GKBA 1RMU1 2QUOA 4LHLA 1QXJA 1LGCA 5FO8B 4NIDA 1O4ZA 5FR3A 3UKNA 3OEAA 1Y9QA 2TEPA 3U11A 4GQ7A 2NP0A 2OZJA 2VH9A 2QQOA 1UOJA 2QZ2A 5CFCA 1RUI1 1VRH2 4IE4A 1FT9A 1PK6A 2GP5A 3WNMA 2XLFA 2R042 1PHMA 1ZA4A 1WD4A 4I0BA 1NUKA 2HKXA 2J1UA 4R4XA 3V56A 1IQDC 5F3GA 5H9RA 4AEJA 5FLIA 3C7HA 3LOBA 2EIEA 1CZSA 1KFUL 4LKFA 3I7DA 3M7AA 3VHRA 1V6KA 4Y1VA 5L9BA 1PMJX 2BNOA 3EJKA 5F5QA 1KEXA 1DU3D 1PO13 1VB2A 2V4AA 4AGGA 1KS5A 1X9PA 4QPGA 4BPZA 2WO3A 4JHTA 1CAXA 5DAWA 2IVJA 5LBCA 1W6QA 5LK5A 4FOWA 3ZDSA 4E4DX 5IK7A 4J1XA 2AACA 3LB9A 1K5JA 2ZXQA 1R092 3VZJA 1XU1A 2ZACA 1YHFA 4QDSA 1S4CA 1C8NA 4AI3A 2J42A 3ZIXA 1KXGA 3POEA 3VZOA 1V6MA 2B5HA 4HVOA 3ZFGB 4QGNA 2YMZA 3OY8B 3VKLA 1ST8A 4RL7A 1YI9A 3J7HA 3ZXEA 4BMEA 1NXD1 1AF9A 5FYTA 1MS3A 3KMHA 1MS1A 4ATEA 2ID4A 3RZJA 1Q5OA 5IW0A 1RL3A 1HRV1 3T4HB 2QTWB 4L99A 4NROA 4CUAA 3AB0A 5JMCA 4IESA 1CQ9A 1GNHA 1RUJ1 2VOXA 2ZOEB 3AYCA 4MG2A 4CP2A 3NV4A 3GALA 2P6CA 5I0SA 3LEGA 5GLZA 2CY6A 4D6RA 1KS4A 4LR4A 3WY6A 4MZUA 5D2AA 2DURA 3DKWA 5LA1A 1DQ2A 4IDZA 1AXKA 2YPDA 3E97A 2Y60A 2VR4A 3DXTA 2VC9A 1CAWB 5C3QA 1RITA 1VRH1 4S2GA 4CEWB 3RZHA 1H8TC 5CB7A 1BEV2 3WNKA 1QJX1 4LHSA 1F35A 3DGTA 3WG2A 4CU7A 2WNUB 1BMV2 1XBFA 4E8DA 1WW5A 5BNNC 4D3WA 3IZOA 5LASA 4YM2A 1WMXA 4QX3A 1MQTC 1MR5A 4UWDA 5FZ8A 3O1MA 3T2PA 3T0BA 4Y1UA 5EP9A 3NKGA 1VP6A 3NSTA 4TLFA 3T4VA 1UKRA 3I54A 4MH0E 4XUPA 1JBCA 2DCTA 2R062 1CR7A 1VBC3 2FHRA 1CONA 1F9KA 4P14A 2ILMA 1GBGA 5SV5A 3ZX7A 1AR92 3PMSA 2WYFA 4AFMA 4AI9A 1UU4A 1JZ4A 1R091 5IVFA 3ZYFA 3ZM8A 1OI6A 2ZX1A 1X8EA 5CKMA 2BGPA 5T5JA 2BUKA 1C5HA 2VVDA 1G9BA 1W2NA 3ZKYA 1BQPA 4P9XA 3K51A 5A7QA 4G9SB 4XJ8A 4ZS2A 3WNXA 3ZFGA 4CDXB 3U0ZA 1DHKB 1WCUA 3OY8A 3ACGA 2WQ8A 5JXJA 4OLLA 1YCIA 3E6DA 4CCKA 4E4SA 4ZXKA 1FATA 2R1BA 2R30A 5J09A 1RMU3 4BWOA 3PL0A 4KQ7A 5FWEA 4CEYB 3GF6A 1FOD3 1OLMA 4P9WA 2CYFA 4XF4A 3E5UA 3WZ1A 3ZMOA 5J36A 3ILRA 1D2QA 1OUXA 4LXLA 5E1RA 4ISRA 3N7MA 2YGLA 4D7TA 2B8MA 3A21A 3IT8A 3RJRA 3ZYPA 3HNMA 4DEQA 5DZFA 3ZSKA 2DCZA 4Q27A 1A34A 2YYOA 4QB1A 1AR81 1LEMA 4IE0A 1LCLA 4K3UA 4NWWA 5ERLA 2WWUA 3FL7A 2WZR2 1IS6A 2X5IB 5I0RA 5BNOC 1QNWA 2XJQA 5FXXA 4CPBA 1O4TA 4PDWC 3KV9A 1Q8OA 1YYNA 4DINB 3OBRA 1WMDA 4OUSA 1CAWA 4CEWA 5TSWA 1BLZA 3WHUA 4ZU7A 1M06G 1XU2A 2EXJA 1IKPA 4Q29A 5L19A 1UMIA 4KWUA 3T0AA 2TUNA 2ZKNA 5DDJ3 1FYUA 2ZGPA 4YFWA 3DKQA 2XWBB 2YBSA 2WNUA 4JZRA 4Q4W2 2KR2A 3PVBB 1HX6A 5JUVA 2EIDA 5AFEA 2Y6FA 3EXUA 1UPIA 2XUMA 2C5DA 2CDOA 2G9GA 1HJFA 2XKPA 3LD8A 4DO0A 3B5LB 4LE3A 3PNAA 4RGKA 2ZHMA 2XJTA 5DPNA 5I8YA 5B2GB 2W08A 2CGNA 2PAKA 3NJYA 1OLME 4Q4Y2 3UT0A 2PXJA 1QOOA 1Z7S2 2UYAA 3CLPA 4P5YA 2CTVA 3UETA 4DIQA 4XJUA 3D82A 5F5AA 1AR91 1WW4A 1XYPA 1LEDA 4DY5A 1XE0A 4FI9A 1TME2 1YQ2A 2WIIB 3RMXA 1C5IA 3IAQA 4UW6A 1CPNA 1HRV3 4NPRA 4DRRA 3I4IA 2XBO2 4IV1A 1B35B 4HG6B 4QM8A 4MX3A 5FFOC 4CDXA 2C4XA 2XVLA 4NHLA 5E6HA 5JZGC 4FQZA 3HOBA 5A33B 5L7OC 3E6BA 3VDDC 1H4HA 4PT6A 4B4PA 1RUD2 4AFCA 4RFRB 4JQTA 2MEV2 1OLRA 4LBQB 1UOGA 2O8OA 2QDNA 4CEYA 2PQSA 3TEYA 1DZTA 5FY0A 3KV5A 1HXS2 4UFLA 1LTEA 3OGRA 2RMU3 2JECA 5LY1A 1CX1A 4FO9A 1DZQA 4YGBA 2H0BA 2DCJA 1HKDA 3H50A 4HBNA 5IATA 4XW3A 1H6XA 1QJX3 2WINB 4N53C 3TN93 1OOPB 1ULEA 5ANNA 3RYKA 1W9TA 5FP8A 4OI2A 1JTZX 1O5LA 5D8AC 2ERFA 4AHWA 5IVCA 2RDRA 3CF6E 2BERA 2ZPXA 5FY8A 3ES1A 1ZZ9A 3KS7A 4QXBA 5F7UA 2JX9A 3VL9A 2WLPA 3MDPA 1GNYA 1QJU1 2WNOA 3BPSA 2OUJA 3U14A 3WHTA 4DQAA 1DG6A 4B3NA 4Q4W1 2GC2A 4QWNA 1W9SA 3HMYA 3LDBA 3HT2A 3NW4A 4QX7A 4Z92B 2FDKA 3GCXA 3O0VA 5A80A 2ZGNA 1PGL1 3V0BB 1ZRRA 3BU7A 3E1F1 4MXWB 2X53S 1RUC2 4WM7A 3KGLA 2XLAA 2JG9C 1ND3C 2ES3A 4SBVA 2VMFA 3O1OA 2FDIA 4YFZA 4XFFA 4Y33A 1ULOA 1ZBE2 4QPIA 5C5TA 4Q4Y1 3JBG3 2K2SA 2VMGA 1SACA 1WLCA 2AYHA 4ES9A 2A6YA 1SG3A 3WT3A 3W58A 2KXLA 4QB6A 4B7KA 5CFDC 4RGGA 2Y0OA 1TME1 4IXLA 1QKQA 3ES4A 4A45A 4DXZA 3IMNA 3OBAA 3LEKA 1NA1C 1GICA 4GZ9A 1B35A 5FPLA 3W20A 2VCCA 1OQEA 4Y4RA 1RUG2 5I0UA 5FV3A 5LATA 3T09A 1MPXA 4EV0A 3ME2A 3RZKA 3VZNA 2WKKA 2VUAA 2VCAA 4LBLA 1AR83 4IV3C 1AR73 3OOXA 1I6XA 1ZBA1 1J3RA 4LBQA 3GM8A 4UF0B 3D5OA 3O1PA 4D94A 4FPJA 4I3PA 3B9IA 2QQLA 2ZX4A 3VBOB 1HXS1 3ORJA 5FP4A 3ZFEB 4DY3A 3D6EA 3O1SA 1HQNA 2RR11 3VDAA 4UFKA 4QPYA 3ZSMA 1RVF2 3WP3A 3O7OA 4COWA 1ZX5A 5K4LA 3TNQA 4YG6A 2BVVA 2A73B 1S2EA 1DLCA 1OOPA 2C9AA 1WBLA 3GZUC 4Q5OA 2ZEXA 3S6PA 4FPKA 3DCQA 2BEOA 2V09A 3BUCA 2XG3A 3ZXLA 4H55A 4QX2A 2RDQA 2J1RA 3AFGA 3NV1A 3PVOA 2Y6GA 4OHWA 1FV3A 5GLTA 1FAYA 4Q0QA 4B4RA 3KF5A 3BVCA 1CAVB 2BDRA 5FP3A 4IW3A 2CL2A 2G19A 2R073 5FZ6A 4BQXA 5JOZA 2YV8A 4XMIA 2VY0A 4PIZA 4ZONA 3WX5A 4F7ZA 1GLHA 3WUCA 2QFEA 1GOFA 3ZOIA 1DGRN 4KG0A 2XOMA 3QH6A 1LR5A 3WLUA 1POV3 3T2TA 1LHWA 1C1LA 1RUC1 3B00A 5A3UA 1AL22 2DV9A 1BCXA 1TMF3 3AL6A 1H8TB 1UWWA 1UYYA 1W2AX 1PVC3 4IUGA 2R32A 4A4AA 3JB4C 2VG9A 3LSEA 5BNNB 3VHOA 4RD7A 4E27A 1PIV2 1US2A 5B4NA 1MQTB 2ZEZA 3PURA 2UY9A 3EBRA 4GB32 5EXOA 1A6CA 2HWB3 3V65A 4X6RB 4YVWA 4XHBA 2JDMA 2VM9A 3S30A 5KXCA 4YM1A 3WF0A 2JE9A 4MHRA 1MZEA 3JD72 3MIDA 2W9XA 2W3JA 1V9U1 4MGIE 3JXSA 4COZA 3MIHA 2RM22 3NVCA 4UF0A 5F3IA 2PHRA 1V6IA 3KQRA 4DOUA 4XBLA 3H1YA 2VCMA 1MZ5A 3VBOA 3ZFEA 5BUVA 2QVSB 5SV8A 2WYSA 4NVPA 4AFAA 1QY4A 4XHXA 1W8WA 2QQUA 5LBEA 3ZFFC 3ALQA 3DYMA 3LFMA 3WXPA 1S0IA 3PUSA 1S2KA 5IJRA 4LUKA 1RVF1 1XSQA 4LIUA 1QJU3 3POIA 4QGMA 1K5MC 4Y5Z0 2X8KA 1I1EA 1RINA 3NJZA 1D2SA 5L73A 1UOFA 2ZMKA 1U5ZA 4IEXA 1W6NB 4XF3A 4GJYA 3WD5A 5K0UB 3VD3A 3N7LA 4R8HA 5FYIA 3DYOA 3WDTA 5FTTC 3T0DA 5JAXA 1UY0A 4IEUA 5F2SA 2PHUA 4IEVA 2ZGQA
chains in the Genus database with same CATH topology
1T6GC 4LUMA 1CAVA 4RGAA 3N36A 1RHI2 4R52A 3J9SA 1W0PA 1YFWA 4YW1A 1DFQA 1QDCA 2A6VA 2I45A 4WVZA 3JCIA 3AYAA 4QQHA 1ZRFA 2BQPA 1AJOA 4PDWB 2JEMA 4E2QA 2DUQA 2BVBA 2IFWA 1AL21 3B7MA 2JE7A 4AW7A 2HWE2 2VNOA 4P9LA 1EV12 2NYYA 3FC0A 4Q2FA 2Q5TA 2PLV2 5T54A 4QU2A 5GJ6A 3SH5A 1ZBA3 5BNNA 4YNIA 1MEC1 3GBFA 3WR0A 4HETA 3SCFA 2RS31 4XTPA 1QJY3 2H6CA 3RS6A 1O3SA 2W0XA 2E53A 2FZ1A 4GB31 2HYKA 2EXHA 1RB8G 2RR13 1AYM2 2AR6A 3WW2A 1N1VA 3VBRC 1CIWA 2A70A 3JD71 1I3HA 2TNFA 4J6GA 1IS5A 2A75A 2WZPP 4YZ5A 2SBAA 3ZYRA 2WFF2 2RM21 1I9RA 1A78A 4V1PA 4AEDB 3WW3A 3AP7A 4NHMA 1VBB1 3LA2A 3M4FA 4LA3A 3M3IA 1C3HA 2C1FA 5J96B 4AVAA 1NLSA 4FBFA 4AK3A 3KT1A 5KHGA 1OA4A 4A3XA 3NWKA 5JZGB 2VNGA 5DG1A 5L7OB 1IHMA 3O5SA 1AVBA 4HKLA 5CAZA 1H1IA 4GIQA 3WG1A 2E7QA 5K0UA 1W6NA 5FOJB 5BNPB 2OPKA 3RI8A 1V6OA 5T55A 2PHDA 4RS5C 3A0KA 3KT4A 4QX5A 1PMIA 2WT2A 4YZ3A 4PBPA 4D69A 1SMVA 4L2NA 1LRHA 1NLRA 3INAA 1I5ZA 1RHI1 4N90A 5AC92 5FMOL 2QNKA 5BPXA 4TZDA 4IEPA 4FCAA 4GXLA 4BE3A 3MPPG 4YLZA 1O3TA 4NR1A 2XWJB 1OPOA 4YZ2A 1DQ4A 2BPA2 1PZ7A 3AM2A 1CX4A 1EV11 3TNPB 2VPVA 4XETA 4BLIA 4FAGA 3SISA 1V9U3 2VOWA 1S0CA 4AXOA 3X29B 4RHV3 5BXXA 1NCRB 1QOTA 3P3NA 1RUNA 1ENQA 4LHNA 5IK4A 1FI2A 4N43C 3VZKA 1ND3B 4XPVA 3DPRB 4EROA 1KDMA 1HRI3 4F3JA 1FXZA 1GFF2 4QHBA 4B7EA 4KWJA 2CNAA 4WM8A 1C28A 5DZGA 2WFF1 4ONUA 1ONAA 1PGW2 1LENA 2GC1A 2PTMA 5C4WC 1FNZA 1COV2 4AEDA 5CFDB 1AYN1 4CDQA 1XNBA 4MGYE 1NA1B 4L97A 3QACA 3ECQA 5JZGA 5C9AB 3KM5A 4I01A 4FP3A 4A7ZA 1UIJA 1O91A 1RC6A 4IV3B 4TYSA 2XJRA 5BNPA 3WDXA 5D1IA 4Y20A 2B42B 3ELNA 5CG8A 3AZZA 4WBBA 3QD6A 2ZHKA 4Q4V1 1D4M2 2DU0A 2XHKA 4CP1A 2NN8A 5AC91 1ASJ2 5L36A 4AI0A 1LGNA 4XZPA 1HLCA 1VBE3 2EXIA 2ZMLA 1MEC3 3GZAA 2RS33 4HSLA 5GLVA 5FO9B 2PYTA 3PVEA 4E9KA 3WVJA 1BBT1 2RS12 4XFCA 1X8MA 4BA6A 1PO22 4ATFA 2IXLA 2YDEA 4OHZA 1GANA 3CJIC 1HW5A 1WUVA 1WMFA 1SLAA 2RS52 3KSCA 5K8SA 1AR62 1JH5A 1YIFA 2IC1A 1G7YA 4ZU5A 1NCRA 1QF3A 1VBB3 3TAYA 2ZTNA 1LOEA 1YFYA 4QQ2A 4AVCA 3DPRA 5JSOA 4XF1A 3VL8A 4LNVA 1SLLA 3QLQA 1PGW1 2EF6A 3MFCA 1COV1 4AE2A 1PM7A 1QQP2 4W6YA 1Q8PA 3KCXA 2HWF3 5K9YA 2XJPA 4ZU4A 3WOGA 2R16A 4FPEA 4YSFA 4AG4A 5C9AA 3RI9A 1U5YA 1ZM1A 1QXPA 4U2AA 5AVPA 5LRSA 4Q4X3 4XF9A 1MS4A 2B46X 1XYNA 5E16A 4XILA 2HWD3 3RMYA 1UPSA 3VN4A 2IXKA 4LBMA 2H0VA 2D40A 4FPCA 1D4M1 1W39A 3ZFFB 3RQ0A 4GH4C 1C8M2 1QHDA 2HEVF 2BTVC 1ASJ1 4Q0UA 3G6JB 3HN1A 1CGPA 3J8F3 3H3UA 4B8EA 2BFUS 4JDMA 4JGYA 4IEQA 4XBQA 5KXEA 3ZPYA 3S7EA 3M70A 3PTYA 1U0AA 2XJSA 2RS11 2EIGA 2DVAA 3T1LA 1PO21 3AFKA 3WDUA 4OUMA 3VBFC 2RJKA 4H3WA 3MLLA 1Q43A 1YO8A 1ULGA 2IXJA 2K0GA 2VQAA 1VBA2 5JSPA 2ZA9A 2PHWA 5HCFA 1CAUA 3ASIA 3MIGA 1AR61 1KJRA 4LBOA 5JPMB 1AYN3 4EN6B 1FPN2 3AZYA 2DVGA 2VOVA 1UW8A 1LOBA 1QU0A 2B9UA 3MIEA 2D43A 2PELA 4OHXA 4RFT0 2VULA 3HT1A 1H30A 3KD4A 4YVSC 3NV3A 1QQP1 4IL7A 4Z8BA 2A7AA 1RUF1 2QCSB 5DZEA 3UV9A 2HWC2 3OD0A 5IK8A 4JRLA 5JPNB 1QXRA 2XL9A 4Q4V3 2GNBA 2WNVC 3GNEA 1OA3A 3VBRB 4OI0A 3AMHA 2R041 1UU5A 5LRRA 3KZ4C 5KXDA 5ACA2 1S1AA 2FBEA 4DS0A 4JV4A 3B94A 1GNZA 3WW4A 5C33A 3IPVB 3CJXA 3JUUA 1BBT3 4S2HA 1G9CA 2MHFA 1DGLA 1XE8A 3FBMA 2GH8A 4EWEA 2I2SA 1C8M1 1VBD2 4ES8A 2DFCA 5BYNA 3AMPA 3H0OA 2Q1ZB 1LOFA 5HCAA 3MICA 5EYYA 4FSJA 3FHIB 1BXHA 3AP6A 4TSVA 4H14A 4Z1VA 3BB6A 4FXGB 4RS5B 3R6SA 3AMQA 1ZNPA 3MW3A 3VBHC 2BNNA 2IWGB 4K21A 2JG8C 4QXKA 4I02A 4LLFA 1ND2C 1U12A 1VBA1 1ZYBA 3A0NA 4C0BA 1RUE3 5E88A 5E89A 1YUDA 3OGJA 1RJ8A 3ZIWA 1FPN1 4YYOA 5JI9A 3ST7A 2CGPA 4XE9A 1SLTA 2ZKLA 4LO8A 5FRAA 1NXMA 4ORFA 2KA3A 4DMIA 4KG8A 3HWJA 1IZ3A 1QJZA 1RUI3 3FFQA 3OYWB 4G3YC 4X8PA 2OZ6A 1SBDA 2GMMA 4C0HA 1O4YA 3HAGA 4YM0A 3E5QA 1TNFA 3ZXDA 3ZN4A 3PLQA 5C6CA 5ABJB 3USSA 4SLIA 2AGSA 1UD1A 5LEKA 3I59B 1Q8QA 2DVDA 4N43B 5KXBA 2XVGA 5JVVA 2VW2A 4AQ6A 1BEV1 3ZMNA 2DF7A 5ACA1 3W9AA 1LODA 2YUEA 5CVRA 2QQPA 4PLNA 1ZREA 5C4WB 1BMV1 4HT1T 4S2DA 1S55A 3OJBA 3L2YA 3HIFA 5E8AA 1R1A2 2ZABA 4CDUC 2BWAA 1VBD1 1YXWA 1DQ1A 4WZFA 2R061 3NAPC 1F5JA 2F4PA 1NCQC 2Z79A 1NE4A 2WL1A 1G9AA 1KFXL 3RZZA 2ZGTA 3VBSB 5JWPA 4WZCA 4FOQA 4RR3C 4Y24A 4MV2A 3B02A 5CIRA 4BIFA 2W68A 1RUJ3 3ZYGA 1Q3EA 4XQWA 5F6LB 2KM2A 5BV6A 4Z07A 2K9ZA 3VLBB 1RUF3 1PNGA 3FWEA 4CDWC 1LESA 4P9IA 4F83A 4E4ZA 1U5XA 3RYPA 4BYYA 1REDA 1XQNA 3N4MA 1WW6A 1VRH3 5I8TA 2OIIA 3AYDA 2R043 4GKXA 5AVAA 1Z78A 3AMNA 4LA2A 2GNMA 1EY2A 4HKOA 5ABJA 4MUVA 4AEMA 2WZR1 1UZZA 3DUIA 1D0HA 2X5IA 4AEKA 4LBNA 3H9AA 4UBHA 1DF0A 3BALA 4MSVA 3I59A 3ZXJA 2IZWA 4OVEA 2Q4SA 1H2KA 3NL1A 1MVEA 3ZSJA 3BOPA 2XVKA 1ZZ7A 2ZGKA 2YROA 1QWRA 5C8CC 3CL1A 4QQLA 4R9DA 2P37A 5T5LA 5LEJA 3DN7A 1H2MA 1R093 1R1A1 4XJAA 2EXKA 5JIAA 2D97A 4FTBA 3AKRA 2NQYA 4INDA 2UWBA 5GZDA 4AVTA 5EYXA 1IGOA 4N7IA 3VBUC 4XFHA 2WS92 3S7IA 1Z7S1 4HLTA 4RQPC 3IDEA 2D5HA 5FAXA 3VBSA 4XFGA 3O14A 1BVP1 3MLJA 2ETEA 4Q1RA 1LHOA 3O12A 1CN1A 2XBO1 4Y1YA 3N7JA 1W2UA 4M00A 5FO7B 4GH4B 1NE6A 4ASLA 3N3HA 4PBOA 5A33A 5FLJA 4AYUA 4LBQD 1VAVA 1LU2A 1RUD1 2MEV1 4XJZA 2A6ZA 4AQSA 4L92A 2Q1MA 3WQ7A 4JGZC 1R1ZA 1FMD2 1IQAA 1PGSA 1RIRA 2JDZA 3M1HA 3O0XA 1BEV3 2VUJA 1BYHA 2DUPA 1CPMA 2D5FA 2ARXA 1AHSA 5CFCC 2YC0A 1PK6C 3GBGA 4UXAA 3RPQA 4EN9B 1EAH2 1F5FA 4XXAA 1UZYA 1YIPA 3FLRA 1UF2C 3FBYA 4AF9A 3BIWE 1PVXA 4I0AA 4JTOA 3JQWA 4XFBA 4UW5A 4AWDA 5DUUA 5T3NA 2R063 4GA9A 3GYDA 2WQ4A 3B9CA 1RUH2 4AQ2A 1NYWA 2WSUA 4YVSB 2XJUA 4QPGC 1AR93 1G86A 1H1AA 1WW7A 3FZ3A 4O9EA 5A32B 3V0BA 3WCSA 4COUA 1WLDA 4MXWA 4NN0A 2WNVB 1LOAA 3IKWA 1ZBE1 4N7UA 2WS91 1RUOA 1H1MA 4R4ZA 2VNRA 3WCRA 3POYA 5DG2A 4META 3ZXAC 1B09A 2YY1A 2D6OX 4IERA 3H1WA 1RUG1 1X33A 4DFSA 2YGMA 5GZFA 5JSRA 1AX1A 1VALA 1YJKA 4P9YA 4FPYA 2WZR3 4LBKA 3RJ2X 3UJOA 1DYKA 3UKTA 1SLBA 1R082 4TWTA 2PHLA 1HV1A 2D6NA 3FLTA 3WP5A 4HANA 2Q0AA 4EWAA 5LK7B 4FPHA 2GC3A 3MPBA 4AQTA 2R1DA 4Q4W3 4BM8A 2VMIA 4M3CB 1UU6A 1U5IA 3ZXFA 4M0NA 1CVNA 1DGWX 3GHNA 5JDBA 2D3RA 1IPKA 3B01A 5EJ3A 3TOJA 1QNYA 2H6BA 4Q4Y3 1XNCA 1LHUA 1RUH1 1Z7S3 4Z2WA 4BIOA 2DWRA 2ZHNA 4IQPA 1TME3 5A32A 5BNOB 4XBNA 4AVBA 2GSYA 5KHJA 1IPJA 4I0WB 2XBO3 3UL2A 3R4UA 2Z69A 1H8TA 4K9SA 1CJPA 2FZ2A 2BW8A 3IIAA 4E2GA 2YPJA 4FOVA 5JR7B 3WDWA 1RUD3 3ZFGC 1VR3A 4YGEA 2MEV3 3TWIA 2W52A 1SDWA 2G4IA 1PIV1 1MQTA 1HXS3 4KL1A 4COVA 4QMAA 4FPLA 2VXRA 2X29A 4E2SA 2NLRA 5KHKA 5F6KA 2R0HA 3JZVA 4LBJA 1X36A 1NCQB 1YFXA 3OCPA 2D7FA 1PO12 2BBVA 1LULA 4WVVA 3IN9A 1GZ9A 1MVQA 2BNMA 1X7NA 1R081 4YRDA 1J59A 2B7YA 2AH2A 2OYZA 1MS5A 1O7FA 1Q8VA 3NV2A 3WQ0A 4F8AA 3E6CC 1DGWA 1FX5A 2I74A 4WV8A 3VDDB 4D7SA 2Y0IA 4CEWC 4EN7B 3W59A 1HDKA 5GZEA 2Q8OA 3AXEA 1G9FA 2Y26A 4CDWB 3PJQA 4XEZA 4JQRA 3WUDA 1UKGA 5JOXA 2WNUC 1RUC3 5GALA 1XNKA 2ZGUA 2ZZJA 3KT7A 3MW4A 1ZBE3 4ASMB 5FREA 2XKOA 3DL3A 1EPWA 3EO6A 4N53B 2WA3A 3FE5A 3ZO0B 2ZMNA 1DQ5A 5CBLA 5BNOA 4XIKA 4JC1A 2ZGLA 4PDWA 5FQ0B 4JRAA 3WG3A 3ACLA 5D8AB 1WCSA 1WMEA 3GHMA 3B69A 1WA4A 1RUG3 2HWE1 4PF5A 4EN8B 1IS3A 2Z42A 3BCWA 2PLV1 4IV1C 3AP9A 2P2KA 5JIUA 4DB5A 2XB6C 1HQLA 1SCSA 1SQ4A 4CDXC 3WINE 3WDVA 5C8CB 3U10A 1QGLA 1CD3G 1ULDA 2EAKA 1BK1A 4HPKB 4OULA 1AXZA 2JG9B 1AYM1 4GULA 2Z2SB 1ULCA 3LZZA 3VBUB 4NOTA 1RVF3 2ZGSA 1PO11 1SCRA 4R9AA 2GMPA 1VIWB 4FP2A 1LOCA 1Q8SA 2PHTA 1VBC2 3Q9OA 1BZWA 2ZX0A 4K20A 1GZWB 2LALA 3ZN6B 3U4XA 3KCYA 3VHNA 4FPFA 3ZYIB 3BOWA 5L7OA 3VDDA 3V64A 3ZN5A 3HR9A 1S0BA 2CWSA 2FQPA 1LHNA 5GLUA 5CG9A 1Y7BA 3VKFC 2DU1A 3OPZA 5I8SA 1PZ8A 1DBNA 1H4GA 1AL23 1KITA 1RMU2 2CAUA 3C2UA 3MW2A 4I3GA 1RJ7A 1FOD2 4WM7C 4LE4A 2IXIA 4N53A 1ENRA 2CWMA 3UKVA 4QPIC 3M8LA 3VKNA 2JJ6A 2UWCA 1PIV3 4WVMB 5DXDA 3SMHA 5D8AA 1YRZA 4GB33 1QMJA 3SHRA 2CGOA 5JCTA 1D0GA 1EYBA 3M3QA 4JAAA 4Y26A 1LU1A 4MGZE 1AXYA 5JLVA 1HQWA 2YXSA 3JD73 3AKSA 4LLOA 4CZSA 1B35C 1DZRA 4QM9A 1YI7A 1C57A 2RM23 3CEWA 4GMP1 1BVVA 4QPGB 5DDJ2 4ISQA 3THTA 1GQHA 4GMP0 5JI7A 4HPKA 1JYCA 3LSDA 1KQRA 1LKNA 2JG9A 1ND3A 4XOGA 3S0MA 1XE7A 2E63A 3SITA 4OI4A 5CFDA 2PFWA 3MZHA 2E9QA 1VBC1 4YGDA 2O8QA 1S0JA 4IETA 3D4KA 1NA1A 1OOPC 4COYA 3PMEA 3LA3A 4S2FA 1OPMA 1PNFA 1HRV2 1RHI3 3E5XA 3RNSA 1LB2A 2BWCA 3EQEA 4IV3A 1J1LA 4YG0A 5EV7A 2DCKA 3WW1A 4L11A 3MF9A 2CAVA 4DPNA 1OSGA 3SXWA 2UY8A 3A4UA 3OBTA 3AYEA 1FNYA 2HWE3 1OFSA 3D8CA 1OQDA 1EV13 1FOD1 4MLOA 2WFPA 1AX2A 2PLV3 4OHYA 4JDNA 1K5MB 4PLOA 5T50A 1NZCA 2RMU2 1QH6A 4Y22B 1GR3A 1IOAA 4IEYA 2W39A 3J4UH 3MGUA 2VW0A 1QJX2 4WVMA 1RTVA 3TN92 1W6OB 5FPZA 1AYM3 2WLQA 4J1WA 4KGQA 4KNCA 1BJQA 3PVNA 4YVWC 2GNTA 2WFF3 1SLCA 1QDOA 2RS51 1JW6A 4PLMA 4FAHA 1NOVA 4BQ1A 5DDJ1 2I07B 2P3IA 3HQXA 3MEPA 3V0AB 3NKTA 4IEOA 5KHHA 4Q1PA 3APBA 3POWA 3VBOC 2XJVA 1W6PB 3ZFEC 2D44A 4C1XA 3T1MA 2FMYA 2V5YA 2ZJCA 1H2NA 1IKQA 1XNDA 3MIFA 4FT8A 3JBG2 1S0EA 5KBFA 2A71A 4C1WA 4XQDA 1TNRA 4LTAA 3ZXKA 1SBFA 4FTSA 4CTEA 2P34A 2D98A 5AC93 4MGKE 2WSVA 4K6BA 4DNYA 2JKBA 4Q0PA 4Y1XA 3K48A 5CADA 4W65A 1AR82 2WNEA 1AR72 2PN5A 5I0TA 2VMHA 4FVVA 2Y38A 2O0OA 3CU7A 3ZFFA 4BH9A 1SFNA 3AZWA 3CNAA 4BLJA 2GC0A 4HK8A 1K5MA 1HV0A 5HBAA 2RMU1 4Y22A 1ALYA 4GMP3 3L9JT 5IK5A 2GALA 4EN0A 2ZX3A 2QDRA 1UAIA 1V00A 4HSJA 4FPGA 3TN91 1OFNA 1WBFA 4I30A 4PIXA 1W6OA 3R05A 2DTWA 4I09A 4LT5A 3G7DA 4BOWA 3TB0A 5J37A 1KDKA 2GNDA 3L2HA 3TBDA 5CU1A 1CESA 3FUQA 4H7LA 3VZLA 1COV3 2QKDA 4KGGA 2R072 1W0OA 3POSA 1L3JA 1C1FA 4GWNA 2OW4A 4HVRA 2A3XA 4AFBA 3V0AA 3SLIA 2RE9A 1WGPA 1W6PA 2P17A 5BNQA 4K1YA 4BCUA 3O0WA 2VECA 4QD2A 3M2MA 4HN1A 3FFZA 2D6PA 1SEFA 1ZZ8A 4IV1B 4BHPA 3VUOA 3IDBB 4XIOA 2GH2A 2IXCA 2LUWA 3LWCA 3RWNA 1GV9A 1TMF2 3VV1A 1MZFA 1VAMA 3JBG1 2TBVA 1PVC2 2HWC1 1DIWA 3MFAA 1UIKA 1TQ5A 1OD5A 3AX4A 5T52A 1Y3TA 5K0UC 1D4M3 5FDBA 3ILNA 3VBRA 3UJQA 5J7MA 1ASJ3 1N3PA 2HWB2 1SBEA 4LULA 4W6XA 1Z0HA 1CJDA 2ENRA 4PCRA 2VQ0A 4XFAA 4UBGA 1WCDJ 2BGCA 3IPVA 1QH7A 1UL9A 2RS13 4H7MA 1AR71 3OF1A 4D7YA 2YZ4A 1PO23 2ZGMA 3FMGA 2VU9A 2SLIA 1WCKA 3PHMA 3EHKA 3B3QE 3LCPA 4IEWA 4GKYA 2D3PA 2MPFA 5A3MA 2RS53 1WD3A 2XGXA 1V6JA 1AR63 1WLTA 3I2DA 3MI8A 5GLWA 3ZYJB 1QJU2 2VVFA 4HFSA 4P9JA 4RS5A 2GU9A 4AI8A 2R0FA 5H9QA 3IWZA 1PGL2 1S0GA 3QCWA 4NHKA 4WM7B 1N1TA 3AKQA 1E57A 3AZVA 4QQPA 4HVQA 3MYXA 4Q0SA 4QQOA 3C3VA 4YG3A 2A6XA 4QPIB 1C4RA 1QQP3 4XTMA 4B4QA 2R071 1DGRA 3VKOA 1AJKA 4WM8C 2VVEA 4LO4B 3LKJA 2DYCA 3R4SA 5JOWA 3JB8A 4AEDC 3BODA 2A5ZA 2DTYA 1POV1 3OYWA 4CDQC 1BKZA 3CO2A 5F9TA 1AL0G 1N1YA 3CJIB 2ZGRA 5T5OA 1OKQA 1TMF1